WO2012106560A1 - Tailored oils produced from recombinant oleaginous microorganisms - Google Patents
Tailored oils produced from recombinant oleaginous microorganisms Download PDFInfo
- Publication number
- WO2012106560A1 WO2012106560A1 PCT/US2012/023696 US2012023696W WO2012106560A1 WO 2012106560 A1 WO2012106560 A1 WO 2012106560A1 US 2012023696 W US2012023696 W US 2012023696W WO 2012106560 A1 WO2012106560 A1 WO 2012106560A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cell
- fatty acid
- acp
- desaturase
- fatty
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P7/00—Preparation of oxygen-containing organic compounds
- C12P7/64—Fats; Fatty oils; Ester-type waxes; Higher fatty acids, i.e. having at least seven carbon atoms in an unbroken chain bound to a carboxyl group; Oxidised oils or fats
- C12P7/6436—Fatty acid esters
- C12P7/6445—Glycerides
- C12P7/6463—Glycerides obtained from glyceride producing microorganisms, e.g. single cell oil
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23L—FOODS, FOODSTUFFS OR NON-ALCOHOLIC BEVERAGES, NOT OTHERWISE PROVIDED FOR; PREPARATION OR TREATMENT THEREOF
- A23L33/00—Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof
- A23L33/10—Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof using additives
- A23L33/115—Fatty acids or derivatives thereof; Fats or oils
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C69/00—Esters of carboxylic acids; Esters of carbonic or haloformic acids
- C07C69/52—Esters of acyclic unsaturated carboxylic acids having the esterified carboxyl group bound to an acyclic carbon atom
-
- C—CHEMISTRY; METALLURGY
- C10—PETROLEUM, GAS OR COKE INDUSTRIES; TECHNICAL GASES CONTAINING CARBON MONOXIDE; FUELS; LUBRICANTS; PEAT
- C10L—FUELS NOT OTHERWISE PROVIDED FOR; NATURAL GAS; SYNTHETIC NATURAL GAS OBTAINED BY PROCESSES NOT COVERED BY SUBCLASSES C10G OR C10K; LIQUIFIED PETROLEUM GAS; USE OF ADDITIVES TO FUELS OR FIRES; FIRE-LIGHTERS
- C10L1/00—Liquid carbonaceous fuels
- C10L1/02—Liquid carbonaceous fuels essentially based on components consisting of carbon, hydrogen, and oxygen only
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/52—Genes encoding for enzymes or proenzymes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/0004—Oxidoreductases (1.)
- C12N9/0071—Oxidoreductases (1.) acting on paired donors with incorporation of molecular oxygen (1.14)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/10—Transferases (2.)
- C12N9/1025—Acyltransferases (2.3)
- C12N9/1029—Acyltransferases (2.3) transferring groups other than amino-acyl groups (2.3.1)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23V—INDEXING SCHEME RELATING TO FOODS, FOODSTUFFS OR NON-ALCOHOLIC BEVERAGES AND LACTIC OR PROPIONIC ACID BACTERIA USED IN FOODSTUFFS OR FOOD PREPARATION
- A23V2002/00—Food compositions, function of food ingredients or processes for food or foodstuffs
-
- C—CHEMISTRY; METALLURGY
- C10—PETROLEUM, GAS OR COKE INDUSTRIES; TECHNICAL GASES CONTAINING CARBON MONOXIDE; FUELS; LUBRICANTS; PEAT
- C10L—FUELS NOT OTHERWISE PROVIDED FOR; NATURAL GAS; SYNTHETIC NATURAL GAS OBTAINED BY PROCESSES NOT COVERED BY SUBCLASSES C10G OR C10K; LIQUIFIED PETROLEUM GAS; USE OF ADDITIVES TO FUELS OR FIRES; FIRE-LIGHTERS
- C10L2200/00—Components of fuel compositions
- C10L2200/04—Organic compounds
- C10L2200/0461—Fractions defined by their origin
- C10L2200/0469—Renewables or materials of biological origin
- C10L2200/0476—Biodiesel, i.e. defined lower alkyl esters of fatty acids first generation biodiesel
-
- C—CHEMISTRY; METALLURGY
- C10—PETROLEUM, GAS OR COKE INDUSTRIES; TECHNICAL GASES CONTAINING CARBON MONOXIDE; FUELS; LUBRICANTS; PEAT
- C10L—FUELS NOT OTHERWISE PROVIDED FOR; NATURAL GAS; SYNTHETIC NATURAL GAS OBTAINED BY PROCESSES NOT COVERED BY SUBCLASSES C10G OR C10K; LIQUIFIED PETROLEUM GAS; USE OF ADDITIVES TO FUELS OR FIRES; FIRE-LIGHTERS
- C10L2290/00—Fuel preparation or upgrading, processes or apparatus therefore, comprising specific process steps or apparatus units
- C10L2290/26—Composting, fermenting or anaerobic digestion fuel components or materials from which fuels are prepared
-
- C—CHEMISTRY; METALLURGY
- C10—PETROLEUM, GAS OR COKE INDUSTRIES; TECHNICAL GASES CONTAINING CARBON MONOXIDE; FUELS; LUBRICANTS; PEAT
- C10L—FUELS NOT OTHERWISE PROVIDED FOR; NATURAL GAS; SYNTHETIC NATURAL GAS OBTAINED BY PROCESSES NOT COVERED BY SUBCLASSES C10G OR C10K; LIQUIFIED PETROLEUM GAS; USE OF ADDITIVES TO FUELS OR FIRES; FIRE-LIGHTERS
- C10L2290/00—Fuel preparation or upgrading, processes or apparatus therefore, comprising specific process steps or apparatus units
- C10L2290/30—Pressing, compressing or compacting
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02E—REDUCTION OF GREENHOUSE GAS [GHG] EMISSIONS, RELATED TO ENERGY GENERATION, TRANSMISSION OR DISTRIBUTION
- Y02E50/00—Technologies for the production of fuel of non-fossil origin
- Y02E50/10—Biofuels, e.g. bio-diesel
Definitions
- the present invention relates to the production of oils, fuels, and oleochemicals made from microorganisms.
- the disclosure relates to oil-bearing microalgae, methods of cultivating them for the production of useful compounds, including lipids, fatty acid esters, fatty acids, aldehydes, alcohols, and alkanes, and methods and reagents for genetically altering them to improve production efficiency and alter the type and composition of the oils produced by them.
- Fossil fuel is a general term for buried combustible geologic deposits of organic materials, formed from decayed plants and animals that have been converted to crude oil, coal, natural gas, or heavy oils by exposure to heat and pressure in the earth's crust over hundreds of millions of years.
- Fossil fuels are a finite, non-renewable resource.
- Increased demand for energy by the global economy has also placed increasing pressure on the cost of hydrocarbons.
- many industries, including plastics and chemical manufacturers rely heavily on the availability of hydrocarbons as a feedstock for their manufacturing processes. Cost-effective alternatives to current sources of supply could help mitigate the upward pressure on energy and these raw material costs.
- PCT Pub. No. 2008/151149 describes methods and materials for cultivating microalgae for the production of oil and particularly exemplifies the production of diesel fuel from oil produced by the microalgae Chlorella protothecoides.
- a polyurethane is a compound that comprises a carbamate (urethane) linkage.
- a polyurethane is a polymer of organic units. The polymer is prepared by the reaction of a first organic unit comprising an isocyanate moiety ( C(0)N-Ri-NC(0) ) and a second organic unit comprising a hydroxyl group ( HO-R 2 -OH ).
- a polyurethane can be represented as -[C(0)NH-R NHC(0)-0-R2-0] m -, wherein the subscript m is a number that denotes the number of monomers contained in the polymer.
- R] and R 2 can be the same or different, but are typically different.
- Polyurethanes are used in many different applications including both flexible and rigid materials. Polyurethanes are used in shoes, automobiles, airplanes, bushings, gaskets, adhesives, carpeting, spandex fibers, housing for electronics and the like.
- Illustrative embodiments of the present invention provide oleaginous cells that produce altered glycerolipid profiles and products produced from the cells.
- oleagninous cells include microbial cells having a type II lipid biosynthesis pathway.
- Embodiments also feature natural oils, which are obtainable using the cells.
- Embodiments include recombinant cells expressing exogenous genes encoding proteins such as fatty acyl- ACP thioesterases.
- the present invention also provides methods of making lipids and oil- based products, including fuels such as biodiesel, renewable diesel and jet fuel, food oils and chemicals from such cells.
- the present invention provides a microalgal cell having a lipid profile that is at least 3% C8:0. In some cases, the lipid profile is at least 12% C8:0.
- the cell is a recombinant cell. In some cases, the recombinant cell comprises an exogenous gene encoding an acyl-ACP thioesterase protein that has hydrolysis activity towards fatty acyl-ACP substrates of chain length C8. In some embodiments, the exogenous gene encodes a Cuphea palustris acyl-ACP thioesterase. In some cases, the cell is a
- Prototheca cell In some cases, the cell is of a microalgal genus or species selected from microalgae identified in Table 1.
- the present invention provides a microalgal cell having a lipid profile that is at least 4% C10:0. In some cases, the lipid profile is at least 18% C10:0. In some cases, the lipid profile is at least 20% C10:0. In some cases, the lipid content of the microalgal cell further comprises C12:0. In some cases, the ratio of C10:0 to C12:0 is at least 3: 1. In some cases, the lipid content of the microalgal cell further comprises C14:0. In some cases, the ratio of C10:0 to C14:0 is at least 10: 1. In some embodiments, the cell is a recombinant cell.
- the recombinant cell comprises an exogenous gene encoding a fatty acyl-ACP thioesterase protein that has hydrolysis activity towards fatty acyl- ACP substrates of chain length CIO.
- the exogenous gene encodes a fatty acyl-ACP thioesterase protein from a species selected from the group consisting of Cuphea hookeriana and Ulmus americana.
- the fatty acyl-ACP thioesterase protein is from a species selected from the group consisting of Cuphea hookeriana and Ulmus americana.
- the fatty acyl-ACP thioesterase gene is selected from the group consisting of a fatty acyl-ACP thioesterase gene from Cuphea hookeriana and Ulmus americana that has hydrolysis activity towards fatty acyl-ACP substrates of chain length CIO.
- the cell is a Prototheca cell.
- the cell is of a microalgal genus or species selected from microalgae identified in Table 1.
- the present invention provides a microalgal cell having a lipid profile that is at least 13% C12:0.
- the cell is a recombinant cell.
- the recombinant cell comprises an exogenous gene encoding a fatty acyl-ACP thioesterase protein that has hydrolysis activity towards fatty acyl-ACP substrates of chain length C12.
- the fatty acyl-ACP thioesterase protein is from a species selected from the group consisting of Umbellularia californica and Cinnamomum camphora.
- the fatty acyl-ACP thioesterase gene is selected from the group consisting of a fatty acyl-ACP thioesterase gene from Umbellularia californica and Cinnamomum camphora that has hydrolysis activity towards fatty acyl-ACP substrates of chain length CI 2.
- the cell is a Prototheca cell.
- the present invention provides a microalgal cell having a lipid profile that is at least 10% C14:0. In some cases, the lipid profile is at least 35% C14:0. In some cases, the lipid content of the microalgal cell further comprises C12:0. In some cases, the ratio of C14:0 to C12:0 is at least 3: 1. In some cases, the cell is a recombinant cell. In some embodiments, the recombinant cell comprises an exogenous gene encoding a fatty acyl- ACP thioesterase protein that has hydrolysis activity towards fatty acyl-ACP substrates of chain length C14.
- the fatty acyl-ACP thioesterase protein is from a species selected from the group consisting of Cinnamomum camphora and Ulmus americana.
- the fatty acyl-ACP thioesterase gene is selected from the group consisting of a fatty acyl-ACP thioesterase gene from Cinnamomum camphora and Ulmus americana that has hydrolysis activity toward fatty acyl-ACP substrates of chain length C14.
- the cell is a Prototheca cell.
- the cell is of a microalgal genus or species selected from microalgae identified in Table 1.
- the present invention provides a microalgal cell having a lipid profile that is at least 15% C16:0. In some cases, the lipid profile is at least 39% C16:0. In some cases, the lipid profile is at least 67% C16:0. In some cases, the cell is a recombinant cell. In some embodiments, the recombinant cell comprises an exogenous gene encoding a fatty acyl-ACP thioesterase protein that has hydrolysis activity towards fatty acyl-ACP substrates of chain length C16. In some embodiments, the fatty acyl-ACP thioesterase protein is from a species selected from Cuphea hookeriana and Ulmus Americana.
- the recombinant cell comprises an exogenous gene encoding a fatty acyl-ACP thioesterase protein from a species selected from the group consisting of Cuphea hookeriana and Ulmus americana that have hydrolysis activity towards fatty acyl-ACP substrates of chain length C16.
- the cell is a Prototheca cell.
- the microalgal cell further comprises an endogenous desaturase gene, wherein the endogenous desaturase gene has been mutated to encode a desaturase that is inactive or less active than the non-mutated desaturase, or wherein, said endogenous desaturase has been deleted from the microalgal cell genome.
- the present invention provides a microalgal cell having a lipid profile that is at least 60% saturated fatty acids.
- the microalgal cell has a lipid profile that is at least 85% saturated fatty acids.
- the cell is a recombinant cell.
- the recombinant cell comprises an exogenous gene encoding a fatty acyl-ACP thioesterase protein that has hydrolysis activity towards fatty acyl-ACP substrates of chain lengths C10-C16.
- the cell is a Prototheca cell.
- the present invention provides a microalgal cell having a lipid profile that is at least 19% C18:0. In some cases, the lipid profile is at least 27% C18:0. In some cases, the cell is a recombinant cell. In some embodiments, the recombinant cell comprises an exogenous gene encoding a fatty acyl-ACP thioesterase protein that has hydrolysis activity towards fatty acyl-ACP substrates of chain length C18. In some embodiments, the fatty acyl-ACP thioesterase protein is from a species selected from Brassica napus.
- the recombinant cell comprises an exogenous gene encoding a fatty acyl-ACP thioesterase protein from Brassica napus that has hydrolysis activity towards fatty acyl-ACP substrates of chain length C16.
- the present invention provides a microalgal cell comprising an exogenous gene encoding a fatty acyl-ACP thioesterase protein from the group consisting of Cuphea hookeriana, Umbellularia californica, Cinnamomun camphora, Cuphea palustris, Cuphea lanceolata, Iris germanica, Myristica fragrans, Garcinia mangostana, Elaeis guiniensis, Brassica napus, Ricinus communis and Ulmus americana.
- a fatty acyl-ACP thioesterase protein from the group consisting of Cuphea hookeriana, Umbellularia californica, Cinnamomun camphora, Cuphea palustris, Cuphea lanceolata, Iris germanica, Myristica fragrans, Garcinia mangostana, Elaeis guiniensis, Brassica napus, Ricinus communis and Ulmus americana.
- the present invention provides a microalgal cell comprising an expression construct wherein the expression construct down-regulates the expression of an endogenous gene selected from the methods consisting of the endogenous gene has been mutated to encode a gene product that is inactive or less active than the non-mutated gene product, the endogenous gene has been deleted from the microalgal cell genome, and through a RNA-induced mechanism.
- the method is a RNA-induced mechanism, such as RNAi, antisense and/or dsRNA.
- the endogenous gene is a desaturase gene.
- the desaturase gene is a delta 12 fatty acid desaturase gene.
- the cell is a Prototheca cell.
- the present invention provides a microalgal cell as described in any of the above aspects, wherein the microalgal cell is cultivated using stachyose, raffinose or melibiose as a carbon source.
- the present invention provides a microalgal cell having a lipid profile that is no more than 2% 18:2. In some cases, the present invention provides a microalgal cell having a lipid profile that is no more than 7% 18:2.
- the present invention provides a method of making lipid.
- the method comprises (a) cultivating a microalgal cell as discussed above until the cell is at least 20% lipid by dry weight; and (b) separating the lipid from water-soluble biomass components.
- the present invention provides another method of making lipid.
- the method comprises (a) cultivating a microalgal cell containing two different exogenous genes encoding two different acyl-ACP thioesterases, and (b) separating the lipid from water-soluble biomass components.
- at least one of the exogenous genes encodes a fatty acyl-ACP thioesterase selected from the group consisting of the thioesterases identified in Table 4.
- the present invention provides a method of making an oil- based product.
- the method comprises (a) cultivating a microalgal cell as discussed above until the cell is at least 10% lipid by dry weight;(b) separating the lipid from the microalgal cell; (c) subjecting the lipid to at least one chemical reaction selected from the group consisting of: saponification; metathesis; acid hydrolysis; alkaline hydrolysis;
- enzymatic hydrolysis catalytic hydrolysis; hot-compressed water hydrolysis; a catalytic hydrolysis reaction wherein the lipid is split into glycerol and fatty acids; an amination reaction to produce fatty nitrogen compounds; an ozonolysis reaction to produce mono- and dibasic-acids; a triglyceride splitting reaction selected from the group consisting of enzymatic splitting and pressure splitting; a condensation reaction that follows a hydrolysis reaction; a hydroprocessing reaction; a hydroprocessing reaction and a deoxygenation reaction and/or a condensation reaction prior to or simultaneous with the hydroprocessing reaction; a gas removal reaction; a deoxygenation reaction selected from the group consisting of a hydrogenolysis reaction, hydrogenation, a consecutive hydrogenation-hydrogenolysis reaction, a consecutive hydrogenolysis -hydrogenation reaction, and a combined
- the oil-based product is selected from soap or a fuel product.
- the oil-based product is a fuel product selected from the group consisting biodiesel, renewable diesel, and jet fuel.
- the fuel product is biodiesel with one or more of the following attributes: (i) 0.025-0.3 mcg/g, preferably 0.05-0.244 mcg/g, total carotenoids; (ii) less than 0.005 mcg/g, preferably less than 0.003 mcg/g, lycopene; (iii) less than 0.005 mcg/g, preferably less than 0.003 mcg/g, beta carotene; (iv) 0.025-0.3 mcg/g, preferably 0.045-0.268 mcg/g, chlorophyll A; (v) 35-175 mcg/g, preferably 38.3-164 mcg/g, gamma tocop
- the present invention provides a triglyceride oil comprising (a) a lipid profile of at least 1-5%, preferably at least 3%, C8:0, at least 2.5%, preferably at least 4%, C10:0, at least 10%, preferably at least 13%, C12:0, at least 10% C14:0, and/or at least 60% saturated fatty acids, and (b) one or more of the following attributes: (i) 0.025-0.3 mcg/g, preferably 0.05-0.244 mcg/g, total carotenoids; (ii) less than 0.005 mcg/g, preferably less than 0.003 mcg/g, lycopene; (iii) less than 0.005 mcg/g, preferably less than 0.003 mcg/g, beta carotene; (iv) 0.025-0.3 mcg/g, preferably 0.045-0.268 mcg/g,
- the present invention provides a triglyceride oil isolated from microalgae that has a C8:C10 fatty acid ratio of at least 5: 1.
- the triglyceride oil is isolated from microalgal cell (e.g., of the genus Prototheca), wherein the microalgal cell comprises an exogenous gene.
- the present invention provides a triglyceride oil isolated from microalgae with at least 60% saturated fatty acids.
- the present invention provides a triglyceride oil isolated from microalgae having a lipid profile that has a C 16: 14 fatty acid ratio of about 2: 1.
- the present invention provides a triglyceride oil produced by a microalgal cell, wherein the microalgal cell comprises an exogenous gene.
- the microalgae is of the genus Prototheca.
- the present invention provides a triglyceride oil isolated from microalgae having a lipid profile that has a C 12: 14 fatty acid ratio of about 3: 1.
- the present invention provides a triglyceride oil produced by a microalgal cell, wherein the microalgal cell comprises an exogenous gene.
- the microalgae is of the genus Prototheca.
- the present invention provides a triglyceride oil comprising (a) a lipid profile of less than 1% ⁇ C12; between 1%-10%, preferably 2%-7%, C14:0;
- the triglyceride oil is isolated from a microbe comprising one or more exogenous gene.
- the one or more exogenous gene encodes a fatty acyl-ACP thioesterase.
- the fatty acyl-ACP thioesterase has hydrolysis activity towards fatty acyl-ACP substrates of chain length C14.
- the microbe further comprising expression construct wherein the expression construct down- regulates the expression of an endogenous gene selected from the methods consisting of the endogenous gene has been mutated to encode a gene product that is inactive or less active than the non-mutated gene product, the endogenous gene has been deleted from the microalgal cell genome, and through a RNA-induced mechanism.
- the endogenous gene encodes a desaturase.
- the desaturase is a stearoyl-acyl carrier protein desaturase (SAD) or a fatty acid desaturase (FAD).
- the present invention provides a method of producing a triglyceride oil comprising a lipid profile of less than 1% ⁇ C12; between 2 -7 C14:0; between 23 -30 C16:0; between 7%-15% C18:0; between 40-55% C18: l ; and between
- the triglyceride oil is isolated from a microbe comprising one or more exogenous gene.
- the triglyceride oil comprises a lipid profile of
- the one or more exogenous gene encodes a fatty acyl-ACP thioesterase.
- the fatty acyl-ACP thioesterase has hydrolysis activity towards fatty acyl-ACP substrates of chain length C14.
- the present invention provides a microbial cell that produces ricinoleic acid.
- the microbial cell is a microalgal cell.
- the microbial cell and the microalgal cell comprises an exogenous gene that encodes a fatty acid hydroxylase.
- the fatty acid hydroxylase is an oleate 12-hydroxylase.
- the fatty acid hydroxylase is from Ricinus communis.
- the microbial cell is of the genus Prototheca, such as, for example Prototheca moriformis.
- the present invention provides a microalgal cell comprising an exogenous gene that encodes an alpha-galactosidase.
- the microalgal cell comprising an exogenous gene that encodes an alpha-galactosidase wherein the alpha- galactosidase is secreted.
- the exogenous gene that encodes an alpha- galactosidase is from a genus selected from the group consisting of Saccharomyces, Aspergillus and Cyamopsis.
- the present invention provides a method of producing a lipid composition comprising the steps of: (a) cultivating a microalgal cell under heterotrophic conditions in the presence of a fixed carbon source, wherein the microalgal cell comprises an exogenous gene encoding an alpha-galactosidase and the fixed carbon source is selected from the group consisting of raffinose, stachyose and melibiose; (b) separating the lipid from the non-lipid components; thereby producing a lipid composition.
- the microalgal cell is of the genus Prototheca.
- the present invention provides a microalgal cell comprising an exogenous gene that encodes a THIC enzyme.
- the THIC enzyme is from a genus selected from the group consisting of Coccomyxa, Arabidopsis, and Synechocystis.
- the present invention provides a method of cultivating a microalgal cell in the absence of thiamine comprising expressing an exogenous gene that encodes a THIC enzyme.
- the THIC enzyme is from a genus selected from the group consisting of Coccomyxa, Arabidopsis, and Synechocystis.
- the present invention provides a microalgal cell as described herein, wherein said microalgal cell further comprises another exogenous gene selected from the group consisting of a sucrose invertase, an alpha-galactosidase, and a THIC enzyme.
- Another aspect of this invention provides a hydroxylated oil isolated from a microbial cell.
- the hydroxylated oil is isolated from a microbial cell, wherein the microbial cell is a microalgal cell ⁇ e.g., of the genus Prototheca).
- the hydroxylated oil is isolated from a Prototheca moriformis cell.
- the hydroxylated oil is a hydroxylated triglyceride.
- the hydroxylated triglyceride may be chemically similar or identical to castor oil.
- a further aspect of the invention is a hydroxylated fatty acid.
- One embodiment of the hydroxylated fatty acid is ricinoleic acid.
- the microbial hydroxylated oil or hydroxylated fatty acid is further hydroxylated.
- ricinoleic acid is hydroxylated, a fatty acid containing two hydroxyl groups is provided.
- Yet another aspect of the invention provides a composition prepared by reacting a hydroxylated oil and/or a hydroxylated fatty acid with a compound that contains an isocyanate moiety to form a polyurethane.
- Another aspect of the invention provides a microalgal cell having a lipid profile that is at least 20% C18:2. In some cases, the microalgal cell has a lipid profile that is at least 30% C18:2. In some cases, the microalgal cell has a lipid profile that is at least 40% C18:2. In some cases, the microalgal cell has a lipid profile that is at least 50% C18:2.
- Another aspect of the invention provides a method of making a lipid, comprising:
- the sugar concentration of the culture medium reaches less than about 1 gram per liter, adding a first sugar solution to the culture medium at a continuous rate of between about 2 grams per hour per liter to about 10 grams per hour per liter for about 2 to about 24 hours; (c) adding a second sugar solution to the culture medium to maintain the sugar concentration of the culture medium at about 15 to about 20 grams per liter; and (d) isolating the lipid from the microalgal biomass.
- the first sugar solution is added to the culture medium at a rate of about 4 grams of sucrose per hour per liter to about 6 grams of sucrose per hour per liter.
- the first sugar solution is added to the culture medium at a rate of about 5.25 grams of sucrose per hour per liter.
- the sugar is sucrose or glucose.
- Another aspect of the invention provides a microalgal cell having a lipid profile that is at least 10% C18:3.
- the microalgal cell has a lipid profile that is at least 20% C18:3.
- the microalgal cell has a lipid profile that is at least 30% C18:3.
- the microalgal cell has a lipid profile is at least 40% C18:3.
- the microalgal cell has a lipid profile is at least 50% C18:3.
- Another aspect of the invention provides a microorganism that produces a triglyceride comprising linoleic acid or linolenic acid, wherein the microorganism comprises a recombinant nucleic acid encoding a ⁇ -ketoacyl-ACP synthase II (KAS II) enzyme.
- the microorganism further comprises a recombinant nucleic acid encoding a stearoyl ACP desaturase (SAD) enzyme.
- the microorganism further comprises a recombinant nucleic acid encoding an oleate-specific thioesterase enzyme.
- the microorganism further comprises a recombinant nucleic acid encoding a fatty acid desaturase (FAD) enzyme. In some cases, the microorganism further comprises a recombinant nucleic acid encoding a glycerolipid desaturase.
- FAD fatty acid desaturase
- the KAS II enzyme can comprise an amino acid sequence selected from the group consisting of SEQ ID NO: 175, SEQ ID NO: 176, SEQ ID NO: 177, SEQ ID NO: 178 and SEQ ID NO: 179.
- the SAD enzyme can comprise an amino acid sequence selected from the group consisting of SEQ ID NO: 172, SEQ ID NO: 196, SEQ ID NO: 197, SEQ ID NO: 198, SEQ ID NO: 199, SEQ ID NO: 200, and SEQ ID NO: 201.
- the oleate-specific thioesterase enzyme can comprise an amino acid sequence selected from the group consisting of SEQ ID NO: 195, SEQ ID NO: 202, SEQ ID NO: 203, SEQ ID NO: 204, SEQ ID NO: 205, and SEQ ID NO: 206.
- the FAD enzyme can comprise an amino acid sequence seleted from the group consisting of SEQ ID NO: 181, SEQ ID NO: 182.
- SEQ ID NO: 183, SEQ ID NO: 184 and SEQ ID NO: 185 can be any amino acid sequence selected from the group consisting of SEQ ID NO: 195, SEQ ID NO: 202, SEQ ID NO: 203, SEQ ID NO: 204, SEQ ID NO: 205, and SEQ ID NO: 206.
- the FAD enzyme can comprise an amino acid sequence seleted from the group consisting of SEQ ID NO: 181, SEQ ID NO: 182.
- the FAD enzyme is a ⁇ 12 FAD enzyme comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 207, SEQ ID NO: 208, SEQ ID NO: 209, SEQ ID NO: 210, SEQ ID NO: 211, and SEQ ID NO: 212.
- the FAD enzyme is a ⁇ 15 FAD enzyme comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 213, SEQ ID NO: 214, SEQ ID NO: 215, SEQ ID NO: 216, SEQ ID NO: 217, SEQ ID NO: 218, SEQ ID NO: 219, SEQ ID NO: 220, and SEQ ID NO: 221.
- the glycerolipid desaturase is a ⁇ -6 fatty acid desaturase, a ⁇ -3 fatty acid desaturase, or a ⁇ -6 oleate desaturase.
- any one of the engineered microorgansims discussed above can further comprise a recombinant nucleic acid encoding a sucrose utilization pathway enzyme.
- the sucrose utilization pathway enzyme is a sucrose invertase.
- the microorganism can be further engineered to increase the proportion of linoleic acid or linolenic acid relative to other fatty acids.
- the microorganism can be further engineered to overexpress a thioesterase specific for or preferential to C18 substrates.
- the microorganism can be futher engineered to decrease expression of a thioesterase specific for or preferential to a C8-C16 substrate.
- the microorganism can be a microalgal cell.
- the microalgal cell is of the genus Prototheca. In some cases, the microalgal cell is a Prototheca moriformis cell.
- Another aspect of the invention provides an oil produced by any one of the engineered microorganisms discussed above.
- Another aspect of the invention provides methods of producing the engineered microorganisms discussed above by introducing into the microorganisms one or more of the recombinant nucleic acids to produce triglycerides comprising linoleic acid or linolenic acid.
- Another aspect of the invention provides a method for producing a natural oil comprising triacylglycerides, or a product produced from the natural oil, in which the method comprises (i) cultivating a cell of a recombinant microorganism, the cell comprising recombinant nucleic acids operable to (a) decrease or eliminate the expression of an enzyme encoded by one or more genes that encode a ⁇ -ketoacyl-ACP synthase I, ⁇ -ketoacyl-ACP synthase II, stearoyl ACP desaturase, fatty acid desaturase, or acyl-ACP thioesterase, and optionally wherein the cell comprises recombinant nucleic acids operable to decrease or eliminate the expression of two copies of a gene encoding a ⁇ -ketoacyl-ACP synthase I, ⁇ - ketoacyl-ACP synthase II, stearoyl ACP desaturase, or fatty acid desaturas
- the microorganism synthesizes fatty acids through a type II fatty acid biosynthesis pathway.
- the microorganism is a microalga.
- the microalga is an obligate heterotroph.
- the microalga is a species of Prototheca or Chlorella.
- the microalga is Prototheca wickerhamii, Prototheca stagnora, Prototheca portoricensis, Prototheca moriformis, or Prototheca zopfii.
- the microalga is Chlorella kessleri, Chlorella luteoviridis Chlorella protothecoides, or Chlorella vulgaris.
- the cell is a recombinant cell expressing an active sucrose invertase.
- the cultivating is heterotrophic.
- the fatty acid desaturase is one or more of a ⁇ -6 fatty acid desaturase, a ⁇ -3 fatty acid desaturase, or a ⁇ -6 oleate desaturase, or a delta 12 fatty acid desaturase.
- the cell is cultivated so as to comprise between at least 50%, at least 60%, at least 70%, or 50 and 90% triglyceride by dry cell weight.
- the oil comprises less than 500, 50, or 5 ppm of colored molecules.
- the recombinant nucleic acids are stably integrated. In some cases, the recombinant nucleic acids are stably integrated into the chromosome of the microorganism. In some cases, the cell further comprises at least one selectable marker.
- the cell comprises recombinant nucleic acids operable to decrease or eliminate the expression of an enzyme through expression of antisense, RNAi, or dsRNA targeting the transcript of a gene encoding for the enzyme.
- the decrease or eliminatation of the expression of an enzyme encoded by one or more genes that encode a ⁇ - ketoacyl-ACP synthase I, ⁇ -ketoacyl-ACP synthase II, stearoyl ACP desaturase, or fatty acid desaturase is due to the interruption or replacement of the one or more genes with one or more genes encoding an active ⁇ -ketoacyl-ACP synthase I, ⁇ -ketoacyl-ACP synthase II, stearoyl ACP desaturase, or fatty acid desaturase, or acyl-ACP thioesterase.
- the recombinant cell further comprises an exogenous gene encoding an oleate 12- hydroxylase, so as to synthesize ricinoleic acid.
- the recombinant cell comprises nucleic acids operable to decrease or eliminate the expression of a ⁇ -ketoacyl-ACP synthase II encoded by a KASII gene, and to express a product of an exogenous gene encoding an acyl-ACP thioesterase.
- the cell produces an oil with a fatty acid profile characterized by having at least 40, 50, 60, 70, or 80% C16 fatty acids.
- the cell produces an oil with a fatty acid profile characterized by having at least 50-75% C16:0. In some cases, the cell produces an oil with a fatty acid profile further characterized by having at least 20-40% C18: l.
- the exogenous gene encoding an acyl-ACP thioesterase produces an active acyl-ACP thioesterase having greater activity in hydrolysis of C8-C16 fatty acyl chains than a native acyl-ACP-thioestearase of the cell. In some cases, the exogenous gene encoding an acyl-ACP thioesterase interrupts the KASII gene. In some cases, the recombinant cell comprises nucleic acids operable to decrease or eliminate the expression of an enzyme encoded by one or more genes that encode a ⁇ -ketoacyl-ACP synthase I.
- the oil produced has a fatty acid profile characterized by a shorter mean fatty acid chain length as a result of the recombinant nucleic acids.
- the recombinant cell comprises nucleic acids operable to decrease or eliminate the expression of a fatty acid destaurase encoded by at least one FAD gene and express a product of a stearoyl- ACP desaturase exogenous gene encoding an active stearoyl ACP desaturase.
- nucleic acids are operable to decrease or eliminate the expression of a fatty acid destaurase encoded by multiple copies of a fatty acid desaturase gene.
- the Stearoyl- ACP desaturase exogenous gene is recombined into a locus within the coding region of the fatty acid desaturase gene.
- the oil produced has a fatty acid profile having elevated oleic acid.
- the oleic acid comprises at least 50, 60, 70, 80, or 90% of the fatty acids.
- the recombinant cell comprises nucleic acids operable to express a product of a ⁇ -ketoacyl-ACP synthase II exogenous gene encoding an active ⁇ -ketoacyl-ACP synthase II.
- the oil produced is characterized by a fatty acid profile elevated in C 18: 1 fatty acids and reduced in C16 fatty acids as a result of the recombinant nucleic acids.
- the recombinant cell comprises nucleic acids operable to decrease or eliminate the expression of an enzyme encoded by one or more genes that encode a stearoyl ACP desaturase by RNA interference.
- the oil produced has a fatty acid profile characterized by an increase in C18:0 fatty acids.
- the oil produced is characterized by a fatty acid profile having at least 50, 60, 70, 80, or 90% C18:0.
- the oil produced is characterized by a fatty acid profile having at least 50-75% C18:0. In some cases, the oil produced is further characterized by a fatty acid profile having at least 20-40% C18: l.
- the cell comprises recombinant nucleic acids operable to decrease or eliminate the expression of two copies of a gene encoding a ⁇ -ketoacyl-ACP synthase I, ⁇ -ketoacyl-ACP synthase II, stearoyl ACP desaturase, or fatty acid desaturase.
- the nucleic acids are operable to express a product of a fatty acid desaturase exogenous gene encoding an active a ⁇ -3 fatty acid desaturase and/or a ⁇ -6 oleate desaturase.
- the oil produced has a fatty acid profile characterized by an elevated level of linoleic acid, linolenic acid, or both.
- the fatty acid profile of the oil is characterized by having at least 10, 20, 30, 40, or 50% linoleic acid, linolenic acid, or both.
- the further processing of the oil comprises one or more of refining, bleaching, deodorizing, metathesis, transesterification, hydrogenation, hydrolysis, hydrogenation, deoxygenation, hydrocracking, isomerization, hydrolxylation, interesterification, amidation, sulfonation, and sufurization.
- the oil is processed to create a food oil, fatty acids, a fatty alcohol, a lubricant, a soap, a fatty acid ester, a fatty acid ethoxylate, a fatty amine, an akyl chloride, a fatty alchohol ethoxylate, a fatty alcohol sulfate, a fatty acid alkanolamide, a sulfonated oil, a sulfurized oil, diesel fuel, jet fuel, gasoline, fuel blendstock, fuel additive, lubricant additive, or coating.
- Another aspect of the invention provides natural oil obtainable by the methods discussed above.
- the product comprises a food oil, fatty acids, a fatty alcohol, a lubricant, a soap, a fatty acid ester, a fatty acid ethoxylate, a fatty amine, an akyl chloride, a fatty alchohol ethoxylate, a fatty alcohol sulfate, a fatty acid alkanolamide, a sulfonated oil, a sulfurized oil, diesel fuel, jet fuel, gasoline, fuel blendstock, fuel additive, chemical additive, or coating.
- Another aspect of the invention provides a recombinant cell comprising
- recombinant nucleic acids operable to (a) decrease or eliminate the expression of an enzyme encoded by one or more genes that encode a ⁇ -ketoacyl-ACP synthase I, ⁇ -ketoacyl-ACP synthase II, stearoyl ACP desaturase, fatty acid desaturase, or acyl-ACP thioesterase, and optionally wherein the cell comprises recombinant nucleic acids operable to decrease or eliminate the expression of two copies of a gene encoding a ⁇ -ketoacyl-ACP synthase I, ⁇ - ketoacyl-ACP synthase II, stearoyl ACP desaturase, or fatty acid desaturase, or acyl-ACP thioesterase; or (b) express a product of an exogenous gene encoding an active ⁇ -ketoacyl- ACP synthase I, ⁇ -ketoacyl-ACP synthase II, ste
- the microorganism synthesizes fatty acids through a type II fatty acid biosynthesis pathway.
- the microorganism is a microalga.
- the microalga is an obligate heterotroph.
- the microalga is a species of Prototheca or Chlorella.
- the microalga is Prototheca wickerhamii, Prototheca stagnora, Prototheca portoricensis, Prototheca moriformis, or Prototheca zopfii.
- the microalga is Chlorella kessleri, Chlorella luteoviridis Chlorella protothecoides, or Chlorella vulgaris.
- the cell is a recombinant cell expressing an active sucrose invertase.
- the cell is capable of heterotrophic growth.
- the fatty acid desaturase is one or more of a ⁇ -6 fatty acid desaturase, a ⁇ -3 fatty acid desaturase, or a ⁇ -6 oleate desaturase, or a delta 12 fatty acid desaturase.
- the cell is capable of beiong cultivated so as to comprise between at least 50%, at least 60%, at least 70%, or 50 and 90% triglyceride by dry cell weight.
- the recombinant nucleic acids are stably integrated.
- the recombinant nucleic acids are stably integrated into the chromosome of the microorganism.
- the cell further comprises at least one selectable marker.
- the cell comprises recombinant nucleic acids operable to decrease or eliminate the expression of an enzyme through expression of antisense, RNAi, or dsRNA targeting the transcript of a gene encoding for the enzyme.
- the decrease or eliminatation of the expression of an enzyme encoded by one or more genes that encode a ⁇ -ketoacyl-ACP synthase I, ⁇ -ketoacyl-ACP synthase II, stearoyl ACP desaturase, or fatty acid desaturase is due to the interruption or replacement of the one or more genes with one or more genes encoding an active ⁇ -ketoacyl-ACP synthase I, ⁇ -ketoacyl-ACP synthase II, stearoyl ACP desaturase, or fatty acid desaturase, or acyl-ACP thioesterase.
- the recombinant cell further comprises an exogenous gene encoding an oleate 12-hydroxylase, so as to synthesize ricinoleic acid.
- the recombinant cell comprises nucleic acids operable to decrease or eliminate the expression of a ⁇ -ketoacyl- ACP synthase II encoded by a KASII gene, and to express a product of an exogenous gene encoding an acyl-ACP thioesterase.
- the cell produces an oil with a fatty acid profile characterized by having at least 40, 50, 60, 70, or 80% C16 fatty acids.
- the cell produces an oil with a fatty acid profile characterized by having at least 50-75% C16:0. In some cases, the cell produces an oil with a fatty acid profile further characterized by having at least 20-40% C18: l.
- the exogenous gene encoding an acyl-ACP thioesterase produces an active acyl-ACP thioesterase having greater activity in hydrolysis of C8-C16 fatty acyl chains than a native acyl-ACP-thioestearase of the cell. In some cases, the exogenous gene encoding an acyl-ACP thioesterase interrupts the KASII gene.
- the recombinant cell comprises nucleic acids operable to decrease or eliminate the expression of an enzyme encoded by one or more genes that encode a ⁇ -ketoacyl-ACP synthase I.
- the oil produced has a fatty acid profile characterized by a shorter mean fatty acid chain length as a result of the recombinant nucleic acids.
- the recombinant cell comprises nucleic acids operable to decrease or eliminate the expression of a fatty acid destaurase encoded by at least one FAD gene and express a product of a stearoyl- ACP desaturase exogenous gene encoding an active stearoyl ACP desaturase.
- the nucleic acids are operable to decrease or eliminate the expression of a fatty acid destaurase encoded by multiple copies of a fatty acid desaturase gene.
- the Stearoyl-ACP desaturase exogenous gene is recombined into a locus within the coding region of the fatty acid desaturase gene.
- the oil produced has a fatty acid profile having elevated oleic acid.
- the oleic acid comprises at least 50, 60, 70, 80, or 90% of the fatty acids.
- the recombinant cell comprises nucleic acids operable to express a product of a ⁇ -ketoacyl-ACP synthase II exogenous gene encoding an active ⁇ -ketoacyl-ACP synthase II.
- the oil produced is characterized by a fatty acid profile elevated in CI 8: 1 fatty acids and reduced in CI 6 fatty acids as a result of the recombinant nucleic acids.
- the recombinant cell comprises nucleic acids operable to decrease or eliminate the expression of an enzyme encoded by one or more genes that encode a stearoyl ACP desaturase by RNA interference.
- the oil produced has a fatty acid profile characterized by an increase in C18:0 fatty acids.
- the oil produced is characterized by a fatty acid profile having at least 50, 60, 70, 80, or 90% C18:0.
- the oil produced is characterized by a fatty acid profile having at least 50-75% C18:0.
- the oil produced is further characterized by a fatty acid profile having at least 20-40% C18: l.
- the cell comprises recombinant nucleic acids operable to decrease or eliminate the expression of two copies of a gene encoding a ⁇ -ketoacyl-ACP synthase I, ⁇ -ketoacyl-ACP synthase II, stearoyl ACP desaturase, or fatty acid desaturase.
- the nucleic acids are operable to express a product of a fatty acid desaturase exogenous gene encoding an active a ⁇ -3 fatty acid desaturase and/or a ⁇ -6 oleate desaturase.
- the oil produced has a fatty acid profile characterized by an elevated level of linoleic acid, linolenic acid, or both.
- the fatty acid profile of the oil is characterized by having at least 10, 20, 30, 40, or 50% linoleic acid, linolenic acid, or both.
- Another aspect of the invention provides a natural oil or oil-containing product produced from the cells described above.
- Another aspect of the invention provides a method for producing a natural oil comprising triacylglycerides that comprise ricinoleic acid, or a product produced from the natural oil, the method comprising cultivating a cell of a recombinant microorganism, the cell comprising recombinant nucleic acids operable to express a product of an exogenous gene encoding an active oleate 12-hydroxylase, so as to synthesize the ricinoleic acid.
- the microorganism has a type II fatty acid biosynthesis pathway.
- the microorganism is a microalga.
- the microalga is an obligate heterotroph.
- the microalga is a species of Prototheca.
- the microalga is Prototheca wickerhamii, Prototheca stagnora, Prototheca portoricensis, Prototheca moriformis, or Prototheca zopfii.
- the microalga is Chlorella kessleri, Chlorella luteoviridis Chlorella protothecoides, or Chlorella vulgaris.
- the cell is a recombinant cell expressing an active sucrose invertase. In some cases, the cultivating is heterotrophic. In some cases, the cell produces at least 40, 50, 60, 70, 80, or 90% oleic acid absent the recombinant nucleic acids operable to express a product of an exogenous gene encoding an active oleate 12-hydroxylase. In some cases, the cell further comprises recombinant nucleic acids operable to enhance oleic acid production so as to elevate the substrate levels for the oleate 12-hydroxylase.
- the cell comprises recombinant nucleic acids operable to (a) express a product of an exogenous gene encoding an active stearoyl ACP desaturase and decrease or eliminate the expression of an enzyme encoded by one or more genes that encode a fatty acid desaturase; or (b) express a product of an exogenous gene encoding an active ⁇ -ketoacyl-ACP synthase I and express a product of an exogenous gene encoding an active acyl-ACP thioesterase.
- Another aspect of the invention provides a product produced according to any of the methods discussed above.
- Another aspect of the invention provides a microorganism cell comprising recombinant nucleic acids operable to express a product of an exogenous gene encoding an active oleate 12-hydroxylase, so as to synthesize ricinoleic acid.
- the microorganism has a type II fatty acid biosynthesis pathway.
- the microorganism is a microalga.
- the microalga is an obligate heterotroph.
- the microalga is a species of Prototheca.
- the microalga is Prototheca wickerhamii, Prototheca stagnora, Prototheca portoricensis, Prototheca moriformis, or Prototheca zopfii.
- the microalga is Chlorella kessleri, Chlorella luteoviridis Chlorella protothecoides, or Chlorella vulgaris.
- the cell is a recombinant cell expressing an active sucrose invertase. In some cases, the cell is capable of heterotrophic growth. In some cases, the cell produces at least 40, 50, 60, 70, 80, or 90% oleic acid absent the recombinant nucleic acids operable to express a product of an exogenous gene encoding an active oleate 12-hydroxylase. In some cases, the cell further comprises recombinant nucleic acids operable to enhance oleic acid production so as to elevate the substrate levels for the oleate 12-hydroxylase.
- the cell comprises recombinant nucleic acids operable to (a) express a product of an exogenous gene encoding an active stearoyl ACP desaturase and decrease or eliminate the expression of an enzyme encoded by one or more genes that encode a fatty acid desaturase; or (b) express a product of an exogenous gene encoding an active ⁇ -ketoacyl-ACP synthase I and express a product of an exogenous gene encoding an active acyl-ACP thioesterase.
- Another aspect of the present invention provides a food comprising an oil as discussed above.
- Figure 1 shows a chromatogram of renewable diesel produced from Prototheca triglyceride oil.
- Figure 2 shows GC retention times of a representative positive transgenic clone compared to the ricinoleic acid standard and a wildtype control.
- Figure 3 shows Pstl restriction maps of Prototheca moriformis FADc alleles with and without a targeted gene disruption, as described in Example 18.
- Figure 4 shows the results of the Southern blot described in Example 18.
- Illustrative embodiments of the present invention feature oleaginous cells that produce altered glycerolipid profiles and products produced from the cells.
- oleagninous cells include microbial cells having a type II lipid biosynthesis pathway.
- Embodiments include recombinant cells expressing one or more exogenous genes encoding proteins such as fatty acyl-ACP thioesterases, fatty acid destaturases, keto-acyl syntheases and optionally having one or more knockdowns of endogenous genes encoding proteins with similar activities.
- exogenous genes such as fatty acyl-ACP thioesterases, fatty acid destaturases, keto-acyl syntheases and optionally having one or more knockdowns of endogenous genes encoding proteins with similar activities.
- Some embodiments feature natural oils never before obtainable.
- the present invention also provides methods of making lipids and oil-based products, including fuels such as biodiesel, renewable diesel and jet fuel, food oils and chemicals from such cells.
- the oils produced according to embodiments of the present invention can be used in the transportation fuel, oleochemical, and/or food and cosmetic industries, among other applications.
- transesterification of lipids can yield long-chain fatty acid esters useful as biodiesel.
- Other enzymatic and chemical processes can be tailored to yield fatty acids, aldehydes, alcohols, alkanes, and alkenes.
- renewable diesel, jet fuel, or other hydrocarbon compounds are produced.
- the present invention also provides methods of cultivating microalgae for increased productivity and increased lipid yield, and/or for more cost-effective production of the compositions described herein.
- An embodiment of the invention provides a method for producing a natural oil comprising triacylglycerides, or for producing a product produced from the natural oil.
- the natural oil can be a non-plant or non-seed oil.
- the method comprises cultivating a cell of a recombinant microorganism to produce a tailored oil; i.e., one with an altered fatty acid profile due to the presence of the recombinant nucleic acids in the cell.
- the natural oil can then be further processed to produce a food, fuel, or chemical product.
- the recombinant nucleic acids in the cell are operable to (a) decrease or eliminate the expression of an enzyme encoded by one or more genes that encode a ⁇ -ketoacyl-ACP synthase I, ⁇ -ketoacyl-ACP synthase II, stearoyl ACP desaturase, fatty acid desaturase, or acyl-ACP thioesterase.
- the cell comprises recombinant nucleic acids operable to decrease or eliminate the expression of two copies of a gene (e.g., two alleles in a diploid organism) encoding a ⁇ - ketoacyl-ACP synthase I, ⁇ -ketoacyl-ACP synthase II, stearoyl ACP desaturase, or fatty acid desaturase, or acyl-ACP thioesterase; or (b) express a product of a exogenous gene encoding an active ⁇ -ketoacyl-ACP synthase I, ⁇ -ketoacyl-ACP synthase II, stearoyl ACP desaturase, or fatty acid desaturase, or acyl-ACP thioesterase; or (c) decrease or eliminate the expression of an enzyme encoded by one or more genes that encode a ⁇ -ketoacyl-ACP synthase I or ⁇ - ketoacyl-ACP synthase II
- the nucleic acid may encode for one or more of a ⁇ -6 fatty acid desaturase, a ⁇ -3 fatty acid desaturase, or a ⁇ -6 oleate desaturase, or a delta 12 fatty acid desaturase.
- the cell comprises recombinant nucleic acids operable to decrease or eliminate the expression of an enzyme
- this may occur through expression of antisense, RNAi, or dsRNA targeting the transcript of a gene encoding for the enzyme, or by other suitable means, including a directed mutation, complete deletion, or partial deletion.
- the decrease or alimentation of the expression of an enzyme encoded by one or more genes that encode a ⁇ -ketoacyl-ACP synthase I, ⁇ -ketoacyl-ACP synthase II, stearoyl ACP desaturase, or fatty acid desaturase can be due to the interruption or replacement of the one or more genes with one or more genes encoding an active ⁇ -ketoacyl-ACP synthase I, ⁇ - ketoacyl-ACP synthase II, stearoyl ACP desaturase, or fatty acid desaturase, or acyl-ACP thioesterase.
- the recombinant nucleic acids are stably integrated into the cell; e.g., into the cells chromosome, or an episome.
- the selection of cells with stably integrated nucleic acids may be aided using a selectable marker such as sucrose invertase, an antibiotic resistance gene, or thiamine auxotrophy complementation, as described herein.
- the microorganism can be one that synthesizes fatty acids through a type II fatty acid biosynthesis pathway.
- the microorganism can be a microalga, but can also be a microorganism that normally possesses a type I fatty acid biosynthetic pathway (e.g., an oil producing yeast) into which type two genetic machinery has been introduced using genetic engineering techniques.
- the microorganism can be a heterotroph, and in a specific embodiment, an obligate heterotroph. Where the microalga is used, the microalga may be a species of Prototheca or Chlorella.
- Illustrative species include Prototheca wickerhamii, Prototheca stagnora, Prototheca portoricensis, Prototheca moriformis, Prototheca zopfii, Chlorella kessleri, Chlorella luteoviridis Chlorella protothecoides, and Chlorella vulgaris.
- the recombinant cell can include recombinant nucleic acids that include a sucrose invertase gene so as to express an active sucrose invertase.
- the sucrose invertase may be secreted by the microorganism into the medium.
- Cultivation can be heterotrophic; e.g., performed in a bioreactor using a fixed carbon source such as glucose or sucrose.
- the cultivation may be continued until the cell reaches at least 50%, at least 60%, at least 70%, or 50 to 90% triglyceride by dry cell weight. This may entail cultivation using limiting nitrogen, as described infra.
- the oil produced by the cell can be extracted from the cell.
- the oil comprises less than 500, 50, or 5 ppm of colored molecules.
- the oil is analyzed for its fatty acid profile; e.g., by LC-MS.
- the oil can also have one or more of the properties of the oil of Example 19, tables 60-63.
- the recombinant cell comprises nucleic acids operable to decrease or eliminate the expression of a ⁇ -ketoacyl-ACP synthase II encoded by a KASII gene, and to express a product of an exogenous gene encoding an acyl-ACP thioesterase.
- the cell can produce an oil with a fatty acid profile characterized by having at least 40, 50, 60, or 70% C16 fatty acids (e.g., palmitic acid).
- the oil can have a fatty acid distribution shifted towards shorter chain lengths.
- the shift in the fatty acid distribution can be characterized by a reduced mean fatty acid length o9r other statistical characterization of the distribution.
- the percent of each detectable fatty acid making up the triglycerides is multiplied by the number of carbons in the fatty acid and the sum of the products is divided by 100.
- the exogenous gene encoding the acyl-ACP thioesterase can produce an active acyl-ACP thioesterase having greater activity in hydrolysis of C8-C16 fatty acyl chains than a native acyl-ACP-thioesterase of the cell.
- the exogenous gene encoding an acyl-ACP thioesterase can interrupt the KASII gene. In this way, the insertion of the acyl-ACP thioesterase can also eliminate expression of the ⁇ - ketoacyl-ACP synthase II in one step. See Examples 15 and 16.
- the recombinant cell comprises nucleic acids operable to decrease or eliminate the expression of an enzyme encoded by one or more genes that encode a ⁇ -ketoacyl-ACP synthase I.
- the oil produced has a fatty acid profile characterized by a distribution of fatty acid chain lengths that is shorter than a comparable cell lacking the recombinant nucleic acids. This may be expressed as a reduced mean fatty acid chain length.
- the recombinant cell can include nucleic acids operable to decrease or eliminate the expression of a fatty acid destaurase encoded by at least one FAD gene and to express a product of a stearoyl- ACP desaturase exogenous gene encoding an active stearoyl ACP desaturase.
- the nucleic acids are operable to decrease or eliminate the expression of a fatty acid destaurase encoded by multiple copies (e.g., alleles) of a fatty acid desaturase gene.
- the stearoyl-ACP desaturase exogenous gene is recombined into a locus within the coding region of the fatty acid desaturase gene.
- the oil produced can have an elevated level of oleic acid compared to that produced by a comparable cell lacking the nucleic acids.
- the oleic acid comprises at least 50, 60, 70, 80, or 90% of the fatty acids in the fatty acid profile. See Example 10.
- the recombinant cell comprises nucleic acids operable to express a product of a ⁇ -ketoacyl-ACP synthase II exogenous gene encoding an active ⁇ -ketoacyl-ACP synthase II.
- the oil produced can be characterized by a fatty acid profile elevated in 18: 1 fatty acids and reduced in C16 fatty acids as a result of the recombinant nucleic acids. See Example 13, in which overexpression of a KASII gene increased the percentage of C18 fatty acids from about 68% in the untransformed cells to about 84%. In related embodiments, the increase is greater than 70%, from 75-85%, or from 70-90%.
- the recombinant cell comprises nucleic acids operable to decrease or eliminate the expression of an enzyme encoded by one or more genes that encode a stearoyl ACP desaturase by RNA interference.
- the oil produced can have a fatty acid profile characterized by an increase in 18:0 fatty acids.
- the 18:0 fatty acids can be at least 50, 60, 70, 80, or 90% of the fatty acids in the profile. See Example 12.
- the cell comprises recombinant nucleic acids operable to decrease or eliminate the expression of two copies of a gene (e.g. two alleles) encoding a ⁇ -ketoacyl-ACP synthase I, ⁇ -ketoacyl-ACP synthase II, stearoyl ACP desaturase, or fatty acid desaturase.
- a gene e.g. two alleles
- a gene e.g. two alleles
- the cell comprises recombinant nucleic acids operable to express a product of a fatty acid desaturase exogenous gene encoding an active a ⁇ -3 fatty acid desaturase and/or a ⁇ -6 oleate desaturase.
- elevated levels of linoleic acid, linolenic acid, or both can be produced by the cell, and detected in the fatty acid profile of the cell lipids.
- the cell can have at least 10, 20, 30, 40, or 50% linoleic acid, linolenic acid, or both.
- a recombinant ⁇ 15 desaturase enzyme may be expressed as in Example 11.
- C18:3 fatty acids i.e., linolenic acid
- a cell of a recombinant microorganism is cultivated.
- the cell includes recombinant nucleic acids that operate to express a product of an exogenous gene encoding an active oleate 12-hydroxylase, so as to synthesize the ricinoleic acid.
- This gene may be present in any of the aforementioned embodiments. See Example 7.
- a preferred substrate for 12-hydroxylase is oleic acid.
- a higher yield of ricinoleic acid may be obtained by inclusion in the cell of recombinant nucleic acids that operate to increase oleic acid production.
- the cell comprises recombinant nucleic acids operable to express a product of an exogenous gene encoding an active stearoyl ACP desaturase and decrease or eliminate the expression of an enzyme encoded by one or more genes that encode a fatty acid desaturase; or express a product of an exogenous gene encoding an active ⁇ -ketoacyl-ACP synthase I and express a product of an exogenous gene encoding an active acyl-ACP thioesterase.
- the oil can be extracted and further processed by one or more of refining, bleaching, deodorizing, metathesis, transesterification, hydrogenation, hydrolysis, hydrogenation, deoxygenation, hydrocracking, isomerization, hydroxylation, interesterification, amidation, sulfonation, and sufurization.
- the oil may be processed, for example, to create a food oil, fatty acids, a fatty alcohol, a lubricant, a soap, a fatty acid ester, a fatty acid ethoxylate, a fatty amine, an akyl chloride, a fatty alcohol ethoxylate, a fatty alcohol sulfate, a fatty acid alkanolamide, a sulfonated oil, or a sulfurized oil, diesel, jet gasoline, or a blendstock or additive, a lubricant, or a paint.
- any of the embodiments mentioned herein can be useful as a food or food oil.
- the whole organism can be incorporated into a food.
- the organism can be intact, partly lysed, mostly lysed or entirely lysed.
- Methods for preparing and using oleaginous organisms in food is taught in WO2011/150411 , WO2010/12093, WO2011130578, and WO2011/130576.
- the extracted and optionally purified oil from the organism can be used as food oil, including as a food oil ingredient in prepared foods such as spreads, sauces, confections, and frozen confections.
- the oleaginous cells or food oil comprise 50-70% C18:0 and 20-40% 18: 1 (e.g., oleate). In another specific embodiment, the oleaginous cells or food oil comprises 50-70% C16:0 and 20-40% 18: 1 (e.g., oleate).
- Section I provides definitions of terms used herein.
- Section II provides a description of culture conditions useful in the methods of the invention.
- Section III provides a description of genetic engineering methods and materials.
- Section IV provides a description of genetic engineering to enable sucrose utilization.
- Section V provides a description of genetic engineering to modify lipid biosynthesis.
- Section VI describes methods for making fuels and chemicals.
- Section VII discloses examples and embodiments of the invention. The detailed description of the invention is followed by examples that illustrate the various aspects and embodiments of the invention.
- Active in microalgae refers to a nucleic acid that is functional in microalgae.
- a promoter that has been used to drive an antibiotic resistance gene to impart antibiotic resistance to a transgenic microalgae is active in microalgae.
- Area Percent refers to the area of peaks observed using FAME GC/FID detection methods in which every fatty acid in the sample is converted into a fatty acid methyl ester (FAME) prior to detection. For example, a separate peak is observed for a fatty acid of 14 carbon atoms with no unsaturation (C14:0) compared to any other fatty acid such as C14: l.
- the peak area for each class of FAME is directly proportional to its percent composition in the mixture and is calculated based on the sum of all peaks present in the sample (i.e. [area under specific peak/ total area of all measured peaks] X 100).
- At least 4% C8-C14 means that at least 4% of the total fatty acids in the cell or in the extracted glycerolipid composition have a chain length that includes 8, 10, 12 or 14 carbon atoms.
- Axenic is a culture of an organism free from contamination by other living organisms.
- Biodiesel is a biologically produced fatty acid alkyl ester suitable for use as a fuel in a diesel engine.
- Biomass is material produced by growth and/or propagation of cells. Biomass may contain cells and/or intracellular contents as well as extracellular material, includes, but is not limited to, compounds secreted by a cell.
- Bioreactor is an enclosure or partial enclosure in which cells are cultured, optionally in suspension.
- Cellulosic material is a biological material comprising cellulose and optionally hemicellulose. As such it is digestible to sugars such as glucose and xylose, and optionally may comprise additional compounds such as disaccharides, oligosaccharides, lignin, furfurals and other compounds.
- sources of cellulosic material include sugar cane bagasses, sugar beet pulp, corn stover, wood chips, sawdust and switchgrass.
- Co-culture and variants thereof such as “co-cultivate” and “co-ferment”, refer to cultivating two or more types of cells in the same bioreactor.
- the two or more types of cells may both be microorganisms, such as microalgae, or may be a microalgal cell cultured with a different cell type.
- Colored molecules or “color generating impurities” as used herein refer to any compound that imparts a color to the extracted oil.
- “Colored molecules” or “color generating impurities” include for example, chlorophyll a, chlorophyll b, lycopenes, tocopherols, campesterols, tocotrienols, and carotenoids, such as beta carotene, luteins, zeaxanthin, astaxanthin. These molecules are preferably present in the microbial biomass or the extracted oil at a concentration of no more than 500 ppm, no more than 250 ppm, no more than 100 ppm, no more than 75 ppm, or no more than 25 ppm.
- the amount of chlorophyll that is present in the microbial biomass or the extracted oil is less than 500 mg/kg, less than 100 mg/kg, less than 10 mg/kg, less than 1 mg.kg, less than 0.5 mg/kg, less than 0.1 mg/kg, less than 0.05 mg/kg, or less than 0.01 mg/kg.
- “Cultivated”, and variants thereof such as “cultured” and “fermented”, refer to the intentional fostering of growth (increases in cell size, cellular contents, and/or cellular activity) and/or propagation (increases in cell numbers) of one or more cells by use of selected and/or controlled conditions. The combination of both growth and propagation is termed "proliferation.” Examples of selected and/or controlled conditions include the use of a defined medium (with known characteristics such as pH, ionic strength, and carbon source), specified temperature, oxygen tension, carbon dioxide levels, and growth in a bioreactor. "Cultivated” does not refer to the growth or propagation of microorganisms in nature or otherwise without human intervention; for example, natural growth of an organism that ultimately becomes fossilized to produce geological crude oil is not cultivation.
- “Desaturase” refers to an enzyme in the lipid synthesis pathway responsible for the introduction of double bonds (unsaturation) into the fatty acid chains of triacylglyceride molecules. Examples include but are not limited to stearoyl-Acyl carrier protein desaturase (SAD) and fatty acid desaturase (FAD), also known as fatty acyl desaturase.
- SAD stearoyl-Acyl carrier protein desaturase
- FAD fatty acid desaturase
- “Expression vector” or “expression construct” or “plasmid” or “recombinant DNA construct” is a vehicle for introducing a nucleic acid into a host cell.
- the nucleic acid can be one that has been generated via human intervention, including by recombinant means or direct chemical synthesis, with a series of specified nucleic acid elements that permit transcription and/or translation of a particular nucleic acid.
- the expression vector can be part of a plasmid, virus, or nucleic acid fragment, or other suitable vehicle.
- the expression vector includes a nucleic acid to be transcribed operably linked to a promoter.
- Exogenous gene is a nucleic acid that codes for the expression of an RNA and/or protein that has been introduced into a cell (e.g. by transformation/transfection), and is also referred to as a "transgene".
- a cell comprising an exogenous gene may be referred to as a recombinant cell, into which additional exogenous gene(s) may be introduced.
- the exogenous gene may be from a different species (and so heterologous), or from the same species (and so homologous), relative to the cell being transformed.
- an exogenous gene can include a homologous gene that occupies a different location in the genome of the cell or is under different control, relative to the endogenous copy of the gene.
- An exogenous gene may be present in more than one copy in the cell.
- An exogenous gene may be maintained in a cell as an insertion into the genome (nuclear or plastid) or as an episomal molecule.
- Exogenously provided refers to a molecule provided to the culture media of a cell culture.
- fatty acids shall mean free fatty acids, fatty acid salts, or fatty acyl moieties in a glycerolipid.
- Fixed carbon source is a molecule(s) containing carbon, typically an organic molecule, that is present at ambient temperature and pressure in solid or liquid form in a culture media that can be utilized by a microorganism cultured therein. Accordingly, carbon dioxide is not a fixed carbon source.
- Heterotrophic as it pertains to culture conditions is culturing in the substantial absence of light while utilitizing or metabolizing a fixed carbon source.
- Hydrogen:carbon ratio is the ratio of hydrogen atoms to carbon atoms in a molecule on an atom-to-atom basis. The ratio may be used to refer to the number of carbon and hydrogen atoms in a hydrocarbon molecule. For example, the hydrocarbon with the highest ratio is methane CH 4 (4: 1).
- "Inducible promoter” is a promoter that mediates transcription of an operably linked gene in response to a particular stimulus. Examples of such promoters may be promoter sequences that are induced in conditions of changing pH or nitrogen levels.
- operable linkage is a functional linkage between two nucleic acid sequences, such a control sequence (typically a promoter) and the linked sequence (typically a sequence that encodes a protein, also called a coding sequence).
- a promoter is in operable linkage with an exogenous gene if it can mediate transcription of the gene.
- Lipid modification enzyme refers to an enzyme that alters the covalent structure of a lipid or can otherwise lead to an altered fatty acid profile in a cell.
- lipid modification enzymes include a lipase, a fatty acyl-ACP thioesterase, a fatty acyl- CoA/aldehyde reductase, a fatty acyl-CoA reductase, a fatty aldehyde reductase, a desaturase, including a stearoyl acyl carrier protein desaturase (SAD) and a fatty acyl destaurase (FAD), and a fatty aldehyde decarbonylase.
- SAD stearoyl acyl carrier protein desaturase
- FAD fatty acyl destaurase
- Lipid pathway enzyme is any enzyme that plays a role in lipid metabolism, i.e., either lipid synthesis, modification, or degradation, and any proteins that chemically modify lipids, as well as carrier proteins.
- Lipid profile or “glycerolipid profile” refers to the distribution of fatty acids in a cell or oil derived from a cell in terms of chain length and/or saturation pattern.
- the saturation pattern can comprise a measure of saturated versus unsaturated acid or a more detailed analysis of the distribution of the positions of double bonds in the various fatty acids of a cell.
- Lysis is the breakage of the plasma membrane and optionally the cell wall of a biological organism sufficient to release at least some intracellular content, often by mechanical, chemical, viral or osmotic mechanisms that compromise its integrity.
- Microalgae is a microbial organism that contains a chloroplast or plastid, and optionally that is capable of performing photosynthesis, or a prokaryotic microbial organism capable of performing photosynthesis.
- Microalgae include obligate photoautotrophs, which cannot metabolize a fixed carbon source as energy, as well as heterotrophs, which can live solely off of a fixed carbon source.
- Microalgae include unicellular organisms that separate from sister cells shortly after cell division, such as Chlamydomonas, as well as microbes such as, for example, Volvox, which is a simple multicellular photosynthetic microbe of two distinct cell types.
- Microalgae include cells such as Chlorella, Dunaliella, and Prototheca. Microalgae also include other microbial photosynthetic organisms that exhibit cell-cell adhesion, such as Agmenellum, Anabaena, and Pyrobotrys. Microalgae also include obligate heterotrophic microorganisms that have lost the ability to perform photosynthesis, such as certain dinoflagellate algae species and species of the genus Prototheca.
- Mord chain refers to a C10-C16 fatty acid.
- Short chain in this context, refers to C6-C10 fatty acids, while “long chain” refers to C17 or longer fatty acids.
- a "natural oil” shall mean a predominantly triglyceride oil obtained from an organism, where the oil has not undergone blending with another natural or synthetic oil, or fractionation so as to substantially alter the fatty acid profile of the triglyceride.
- fractionation means removing material from the oil in a way that changes its fatty acid profile relative to the profile produced by the organism, however accomplished.
- a natural oil encompasses such an oil obtained from an organism, where the oil has undergone minimal processing, including refining, bleaching and/or degumming, that does not substantially change its triglyceride profile.
- a natural oil can also be a "noninteresterified natural oil", which means that the natural oil has not undergone a process in which fatty acids have been redistributed in their acyl linkages to glycerol and remain essentially in the same
- Naturally co-expressed with reference to two proteins or genes means that the proteins or their genes are co-expressed naturally in a tissue or organism from which they are derived, e.g., because the genes encoding the two proteins are under the control of a common regulatory sequence or because they are expressed in response to the same stimulus.
- Osmotic shock is the rupture of cells in a solution following a sudden reduction in osmotic pressure. Osmotic shock is sometimes induced to release cellular components of such cells into a solution.
- Polys accharide-degrading enzyme is any enzyme capable of catalyzing the hydrolysis, or saccharification, of any polysaccharide.
- cellulases catalyze the hydrolysis of cellulose.
- Polysaccharides or "glycans” are carbohydrates made up of monosaccharides joined together by glycosidic linkages.
- Cellulose is a polysaccharide that makes up certain plant cell walls.
- Cellulose can be depolymerized by enzymes to yield monosaccharides such as xylose and glucose, as well as larger disaccharides and oligosaccharides.
- Promoter is a nucleic acid control sequence that directs transcription of a nucleic acid.
- a promoter includes necessary nucleic acid sequences near the start site of transcription, such as, in the case of a polymerase II type promoter, a TATA element.
- a promoter also optionally includes distal enhancer or repressor elements, which can be located as much as several thousand base pairs from the start site of transcription.
- Recombinant is a cell, nucleic acid, protein or vector, that has been modified due to the introduction of an exogenous nucleic acid or the alteration of a native nucleic acid.
- recombinant cells can express genes that are not found within the native (non- recombinant) form of the cell or express native genes differently than those genes are expressed by a non-recombinant cell.
- Recombinant cells can, without limitation, include recombinant nucleic acids that encode for a gene product or for suppression elements such as mutations, knockouts, antisense, interfering RNA (RNAi) or dsRNA that reduce the levels of active gene product in a cell.
- RNAi interfering RNA
- a "recombinant nucleic acid” is a nucleic acid originally formed in vitro, in general, by the manipulation of nucleic acid, e.g., using polymerases, ligases, exonucleases, and endonucleases, or otherwise is in a form not normally found in nature.
- Recombinant nucleic acids may be produced, for example, to place two or more nucleic acids in operable linkage.
- an isolated nucleic acid or an expression vector formed in vitro by ligating DNA molecules that are not normally joined in nature are both considered recombinant for the purposes of this invention.
- a recombinant nucleic acid Once a recombinant nucleic acid is made and introduced into a host cell or organism, it may replicate using the in vivo cellular machinery of the host cell; however, such nucleic acids, once produced recombinantly, although subsequently replicated intracellularly, are still considered recombinant for purposes of this invention.
- a "recombinant protein” is a protein made using recombinant techniques, i.e., through the expression of a recombinant nucleic acid.
- Renewable diesel is a mixture of alkanes (such as C10:0, C12:0, C14:0, C16:0 and CI 8:0) produced from a natural oil; e.g. , through hydrogenation and deoxygenation of lipids.
- saccharification is a process of converting biomass, usually cellulosic or lignocellulosic biomass, into monomelic sugars, such as glucose and xylose.
- biomass usually cellulosic or lignocellulosic biomass
- monomelic sugars such as glucose and xylose.
- saccharification or “depolymerized” cellulosic material or biomass refers to cellulosic material or biomass that has been converted into monomeric sugars through saccharification.
- stable or “stably integrated” shall mean that the recombinant nucleic acids are retained by the cells of the strain for at least 10 generations.
- a recombinant strain has a selectable marker that enables cultivation in the presence of a selection pressure
- the recombinant nucleic acids are retained after 10 generations of cultivation in the absence of the selection pressure.
- sucrose utilization gene is a gene that, when expressed, aids the ability of a cell to utilize sucrose as an energy source. Proteins encoded by a sucrose utilization gene are referred to herein as “sucrose utilization enzymes” and include sucrose transporters, sucrose invertases, and hexokinases such as glucokinases and fructokinases.
- the present invention generally relates to cultivation of microorganisms, and particularly oleaginous microorganisms having a type II fatty acid biosynthesis pathway, such as microalgae to produce triglycerides.
- the microorganisms are obligate heterotrophs.
- the microorganisms may be recombinant microorganims based, for example, of the genetic engineering methods disclosed infra. For the convenience of the reader, this section is subdivided into subsections. Subsection 1 describes species and strains of microorganisms. Subsection 2 describes bioreactors useful for cultivation. Subsection 3 describes media for cultivation. Subsection 4 describes oil production in accordance with illustrative cultivation methods of the invention.
- Prototheca is a preferred microorganism for use in the production of lipid.
- the genetic engineering methods described herein with Prototheca as an example are applicable to other microorganisms ⁇ e.g., Chlorella sorokiniana, Chlorella vulgaris Chlorella ellipsoidea, Chlorella kessleri, Dunaliella tertiolecta, Volvox carteri,
- Haematococcus pluvialis Closterium peracerosum-strigosum-littorale complex, Dunaliella viridis, Dunaliella salina, Gonium pectorale, Phaeodactylum tricornutum, Chaetoceros, Cylindrotheca fusiformis, Amphidinium sp., Symbiodinium micro adriacticum,
- Nannochloropsis Cyclotella cryptica, Navicula saprophila, or Thalassiosira pseudonana).
- Lipid or oil obtained from an obligate heterotrophic microalgae such as Prototheca can be generally low in pigment (e.g., low to undetectable levels of chlorophyll and certain carotenoids, for example less than 500, 50 or 5 ppm, of colored molecules, color-generating impurities, or the sum of chlorophyll and carotenoid concentrations) and in any event contains much less pigment than lipid from other microalgae.
- recombinant Prototheca cells provided by the invention can be used to produce lipid in greater yield and efficiency, and with reduced cost, relative to the production of lipid from other microorganisms.
- Prototheca strains for use in the methods of the invention include In addition, this microalgae grows heterotrophically and can be genetically engineered as Prototheca wickerhamii, Prototheca stagnora (including UTEX 327),
- Prototheca portoricensis Prototheca moriformis (including UTEX strains 1441, 1435), and Prototheca zopfii.
- Species of the genus Prototheca are obligate heterotrophs.
- microorganism yields cells that are at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, or at least 70% or more lipid.
- the wild-type or genetically engineered microorganism yields cells that comprise between 40 and 80% or 50 and 90% triglyceride.
- Preferred organisms grow heterotrophically (on sugars in the absence of light).
- Examples of algae that can be used to practice the present invention include, but are not limited to the following algae listed in Table 1.
- Table 1 Examples of algae.
- vacuolata Chlorella glucotropha, Chlorella infusionum, Chlorella infusionum var. actophila, Chlorella infusionum var. auxenophila, Chlorella kessleri, Chlorella lobophora (strain SAG 37.88), Chlorella luteoviridis, Chlorella luteoviridis var. aureoviridis, Chlorella luteoviridis var.
- Chlorella protothecoides including any of UTEX strains 1806, 411, 264, 256, 255, 250, 249, 31, 29, 25, and CCAP strains 211/17 and 21 l/8d), Chlorella protothecoides var. acidicola, Chlorella regularis, Chlorella regularis var. minima, Chlorella regularis var. umbricata, Chlorella reisiglii, Chlorella saccharophila, Chlorella saccharophila var.
- Chlorella salina Chlorella simplex, Chlorella sorokiniana, Chlorella sp., Chlorella sphaerica, Chlorella stigmatophora, Chlorella vanniellii, Chlorella vulgaris, Chlorella vulgaris, Chlorella vulgaris/, tertia, Chlorella vulgaris var. autotrophica, Chlorella vulgaris var. viridis, Chlorella vulgaris var. vulgaris, Chlorella vulgaris var. vulgaris/, tertia, Chlorella vulgaris var.
- Microrganisms are cultured both for purposes of conducting genetic manipulations and for production of hydrocarbons (e.g., lipids, fatty acids, aldehydes, alcohols, and alkanes).
- hydrocarbons e.g., lipids, fatty acids, aldehydes, alcohols, and alkanes.
- the former type of culture is conducted on a small scale and initially, at least, under conditions in which the starting microorganism can grow.
- Culture for purposes of hydrocarbon production is usually conducted on a large scale (e.g., 10,000 L, 40,000 L, 100,000 L or larger bioreactors) in a bioreactor.
- Microalgae, including Prototheca species are typically cultured in the methods of the invention in liquid media within a bioreactor.
- the bioreactor does not allow light to enter.
- the bioreactor or fermentor is used to culture microalgal cells through the various phases of their physiological cycle.
- Bioreactors offer many advantages for use in
- microalgae are preferably fermented in large quantities in liquid, such as in suspension cultures.
- Bioreactors such as steel fermentors can accommodate very large culture volumes (40,000 liter and greater capacity bioreactors are used in various embodiments of the invention).
- Bioreactors also typically allow for the control of culture conditions such as temperature, pH, oxygen tension, and carbon dioxide levels.
- bioreactors are typically configurable, for example, using ports attached to tubing, to allow gaseous components, like oxygen or nitrogen, to be bubbled through a liquid culture.
- Other culture parameters such as the pH of the culture media, the identity and concentration of trace elements, and other media constituents can also be more readily manipulated using a bioreactor.
- Bioreactors equipped with devices such as spinning blades and impellers, rocking mechanisms, stir bars, means for pressurized gas infusion can be used to subject cultures to mixing. Mixing may be continuous or intermittent. For example, in some embodiments, a turbulent flow regime of gas entry and media entry is not maintained for reproduction of cells until a desired increase in number of said cells has been achieved.
- Bioreactor ports can be used to introduce, or extract, gases, solids, semisolids, and liquids, into the bioreactor chamber containing the microalgae. While many bioreactors have more than one port (for example, one for media entry, and another for sampling), it is not necessary that only one substance enter or leave a port.
- a port can be used to flow culture media into the bioreactor and later used for sampling, gas entry, gas exit, or other purposes.
- a sampling port can be used repeatedly without altering compromising the axenic nature of the culture.
- a sampling port can be configured with a valve or other device that allows the flow of sample to be stopped and started or to provide a means of continuous sampling.
- Bioreactors typically have at least one port that allows inoculation of a culture, and such a port can also be used for other purposes such as media or gas entry.
- Bioreactors ports allow the gas content of the culture of microalgae to be manipulated.
- part of the volume of a bioreactor can be gas rather than liquid, and the gas inlets of the bioreactor to allow pumping of gases into the bioreactor.
- Gases that can be beneficially pumped into a bioreactor include air, oxygen, air/C0 2 mixtures, noble gases, such as argon, and other gases.
- Bioreactors are can be equipped to enable the user to control the rate of entry of a gas into the bioreactor. As noted above, increasing gas flow into a bioreactor can be used to increase mixing of the culture.
- Turbulence can be achieved by placing a gas entry port below the level of the aqueous culture media so that gas entering the bioreactor bubbles to the surface of the culture.
- One or more gas exit ports allow gas to escape, thereby preventing pressure buildup in the bioreactor.
- a gas exit port leads to a "one-way" valve that prevents contaminating microorganisms from entering the bioreactor.
- Microbial culture media typically contains components such as a fixed nitrogen source, a fixed carbon source, trace elements, optionally a buffer for pH maintenance, and phosphate (typically provided as a phosphate salt).
- Other components can include salts such as sodium chloride, particularly for seawater microalgae.
- Nitrogen sources include organic and inorganic nitrogen sources, including, for example, without limitation, molecular nitrogen, nitrate, nitrate salts, ammonia (pure or in salt form, such as, (NH 4 ) 2 S0 4 and NH 4 OH), protein, soybean meal, cornsteep liquor, and yeast extract.
- trace elements include zinc, boron, cobalt, copper, manganese, and molybdenum in, for example, the respective forms of ZnCl 2 , H 3 BO 3 , CoCl 2 - 6H 2 0, CuCl 2 -2H 2 0, MnCl 2 -4H 2 0 and
- Microorganisms useful in accordance with the methods of the present invention are found in various locations and environments throughout the world. As a consequence of their isolation from other species and their resulting evolutionary divergence, the particular growth medium for optimal growth and generation of lipid and/or hydrocarbon constituents can be difficult to predict. In some cases, certain strains of microorganisms may be unable to grow on a particular growth medium because of the presence of some inhibitory component or the absence of some essential nutritional requirement required by the particular strain of microorganism. [0149] Solid and liquid growth media are generally available from a wide variety of sources, and instructions for the preparation of particular media that is suitable for a wide variety of strains of microorganisms can be found, for example, online at
- Proteose Medium is suitable for axenic cultures, and a 1L volume of the medium (pH -6.8) can be prepared by addition of lg of proteose peptone to 1 liter of Bristol Medium.
- Bristol medium comprises 2.94 mM NaN0 3 , 0.17 mM CaCl 2 -2H 2 0, 0.3 mM MgS0 4 -7H 2 0, 0.43 mM, 1.29 mM KH 2 P0 4 , and 1.43 mM NaCl in an aqueous solution.
- For 1.5% agar medium 15 g of agar can be added to 1 L of the solution.
- PIM Prototheca isolation medium
- KHP postassium hydrogen phthalate
- 0.9g/L sodium hydroxide O. lg/L magnesium sulfate
- 0.2g/L potassium hydrogen phosphate 0.3g/L ammonium chloride
- lOg/L glucose O.OOlg/L thiamine hydrochloride 20g/L agar, 0.25g/L 5-fluorocytosine, at a pH in the range of 5.0 to 5.2 (see Pore, 1973, App. Microbiology, 26: 648-649).
- SAG refers to the Culture Collection of Algae at the University of Gottingen (Gottingen, Germany)
- CCAP refers to the culture collection of algae and protozoa managed by the Scottish Association for Marine Science (Scotland, United Kingdom)
- CCALA refers to the culture collection of algal laboratory at the Institute of Botany (Trebon, Czech Republic).
- US Patent No. 5,900,370 describes media formulations and conditions suitable for heterotrophic fermentation of Prototheca species.
- a fixed carbon source For oil production, selection of a fixed carbon source is important, as the cost of the fixed carbon source must be sufficiently low to make oil production economical.
- suitable carbon sources can include, for example, acetate, floridoside, fructose, galactose, glucuronic acid, glucose, glycerol, lactose, mannose, N-acetylglucosamine, rhamnose, sucrose, and/or xylose
- selection of feedstocks containing those compounds is an important aspect of the methods of embodiments of the invention.
- Suitable feedstocks useful in accordance with the methods of the invention can include, for example, black liquor, corn starch, depolymerized cellulosic material, milk whey, molasses, potato, sorghum, sucrose, sugar beet, sugar cane, rice, and wheat.
- Carbon sources can also be provided as a mixture, such as a mixture of sucrose and depolymerized sugar beet pulp.
- the one or more carbon source(s) can be supplied at a concentration of at least about 50 ⁇ , at least about 100 ⁇ , at least about 500 ⁇ , at least about 5 mM, at least about 50 mM, and at least about 500 mM, of one or more exogenously provided fixed carbon source(s).
- Highly concentrated carbon sources as feedstock for fermentation are preferred.
- glucose levels of at least 300g/L, at least 400g/L, at least 500g/L, or at least 600g/L or more of glucose level of the feedstock prior to the cultivation step is added to a fed batch cultivation, in which the highly concentrated fixed carbon source is fed to the cells over time as the cells grow and accumulate lipid.
- sucrose levels of at least 500g/L, at least 600g/L, at least 700g/L, at least 800g/L or more of sucrose prior to the cultivation is added to a fed batch cultivation, in which the highly concentrated fixed carbon source is fed to the cells over time as the cells grow and accumulate lipid.
- Non-limiting examples of highly concentrated fixed carbon source such as sucrose include thick cane juice, sugar cane juice, sugar beet juice and molasses.
- Carbon sources of particular interest for purposes of the present invention include cellulose (in a depolymerized form), glycerol, sucrose, and sorghum, each of which is discussed in more detal below.
- microorganisms can be cultured using depolymerized cellulosic biomass as a feedstock.
- Cellulosic biomass e.g., stover, such as corn stover
- feedstocks have been found to be inhibitory to yeast growth, and yeast cannot use the 5-carbon sugars produced from cellulosic materials (e.g., xylose from hemi-cellulose).
- cellulosic materials e.g., xylose from hemi-cellulose.
- at least some microalgae can grow on processed cellulosic material.
- Cellulosic materials generally include about 40- 60% cellulose; about 20-40% hemicellulose; and 10-30% lignin.
- Cellulosic materials include residues from herbaceous and woody energy crops, as well as agricultural crops, i.e., the plant parts, primarily stalks and leaves, not removed from the fields with the primary food or fiber product.
- agricultural wastes such as sugarcane bagasse, rice hulls, corn fiber (including stalks, leaves, husks, and cobs), wheat straw, rice straw, sugar beet pulp, citrus pulp, citrus peels; forestry wastes such as hardwood and softwood thinnings, and hardwood and softwood residues from timber operations; wood wastes such as saw mill wastes (wood chips, sawdust) and pulp mill waste; urban wastes such as paper fractions of municipal solid waste, urban wood waste and urban green waste such as municipal grass clippings; and wood construction waste.
- Additional cellulosics include dedicated cellulosic crops such as switchgrass, hybrid poplar wood, and miscanthus, fiber cane, and fiber sorghum. Five-carbon sugars that are produced from such materials include xylose,
- Cellulosic materials can be treated to increase the efficiency with which the microbe can utilize the sugar(s) contained within the materials.
- Embodiments of the invention provide methods for the treatment of cellulosic materials after acid explosion so that the materials are suitable for use in a heterotrophic culture of microbes (e.g., microalgae and oleaginous yeast).
- lignocellulosic biomass is comprised of various fractions, including cellulose, a crystalline polymer of beta 1,4 linked glucose (a six-carbon sugar), hemicellulose, a more loosely associated polymer predominantly comprised of xylose (a five-carbon sugar) and to a lesser extent mannose, galactose, arabinose, lignin, a complex aromatic polymer comprised of sinapyl alcohol and its derivatives, and pectins, which are linear chains of an alpha 1 ,4 linked polygalacturonic acid.
- the sugars e.g., monomeric glucose and xylose
- the sugars are not in a form that can be efficiently used (metabolized) by many microbes.
- further processing of the cellulosic biomass to generate the monomeric sugars that make up the polymers can be very helpful to ensuring that the cellulosic materials are efficiently utilized as a feedstock (carbon source).
- Celluose or cellulosic biomass is subjected to a process, termed “explosion", in which the biomass is treated with dilute sulfuric (or other) acid at elevated temperature and pressure. This process conditions the biomass such that it can be efficiently subjected to enzymatic hydrolysis of the cellulosic and hemicellulosic fractions into glucose and xylose monomers. The resulting monomeric sugars are termed cellulosic sugars. Cellulosic sugars can subsequently be utilized by microorganisms to produce a variety of metabolites (e.g., lipid). The acid explosion step results in a partial hydrolysis of the hemicellulose fraction to constitutent monosaccharides.
- explosion results in a partial hydrolysis of the hemicellulose fraction to constitutent monosaccharides.
- the further treatment is a hydrothermal treatment that includes washing the exploded material with hot water, which removes contaminants such as salts. This step is not necessary for cellulosic ethanol fermentations due to the more dilute sugar concentrations used in such processes.
- the further treatment is additional acid treatment.
- the further treatment is enzymatic hydrolysis of the exploded material. These treatments can also be used in any combination.
- the type of treatment can affect the type of sugars liberated (e.g., five carbon sugars versus six carbon sugars) and the stage at which they are liberated in the process. As a consequence, different streams of sugars, whether they are predominantly five-carbon or six- carbon, can be created. These enriched five-carbon or six-carbon streams can thus be directed to specific microorganisms with different carbon utilization cabilities.
- the methods of the present invention can involve fermentation to higher cell densities than what is typically achieved in ethanol fermentation.
- the fixed carbon source e.g., the cellulosic derived sugar stream(s)
- the glucose level of the depolymerized cellulosic material is preferably at least 300 g/liter, at least 400 g/liter, at least 500 g/liter or at least 600 g/liter prior to the cultivation step, which is optionally a fed batch cultivation in which the material is fed to the cells over time as the cells grow and accumulate lipid.
- the carbon feedstock(s) can be delivered into the heterotrophic cultures in a highly concentrated form.
- ligin and lignin-derived by-products carbohydrate-derived byproducts such as furfurals and hydroxymethyl furfurals and salts derived from the generation of the cellulosic materials (both in the explosion process and the subsequent neutralization process), and even non- metabolized pentose/hexose sugars can present problems in ethanolic fermentations, these effects are amplified significantly in a process in which their concentration in the initial feedstock is high.
- the concentration of these toxic materials can be 20 times higher than the concentrations typically present in ethanolic fermentations of cellulosic biomass.
- the explosion process treatment of the cellulosic material utilizes significant amounts of sulfuric acid, heat and pressure, thereby liberating by-products of carbohydrates, namely furfurals and hydroxymethyl furfurals.
- Furfurals and hydroxymethyl furfurals are produced during hydrolysis of hemicellulose through dehydration of xylose into furfural and water.
- these by-products e.g., furfurals and hydroxymethyl furfurals
- the process for removal of the by-products of carbohydrates is hydrothermal treatment of the exploded cellulosic materials.
- the present invention provides methods in which strains capable of tolerating compounds such as furfurals or hydroxymethyl furfurals are used for lignocellulosic oil production.
- the present invention also provides methods and microorganisms that are not only capable of tolerating furfurals in the fermentation media, but are actually able to metabolize these by-products during the production of lignocellulosic oil.
- the explosion process also generates significant levels of salts.
- typical conditions for explosion can result in conductivites in excess of 5 mS/cm when the exploded cellulosic biomass is resuspended at a ratio of 10: 1 watensolids (dry weight).
- the diluted exploded biomass is subjected to enzymatic saccharification, and the resulting supernatant is concentrated up to 25 fold for use in the bioreactor.
- the salt level (as measured by conductivity) in the concentrated sugar stream(s) can be unacceptably high (up to 1.5 M Na + equivalents). Additional salts are generated upon neutralization of the exploded materials for the subsequent enzymatic saccharification process as well.
- Embodiments of the present invention provides methods for removing these salts so that the resulting concentrated cellulosic sugar stream(s) can be used in heterotrophic processes for producing lignocellulosic oil.
- the method of removing these salts is deionization with resins, such as, but not limited to, DOWEX Marathon MR3.
- the deionization with resin step occurs before sugar concentration or pH adjustment and hydro thermal treatment of biomass prior to saccharification, or any combination of the preceding; in other embodiments, the step is conducted after one or more of these processes.
- the explosion process itself is changed so as to avoid the generation of salts at unacceptably high levels.
- an alternative to sulfuric acid (or other acid) explosion of the cellulosic biomass is mechanical pulping to render the cellulosic biomass receptive to enzymatic hydrolysis (saccharification).
- native strains of microorganisms resistant to high levels of salts or genetically engineered strains with resistance to high levels of salts are used.
- a preferred embodiment for the process of preparing of exploded cellulosic biomass for use in heterotrophic lignocellulosic oil production using oleaginous microbes follows.
- a first step comprises adjusting the pH of the resuspended exploded cellulosic biomass to the range of 5.0-5.3 followed by washing the cellulosic biomass three times. This washing step can be accomplished by a variety of means including the use of desalting and ion exchange resins, reverse omosis, hydrothermal treatment (as described above), or just repeated re- suspension and centrifugation in deionized water.
- This wash step results in a cellulosic stream whose conductivity is between 100-300 ⁇ 8 : ⁇ and the removal of significant amounts of furfurals and hydroxymethyl furfurals. Decants from this wash step can be saved to concentrate five-carbon sugars liberated from the hemicellulose fraction.
- a second step comprises enzymatic saccharification of the washed cellulosic biomass. In a preferred embodiment, Accellerase (Genencor) is used.
- a third step comprises the recovery of sugars via centrifugation or decanting and rinsing of the saccharified biomass. The resulting biomass (solids) is an energy dense, lignin rich component that can be used as fuel or sent to waste.
- a fourth step comprises microfiltration to remove contaminating solids with recovery of the permeate.
- a fifth step comprises a concentration step which can be accomplished using a vacuum evaporator. This step can optionally include the addition of antifoam agents such as P'2000 (Sigma/Fluka), which is sometimes necessary due to the protein content of the resulting sugar feedstock.
- the carbon source is glycerol, including acidulated and non- acidulated glycerol byproduct from biodiesel transesterification.
- the carbon source includes glycerol and at least one other carbon source.
- all of the glycerol and the at least one other fixed carbon source are provided to the microorganism at the beginning of the fermentation.
- the glycerol and the at least one other fixed carbon source are provided to the microorganism simultaneously at a predetermined ratio.
- the glycerol and the at least one other fixed carbon source are fed to the microbes at a predetermined rate over the course of fermentation.
- microalgae undergo cell division faster in the presence of glycerol than in the presence of glucose (see PCT Pub. No. 2008/151149).
- two-stage growth processes in which cells are first fed glycerol to rapidly increase cell density and are then fed glucose to accumulate lipids, can improve the efficiency with which lipids are produced.
- the use of the glycerol byproduct of the transesterification process can provide significant economic advantages when put back into the production process.
- Other feeding methods are provided as well, such as mixtures of glycerol and glucose. Feeding such mixtures also captures the same economic benefits.
- the invention provides methods of feeding alternative sugars to microalgae such as sucrose in various combinations with glycerol.
- the carbon source is invert sugar.
- Invert sugar is less prone to crystallization compared to sucrose and thus, can provide advantages for storage and in fed batch fermentation, which in the case of heterotrophic cultivation of microbes, including microalgae, there is a need for concentrated carbon source.
- the carbon source is invert sugar, preferably in a concentrated form, preferably at least 800g/liter, at least 900 g/liter, at least 1000 g/liter or at least 1100 g/liter prior to the cultivation step, which is optionally a fed batch cultivation.
- the invert sugar preferably in a concentrated form, is fed to the cells over time as the cells grow and accumulate lipid.
- the carbon source is sucrose, including a complex feedstock containing sucrose, such as thick cane juice from sugar cane processing.
- the fixed carbon source e.g., sucrose, glucose, etc.
- sucrose, glucose, etc. is preferably in a
- the carbon source is sucrose in the form of thick cane juice, preferably in a concentrated form, preferably at least 60% solids or about 770 g/liter sugar, at least 70% solids or about 925 g/liter sugar, or at least 80% solids or about 1125 g/liter sugar prior to the cultivation step, which is optionally a fed batch cultivation.
- the concentrated thick cane juice is fed to the cells over time as the cells grow and accumulate lipid.
- the culture medium further includes at least one sucrose utilization enzyme.
- the sucrose utilization enzyme is a sucrose invertase.
- the sucrose invertase enzyme can be a secrectable sucrose invertase enzyme encoded by an exogenous sucrose invertase gene expressed by the population of microorganisms.
- the secretable sucrose invertase can be secreted by the microorganisms into the culture medium so as to convert sucrose in the medium to glucose and fructose for use by the microorganism.
- the sucrose invertase can be recombinant, thereby imparting upon a microorganism the ability to use pure or complex sucrose feedstocks as a fixed carbon source for growth or oil production.
- the microalgae has been genetically engineered to express a sucrose utilization enzyme, such as a sucrose transporter, a sucrose invertase, a hexokinase, a glucokinase, or a fructokinase.
- Complex feedstocks containing sucrose include waste molasses from sugar cane processing; the use of this low- value waste product of sugar cane processing can provide significant cost savings in the production of hydrocarbons and other oils.
- Another complex feedstock containing sucrose that is useful in the methods of the invention is sorghum, including sorghum syrup and pure sorghum.
- Sorghum syrup is produced from the juice of sweet sorghum cane. Its sugar profile consists of mainly glucose (dextrose), fructose and sucrose.
- Heterotrophic species are grown and propagated for the production of oil in a medium containing a fixed carbon source and in the absence of light; such growth is known as heterotrophic growth.
- an inoculum of lipid-producing microalgal cells are introduced into the medium; there is a lag period (lag phase) before the cells begin to propagate. Following the lag period, the propagation rate increases steadily and enters the log, or exponential, phase. The exponential phase is in turn followed by a slowing of propagation due to decreases in nutrients such as nitrogen, increases in toxic substances, and quorum sensing mechanisms. After this slowing, propagation stops, and the cells enter a stationary phase or steady growth state, depending on the particular environment provided to the cells.
- the culture is typically harvested well after then end of the exponential phase, which may be terminated early by allowing nitrogen or another key nutrient (other than carbon) to become depleted, forcing the cells to convert the carbon sources, present in excess, to lipid, an in particular, to triglcyeride.
- Culture condition parameters can be manipulated to optimize total oil production, the combination of lipid species produced, and/or production of a specific oil.
- Lipid production by cells disclosed herein can occur during the log phase or thereafter, including the stationary phase wherein nutrients are supplied, or still available, to allow the continuation of lipid production in the absence of cell division.
- microorganisms grown using conditions described herein and/or known in the art comprise at least about 20-30%, 30-40%, 40-50%, 50-60%, 60-70%, or 80-90% by dry cell weight of triglyceride.
- Process conditions can be adjusted to increase the yield of lipids suitable for a particular use and/or to reduce production cost.
- a microalgae is cultured in the presence of a limiting concentration of one or more nutrients, such as, for example, nitrogen, phosphorous, or sulfur, while providing an excess of fixed carbon energy such as glucose.
- Nitrogen limitation tends to increase microbial lipid yield (a measure of the amount of lipid produced per gram of dry cell weight) over microbial lipid yield in a culture in which nitrogen is provided in excess.
- the increase in lipid yield is at least about: 10%, 50%, 100%, 200%, or 500%.
- the microbe can be cultured in the presence of a limiting amount of a nutrient for a portion of the total culture period or for the entire period.
- the nutrient concentration is cycled between a limiting concentration and a non- limiting concentration at least twice during the total culture period.
- Lipid content of cells can be increased by continuing the culture for increased periods of time while providing an excess of carbon, but limiting or no nitrogen.
- lipid yield is increased by culturing a lipid-producing microbe (e.g., microalgae) in the presence of one or more cofactor(s) for a lipid pathway enzyme (e.g., a coenzyme or prosthetic group of a fatty acid synthetic enzyme).
- a lipid pathway enzyme e.g., a coenzyme or prosthetic group of a fatty acid synthetic enzyme.
- the concentration of the cofactor(s) is sufficient to increase microbial lipid (e.g., fatty acid) yield over microbial lipid yield in the absence of the cofactor(s).
- the cofactor(s) are provided to the culture by including in the culture a microbe (e.g., microalgae) containing an exogenous gene encoding the cofactor(s).
- cofactor(s) may be provided to a culture by including a microbe (e.g., microalgae) containing an exogenous gene that encodes a protein that participates in the synthesis of the cofactor.
- suitable cofactors include any vitamin required by a lipid pathway enzyme, such as, for example: biotin or pantothenate.
- Genes encoding cofactors suitable for use in the invention or that participate in the synthesis of such cofactors are well known and can be introduced into microbes (e.g., microalgae), using contracts and techniques such as those described above.
- bioreactors, culture conditions, and heterotrophic growth and propagation methods described herein can be combined in any suitable manner to improve efficiencies of microbial growth and lipid and/or protein production.
- Microalgal biomass with a high percentage of oil/lipid accumulation by dry weight has been generated using different methods of culture, which are known in the art (see PCT
- Microalgal biomass generated by the culture methods described herein and useful in accordance with the present invention comprises at least 10% microalgal oil by dry weight. In some embodiments, the microalgal biomass comprises at least
- the microalgal biomass contains from 10-90% microalgal oil, from 25-75% microalgal oil, from
- microalgal oil 75-85%, or from 50-70% microalgal oil by dry weight.
- the microalgal oil of the biomass described herein, or extracted from the biomass for use in the methods and compositions of the present invention can comprise glycerolipids with one or more distinct fatty acid ester side chains.
- Glycerolipids are comprised of a glycerol molecule esterified to one, two or three fatty acid molecules, which can be of varying lengths and have varying degrees of saturation. The length and saturation
- characteristics of the fatty acid molecules (and the microalgal oils) can be manipulated to modify the properties or proportions of the fatty acid molecules in microalgal oils of embodiments of the present invention via culture conditions or via lipid pathway engineering, as described in more detail in Section IV, below.
- Particular modifications of properties and proportions include alteration of the fatty acid distribution of the microbial triglycerides such as changes in chain length profile, saturation profile, and hydroxylation of fatty acids.
- the oils so produced can comprise a natural oil.
- microbial oil can be prepared either within a single species of algae by mixing together the biomass or algal oil from two or more species of microalgae, or by blending algal oil of the invention with oils from other sources such as soy, rapeseed, canola, palm, palm kernel, coconut, corn, waste vegetable, Chinese tallow, olive, sunflower, cottonseed, chicken fat, beef tallow, porcine tallow, microalgae, macroalgae, microbes, Cuphea, flax, peanut, choice white grease, lard, Camelina sativa, mustard seed, cashew nut, oats, lupine, kenaf, calendula, help, coffee, linseed (flax), hazelnut, euphorbia, pumpkin seed, coriander, camellia, sesame, safflower, rice, tung tree, cocoa, copra, pium poppy, castor beans, pecan, jo
- the oil composition i.e. , the properties and proportions of the fatty acid
- consitutents of the glycerolipids can also be manipulated by combining biomass or oil from at least two distinct species of microorganism.
- at least two of the distinct species of microalgae have different glycerolipid profiles.
- the distinct species of microalgae can be cultured together or separately as described herein, preferably under heterotrophic conditions, to generate the respective oils.
- Different species of microalgae can contain different percentages of distinct fatty acid consituents in the cell's glycerolipids.
- Prototheca strains have very little or no fatty acids with the chain length C8-C14.
- the microbial strains containing a transgene encoding a fatty acyl- ACP thioesterase that has activity towards fatty acyl-ACP substrate of chain lengths C8 or C8-10 has at least 1.5%, at least 3.0%, at least 10%, at least 12% or more fatty acids of chain length C8.
- the microbial strains containing a transgene encoding a fatty acyl ACP thioesterase that has activity towards fatty acyl-ACP substrate of chain lengths CIO has at least at least 5.0%, at least 10.0%, at least 24%, at least 29% or more fatty acids of chain length CIO.
- the microbial strains containing a transgene encoding a fatty acyl-ACP thioesterase that has activity towards fatty acyl-ACP substrate of chain length C12 has at least 5%, at least 15%, at least 34%, at least 50% or more fatty acids of the chain length C12.
- the microbial strains containing a transgene encoding a fatty acyl- ACP thioesterase that has activity towards fatty acyl-ACP substrate of chain length C14 has at least 2.0%, at least 7%, at least 10%, at least 15%, at least 30%, at least 43% or more fatty acids of the chain length C14.
- the microbial strains containing a transgene encoding a fatty acyl-ACP thioesterase that has activity towards fatty acyl-ACP substrate of chain length C16 has at least 30%, at least 40%, at least 66% or more fatty acids of the chain length C16.
- the microbial strains containing a transgene encoding a fatty acyl-ACP thioesterase that has activity towards fatty acyl-ACP substrate of chain length C18 and specifically for C18:0 has at least 5%, at least 10%, at least 26%, at least 40% or more C18:0 fatty acid levels.
- the microbe can be a microalgae, such as Prototheca.
- a microbial strain containing a transgene encoding a fatty acyl-ACP thioesterase that has activity towards fatty acyl-ACP substrate of chain length C8 has between 1-20%, preferably between 1.8-13%, fatty acids of chain length C8.
- a microbial strain containing a transgene encoding a fatty acyl-ACP thioesterase that has activity towards fatty acyl-ACP substrate of chain length CIO has between 1-40%, preferably between 1.91-30%, fatty acids of chain length CIO.
- microbial strains containing a transgene encoding a fatty acyl-ACP thioesterase that has activity towards fatty acyl-ACP substrate of chain length C12 has between 10-60%, preferably between 13.55-55%, fatty acids of the chain length C12.
- microbial strains containing a transgene encoding a fatty acyl- ACP thioesterase that has activity towards fatty acyl-ACP substrate of chain length C14 has between 1-50%, preferably between 2.59-43.27%, fatty acids of the chain length C14.
- microbial strains containing a transgene encoding a fatty acyl- ACP thioesterase that has broad specificity towards fatty acyl-ACP substrates of varying carbon chain length has up to 70%fatty acids of the chain length C16.
- microbial strains containing a transgene encoding a fatty acyl-ACP thioesterase that has activity towards fatty acyl-ACP substrate of chain length C16 has up to 75%, preferably up to 67.42%, fatty acids of the chain length C16.
- the microbial strains containing a transgene encoding a fatty acyl-ACP thioesterase that has activity towards fatty acyl-ACP substrate of chain lengths between C8 and C14 have between 1-790%, or between about 2- 80%, (C8-C14) fatty acids. In some cases, the microbial strains containing a transgene encoding a fatty acyl-ACP thioesterase that has activity towards fatty acyl-ACP substrates of chain lengths between C12 and C14 have at least 50% or 60%, C12-C14 fatty acids.
- the transgenic microbial strains under constant and high selective pressure to retain exogenous genes is advantageous due to the increase in the desired fatty acid of a specific chain length.
- High levels of exogenous gene retention can also be achieved by inserting exogenous genes into the nuclear chromosomes of the cells using homologous recombination vectors and methods disclosed herein.
- Recombinant cells containing exogenous genes integrated into nuclear chromosomes are an object of the invention.
- the microbe can be a microalgae, such as Prototheca.
- the microbial oil can also include other constituents produced by the microalgae, or incorporated into the microalgal oil from the culture medium. These other constituents can be present in varying amount depending on the culture conditions used to culture the microalgae, the species of microalgae, the extraction method used to recover microalgal oil from the biomass and other factors that may affect microalgal oil composition.
- Non-limiting examples of such constituents include carotenoids, present from 0.025-0.3 mcg/g, preferably from 0.05 to 0.244 micrograms/gram, of oil; chlorophyll A present from 0.025-0.3 mcg/g, preferably from 0.045 to 0.268 micrograms/gram, of oil; total chlorophyll of less than 0.03 mcg/g, preferably less than 0.025 micrograms/gram, of oil; gamma tocopherol present from 35-175 mcg/g, preferably from 38.3-164 micrograms/gram, of oil; total tocopherols present from 50-300 mcg/g, preferably from 60.8 to 261.7 microgram/gram, of oil; less than 0.5%, preferably less than 0.25%, brassicasterol, campesterol, stigmasterol, or betasitosterol; total tocotrienols less than 300 micrograms/gram of oil; and total tocotrienols present from 225-350
- the other constituents can include, without limitation, phospholipids, tocopherols, tocotrienols, carotenoids (e.g., alpha-carotene, beta-carotene, lycopene, etc.), xanthophylls (e.g., lutein, zeaxanthin, alpha-cryptoxanthin and beta-cry toxanthin), and various organic or inorganic compounds.
- carotenoids e.g., alpha-carotene, beta-carotene, lycopene, etc.
- xanthophylls e.g., lutein, zeaxanthin, alpha-cryptoxanthin and beta-cry toxanthin
- organic or inorganic compounds e.g., phospholipids, tocopherols, tocotrienols, carotenoids (e.g., alpha-carotene, beta-carotene, lycopen
- the oil extracted from Prototheca species comprises between 0.001 to 0.05, preferably from 0.003 to 0.039, microgram lutein/gram of oil, less than 0.005, preferably less than 0.003, micrograms lycopene/gram of oil; and less than 0.005, preferably less than 0.003, microgram beta carotene/gram of oil.
- the present invention provides methods and materials for genentically modifying
- Prototheca cells and recombinant host cells useful in the methods of the present invention including but not limited to recombinant Prototheca moriformis, Prototheca zopfii,
- Prototheca krugani, and Prototheca stagnora host cells The description of these methods and materials is divided into subsections for the convenience of the reader.
- subsection 1 transformation methods are described.
- subsection 2 genetic engineering methods using homologous recombination are described.
- subsection 3 expression vectors and components are described.
- Cells can be transformed by any suitable technique including, e.g., biolistics, electroporation (see Maruyama et al. (2004), Biotechnology Techniques 8:821-826), glass bead transformation and silicon carbide whisker transformation.
- Another method that can be used involves forming protoplasts and using CaCl 2 and polyethylene glycol (PEG) to introduce recombinant DNA into microalgal cells (see Kim et al. (2002), Mar. Biotechnol. 4:63-73, which reports the use of this method for the transformation of Chorella ellipsoidea).
- Co-transformation of microalgae can be used to introduce two distinct vector molecules into a cell simultaneously (see for example Protist 2004 Dec;155(4):381-93).
- Biolistic methods see, for example, Sanford, Trends In Biotech. (1988) 6:299 302, U.S. Patent No. 4,945,050; electroporation (Fromm et al., Proc. Nat'l. Acad. Sci. (USA) (1985) 82:5824 5828); use of a laser beam, microinjection or any other method capable of introducing DNA into a microalgae can also be used for transformation of a Prototheca cell.
- Homologous recombination is the ability of complementary DNA sequences to align and exchange regions of homology.
- Transgenic DNA (“donor") containing sequences homologous to the genomic sequences being targeted (“template”) is introduced into the organism and then undergoes recombination into the genome at the site of the corresponding genomic homologous sequences.
- homologous recombination is a precise gene targeting event, hence, most transgenic lines generated with the same targeting sequence will be essentially identical in terms of phenotype, necessitating the screening of far fewer transformation events.
- homologous recombination also targets gene insertion events into the host chromosome, potentially resulting in excellent genetic stability, even in the absence of genetic selection.
- homologous recombination can be a method of querying loci in an unfamiliar genome environment and to assess the impact of these environments on gene expression.
- recombination is to co-opt specific host regulatory elements such as promoters/UTRs to drive heterologous gene expression in a highly specific fashion.
- ablation or knockout of desaturase genes/gene families with a heterologous gene encoding a selective marker might be expected to increase the overall percentage of saturated fatty acids produced in the host cell.
- Example 6 describes the homologous recombination targeting constructs and a working example of such desaturase gene ablations or knockouts generated in Prototheca moriformis.
- Another approach to decreasing expression of an endogenous gene is to use an RNA-induced downregulation or silencing of gene expression including, but not limited to an RNAi or antisense approach, as well as a dsRNA approach.
- Antisense, RNAi, dsRNA approaches are well known in the art and include the introduction of an expression construct that when expressed as mRNA would lead to the formation of hairpin RNA or an expression construct containing a portion of the target gene that would be transcribed in the antisense orientation. All three approaches would result in the decreased expression of the target gene.
- Example 6 also describes expression constructs and a working example of the down- regulation of an endogenous Prototheca moriformis delta 12 desaturase gene (FADc) by an RNAi and antisense approach.
- FADc Prototheca moriformis delta 12 desaturase gene
- homologous recombination is a precise gene targeting event, it can be used to precisely modify any nucleotide(s) within a gene or region of interest, so long as sufficient flanking regions have been identified. Therefore, homologous recombination can be used as a means to modify regulatory sequences impacting gene expression of RNA and/or proteins. It can also be used to modify protein coding regions in an effort to modify enzyme activites such as substrate specificity, affinities and Km, and thus affecting the desired change in metabolism of the host cell. Homologous recombination provides a powerful means to manipulate the host genome resulting in gene targeting, gene conversion, gene deletion, gene duplication, gene inversion and exchanging gene expression regulatory elements such as promoters, enhancers and 3'UTRs.
- Homologous recombination can be achieve by using targeting constructs containing pieces of endogenous sequences to "target" the gene or region of interest within the endogenous host cell genome.
- Such targeting sequences can either be located 5' of the gene or region of interest, 3 ' of the gene/region of interest or even flank the gene/region of interest.
- Such targeting constructs can be transformed into the host cell either as a supercoiled plasmid DNA with additional vector backbone, a PCR product with no vector backbone, or as a linearized molecule.
- Other methods of increasing recombination efficiency include using PCR to generate transforming transgenic DNA containing linear ends homologous to the genomic sequences being targeted.
- regions of donor DNA sequences that are useful for homologous recombination include the KE858 region of DNA in Prototheca moriformis.
- KE858 is a 1.3 kb, genomic fragment that encompasses part of the coding region for a protein that shares homology with the transfer RNA (tRNA) family of proteins.
- tRNA transfer RNA
- 6S donor sequences at SEQ ID NO: 82, SEQ ID NO: 84 .
- 6S sequence is not the 6S rRNA sequence. The use of this sequence in homologous recombination in Prototheca morifomis are described below in the Examples.
- Vectors for transformation of microorganisms in accordance with the present invention can be prepared by known techniques familiar to those skilled in the art in view of the disclosure herein.
- a vector typically contains one or more genes, in which each gene codes for the expression of a desired product (the gene product) and is operably linked to one or more control sequences that regulate gene expression or target the gene product to a particular location in the recombinant cell.
- this subsection is divided into subsections.
- Subsection A describes control sequences typically contained on vectors as well as novel control sequences provided by the present invention.
- Subsection B describes genes typically contained in vectors as well as novel codon optimization methods and genes prepared using them provided by the invention.
- Control sequences are nucleic acids that regulate the expression of a coding sequence or direct a gene product to a particular location in or outside a cell.
- Control sequences that regulate expression include, for example, promoters that regulate transcription of a coding sequence and terminators that terminate transcription of a coding sequence.
- Another control sequence is a 3 ' untranslated sequence located at the end of a coding sequence that encodes a polyadenylation signal.
- Control sequences that direct gene products to particular locations include those that encode signal peptides, which direct the protein to which they are attached to a particular location in or outside the cell.
- an exemplary vector design for expression of an exogenous gene in a microalgae contains a coding sequence for a desired gene product (for example, a selectable marker, a lipid pathway modification enzyme, or a sucrose utilization enzyme) in operable linkage with a promoter active in microalgae.
- a desired gene product for example, a selectable marker, a lipid pathway modification enzyme, or a sucrose utilization enzyme
- the coding sequence can be transformed into the cells such that it becomes operably linked to an endogenous promoter at the point of vector integration.
- the promoterless method of transformation has been proven to work in microalgae (see for example Plant Journal 14:4, (1998), pp.441-447).
- promoters are active in microalgae, including promoters that are endogenous to the algae being transformed, as well as promoters that are not endogenous to the algae being transformed (i.e., promoters from other algae, promoters from higher plants, and promoters from certain plant viruses or algae viruses).
- promoters from other algae i.e., promoters from higher plants, and promoters from certain plant viruses or algae viruses.
- Illustrative exogenous and/or endogenous promoters that are active in microalgae are described in PCT Pub. No. 2008/151149 and references cited therein).
- the promoter used to express an exogenous gene can be the promoter naturally linked to that gene or can be a heterologous promoter. Some promoters are active in more than one species of microalgae. Other promoters are species-specific. Illustrative promoters include promoters such as ⁇ -tubulin from Chlamydomonas reinhardtii, used in the Examples below,and viral promoters, such as cauliflower mosaic virus (CMV) and chlorella virus, which have been shown to be active in multiple species of microalgae (see for example Plant Cell Rep. 2005 Mar;23(10-l l):727-35; J Microbiol. 2005 Aug;43(4):361-5; Mar Biotechnol (NY).
- CMV cauliflower mosaic virus
- Another promoter that is suitable for use for expression of exogenous genes in Prototheca is the Chlorella sorokiniana glutamate dehydrogenase promoter/5 'UTR.
- the Chlorella sorokiniana glutamate dehydrogenase promoter/5 'UTR is the Chlorella sorokiniana glutamate dehydrogenase promoter/5 'UTR.
- at least 10, 20, 30, 40, 50, or 60 nucleotides or more of these sequences containing a promoter are used.
- Illustrative promoters useful for expression of exogenous genes in Prototheca are listed in the sequence listing of this application, such as the promoter of the Chlorella HUP1 gene (SEQ ID NO: l) and the Chlorella ellipsoidea nitrate reductase promoter (SEQ ID NO:2).
- Chlorella virus promoters can also be used to express genes in Prototheca, such as SEQ ID NOs: 1-7 of U.S. Patent 6,395,965. Additional promoters active in Prototheca can be found, for example, in Biochem Biophys Res
- a promoter can generally be characterized as either constitutive or inducible.
- Constitutive promoters are generally active or function to drive expression at all times (or at certain times in the cell life cycle) at the same level.
- Inducible promoters conversely, are active (or rendered inactive) or are significantly up- or down-regulated only in response to a stimulus. Both types of promoters find application in the methods of the invention.
- Inducible promoters useful in the invention include those that mediate transcription of an operably linked gene in response to a stimulus, such as an exogenously provided small molecule (e.g, glucose, as in SEQ ID NO: 1), temperature (heat or cold), lack of nitrogen in culture media, etc.
- Suitable promoters can activate transcription of an essentially silent gene or upregulate, preferably substantially, transcription of an operably linked gene that is transcribed at a low level. Examples below describe additional inducible promoters that are useful in Prototheca cells.
- termination region control sequence is optional, and if employed, then the choice is be primarily one of convenience, as the termination region is relatively interchangeable.
- the termination region may be native to the transcriptional initiation region (the promoter), may be native to the DNA sequence of interest, or may be obtainable from another source. See, for example, Chen and Orozco, Nucleic Acids Res. (1988) 16:8411.
- the present invention also provides control sequences and recombinant genes and vectors containing them that provide for the directing a gene product of interest to a particular cell compartment such as chloroplasts, plastids, mitochondria, or endoplasmic reticulum.
- embodiments of the present invention include control sequences and recombinant genes and vectors containing them that provide for the secretion of a protein outside the cell.
- Proteins expressed in the nuclear genome of Prototheca can be targeted to the plastid using plastid targeting signals.
- Plastid targeting sequences endogenous to Chlorella are known, such as genes in the Chlorella nuclear genome that encode proteins that are targeted to the plastid; see for example GenBank Accession numbers AY646197 and AF499684, and in one embodiment, such control sequences are used in the vectors of the present invention to target expression of a protein to a Prototheca plastid.
- the expression of a polypeptide in Prototheca is targeted to the endoplasmic reticulum.
- the inclusion of an appropriate retention or sorting signal in an expression vector ensure that proteins are retained in the endoplasmic reticulum (ER) and do not go downstream into Golgi.
- ER endoplasmic reticulum
- IMPACTVECTOR1.3 vector from Wageningen UR- Plant Research International, includes the well known KDEL retention or sorting signal. With this vector, ER retention has a practical advantage in that it has been reported to improve expression levels 5-fold or more. The main reason for this appears to be that the ER contains lower concentrations and/or different proteases responsible for post-translational degradation of expressed proteins than are present in the cytoplasm. ER retention signals functional in green microalgae are known. For example, see Proc Natl Acad Sci U S A. 2005 Apr 26;102(17):6225-30.
- a polypeptide is targeted for secretion outside the cell into the culture media. See Hawkins et al., Current Microbiology Vol. 38 (1999), pp. 335-341 for examples of secretion signals active in Chlorella that can be used, in accordance with the methods of the invention, in Prototheca.
- a gene typically includes a promoter, coding sequence, and termination control sequences.
- a gene When assembled by recombinant DNA technology, a gene may be termed an expression cassette and may be flanked by restriction sites for convenient insertion into a vector that is used to introduce the recombinant gene into a host cell.
- the expression cassette can be flanked by DNA sequences from the genome or other nucleic acid target to facilitate stable integration of the expression cassette into the genome by homologous recombination.
- the vector and its expression cassette may remain unintegrated ⁇ e.g., an episome), in which case, the vector typically includes an origin of replication, which is capable of providing for replication of the heterologous vector DNA.
- a common gene present on a vector is a gene that codes for a protein, the expression of which allows the recombinant cell containing the protein to be differentiated from cells that do not express the protein.
- a gene, and its corresponding gene product is called a selectable marker or selection marker.
- selectable markers Any of a wide variety of selectable markers can be employed in a transgene construct useful for transforming Prototheca. Examples of suitable selectable markers include the G418 resistance gene, the nitrate reductase gene (see Dawson et al. (1997), Current Microbiology 35:356-362), the hygromycin
- selectable markers that are not antibiotic-based can alsobe employed in a transgene construct useful for transforming microalgae in general, including Prototheca species. Genes that confers the ability to utilize certain carbon sources that were previously unable to be utilized by the microalgae can also be used as a selectable marker.
- Prototheca moriformis strains typically grow poorly, if at all, on sucrose. Using a construct containing a sucrose invertase gene can confer the ability of positive
- the expression vector used to prepare a recombinant host cell of the invention will include at least two, and often three, genes, if one of the genes is a selectable marker.
- a genetically engineered Prototheca of the invention can be made by transformation with vectors of the invention that comprise, in addition to a selectable marker, one or more exogenous genes, such as, for example, sucrose invertase gene or acyl ACP-thioesterase gene.
- One or both genes can be expressed using an inducible promoter, which allows the relative timing of expression of these genes to be controlled to enhance the lipid yield and conversion to fatty acid esters.
- Expression of the two or more exogenous genes may be under control of the same inducible promoter or under control of different inducible (or constitutive) promoters. In the latter situation, expression of a first exogenous gene can be induced for a first period of time (during which expression of a second exogenous gene may or may not be induced) and expression of a second exogenous gene can be induced for a second period of time (during which expression of a first exogenous gene may or may not be induced).
- the two or more exogenous genes are: a fatty acyl-ACP thioesterase and a fatty acyl- Co A/aldehyde reductase, the combined action of which yields an alcohol product.
- exogenous genes including without limitation, a fatty acyl-ACP thioesterase and a fatty acyl-CoA reductase to generate aldehydes.
- the vector provides for the combination of a fatty acyl-ACP thioesterase, a fatty acyl-CoA reductase, and a fatty aldehyde decarbonylase to generate alkanes.
- one or more of the exogenous genes can be expressed using an inducible promoter.
- Other illustrative vectors of the invention that express two or more exogenous genes include those encoding both a sucrose transporter and a sucrose invertase enzyme and those encoding both a selectable marker and a secreted sucrose invertase.
- the recombinant Prototheca transformed with either type of vector produce lipids at lower manufacturing cost due to the engineered ability to use sugar cane (and sugar cane-derived sugars) as a carbon source. Insertion of the two exogenous genes described above can be combined with the disruption of polysaccharide biosynthesis through directed and/or random mutagenesis, which steers ever greater carbon flux into lipid production.
- trophic conversion, engineering to alter lipid production and treatment with exogenous enzymes alter the lipid composition produced by a microorganism.
- the alteration can be a change in the amount of lipids produced, the amount of one or more hydrocarbon species produced relative to other lipids, and/or the types of lipid species produced in the
- microalgae can be engineered to produce a higher amount and/or percentage of TAGs (triacylglycerides).
- transgenic messenger RNA mRNA
- codon usage in the transgene is not optimized, available tRNA pools are not sufficient to allow for efficient translation of the heterologous mRNA resulting in ribosomal stalling and termination and possible instability of the transgenic mRNA.
- the present invention provides codon-optimized nucleic acids useful for the successful expression of recombinant proteins in Prototheca. Codon usage in Prototheca species was analyzed by studying cDNA sequences isolated from Prototheca moriformis. This analysis represents the interrogation over 24, 000 codons and resulted in Table 2 below.
- the gene in the recombinant vector has been codon- optimized with reference to a microalgal strain other than a Prototheca strain.
- a microalgal strain other than a Prototheca strain.
- methods of recoding genes for expression in microalgae are described in U.S. Patent 7,135,290. Additional information for codon optimization is available, e.g., at the codon usage database of GenBank.
- the optimized genes are preferably optimized so as to increase expression of the gene product of the gene being optimized by at least 10% and more preferably by at least 20, 40, 60, 80, 100, or 200%.
- the recombinant cell of the invention further contains one or more exogenous sucrose utilization genes.
- the one or more genes encode one or more proteins selected from the group consisting of a fructokinase, a glucokinase, a hexokinase, a sucrose invertase, a sucrose transporter.
- expression of a sucrose transporter and a sucrose invertase allows Prototheca to transport sucrose into the cell from the culture media and hydrolyze sucrose to yield glucose and fructose.
- a fructokinase can be expressed as well in instances where endogenous hexokinase activity is insufficient for maximum phosphorylation of fructose.
- suitable sucrose transporters are Genbank accession numbers CAD91334, CAB92307, and CAA53390.
- suitable fructokinases are Genbank accession numbers P26984, P26420 and CAA43322.
- the present invention provides a host cell that secretes a sucrose invertase.
- Secretion of a sucrose invertase obviates the need for expression of a transporter that can transport sucrose into the cell. This is because a secreted invertase catalyzes the conversion of a molecule of sucrose into a molecule of glucose and a molecule of fructose, both of which can be transported and utilized by microbes provided by the invention.
- sucrose invertase such as SEQ ID NO:3
- a secretion signal such as that of SEQ ID NO: 4 (from yeast), SEQ ID NO: 5 (from higher plants), SEQ ID NO: 6 (eukaryotic consensus secretion signal), and SEQ ID NO: 7 (combination of signal sequence from higher plants and eukaryotic consensus) generates invertase activity outside the cell.
- a secretion signal such as that of SEQ ID NO: 4 (from yeast), SEQ ID NO: 5 (from higher plants), SEQ ID NO: 6 (eukaryotic consensus secretion signal), and SEQ ID NO: 7 (combination of signal sequence from higher plants and eukaryotic consensus)
- Prototheca species expressing an invertase in media containing sucrose are a preferred microalgal species for the production of oil.
- the expression and extracellular targeting of this fully active protein allows the resulting host cells to grow on sucrose, whereas their non-transformed counterparts cannot.
- embodiments of the present invention provide recombinant microalgae (including Prototheca) cells with a codon- optimized invertase gene, including but not limited to the yeast invertase gene, integrated into their genome such that the invertase gene is expressed as assessed by invertase activity and sucrose hydrolysis.
- Invertase genes are useful as selectable markers in the recombinant cells, as such cells are able to grow on sucrose, while their non-transformed counterparts cannot; and methods for selecting recombinant host cells using an invertase as a powerful, selectable marker for algal molecular genetics.
- sucrose invertase in Prototheca also illustrates another aspect of the present invention in that it demonstrates that heterologous
- embodiments of the present invention provide methods and reagents for expressing a wide and diverse array of heterologous proteins in microalgae and secreting them outside of the host cell.
- proteins include, for example, industrial enzymes such as, for example, lipases, proteases, cellulases, pectinases, amylases, esterases, oxidoreductases, transferases, lactases, isomerases, and invertases, as well as therapeutic proteins such as, for example, growth factors, cytokines, full length antibodies comprising two light and two heavy chains, Fabs, scFvs (single chain variable fragment), camellid-type antibodies, antibody fragments, antibody fragment-fusions, antibody-receptor fusions, insulin, interferons, and insulin-like growth factors.
- industrial enzymes such as, for example, lipases, proteases, cellulases, pectinases, amylases, esterases, oxidoreductases,
- sucrose invertase in Prototheca also illustrates another aspect of the present invention in that it provides methods and reagents for the use of fungal transit peptides in algae to direct secretion of proteins in Prototheca; and methods and reagents for determining if a peptide can function, and the ability of it to function, as a transit peptide in Prototheca cells.
- the methods and reagents of the invention can be used as a tool and platform to identify other transit peptides that can successfully traffic proteins outside of a cell, and that the yeast invertase has great utility in these methods.
- sucrose invertases examples include those identified by Genbank accession numbers CAB95010, NP_012104 and CAA06839. Non-limiting examples of suitable invertases are listed below in Table 3. Amino acid sequences for each listed invertase are included in the Sequence Listing below.
- the exogenous sucrose utilization gene suitable for use in the methods and vectors of the invention encodes a sucrose invertase that has at least 40, 50, 60, 75, or 90% or higher amino acid identity with a sucrose invertase selected from Table 3.
- the secretion of an invertase to the culture medium by Prototheca enable the cells to grow as well on waste molasses from sugar cane processing as they do on pure reagent- grade glucose; the use of this low- value waste product of sugar cane processing can provide significant cost savings in the production of lipids and other oils.
- the present invention provides a microbial culture containing a population of Prototheca microorganisms, and a culture medium comprising (i) sucrose and (ii) a sucrose invertase enzyme.
- sucrose in the culture comes from sorghum, sugar beet, sugar cane, molasses, or depolymerized cellulosic material (which may optionally contain lignin).
- the methods and reagents of the invention significantly increase the number and type of feedstocks that can be utilized by recombinant microalgae or other microbes.
- microbes exemplified here are altered such that they can utilize sucrose
- the methods and reagents of the invention can be applied so that feedstocks such as cellulosics are utilizable by an engineered host microbe of the invention with the ability to secrete cellulases, pectinases, isomerases, or the like, such that the breakdown products of the enzymatic reactions are no longer just simply tolerated but rather utilized as a carbon source by the host.
- microbes engineered to express a secretable a-galactosidase conferring the ability to hydrolyze a- galactosyl bonds in oligosaccharides such as those contained in raffinose and stachyose which are two oligosaccharides found in agricultural waste streams.
- sucrose invertase confers the ability for Prototheca cells to more efficiently utilize sucrose as a carbon source (via the enzyme hydrolyzing the a-linkage between fructose and glucose molecules in the disaccharide sucrose)
- the expression of other enzymes that hydrolyze other types of a-linkages in oligosaccharides can confer the ability for Prototheca cells to utilize other carbon sources.
- the expression of these enzymes (and the resulting ability to utilize carbon sources that Prototheca and other microalgal cells ordinarily would not be able to) can be used as a selectable marker for these transgenic Prototheca cells by allowing for the selection of positive clones that are able to grow on these carbon sources.
- the recombinant Prototheca cell of the invention further contains one or more exogenous genes encoding polysaccharide-degrading enzymes.
- the one or more genes encoding a polysaccharide-degrading enzyme is a gene encoding a secreted a-galactosidase.
- the expression of an exogenous secreted a- galactosidase in a Prototheca cell confers the ability of such transformed strains to grow on sugars (carbon sources) containing D-galactosyl linkages, such as a-linkages between galactose and glucose monosaccharide units.
- Prototheca strains expressing an exogenous, secreted ⁇ -galactosidase will be able to utilize disaccharides such as melibiose (disaccharide composed of a-D-galactose-glucose).
- Sugars such as raffinose (a trisaccharide comprised of a-linked galactose-glucose- fructose) and stachyose (a tetrasaccharide composed to two a-linked D-galactose units, followed by ⁇ -linked glucose and fructose) are present in significant proportions in agricultural waste streams such as beet pulp (raffinose) and soybean meal (stachyose).
- Such agricultural residues represent a significant untapped carbon source for the conversion into oil by microbes (including Prototheca) capable of utilizing them.
- Prototheca strains are unable to utilize oligosaccharides such as raffinose and stachyose in any significant quantity or at all.
- oligosaccharides such as raffinose and stachyose
- transgenic strains expressing a sucrose invertase as described above have the ability to hydrolyze the a-linkage between fructose and glucose in a-galactosyl derivatives of sucrose, but the remainder of the oligosaccharide remains unutilized, as sucrose invertase will not cleave the remaining a-linkages in such sugars and the resulting disaccharides are not utilizable.
- the recombinant Prototheca cell of the invention comprises both an exogenous gene encoding a sucrose invertase and an exogenous gene encoding an a-galactosidase.
- strains expressing both a sucrose invertase and an a- galactosidase will be capable of fully hydrolyzing oligosaccharides such as raffinose and stachyose, enabling the consumption of the component monomers.
- a- galactosidase encoding genes may be used as a selectable marker for transformation. Clones containing the the exogenous a-galactosidase gene will have the ability to grow on melibiose.
- the Examples below demonstrates the ability of transgenic Prototheca cells to grow on melibiose when transformed with codon-optimized MEL1 gene from S. carlbergensis and the AglC gene from A. niger, but not an ⁇ -galactosidase encoding gene from the higher plant,
- Cyamopsis tetragonobola (Guar bean).
- Prototheca strains including Prototheca moriformis are known to be thiamine auxotrophic (See, for example, Ciferri, O. (1956) Nature, v.178, pp. 1475-1476), meaning that these strains require thiamine in the nutrient media for growth.
- Thiamine auxotrophy can be the result of mutations or lack of expression of enzymes in the thiamine biosynthetic pathway.
- Complemented transgenic strains expressing the missing enzyme(s) in the thiamine biosynthetic pathway can then be grown without added thiamine, thus reducing the cost of the nutrient media as well as rendering the resulting microalgal biomass more desireable for use as an animal feed.
- Complementation with a thiamine biosynthetic pathway enzyme can also be used as a selectable marker as the transgenic gene confers the ability to grow on plates/media that does not contain thiamine.
- the recombinant Prototheca cell of the invention further contains one or more exogenous genes encoding thiamine biosynthetic pathway enzyme.
- the recombinant Prototheca cell of the invention comprises an exogenous gene encoding hydroxymethylpyrimidine phosphate synthases from algal, plant or cyanobacterial sources.
- the hydroxymethylpyrimidine phosphate synthase is encoded by a THIC gene.
- the THIC gene the Coccomyxa C-169 THIC, Arabidopsis thaliana THIC, or the Synechocystis sp. PCC 6803 thiC.
- the present invention also provides recombinant microalgae or other microbes that have been modified to alter the properties and/or proportions of lipids produced.
- the pathway can further, or alternatively, be modified to alter the properties and/or proportions of various lipid molecules produced through enzymatic processing of lipids and intermediates in the fatty acid pathway.
- the recombinant Prototheca cells of the invention have, relative to their untransformed counterparts, optimized lipid yield per unit volume and/or per unit time, carbon chain length (e.g., for renewable diesel production or for industrial chemicals applications requiring lipid feedstock), reduced or increased number and/or position of double bonds, optionally to zero, hydroxylation of fatty acids, and increasing the
- one or more key enzymes that control branch points in metabolism to fatty acid synthesis have been up-regulated or down-regulated to improve lipid production.
- Up-regulation can be achieved, for example, by transforming cells with expression constructs in which a gene encoding the enzyme of interest is expressed, e.g., using a strong promoter and/or enhancer elements that increase transcription.
- Such constructs can include a selectable marker such that the transformants can be subjected to selection, which can result in gene maintainance, and possibly amplification of the construct and an increase in the expression level of the encoded enzyme.
- Examples of enzymes suitable for up-regulation according to the methods of the invention include pyruvate dehydrogenase, which plays a role in converting pyruvate to acetyl-CoA (examples, some from microalgae, include Genbank accession numbers NP_415392; AAA53047; Q1XDM1; and CAF05587).
- Up-regulation of pyruvate dehydrogenase can increase production of acetyl-CoA, and thereby increase fatty acid synthesis.
- Acetyl-CoA carboxylase catalyzes the initial step in fatty acid synthesis. Accordingly, this enzyme can be up-regulated to increase production of fatty acids (examples, some from microalgae, include Genbank accession numbers BAA94752;
- Fatty acid production can also be increased by up-regulation of acyl carrier protein (ACP), which carries the growing acyl chains during fatty acid synthesis (examples, some from microalgae, include Genbank accession numbers A0T0F8; P51280; NP_849041 ; YP_874433).
- ACP acyl carrier protein
- Glycerol-3- phosphate acyltransferase catalyzes the rate-limiting step of fatty acid synthesis. Up- regulation of this enzyme can increase fatty acid production (examples, some from microalgae, include Genbank accession numbers AAA74319; AAA33122; AAA37647; P44857; and AB094442).
- Up- and/or down-regulation of genes can be applied to global regulators controlling the expression of the genes of the fatty acid biosynthetic pathways. Accordingly, one or more global regulators of fatty acid synthesis can be up- or down-regulated, as appropriate, to inhibit or enhance, respectively, the expression of a plurality of fatty acid synthetic genes and, ultimately, to increase lipid production. Examples include sterol regulatory element binding proteins (SREBPs), such as SREBP-la and SREBP-lc (for examples see Genbank accession numbers NP_035610 and Q9WTN3).
- SREBPs sterol regulatory element binding proteins
- the present invention also provides recombinant Prototheca cells that have been modified to contain one or more exogenous genes encoding lipid modification enzymes such as, for example, fatty acyl-ACP thioesterases (see Table 4), fatty acyl- Co A/aldehyde reductases (see Table 6), fatty acyl-CoA reductases (see Table 7), fatty aldehyde
- lipid modification enzymes such as, for example, fatty acyl-ACP thioesterases (see Table 4), fatty acyl- Co A/aldehyde reductases (see Table 6), fatty acyl-CoA reductases (see Table 7), fatty aldehyde
- fatty acyl-ACP thioesterases typically do not directly chemically modify the lipids, their manipulation in accordance with embodiments of the invention can alter the fatty acid profile of a cell, especially in terms of chain length and double bond distribution.
- genes encoding a fatty acyl-ACP thioesterase and a naturally co-expressed acyl carrier protein are transformed into a
- Prototheca or other microalgal or microbial cell optionally with one or more genes encoding other lipid modification enzymes.
- the ACP and the fatty acyl-ACP thioesterase may have an affinity for one another that imparts an advantage when the two are used together in the microbes and methods of the present invention, irrespective of whether they are or are not naturally co-expressed in a particular tissue or organism.
- embodiments of the present invention contemplate both naturally co-expressed pairs of these enzymes as well as those that share an affinity for interacting with one another to facilitate cleavage of a length-specific carbon chain from the ACP.
- an exogenous gene encoding a desaturase is transformed into the microalgal or other microbial cell in conjunction with one or more genes encoding other lipid modification enzymes to provide modifications with respect to lipid saturation.
- an endogenous desaturase gene is overexpressed (e.g., through the introduction of additonal copies off the gene) in a microalgal or other microbial cell.
- Stearoyl-ACP desaturase (see, e.g., GenBank Accession numbers AAF15308; ABM45911 ; and AAY86086), for example, catalyzes the conversion of stearoyl-ACP to oleoyl-ACP. Up- regulation of this gene can increase the proportion of monounsaturated fatty acids produced by a cell; whereas down-regulation can reduce the proportion of monounsaturates.
- SAD stearoyl-ACP desaturases
- FAD fatty acyl desaturases
- delta 12 fatty acid desaturases are responsible for the synthesis of C18:2 fatty acids from C18: l precursors.
- the expression of one or more glycerolipid desaturases can be controlled to alter the ratio of unsaturated to saturated fatty acids such as ⁇ -6 fatty acid desaturase, ⁇ -3 fatty acid desaturase, or ⁇ -6-oleate desaturase.
- the desaturase can be selected with reference to a desired carbon chain length, such that the desaturase is capable of making location specific modifications within a specified carbon- length substrate, or substrates having a carbon- length within a specified range.
- the desired fatty acid profile is an increase in monounsaturates (such as CI 6: 1 and/or C18: l) overexpression of a SAD or expression of a heterologous SAD can be coupled with the silencing or inactivation (e.g., through mutation, RNAi, antisense, or knockout of an endogenous desaturase gene, etc.) of a fatty acyl desaturase (FAD) or another desaturase gene.
- FAD fatty acyl desaturase
- the microalgal or other microbial cell has been modified to have a mutated endogenous desaturase gene, wherein the mutation renders the gene or desaturase enzyme inactive.
- the mutated endogenous desaturase gene is a fatty acid desaturase (FAD).
- the mutated endogenous desaturase gene is a stearoyl Acyl carrier protein desaturase (SAD).
- SAD stearoyl Acyl carrier protein desaturase
- Example 6 below describes the targeted ablation or knockout of stearoyl- ACP desaturases and delta 12 fatty acid desaturases in Prototheca.
- Example 6 also describes the use of RNAi or antisense constructs to decrease the expression of an endogenous desaturase gene.
- a microalgal or other microbial cell comprises a mutated endogenous desaturase gene and one or more exogenous gene.
- a microalgal or other microbial cell with a mutated endogenous desaturase gene can also express an exogenous fatty acyl-ACP thioesterase gene and/or a sucrose invertase gene.
- Example 6 describes a transgenic Prototheca cell containing a targeted ablation or knockout of an endogenous SAD and also expresses a Cinnamomum camphora CI 4- preferring thioesterase and a sucrose invertase.
- the transgenic Prototheca cell produces a lipid profile that closely approximates the lipid profile found in tallow.
- Tallow is typically derived from rendered beef or mutton fat, is solid at room temperature and is utilized in a variety of applications in the food, cosmetics, and chemicals industries.
- the fatty acid profile of tallow is: 4% C14:0; 26% C16:0; 3% C16: l; 14% C18:0; 41% C18: l; 3% C18:2; and 1% C18:3.
- Example 6 clones of transgenic Prototheca cells with a targeted ablation or knockout of an endogenous SAD and expressing a C.
- camphora C14-pref erring thioesterase have lipid profiles of: less than 1% C12 and shorter carbon chain length fatty acids; 2.74% to 6.13% C14:0; 23.07% to 25.69% C16:0; 7.02% to 11.08% C18:0; 42.03% to 51.21% C18: l; and 9.37% to 13.45% C18:2 (expressed in area percent).
- the transgenic Prototheca cells have lipid profiles of: 3-5% C14:0; 25-27% C16:0; 10-15% C18:0; and 40-45% C18: l.
- microbes of the present invention are genetically engineered to express one or more exogenous genes selected from an acyl-ACP thioesterase, an acyl- Co A/aldehyde reductase, a fatty acyl-CoA reductase, a fatty aldehyde reductase, a fatty aldehyde decarbonylase, or a naturally co-expressed acyl carrier protein.
- exogenous genes selected from an acyl-ACP thioesterase, an acyl- Co A/aldehyde reductase, a fatty acyl-CoA reductase, a fatty aldehyde reductase, a fatty aldehyde decarbonylase, or a naturally co-expressed acyl carrier protein.
- Suitable expression methods are described above with respect to the expression of a lipase gene, including, among other methods, inducible expression and compartmentalized expression.
- a fatty acyl-ACP thioesterase cleaves a fatty acid from an acyl carrier protein (ACP) during lipid synthesis. Through further enzymatic processing, the cleaved fatty acid is then combined with a coenzyme to yield an acyl-CoA molecule.
- This acyl-CoA is the substrate for the enzymatic activity of a fatty acyl-CoA reductase to yield an aldehyde, as well as for a fatty acyl- Co A/aldehyde reductase to yield an alcohol.
- the aldehyde produced by the action of the fatty acyl-CoA reductase identified above is the substrate for further enzymatic activity by either a fatty aldehyde reductase to yield an alcohol, or a fatty aldehyde decarbonylase to yield an alkane or alkene.
- fatty acids, glycerolipids, or the corresponding primary alcohols, aldehydes, alkanes or alkenes, generated by the methods described herein contain 8, 10, 12,or 14 carbon atoms.
- Preferred fatty acids for the production of diesel, biodiesel, renewable diesel, or jet fuel, or the corresponding primary alcohols, aldehydes, alkanes and alkenes, for industrial applications contain 8 to 14 carbon atoms.
- the above fatty acids, as well as the other corresponding hydrocarbon molecules are saturated (with no carbon-carbon double or triple bonds); mono unsaturated (single double bond); poly unsturated (two or more double bonds); are linear (not cyclic) or branched. For fuel production, greater saturation is preferred.
- the enzymes described directly above have a preferential specificity for hydrolysis of a substrate containing a specific number of carbon atoms.
- a fatty acyl-ACP thioesterase may have a preference for cleaving a fatty acid having 12 carbon atoms from the ACP.
- the ACP and the length-specific thioesterase may have an affinity for one another that makes them particularly useful as a combination (e.g., the exogenous ACP and thioesterase genes may be naturally co-expressed in a particular tissue or organism from which they are derived).
- the recombinant Prototheca cell of the invention can contain an exogenous gene that encodes a protein with specificity for catalyzing an enzymatic activity (e.g., cleavage of a fatty acid from an ACP, reduction of an acyl-CoA to an aldehyde or an alcohol, or conversion of an aldehyde to an alkane) with regard to the number of carbon atoms contained in the substrate.
- the enzymatic specificity can, in various embodiments, be for a substrate having from 8 to 34 carbon atoms, preferably from 8 to 18 carbon atoms, and more preferably from 8 to 14 carbon atoms.
- a preferred specificity is for a substrate having fewer, i.e., 12, rather than more, i.e., 18, carbon atoms.
- fatty acyl-ACP thioesterases suitable for use with the microbes and methods of the invention include, without limitation, those listed in Table 4. [0238] Table 4. Fatty acyl-ACP thioesterases and GenBank accession numbers.
- Cinnamomum camphora fatty acyl-ACP thioesterase (GenBank #Q39473)
- Arabidopsis thaliana fatty acyl-ACP thioesterase (GenBank #NP_172327)
- Arabidopsis thaliana fatty acyl-ACP thioesterase (GenBank #CAA85387)
- Arabidopsis thaliana fatty acyl-ACP thioesterase (GenBank #CAA85388)
- Cuphea lanceolata fatty acyl-ACP thioesterase (GenBank #CAA54060)
- Cuphea hookeriana fatty acyl-ACP thioesterase (GenBank #AAC72882)
- Cuphea calophylla subsp. mesostemon fatty acyl-ACP thioesterase (GenBank
- Cuphea lanceolata fatty acyl-ACP thioesterase (GenBank #CAC19933)
- Cuphea hookeriana fatty acyl-ACP thioesterase (GenBank #Q39513)
- Cuphea hookeriana fatty acyl-ACP thioesterase (GenBank#Q39513.1)
- Vitis vinifera fatty acyl-ACP thioesterase GenBank #CAN81819)
- Garcinia mangostana fatty acyl-ACP thioestease GenBank#AAB 51525.1
- Brassica juncea fatty acyl-ACP thioesterase (GenBank #ABI18986)
- Brassica napus fatty acyl-ACP thioesterase (GenBank #ABH11710)
- Brassica napus fatty acyl-ACP thioesterase (GenBank#CAA52070.1)
- Oryza sativa indica cultivar-group fatty acyl-ACP thioesterase (GenBank #EAY86877)
- Oryza sativa japonica cultivar-group fatty acyl-ACP thioesterase (GenBank
- Oryza sativa indica cultivar-group fatty acyl-ACP thioesterase (GenBank #EAY99617)
- Cuphea hookeriana fatty acyl-ACP thioesterase (GenBank #AAC49269)
- Cuphea lanceolata fatty acyl-ACP thioesterase (GenBank #CAB60830)
- Cuphea palustris fatty acyl-ACP thioesterase (GenBank #AAC49180)
- Iris germanica fatty acyl-ACP thioesterase GenBank #AAG43858
- Iris germanica fatty acyl-ACP thioesterase GenBank #AAG43858.1
- Cuphea palustris fatty acyl-ACP thioesterase (GenBank #AAC49179)
- Myristica fragrans fatty acyl-ACP thioesterase (GenBank# AAB71729)
- Cuphea hookeriana fatty acyl-ACP thioesterase (GenBank #U39834)
- Cinnamomum camphora fatty acyl-ACP thioesterase GenBank #U318173
- Ricinus communis fatty acyl-ACP thioesterase (GenBank#ABS30422.1) [0239] Examples below describe the successful targeting and expression of heterologous fatty acyl-ACP thioesterases from Cuphea hookeriana, Umbellularia californica,
- Table 5 shows the fatty acid profiles of common commercial seed oils. All commercial seed oil data below were compiled from the US Pharmacopeias Food and Chemicals Codes, 7 th Ed. 2010-2011. Tallow data is from the National Research Council: Fat Content and Composition of Animal Products (1976).
- Palm oil is the highest C16:0 fatty acid (32-47%) containing oil, but palm oil has very little C14:0 fatty acids.
- Prototheca containing the U. americana thioesterase achieved about 33-38% C16:0 fatty acids and about a 10-16% C14:0 fatty acids (about a 2: 1 C16:0 to C14:0 ratio).
- This fatty acid profile has been commercially impractical through blending of existing oils at a commercial level because the seed oils that are high in 16:0 fatty acids usually do not contain much 14:0 fatty acids.
- Palm oil is currently the largest source of saturated oil, with a total saturates to unsaturates of 52% to 48%.
- Prototheca with heterologous thioesterases from U. americana and C. camphora achieved total saturates levels of over 60% in the oil that it produced.
- Prototheca with heterologous thioesterase from U. americana achieved total saturates level of over 86% in the oil that it produced.
- Fatty acyl- Co A/aldehyde reductases suitable for use with the microbes and methods of the invention include, without limitation, those listed in Table 6.
- Fatty acyl-CoA reductases suitable for use with the microbes and methods of the invention include, without limitation, those listed in Table 7.
- NP_187805 AB014927
- NP_001049083 CAN83375
- NP_191229 EAZ42242
- Fatty aldehyde decarbonylases suitable for use with the microbes and methods of the invention include, without limitation, those listed in Table 8.
- hydrocarbon or lipid modification enzymes include amino acid sequences contained in, referenced in, or encoded by nucleic acid sequences contained or referenced in, any of the following US patents: 6,610,527; 6,451,576; 6,429,014;
- Kas keto acyl-ACP synthase
- Kas II typically participates in the final condensation step leading from C16:0-ACP to C18:0-ACP incorporating malonyl-ACP.
- Kas II enzymes interact with products of FatA genes (acyl-ACP thioesterases).
- Acyl-ACP liberate growing fatty acid chains from ACP during fatty acid biosynthesis, and in most plant species, this is carried out by members of the FatA gene family, whose role is to terminate elongation at the C16:0 to C18:0 stage. In species that synthesize shorter chain fatty acids (such as Cuphea, Elaeis, Myristica, or Umbellularia), a different group of acyl-ACP thioesterases encoded by FatB genes carry out this termination step. The interaction between Kas II enzymes and acyl-Acp thioesterases is important for the correct termination of fatty acid chain elongation.
- Kas IV genes are responsible for chain length elongation of a specific size range of fatty acids, 4-14 carbons in length.
- Suitable enzymes for use with the microbes and the methods of the invention include those that have at least 70% amino acid identity with one of the proteins listed in Tables 4, 6-8, and that exhibit the corresponding desired enzymatic activity (e.g., cleavage of a fatty acid from an acyl carrier protein, reduction of an acyl-CoA to an aldehyde or an alcohol, or conversion of an aldehyde to an alkane).
- the enzymatic activity is present in a sequence that has at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or at least about 99% identity with one of the above described sequences, all of which are hereby incorporated by reference as if fully set forth.
- the microbe can contain one or more of (i) an exogenous gene encoding a fatty acyl-ACP thioesterase; and, optionally, (ii) a naturally co-expressed acyl carrier protein or an acyl carrier protein otherwise having affinity for the fatty acyl-ACP thioesterase (or conversely); and, optionally, (iii) an exogenous gene encoding a fatty acyl- Co A/aldehyde reductase or a fatty acyl-CoA reductase; and, optionally, (iv) an exogenous gene encoding a fatty aldehyde reductase or a fatty aldehyde decarbonylase.
- the microbe can also contain one or more of an exogenous stearoil ACP desturase, fatty acid destaurase, ⁇ - ketoacyl-ACP synthase I (e.g. as encoded by a KASI gene), a ⁇ -ketoacyl-ACP synthase II (e.g. as encoded by a KASII gene), or oleate- 12 hydroxylase.
- the microbe under culture conditions described herein, synthesizes a fatty acid linked to an ACP and the fatty acyl-ACP thioesterase catalyzes the cleavage of the fatty acid from the ACP to yield, through further enzymatic processing, a fatty acyl-CoA molecule.
- the fatty acyl-CoA/aldehyde reducatase catalyzes the reduction of the acyl-CoA to an alcohol.
- the fatty acyl- CoA reductase when present, catalyzes the reduction of the acyl-CoA to an aldehyde.
- a fatty aldehyde reductase encoded by the third exogenous gene, catalyzes the reduction of the aldehyde to an alcohol.
- a fatty aldehyde decarbonylase catalyzes the conversion of the aldehyde to an alkane or an alkene, when present.
- the microbe can contain: (i) an exogenous gene encoding a fatty acyl-ACP thioesterase; (ii) optionally, a naturally co-expressed acyl carrier protein or an acyl carrier protein having affinity for the fatty acid acyl-ACP thioesterase; (iii) a mutated endogenous desaturase gene, wherein the mutation renders the desaturase gene or desaturase protein inactive, such as a desaturase knockout or a a desturase suppression element such as a targeted RNAi, antisense or dsRNA construct; (iv) overexpression of an endogenous stearoyl acyl carrier protein desaturase or the expression of a heterologous SAD; and (v) any combination of the foregoing.
- Genes encoding such enzymes can be obtained from cells already known to exhibit significant lipid production such as Chlorella protothec oides. Genes already known to have a role in lipid production, e.g., a gene encoding an enzyme that saturates double bonds, can be transformed individually into recipient cells. However, to practice the invention it is not necessary to make a priori assumptions as to which genes are required. Methods for identifiying genes that can alter (improve) lipid production in microalgae are described in PCT Pub. No.2008/151149.
- the present invention provides a Prototheca cell that has been genetically engineered to express a lipid pathway enzyme at an altered level compared to a wild-type cell of the same species.
- the cell produces more lipid compared to the wild-type cell when both cells are grown under the same conditions.
- the cell has been genetically engineered and/or selected to express a lipid pathway enzyme at a higher level or a lower level than the wild-type cell.
- the lipid pathway enzyme is selected from the group consisting of pyruvate dehydrogenase, acetyl-CoA carboxylase, acyl carrier protein, and glycerol-3 phosphate acyltransferase.
- the cell has been genetically engineered and/or selected to express a lipid pathway enzyme at a lower level than the wild-type cell.
- the lipid pathway enzyme comprises citrate synthase.
- the cell has been genetically engineered and/or selected to express a global regulator of fatty acid synthesis at an altered level compared to the wild-type cell, whereby the expression levels of a plurality of fatty acid synthetic genes are altered compared to the wild-type cell.
- the lipid pathway enzyme comprises an enzyme that modifies a fatty acid.
- the lipid pathway enzyme is selected from a stearoyl-ACP desaturase and a glycerolipid desaturase.
- the cell has been genetically engineered and/or selected to express a lower level of a lipid pathway enzyme, or not to express a specific lipid pathway enzyme at all (i.e., wherein a lipid pathway enzyme has been knockout, replaced with an exogenous gene, or expression has been reduced using RNAi or antisense methods).
- the lipid pathway enzyme is the heterologous expression of a desaturase gene, including but not limited to a stearoyl-ACP desaturase or a fatty acid desaturase (FAD).
- FAD fatty acid desaturase
- Example 6 describes the expression of a heterologous stearoyl-ACP from Olea europaea in a Prototheca moriformis genetic background.
- the present invention is directed to an oil-producing microbe containing one or more exogenous genes, wherein the exogenous genes encode protein(s) selected from the group consisting of a fatty acyl-ACP thioesterase, a fatty acyl-CoA reductase, a fatty aldehyde reductase, a fatty acyl- Co A/aldehyde reductase, a fatty aldehyde decarbonylase, a desaturase, and an acyl carrier protein.
- an endogenous desaturase gene is overexpressed in a microbe containing one or more of the above exogenous genes.
- the exogenous gene is in operable linkage with a promoter, which is inducible or repressible in response to a stimulus.
- the stimulus is selected from the group consisting of an exogenously provided small molecule, heat, cold, and limited or no nitrogen in the culture media.
- the exogenous gene is expressed in a cellular compartment.
- the cellular compartment is selected from the group consisting of a chloroplast, a plastid and a mitochondrion.
- the microbe is Prototheca moriformis, Prototheca krugani, Prototheca stagnora or Prototheca zopfii.
- the exogenous gene encodes a fatty acid acyl-ACP thioesterase.
- the thioesterase encoded by the exogenous gene catalyzes the cleavage of an 8 to 18-carbon fatty acid from an acyl carrier protein (ACP).
- ACP acyl carrier protein
- the thioesterase encoded by the exogenous gene catalyzes the cleavage of a 10 to 14-carbon fatty acid from an ACP.
- the thioesterase encoded by the exogenous gene catalyzes the cleavage of a 12-carbon fatty acid from an ACP.
- the exogenous gene encodes a fatty acyl-CoA/aldehyde reductase.
- the reductase encoded by the exogenous gene catalyzes the reduction of an 8 to 18-carbon fatty acyl-CoA to a corresponding primary alcohol.
- the reductase encoded by the exogenous gene catalyzes the reduction of a 10 to 14- carbon fatty acyl-CoA to a corresponding primary alcohol.
- the reductase encoded by the exogenous gene catalyzes the reduction of a 12-carbon fatty acyl-CoA to dodecanol.
- the present invention also provides a recombinant Prototheca or other cell containing two exogenous genes, wherein a first exogenous gene encodes a fatty acyl-ACP thioesterase and a second exogenous gene encodes a protein selected from the group consisting of a fatty acyl-CoA reductase, a fatty acyl- Co A/aldehyde reductase, and an acyl carrier protein.
- the two exogenous genes are each in operable linkage with a promoter, which is inducible in response to a stimulus.
- each promoter is inducible in response to an identical stimulus, such as limited or no nitrogen in the culture media.
- the lipid as a percentage of dry cell weight can be pushed to high levels such as at least 30%, at least 40%, at least 50%, at least 60%, at least 70% at least 75%, at least 80%, at least 85% or between 75 to 90%; methods disclosed herein provide for cells with these levels of lipid, wherein the lipid is at least 4% C8-C14, at least 0.3% C8, at least 2% CIO, at least 2% C12, and at least 2% C14.
- the cells are over 25% lipid by dry cell weight and contain lipid that is at least 10% C8-C14, at least 20% C8-C14, at least 30% C8-C14, 10-30% C8-C14 and 20-30% C8-C14.
- novel oils disclosed herein are distinct from other naturally occurring oils that are high in mid-chain fatty acids, such as palm oil, palm kernel oil, and coconut oil.
- levels of contaminants such as carotenoids are far higher in palm oil and palm kernel oil than in the oils of the invention.
- Palm and palm kernel oils in particular contain alpha and beta carotenes and lycopene in much higher amounts than is in the oils of the invention.
- over 20 different carotenoids are found in palm and palm kernel oil, whereas the Examples demonstrate that the oils of the invention contain very few carotenoids species and very low levels.
- the levels of vitamin E compounds such as tocotrienols are far higher in palm, palm kernel, and coconut oil than in the oils of the invention.
- the thioesterase encoded by the first exogenous gene catalyzes the cleavage of an 8 to 18-carbon fatty acid from an ACP.
- the second exogenous gene encodes a fatty acyl- Co A/aldehyde reductase which catalyzes the reduction of an 8 to 18-carbon fatty acyl-CoA to a corresponding primary alcohol.
- the thioesterase encoded by the first exogenous gene catalyzes the cleavage of a 10 to 14-carbon fatty acid from an ACP
- the reductase encoded by the second exogenous gene catalyzes the reduction of a 10 to 14-carbon fatty acyl-CoA to the corresponding primary alcohol, wherein the thioesterase and the reductase act on the same carbon chain length.
- the thioesterase encoded by the first exogenous gene catalyzes the cleavage of a 12-carbon fatty acid from an ACP
- the reductase encoded by the second exogenous gene catalyzes the reduction of a 12-carbon fatty acyl-CoA to dodecanol
- the second exogenous gene encodes a fatty acyl-CoA reductase which catalyzes the reduction of an 8 to 18-carbon fatty acyl-CoA to a corresponding aldehyde.
- the second exogenous gene encodes an acyl carrier protein that is naturally co-expressed with the fatty acyl-ACP thioesterase.
- the second exogenous gene encodes a fatty acyl-CoA reductase
- the microbe further contains a third exogenous gene encoding a fatty aldehyde decarbonylase.
- the thioesterase encoded by the first exogenous gene catalyzes the cleavage of an 8 to 18-carbon fatty acid from an ACP
- the reductase encoded by the second exogenous gene catalyzes the reduction of an 8 to 18-carbon fatty acyl-CoA to a corresponding fatty aldehyde
- the decarbonylase encoded by the third exogenous gene catalyzes the conversion of an 8 to 18-carbon fatty aldehyde to a corresponding alkane, wherein the thioesterase, the reductase, and the decarbonylase act on the same carbon chain length.
- the second exogenous gene encodes an acyl carrier protein
- the microbe further contains a third exogenous gene encoding a protein selected from the group consisting of a fatty acyl-CoA reductase and a fatty acyl- Co A/aldehyde reductase.
- the third exogenous gene encodes a fatty acyl-CoA reductase
- the microbe further contains a fourth exogenous gene encoding a fatty aldehyde decarbonylase.
- the present invention also provides methods for producing an alcohol comprising culturing a population of recombinant Prototheca cells in a culture medium, wherein the cells contain (i) a first exogenous gene encoding a fatty acyl- ACP thioesterase, and (ii) a second exogenous gene encoding a fatty acyl-Co A/aldehyde reductase, and the cells synthesize a fatty acid linked to an acyl carrier protein (ACP), the fatty acyl- ACP thioesterase catalyzes the cleavage of the fatty acid from the ACP to yield, through further processing, a fatty acyl- CoA, and the fatty acyl- Co A/aldehyde reductase catalyzes the reduction of the acyl-CoA to an alcohol.
- ACP acyl carrier protein
- the present invention also provides methods of producing a lipid molecule in a Prototheca cell.
- the method comprises culturing a population of Prototheca cells in a culture medium, wherein the cells contain (i) a first exogenous gene encoding a fatty acyl- ACP thioesterase, and (ii) a second exogenous gene encoding a fatty acyl-CoA reductase, and wherein the microbes synthesize a fatty acid linked to an acyl carrier protein (ACP), the fatty acyl- ACP thioesterase catalyzes the cleavage of the fatty acid from the ACP to yield, through further processing, a fatty acyl-Co A, and the fatty acyl-CoA reductase catalyzes the reduction of the acyl- Co A to an aldehyde.
- ACP acyl carrier protein
- the present invention also provides methods of producing a fatty acid molecule having a specified carbon chain length in a Prototheca cell.
- the method comprises culturing a population of lipid-producing Prototheca cells in a culture medium, wherein the microbes contain an exogenous gene encoding a fatty acyl- ACP thioesterase having an activity specific or preferential to a certain carbon chain length, such as 8, 10, 12 or 14 carbon atoms, and wherein the microbes synthesize a fatty acid linked to an acyl carrier protein (ACP) and the thioesterase catalyzes the cleavage of the fatty acid from the ACP when the fatty acid has been synthesized to the specific carbon chain length.
- ACP acyl carrier protein
- the Prototheca cell can contain at least one exogenous gene encoding a lipid pathway enzyme or a suppression element such as an RNA interference element that suppresses expression of the gene product.
- the lipid pathway enzyme is selected from the group consisting of a stearoyl-ACP desaturase, a glycerolipid desaturase, a pyruvate dehydrogenase, an acetyl-CoA carboxylase, an acyl carrier protein, and a glycerol-3 phosphate acyltransferase.
- the Prototheca cell contains a lipid modification enzyme selected from the group consisting of a fatty acyl- ACP thioesterase, a fatty acyl-Co A/aldehyde reductase, a fatty acyl-CoA reductase, a fatty aldehyde reductase, a fatty aldehyde decarbonylase, and/or an acyl carrier protein.
- a lipid modification enzyme selected from the group consisting of a fatty acyl- ACP thioesterase, a fatty acyl-Co A/aldehyde reductase, a fatty acyl-CoA reductase, a fatty aldehyde reductase, a fatty aldehyde decarbonylase, and/or an acyl carrier protein.
- the present invention also provides for a microbial cell that contains a heterologous gene that encodes a hydroxylase that generates a hydroxylated fatty acid.
- the microbial cell may comprise a type II fatty acid synthesis pathway.
- the microbial cell may be a microalgal cell.
- the microalgal cell is selected from the microalgal cells listed in Table 1 above.
- the microalgal cell is of the genus Prototheca.
- the microalgal cell is Prototheca moriformis.
- Hydroxylases are enzymes that adds a hydroxyl group (-OH) onto a substrate.
- Fatty acid hydroxylases are naturally occurring enzymes found in some higher plants.
- a non- limiting example of a naturally occurring hydroxylase found in a higher plant is the oleate 12- hydroxylase from Ricinus communis which is responsible for the production of ricinoleic acid.
- Example 7 describes an example of the heterologous expression of a hydroxylase in Prototheca cells, specifically, the expression of Ricinus communis oleate 12-hydroxlase in Prototheca moriformis cells.
- lipids produced by cells of the invention are harvested, or otherwise collected, by any convenient means.
- Lipids can be isolated by whole cell extraction. The cells are first disrupted, and then intracellular and cell membrane/cell wall- associated lipids as well as extracellular hydrocarbons can be separated from the cell mass, such as by use of centrifugation as described above.
- Intracellular lipids produced in microorganisms are, in some embodiments, extracted after lysing the cells of the microorganism. Once extracted, the lipids are further refined to produce oils, fuels, or oleochemicals.
- the microorganisms can be separated from the fermentation broth.
- the separation is effected by centrifugation to generate a concentrated paste. Centrifugation does not remove significant amounts of intracellular water from the microorganisms and is not a drying step.
- the biomass can then optionally be washed with a washing solution (e.g., DI water) to get rid of the fermentation broth and debris.
- a washing solution e.g., DI water
- the washed microbial biomass may also be dried (oven dried, lyophilized, etc.) prior to cell disruption.
- cells can be lysed without separation from some or all of the fermentation broth when the fermentation is complete.
- the cells can be at a ratio of less than 1 : 1 v:v cells to extracellular liquid when the cells are lysed.
- Microorganisms containing a lipid can be lysed to produce a lysate.
- the step of lysing a microorganism can be achieved by any convenient means, including heat-induced lysis, adding a base, adding an acid, using enzymes such as proteases and polysaccharide degradation enzymes such as amylases, using ultrasound, mechanical lysis, using osmotic shock, infection with a lytic virus, and/or expression of one or more lytic genes. Lysis is performed to release intracellular molecules which have been produced by the microorganism.
- Each of these methods for lysing a microorganism can be used as a single method or in combination simultaneously or sequentially.
- the extent of cell disruption can be observed by microscopic analysis. Using one or more of the methods described herein, typically more than 70% cell breakage is observed. Preferably, cell breakage is more than 80%, more preferably more than 90% and most preferred about 100%.
- the microorganism is lysed after growth, for example to increase the exposure of cellular lipid and/or hydrocarbon for extraction or further processing.
- the timing of lipase expression (e.g., via an inducible promoter) or cell lysis can be adjusted to optimize the yield of lipids and/or hydrocarbons.
- the step of lysing a microorganism comprises heating of a cellular suspension containing the microorganism.
- the fermentation broth containing the microorganisms is heated until the microorganisms, i.e., the cell walls and membranes of microorganisms degrade or breakdown.
- temperatures applied are at least 50°C.
- Higher temperatures such as, at least 30°C at least 60°C, at least 70°C, at least 80°C, at least 90°C, at least 100°C, at least 110°C, at least 120°C, at least 130°C or higher are used for more efficient cell lysis.
- Lysing cells by heat treatment can be performed by boiling the microorganism. Alternatively, heat treatment (without boiling) can be performed in an autoclave.
- the heat treated lysate may be cooled for further treatment.
- Cell disruption can also be performed by steam treatment, i.e., through addition of pressurized steam. Steam treatment of microalgae for cell disruption is described, for example, in U.S. Patent No. 6,750,048.
- steam treatment may be achieved by sparging steam into the fermentor and maintaining the broth at a desired temperature for less than about 90 minutes, preferably less than about 60 minutes, and more preferably less than about 30 minutes.
- the step of lysing a microorganism comprises adding a base to a cellular suspension containing the microorganism.
- the base should be strong enough to hydrolyze at least a portion of the proteinaceous compounds of the microorganisms used.
- Bases which are useful for solubilizing proteins are known in the art of chemistry.
- Exemplary bases which are useful in the methods of the present invention include, but are not limited to, hydroxides, carbonates and bicarbonates of lithium, sodium, potassium, calcium, and mixtures thereof.
- a preferred base is KOH.
- Base treatment of microalgae for cell disruption is described, for example, in U.S. Patent No. 6,750,048.
- the step of lysing a microorganism comprises adding an acid to a cellular suspension containing the microorganism.
- Acid lysis can be effected using an acid at a concentration of 10-500 mN or preferably 40-160 nM. Acid lysis is preferably performed at above room temperature (e.g., at 40-160°, and preferably a temperature of 50-130°. For moderate temperatures (e.g., room temperature to 100°C and particularly room temperature to 65°, acid treatment can usefully be combined with sonication or other cell disruption methods.
- the step of lysing a microorganism comprises lysing the microorganism by using an enzyme.
- Preferred enzymes for lysing a microorganism are proteases and polysaccharide-degrading enzymes such as hemicellulase (e.g., hemicellulase from Aspergillus niger; Sigma Aldrich, St. Louis, MO; #H2125), pectinase (e.g., pectinase from Rhizopus sp:, Sigma Aldrich, St.
- lysis is accomplished using an enzyme such as, for example, a cellulase such as a polysaccharide-degrading enzyme, optionally from Chlorella or a Chlorella virus, or a proteases, such as Streptomyces griseus protease, chymotrypsin, proteinase K, proteases listed in Degradation of Polylactide by Commercial Proteases, Oda Yet al., Journal of Polymers and the Environment, Volume 8, Number 1, January 2000 , pp. 29-32(4), Alcalase 2.4 FG (Novozymes), and Flavourzyme 100 L (Novozymes).
- a protease and a polysaccharide-degrading enzyme can also be used, including any combination of the preceding proteases and polysaccharide- degrading enzymes.
- lysis can be performed using an expeller press.
- biomass is forced through a screw-type device at high pressure, lysing the cells and causing the intracellular lipid to be released and separated from the protein and fiber (and other components) in the cell.
- the step of lysing a microorganism is performed by using ultrasound, i.e., sonication.
- ultrasound i.e., sonication.
- cells can also by lysed with high frequency sound.
- the sound can be produced electronically and transported through a metallic tip to an appropriately concentrated cellular suspension. This sonication (or ultrasonication) disrupts cellular integrity based on the creation of cavities in cell suspension.
- the step of lysing a microorganism is performed by mechanical lysis.
- Cells can be lysed mechanically and optionally
- a pressure disrupter can be used to pump a cell containing slurry through a restricted orifice valve. High pressure (up to 1500 bar) is applied, followed by an instant expansion through an exiting nozzle. Cell disruption is accomplished by three different mechanisms: impingement on the valve, high liquid shear in the orifice, and sudden pressure drop upon discharge, causing an explosion of the cell. The method releases intracellular molecules.
- a ball mill can be used. In a ball mill, cells are agitated in suspension with small abrasive particles, such as beads. Cells break because of shear forces, grinding between beads, and collisions with beads. The beads disrupt the cells to release cellular contents. Cells can also be disrupted by shear forces, such as with the use of blending (such as with a high speed or Waring blender as examples), the french press, or even centrifugation in case of weak cell walls, to disrupt cells.
- the step of lysing a microorganism is performed by applying an osmotic shock.
- the step of lysing a microorganism comprises infection of the microorganism with a lytic virus.
- viruses are known to lyse microorganisms suitable for use in the present invention, and the selection and use of a particular lytic virus for a particular microorganism is within the level of skill in the art.
- Paramecium bursaria chlorella virus (PBCV-1) is the prototype of a group (family Phycodnaviridae, genus Chlorovirus) of large, icosahedral, plaque-forming, double- stranded DNA viruses that replicate in, and lyse, certain unicellular, eukaryotic chlorella- like green algae. Accordingly, any susceptible microalgae can be lysed by infecting the culture with a suitable chlorella virus. Methods of infecting species of Chlorella with a chlorella virus are known. See for example Adv. Virus Res. 2006;66:293-336; Virology, 1999 Apr 25;257(l): 15-23; Virology, 2004 Jan 5;318(l):214-23; Nucleic Acids Symp. Ser.
- the step of lysing a microorganism comprises autolysis.
- a microorganism according to the invention is genetically engineered to produce a lytic protein that will lyse the microorganism.
- This lytic gene can be expressed using an inducible promoter so that the cells can first be grown to a desirable density in a fermentor, followed by induction of the promoter to express the lytic gene to lyse the cells.
- the lytic gene encodes a polysaccharide-degrading enzyme.
- the lytic gene is a gene from a lytic virus.
- a lytic gene from a Chlorella virus can be expressed in an algal cell; see Virology 260, 308-315 (1999); FEMS Microbiology Letters 180 (1999) 45-53; Virology 263, 376-387 (1999); and Virology 230, 361-368 (1997).
- Expression of lytic genes is preferably done using an inducible promoter, such as a promoter active in microalgae that is induced by a stimulus such as the presence of a small molecule, light, heat, and other stimuli.
- lipids and lipid derivatives such as fatty aldehydes, fatty alcohols, and hydrocarbons such as alkanes can be extracted with a hydrophobic solvent such as hexane (see Frenz et al. 1989, Enzyme Microb. Technol., 11 :717).
- Lipids and lipid derivatives can also be extracted using liquefaction (see for example Sawayama et al. 1999, Biomass and Bioenergy 17:33-39 and Inoue et al. 1993, Biomass Bioenergy 6(4):269-274); oil liquefaction (see for example Minowa et al.
- Miao and Wu describe a protocol of the recovery of microalgal lipid from a culture of Chlorella prototheocoides in which the cells were harvested by centrifugation, washed with distilled water and dried by freeze drying. The resulting cell powder was pulverized in a mortar and then extracted with n-hexane.
- lipids, lipid derivatives and hydrocarbons generated by the microorganisms of the present invention can be recovered by extraction with an organic solvent.
- the preferred organic solvent is hexane.
- the organic solvent is added directly to the lysate without prior separation of the lysate components.
- the lysate generated by one or more of the methods described above is contacted with an organic solvent for a period of time sufficient to allow the lipid and/or hydrocarbon components to form a solution with the organic solvent.
- the solution can then be further refined to recover specific desired lipid or hydrocarbon components.
- Hexane extraction methods are well known in the art.
- Lipids and lipid derivatives such as fatty aldehydes, fatty alcohols, and
- hydrocarbons such as alkanes produced by cells as described herein can be modified by the use of one or more enzymes, including a lipase, as described above.
- the one or more enzymes can be added to that environment under conditions in which the enzyme modifies the hydrocarbon or completes its synthesis from a hydrocarbon precursor.
- the hydrocarbons can be partially, or completely, isolated from the cellular material before addition of one or more catalysts such as enzymes. Such catalysts are exogenously added, and their activity occurs outside the cell or in vitro.
- lipids and hydrocarbons produced by cells in vivo, or enzymatically modified in vitro, as described herein can be optionally further processed by conventional means.
- the processing can include "cracking" to reduce the size, and thus increase the hydrogen:carbon ratio, of hydrocarbon molecules.
- Catalytic and thermal cracking methods are routinely used in hydrocarbon and triglyceride oil processing. Catalytic methods involve the use of a catalyst, such as a solid acid catalyst.
- the catalyst can be silica- alumina or a zeolite, which result in the heterolytic, or asymmetric, breakage of a carbon-carbon bond to result in a carbocation and a hydride anion.
- Hydrocarbons can also be processed to reduce, optionally to zero, the number of carbon-carbon double, or triple, bonds therein. Hydrocarbons can also be processed to remove or eliminate a ring or cyclic structure therein. Hydrocarbons can also be processed to increase the hydrogen:carbon ratio. This can include the addition of hydrogen ("hydrogenation") and/or the "cracking" of hydrocarbons into smaller hydrocarbons.
- Thermal methods involve the use of elevated temperature and pressure to reduce hydrocarbon size.
- An elevated temperature of about 800°C and pressure of about 700kPa can be used. These conditions generate "light,” a term that is sometimes used to refer to hydrogen-rich hydrocarbon molecules (as distinguished from photon flux), while also generating, by condensation, heavier hydrocarbon molecules which are relatively depleted of hydrogen.
- the methodology provides homolytic, or symmetrical, breakage and produces alkenes, which may be optionally enzymatically saturated as described above.
- hydrocarbons produced by cells as described herein can be collected and processed or refined via conventional means. See Hillen et al. (Biotechnology and Bioengineering, Vol. XXIV: 193-205 (1982)) for a report on hydrocracking of microalgae- produced hydrocarbons.
- the fraction is treated with another catalyst, such as an organic compound, heat, and/or an inorganic compound.
- a transesterification process is used as described below in this Section.
- Hydrocarbons produced via methods of the present invention are useful in a variety of industrial applications.
- linear alkylbenzene sulfonate LAS
- an anionic surfactant used in nearly all types of detergents and cleaning preparations utilizes hydrocarbons generally comprising a chain of 10-14 carbon atoms.
- LAS linear alkylbenzene sulfonate
- Surfactants such as LAS, can be used in the manfacture of personal care compositions and detergents, such as those described in US Patent Nos.:
- ASTM American Society of Testing and Materials
- lipid and/or hydrocarbon components recovered from the microbial biomass described herein can be subjected to chemical treatment to manufacture a fuel for use in diesel vehicles and jet engines.
- Biodiesel is a liquid which varies in color - between golden and dark brown - depending on the production feedstock. It is practically immiscible with water, has a high boiling point and low vapor pressure.
- Biodiesel refers to a diesel-equivalent processed fuel for use in diesel-engine vehicles. Biodiesel is biodegradable and non-toxic. An additional benefit of biodiesel over conventional diesel fuel is lower engine wear.
- biodiesel comprises C14-C18 alkyl esters.
- Various processes convert biomass or a lipid produced and isolated as described herein to diesel fuels.
- a preferred method to produce biodiesel is by transesterification of a lipid as described herein.
- a preferred alkyl ester for use as biodiesel is a methyl ester or ethyl ester.
- Biodiesel produced by a method described herein can be used alone or blended with conventional diesel fuel at any concentration in most modern diesel-engine vehicles.
- biodiesel When blended with conventional diesel fuel (petroleum diesel), biodiesel may be present from about 0.1% to about 99.9%.
- B Much of the world uses a system known as the "B" factor to state the amount of biodiesel in any fuel mix. For example, fuel containing 20% biodiesel is labeled B20. Pure biodiesel is referred to as B100.
- Biodiesel can also be used as a heating fuel in domestic and commercial boilers.
- Existing oil boilers may contain rubber parts and may require conversion to run on biodiesel.
- the conversion process is usually relatively simple, involving the exchange of rubber parts for synthetic parts due to biodiesel being a strong solvent. Due to its strong solvent power, burning biodiesel will increase the efficiency of boilers.
- Biodiesel can be used as an additive in formulations of diesel to increase the lubricity of pure Ultra- Low Sulfur Diesel (ULSD) fuel, which is advantageous because it has virtually no sulfur content.
- ULSD Ultra- Low Sulfur Diesel
- Biodiesel is a better solvent than petrodiesel and can be used to break down deposits of residues in the fuel lines of vehicles that have previously been run on petrodiesel.
- Biodiesel can be produced by transesterification of triglycerides contained in oil- rich biomass.
- a method for producing biodiesel comprises the steps of (a) cultivating a lipid-containing microorganism using methods disclosed herein (b) lysing a lipid-containing microorganism to produce a lysate, (c) isolating lipid from the lysed microorganism, and (d) transesterifying the lipid composition, whereby biodiesel is produced.
- Methods for growth of a microorganism, lysing a microorganism to produce a lysate, treating the lysate in a medium comprising an organic solvent to form a heterogeneous mixture and separating the treated lysate into a lipid composition have been described above and can also be used in the method of producing biodiesel.
- the lipid profile of the biodiesel is usually highly similar to the lipid profile of the feedstock oil.
- Other oils provided by the methods and compositions of the invention can be subjected to transesterification to yield biodiesel with lipid profiles including (a) at least 4% C8-C14; (b) at least 0.3% C8; (c) at least 2% CIO; (d) at least 2% C12; and (3) at least 30% C8-C14.
- Lipid compositions can be subjected to transesterification to yield long-chain fatty acid esters useful as biodiesel.
- Preferred transesterification reactions are outlined below and include base catalyzed transesterification and transesterification using recombinant lipases.
- the triacylglycerides are reacted with an alcohol, such as methanol or ethanol, in the presence of an alkaline catalyst, typically potassium hydroxide. This reaction forms methyl or ethyl esters and glycerin (glycerol) as a byproduct.
- Animal and plant oils are typically made of triglycerides which are esters of free fatty acids with the trihydric alcohol, glycerol.
- TAG triacylglyceride
- a typical reaction scheme is as follows: + R 2 C00Et + R 3 C00Et + C 3 H 5 (OH) 3
- the alcohol is deprotonated with a base to make it a stronger nucleophile.
- a base commonly, ethanol or methanol is used in vast excess (up to 50-fold). Normally, this reaction will proceed either exceedingly slowly or not at all. Heat, as well as an acid or base can be used to help the reaction proceed more quickly. The acid or base are not consumed by the transesterification reaction, thus they are not reactants but catalysts. Almost all biodiesel has been produced using the base-catalyzed technique as it requires only low temperatures and pressures and produces over 98% conversion yield (provided the starting oil is low in moisture and free fatty acids).
- Transesterification has also been carried out, as discussed above, using an enzyme, such as a lipase instead of a base.
- Lipase-catalyzed transesterification can be carried out, for example, at a temperature between the room temperature and 80° C, and a mole ratio of the TAG to the lower alcohol of greater than 1 : 1, preferably about 3: 1.
- Lipases suitable for use in transesterification include, but are not limited to, those listed in Table 9. Other examples of lipases useful for transesterification are found in, e.g. U.S. Patent Nos. 4,798,793; 4,940,845 5,156,963; 5,342,768; 5,776,741 and WO89/01032.
- Such lipases include, but are not limited to, lipases produced by microorganisms of Rhizopus, Aspergillus, Candida, Mucor, Pseudomonas, Rhizomucor, Candida, and Humicola and pancreas lipase.
- Candida cylindracea lipase AAR24090 Candida lipolytica lipase (Lipase L; Amano Pharmaceutical Co., Ltd.), Candida rugosa lipase (e.g., Lipase-OF; Meito Sangyo Co., Ltd.), Mucor miehei lipase (Lipozyme IM 20), Pseudomonas fluor esc ens lipase AAA25882, Rhizopus japonicas lipase (Lilipase A-10FG) Q7M4U7_1, Rhizomucor miehei lipase B34959, Rhizopus oryzae lipase (Lipase F) AAF32408, Serratia marcescens lipase (SM Enzyme) ABI13521, Thermomyces lanuginosa lipase CAB58509, Lipase P (Nagase ChemteX Corporation
- lipase for the production of fatty acid esters suitable for biodiesel is that the price of lipase is much higher than the price of sodium hydroxide (NaOH) used by the strong base process.
- NaOH sodium hydroxide
- This challenge has been addressed by using an immobilized lipase, which can be recycled.
- the activity of the immobilized lipase must be maintained after being recycled for a minimum number of cycles to allow a lipase- based process to compete with the strong base process in terms of the production cost.
- Immobilized lipases are subject to poisoning by the lower alcohols typically used in transesterification.
- U.S. Patent No. 6,398,707 (issued June 4, 2002 to Wu et al.) describes methods for enhancing the activity of immobilized lipases and regenerating immobilized lipases having reduced activity. Some suitable methods include immersing an immobilized lipase in an alcohol having a carbon atom number not less than 3 for a period of time, preferably from 0.5-48 hours, and more preferably from 0.5-1.5 hours. Some suitable methods also include washing a deactivated immobilized lipase with an alcohol having a carbon atom number not less than 3 and then immersing the deactivated immobilized lipase in a vegetable oil for 0.5-48 hours.
- a recombinant lipase is expressed in the same microorganisms that produce the lipid on which the lipase acts.
- Suitable recombinant lipases include those listed above in Table 9 and/or having GenBank Accession numbers listed above in Table 9, or a polypeptide that has at least 70% amino acid identity with one of the lipases listed above in Table 9 and that exhibits lipase activity.
- the enzymatic activity is present in a sequence that has at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or at least about 99% identity with one of the above described sequences, all of which are hereby incorporated by reference as if fully set forth.
- DNA encoding the lipase and selectable marker is preferably codon-optimized cDNA. Methods of recoding genes for expression in microalgae are described in US Patent 7,135,290.
- Biodiesel meeting the quality standards is very nontoxic, with a toxicity rating (LD 50 ) of greater than 50 mL/kg.
- biodiesel that meets the ASTM standards has to be non-toxic, there can be contaminants which tend to crystallize and/or precipitate and fall out of solution as sediment. Sediment formation is particularly a problem when biodiesel is used at lower temperatures. The sediment or precipitates may cause problems such as decreasing fuel flow, clogging fuel lines, clogging filters, etc. Processes are well-known in the art that specifically deal with the removal of these contaminants and sediments in biodiesel in order to produce a higher quality product.
- Examples for such processes include, but are not limited to, pretreatment of the oil to remove contaiminants such as phospholipids and free fatty acids (e.g., degumming, caustic refining and silica adsorbant filtration) and cold filtration.
- Cold filtration is a process that was developed specifically to remove any particulates and sediments that are present in the biodiesel after production. This process cools the biodiesel and filters out any sediments or precipitates that might form when the fuel is used at a lower temperature.
- Such a process is well known in the art and is described in US Patent Application Publication No. 2007- 0175091.
- Suitable methods may include cooling the biodiesel to a temperature of less than about 38°C so that the impurities and contaminants precipitate out as particulates in the biodiesel liquid.
- Diatomaceous earth or other filtering material may then added to the cooled biodiesel to form a slurry, which may then filtered through a pressure leaf or other type of filter to remove the particulates.
- the filtered biodiesel may then be run through a polish filter to remove any remaining sediments and diatomaceous earth, so as to produce the final biodiesel product.
- Example 9 describes the production of biodiesel using triglyceride oil from
- biodiesel will be used in particularly cold temperatures.
- Such processes include winterization and fractionation. Both processes are designed to improve the cold flow and winter performance of the fuel by lowering the cloud point (the temperature at which the biodiesel starts to crystallize).
- cloud point the temperature at which the biodiesel starts to crystallize.
- biodiesel There are several approaches to winterizing biodiesel. One approach is to blend the biodiesel with petroleum diesel. Another approach is to use additives that can lower the cloud point of biodiesel.
- Fractionation selectively separates methyl esters into individual components or fractions, allowing for the removal or inclusion of specific methyl esters.
- Fractionation methods include urea fractionation, solvent fractionation and thermal distillation.
- renewable diesel which comprises alkanes, such as C10:0, C12:0, C14:0, C16:0 and C18:0 and thus, are distinguishable from biodiesel.
- High quality renewable diesel conforms to the ASTM D975 standard.
- the lipids produced by the methods of the present invention can serve as feedstock to produce renewable diesel.
- a method for producing renewable diesel is provided.
- Renewable diesel can be produced by at least three processes: hydrothermal processing (hydrotreating); hydroprocessing; and indirect liquefaction. These processes yield non-ester distillates. During these processes,
- triacylglycerides produced and isolated as described herein, are converted to alkanes.
- the method for producing renewable diesel comprises (a) cultivating a lipid-containing microorganism using methods disclosed herein (b) lysing the microorganism to produce a lysate, (c) isolating lipid from the lysed microorganism, and (d) deoxygenating and hydrotreating the lipid to produce an alkane, whereby renewable diesel is produced.
- Lipids suitable for manufacturing renewable diesel can be obtained via extraction from microbial biomass using an organic solvent such as hexane, or via other methods, such as those described in US Patent 5,928,696. Some suitable methods may include mechanical pressing and centrifuging.
- the microbial lipid is first cracked in conjunction with
- hydrotreating to reduce carbon chain length and saturate double bonds, respectively.
- the material is then isomerized, also in conjunction with hydrotreating.
- the naptha fraction can then be removed through distillation, followed by additional distillation to vaporize and distill components desired in the diesel fuel to meet an ASTM D975 standard while leaving components that are heavier than desired for meeting the D975 standard.
- Hydrotreating, hydrocracking, deoxygenation and isomerization methods of chemically modifying oils, including triglyceride oils are well known in the art. See for example European patent applications EP1741768 (Al); EP1741767 (Al); EP1682466 (Al); EP1640437 (Al);
- EP1681337 (Al); EP1795576 (Al); and U.S. Patents 7,238,277; 6,630,066; 6,596,155;
- treating the lipid to produce an alkane is performed by hydrotreating of the lipid composition.
- hydrothermal processing typically, biomass is reacted in water at an elevated temperature and pressure to form oils and residual solids. Conversion temperatures are typically 300° to 660°F, with pressure sufficient to keep the water primarily as a liquid, 100 to 170 standard atmosphere (atm). Reaction times are on the order of 15 to 30 minutes. After the reaction is completed, the organics are separated from the water. Thereby a distillate suitable for diesel is produced.
- the first step of treating a triglyceride is hydroprocessing to saturate double bonds, followed by deoxygenation at elevated temperature in the presence of hydrogen and a catalyst.
- hydrogenation and deoxygenation occur in the same reaction.
- deoxygenation occurs before hydrogenation.
- Isomerization is then optionally performed, also in the presence of hydrogen and a catalyst. Naphtha components are preferably removed through distillation.
- One suitable method for the hydrogenation of triglycerides includes preparing an aqueous solution of copper, zinc, magnesium and lanthanum salts and another solution of alkali metal or preferably, ammonium carbonate.
- the two solutions may be heated to a temperature of about 20°C to about 85°C and metered together into a precipitation container at rates such that the pH in the precipitation container is maintained between 5.5 and 7.5 in order to form a catalyst.
- Additional water may be used either initially in the precipitation container or added concurrently with the salt solution and precipitation solution.
- the resulting precipitate may then be thoroughly washed, dried, calcined at about 300°C and activated in hydrogen at temperatures ranging from about 100°C to about 400°C.
- One or more triglycerides may then be contacted and reacted with hydrogen in the presence of the above-described catalyst in a reactor.
- the reactor may be a trickle bed reactor, fixed bed gas- solid reactor, packed bubble column reactor, continuously stirred tank reactor, a slurry phase reactor, or any other suitable reactor type known in the art.
- the process may be carried out either batchwise or in continuous fashion. Reaction temperatures are typically in the range of from about 170°C to about 250°C while reaction pressures are typically in the range of from about 300 psig to about 2000 psig.
- the molar ratio of hydrogen to triglyceride in the process of the present invention is typically in the range of from about 20: 1 to about 700: 1.
- the process is typically carried out at a weight hourly space velocity (WHSV) in the range of from about 0.1 hr 1 to about 5 hr 1 .
- WHSV weight hourly space velocity
- the products produced by the such hydrogenation processes include fatty alcohols, glycerol, traces of paraffins and unreacted triglycerides. These products are typically separated by conventional means such as, for example, distillation, extraction, filtration, crystallization, and the like.
- Petroleum refiners use hydroprocessing to remove impurities by treating feeds with hydrogen. Hydroprocessing conversion temperatures are typically 300° to 700°F. Pressures are typically 40 to 100 atm. The reaction times are typically on the order of 10 to 60 minutes. Solid catalysts are employed to increase certain reaction rates, improve selectivity for certain products, and optimize hydrogen consumption.
- Suitable methods for the deoxygenation of an oil includes heating an oil to a temperature in the range of from about 350°F to about 550°F and continuously contacting the heated oil with nitrogen under at least pressure ranging from about atmospeheric to above for at least about 5 minutes.
- Suitable methods for isomerization include using alkali isomerization and other oil isomerization known in the art.
- Hydrotreating and hydroprocessing ultimately lead to a reduction in the molecular weight of the triglyceride feed.
- the triglyceride molecule is reduced to four hydrocarbon molecules under hydroprocessing conditions: a propane molecule and three heavier hydrocarbon molecules, typically in the C8 to C18 range.
- the product of one or more chemical reaction(s) performed on lipid compositions of the invention is an alkane mixture that comprises ASTM D975 renewable diesel.
- Production of hydrocarbons by microorganisms is reviewed by Metzger et al. Appl Microbiol Biotechnol (2005) 66: 486-496 and A Look Back at the U.S. Department of Energy's Aquatic Species Program: Biodiesel from Algae, NREL/TP-580- 24190, John Sheehan, Terri Dunahay, John Benemann and Paul Roessler (1998).
- T10 of the material produced in Example 9 was 242.1°C.
- Methods of hydrotreating, isomerization, and other covalent modification of oils disclosed herein, as well as methods of distillation and fractionation (such as cold filtration) disclosed herein, can be employed to generate renewable diesel compositions with other T10 values, such as T10 between 180 and 295, between 190 and 270, between 210 and 250, between 225 and 245, and at least 290.
- the T90 of the material produced in Example 9 was 300°C.
- Methods of hydrotreating, isomerization, and other covalent modification of oils disclosed herein, as well as methods of distillation and fractionation (such as cold filtration) disclosed herein can be employed to generate renewable diesel compositions with other T90 values, such as T90 between 280 and 380, between 290 and 360, between 300 and 350, between 310 and 340, and at least 290.
- the FBP of the material produced in Example 9 was 300°C.
- Methods of hydrotreating, isomerization, and other covalent modification of oils disclosed herein, as well as methods of distillation and fractionation (such as cold filtration) disclosed herein, can be employed to generate renewable diesel compositions with other FBP values, such as FBP between 290 and 400, between 300 and 385, between 310 and 370, between 315 and 360, and at least 300.
- oils provided by the methods and compositions of the invention can be subjected to combinations of hydrotreating, isomerization, and other covalent modification including oils with lipid profiles including (a) at least 4% C8-C14; (b) at least 0.3% C8; (c) at least 2% CIO; (d) at least 2% C12; and (3) at least 30% C8-C14.
- a traditional ultra- low sulfur diesel can be produced from any form of biomass by a two-step process. First, the biomass is converted to a syngas, a gaseous mixture rich in hydrogen and carbon monoxide. Then, the syngas is catalytically converted to liquids.
- treating the lipid composition to produce an alkane is performed by indirect liquefaction of the lipid composition.
- Jet fuel is clear to straw colored.
- the most common fuel is an unleaded/paraffin oil-based fuel classified as Aeroplane A-l, which is produced to an internationally standardized set of specifications.
- Jet fuel is a mixture of a large number of different hydrocarbons, possibly as many as a thousand or more. The range of their sizes (molecular weights or carbon numbers) is restricted by the requirements for the product, for example, freezing point or smoke point.
- Kerosone-type Aeroplane fuel (including Jet A and Jet A-l) has a carbon number distribution between about 8 and 16 carbon numbers.
- Wide-cut or naphta-type Aeroplane fuel including Jet B) typically has a carbon number distribution between about 5 and 15 carbons.
- Both Aeroplanes may contain a number of additives.
- Useful additives include, but are not limited to, antioxidants, antistatic agents, corrosion inhibitors, and fuel system icing inhibitor (FSII) agents.
- Antioxidants prevent gumming and usually, are based on alkylated phenols, for example, AO-30, AO-31, or AO-37.
- Antistatic agents dissipate static electricity and prevent sparking.
- Stadis 450 with dinonylnaphthylsulfonic acid (DINNSA) as the active ingredient is an example.
- Corrosion inhibitors e.g., DCI-4A is used for civilian and military fuels and DCI-6A is used for military fuels.
- FSII agents include, e.g., Di-EGME.
- a jet fuel is produced by blending algal fuels with existing jet fuel.
- the lipids produced by the methods of the present invention can serve as feedstock to produce jet fuel.
- a method for producing jet fuel is provided.
- FCC fluid catalytic cracking
- HDO hydrodeoxygenation
- Fluid Catalytic Cracking is one method which is used to produce olefins, especially propylene from heavy crude fractions.
- the lipids produced by the method of the present invention can be converted to olefins.
- the process involves flowing the lipids produced through an FCC zone and collecting a product stream comprised of olefins, which is useful as a jet fuel.
- the lipids produced are contacted with a cracking catalyst at cracking conditions to provide a product stream comprising olefins and hydrocarbons useful as jet fuel.
- the method for producing jet fuel comprises (a) cultivating a lipid-containing microorganism using methods disclosed herein, (b) lysing the lipid- containing microorganism to produce a lysate, (c) isolating lipid from the lysate, and (d) treating the lipid composition, whereby jet fuel is produced.
- the lipid composition can be flowed through a fluid catalytic cracking zone, which, in one embodiment, may comprise contacting the lipid composition with a cracking catalyst at cracking conditions to provide a product stream comprising C2-C5 olefins.
- the lipid composition is pretreated.
- Pretreatment may involve contacting the lipid composition with an ion-exchange resin.
- the ion exchange resin is an acidic ion exchange resin, such as AmberlystTM-15 and can be used as a bed in a reactor through which the lipid composition is flowed, either upflow or downflow.
- Other pretreatments may include mild acid washes by contacting the lipid composition with an acid, such as sulfuric, acetic, nitric, or hydrochloric acid. Contacting is done with a dilute acid solution usually at ambient temperature and atmospheric pressure.
- the lipid composition is flowed to an FCC zone where the hydrocarbonaceous components are cracked to olefins.
- Catalytic cracking is accomplished by contacting the lipid composition in a reaction zone with a catalyst composed of finely divided particulate material.
- the reaction is catalytic cracking, as opposed to hydrocracking, and is carried out in the absence of added hydrogen or the consumption of hydrogen.
- substantial amounts of coke are deposited on the catalyst.
- the catalyst is regenerated at high temperatures by burning coke from the catalyst in a regeneration zone.
- Coke-containing catalyst referred to herein as "coked catalyst" is continually transported from the reaction zone to the regeneration zone to be regenerated and replaced by essentially coke-free regenerated catalyst from the regeneration zone.
- Fluidization of the catalyst particles by various gaseous streams allows the transport of catalyst between the reaction zone and regeneration zone.
- hydrocarbons such as those of the lipid composition described herein, in a fluidized stream of catalyst, transporting catalyst between reaction and regeneration zones, and combusting coke in the regenerator are well known by those skilled in the art of FCC processes.
- Suitable FCC catalysts generally comprise at least two components that may or may not be on the same matrix. In some embodiments, both two components may be circulated throughout the entire reaction vessel.
- the first component generally includes any of the well- known catalysts that are used in the art of fluidized catalytic cracking, such as an active amorphous clay-type catalyst and/or a high activity, crystalline molecular sieve. Molecular sieve catalysts may be preferred over amorphous catalysts because of their much-improved selectivity to desired products. IN some preferred embodiments, zeolites may be used as the molecular sieve in the FCC processes.
- the first catalyst component comprises a large pore zeolite, such as an Y-type zeolite, an active alumina material, a binder material, comprising either silica or alumina and an inert filler such as kaolin.
- a large pore zeolite such as an Y-type zeolite
- an active alumina material such as aluminum silicate
- a binder material comprising either silica or alumina and an inert filler such as kaolin.
- cracking the lipid composition of the present invention takes place in the riser section or, alternatively, the lift section, of the FCC zone.
- the lipid composition is introduced into the riser by a nozzle resulting in the rapid vaporization of the lipid composition.
- the lipid composition will ordinarily have a temperature of about 149°C to about 316°C (300°F to 600°F).
- the catalyst is flowed from a blending vessel to the riser where it contacts the lipid composition for a time of abort 2 seconds or less.
- any arrangement of separators such as a swirl arm arrangement can be used to remove coked catalyst from the product stream quickly.
- the separator e.g. swirl arm separator, is located in an upper portion of a chamber with a stripping zone situated in the lower portion of the chamber. Catalyst separated by the swirl arm arrangement drops down into the stripping zone.
- the cracked product vapor stream comprising cracked hydrocarbons including light olefins and some catalyst exit the chamber via a conduit which is in communication with cyclones.
- the cyclones remove remaining catalyst particles from the product vapor stream to reduce particle concentrations to very low levels.
- the product vapor stream then exits the top of the separating vessel.
- Catalyst separated by the cyclones is returned to the separating vessel and then to the stripping zone.
- the stripping zone removes adsorbed hydrocarbons from the surface of the catalyst by counter-current contact with steam.
- Low hydrocarbon partial pressure operates to favor the production of light olefins. Accordingly, the riser pressure is set at about 172 to 241 kPa (25 to 35 psia) with a hydrocarbon partial pressure of about 35 to 172 kPa (5 to 25 psia), with a preferred hydrocarbon partial pressure of about 69 to 138 kPa (10 to 20 psia).
- This relatively low partial pressure for hydrocarbon is achieved by using steam as a diluent to the extent that the diluent is 10 to 55 wt- of lipid composition and preferably about 15 wt- of lipid composition.
- Other diluents such as dry gas can be used to reach equivalent hydrocarbon partial pressures.
- the temperature of the cracked stream at the riser outlet will be about 510°C to 621°C (950°F to 1150°F). However, riser outlet temperatures above 566°C (1050°F) make more dry gas and more olefins. Whereas, riser outlet temperatures below 566°C (1050°F) make less ethylene and propylene. Accordingly, it is preferred to run the FCC process at a preferred temperature of about 566°C to about 630°C, preferred pressure of about 138 kPa to about 240 kPa (20 to 35 psia). Another condition for the process is the catalyst to lipid composition ratio which can vary from about 5 to about 20 and preferably from about 10 to about 15.
- the lipid composition is introduced into the lift section of an FCC reactor.
- the temperature in the lift section will be very hot and range from about 700°C (1292°F) to about 760°C (1400°F) with a catalyst to lipid composition ratio of about 100 to about 150. It is anticipated that introducing the lipid composition into the lift section will produce considerable amounts of propylene and ethylene.
- HDO hydrodeoxygenation
- the process for producing a fuel by hydrogenating a hydrocarbon feed can also be performed by passing the lipid composition or the lipids as a co-current flow with hydrogen gas through a first hydrogenation zone, and thereafter the hydrocarbon effluent is further hydrogenated in a second hydrogenation zone by passing hydrogen gas to the second hydrogenation zone as a counter-current flow relative to the hydrocarbon effluent.
- exemplary HDO applications and catalysts useful for cracking the lipid composition to produce C2-C5 olefins are described in U.S. Pat. No. 7,232,935, which is incorporated in its entirety by reference.
- the structure of the biological component such as the lipid composition or lipids herein, is decomposed, oxygen, nitrogen, phosphorus and sulphur compounds, and light hydrocarbons as gas are removed, and the olefinic bonds are hydrogenated.
- isomerzation is carried out for branching the hydrocarbon chain and improving the performance of the paraffin at low temperatures.
- HDO step of the cracking process, hydrogen gas and the lipid composition or lipids herein which are to be hydrogenated are passed to a HDO catalyst bed system either as co-current or counter-current flows, said catalyst bed system comprising one or more catalyst bed(s), preferably 1-3 catalyst beds.
- the HDO step is typically operated in a co-current manner. In case of a HDO catalyst bed system comprising two or more catalyst beds, one or more of the beds may be operated using the counter-current flow principle.
- the pressure varies between 20 and 150 bar, preferably between 50 and 100 bar, and the temperature varies between 200 and 500°C, preferably in the range of 300-400°C.
- known hydrogenation catalysts containing metals from Group VII and/or VIB of the Periodic System may be used.
- the hydrogenation catalysts are supported Pd, Pt, Ni, NiMo or a CoMo catalysts, the support being alumina and/or silica.
- NiMo/Al 2 0 3 and CoMo/Al 2 0 3 catalysts are used.
- the lipid composition or lipids herein may optionally be treated by prehydrogenation under milder conditions thus avoiding side reactions of the double bonds.
- prehydrogenation is carried out in the presence of a prehydrogenation catalyst at temperatures of 50-400°C and at hydrogen pressures of 1-200 bar, preferably at a temperature between 150 and 250°C and at a hydrogen pressure between 10 and 100 bar.
- the catalyst may contain metals from Group VIII and/or VIB of the Periodic System.
- the prehydrogenation catalyst is a supported Pd, Pt, Ni, NiMo or a CoMo catalyst, the support being alumina and/or silica.
- a gaseous stream from the HDO step containing hydrogen is cooled and then carbon monoxide, carbon dioxide, nitrogen, phosphorus and sulphur compounds, gaseous light hydrocarbons and other impurities are removed therefrom.
- the purified hydrogen or recycled hydrogen is returned back to the first catalyst bed and/or between the catalyst beds to make up for the withdrawn gas stream.
- Water is removed from the condensed liquid. The liquid is passed to the first catalyst bed or between the catalyst beds.
- the isomerization step comprises an optional stripping step, wherein the reaction product from the HDO step may be purified by stripping with water vapour or a suitable gas such as light hydrocarbon, nitrogen or hydrogen.
- the optional stripping step is carried out in counter-current manner in a unit upstream of the isomerization catalyst, wherein the gas and liquid are contacted with each other, or before the actual isomerization reactor in a separate stripping unit utilizing counter- current principle.
- the hydrogen gas and the hydrogenated lipid composition or lipids herein, and optionally an n-paraffin mixture are passed to a reactive isomerization unit comprising one or several catalyst bed(s).
- the catalyst beds of the isomerization step may operate either in co-current or counter-current manner.
- the counter-current flow principle is applied in the isomerization step.
- this is done by carrying out either the optional stripping step or the isomerization reaction step or both in counter-current manner.
- the pressure varies in the range of 20-150 bar, preferably in the range of 20-100 bar, the temperature being between 200 and 500°C, preferably between 300 and 400°C.
- isomerization catalysts known in the art may be used. Suitable isomerization catalysts contain molecular sieve and/or a metal from Group VII and/or a carrier.
- the isomerization catalyst contains SAPO-11 or SAP041 or ZSM-22 or ZSM-23 or ferrierite and Pt, Pd or Ni and AI2O 3 or Si0 2 .
- Typical isomerization catalysts are, for example, Pt/SAPO-l l/Al 2 0 3 , Pt/ZSM-22/Al 2 0 3 , Pt/ZSM-23/Al 2 0 3 and Pt/SAPO-l l/Si0 2 .
- the isomerization step and the HDO step may be carried out in the same pressure vessel or in separate pressure vessels.
- Optional prehydrogenation may be carried out in a separate pressure vessel or in the same pressure vessel as the HDO and isomerization steps.
- the product of one or more chemical reactions is an alkane mixture that comprises HRJ-5.
- the product of the one or more chemical reactions is an alkane mixture that comprises ASTM D1655 jet fuel.
- the composition comforming to the specification of ASTM 1655 jet fuel has a sulfur content that is less than 10 ppm.
- the composition conforming to the specification of ASTM 1655 jet fuel has a T10 value of the distillation curve of less than 205° C.
- the composition conforming to the specification of ASTM 1655 jet fuel has a final boiling point (FBP) of less than 300° C.
- the composition conforming to the specification of ASTM 1655 jet fuel has a flash point of at least 38° C. In another embodiment, the composition conforming to the specification of ASTM 1655 jet fuel has a density between 775 K/M 3 and 840K/M 3 . In yet another embodiment, the composition conforming to the specification of ASTM 1655 jet fuel has a freezing point that is below -47° C. In another embodiment, the composition conforming to the specification of ASTM 1655 jet fuel has a net Heat of Combustion that is at least 42.8 MJ/K. In another embodiment, the composition conforming to the specification of ASTM 1655 jet fuel has a hydrogen content that is at least 13.4 mass .
- composition conforming to the specification of ASTM 1655 jet fuel has a thermal stability, as tested by quantitative gravimetric JFTOT at 260° C, that is below 3mm of Hg.
- composition conforming to the specification of ASTM 1655 jet fuel has an existent gum that is below 7 mg/dl.
- the present invention discloses a variety of methods in which chemical modification of microalgal lipid is undertaken to yield products useful in a variety of industrial and other applications.
- processes for modifying oil produced by the methods disclosed herein include, but are not limited to, hydrolysis of the oil,
- microalgal lipid hydroprocessing of the oil, and esterification of the oil.
- Other chemical modification of microalgal lipid include, without limitation, epoxidation, oxidation, hydrolysis, sulfations, sulfonation, ethoxylation, propoxylation, amidation, and saponification.
- the modification of the microalgal oil produces basic oleochemicals that can be further modified into selected derivative oleochemicals for a desired function. In a manner similar to that described above with reference to fuel producing processes, these chemical modifications can also be performed on oils generated from the microbial cultures described herein.
- Examples of basic oleochemicals include, but are not limited to, soaps, fatty acids, fatty esters, fatty alcohols, fatty nitrogen compounds, fatty acid methyl esters, and glycerol.
- Examples of derivative oleochemicals include, but are not limited to, fatty nitriles, esters, dimer acids, quats, surfactants, fatty alkanolamides, fatty alcohol sulfates, resins, emulsifiers, fatty alcohols, olefins, drilling muds, polyols, polyurethanes, polyacrylates, rubber, candles, cosmetics, metallic soaps, soaps, alpha-sulphonated methyl esters, fatty alcohol sulfates, fatty alcohol ethoxylates, fatty alcohol ether sulfates, imidazolines, surfactants, detergents, esters, quats, ozonolysis products, fatty amines, fatty alkanolamides,
- 7,262,158 (Cleansing compositions); 7,115,173 (Fabric softener compositions); 6,342,208 (Emulsions for treating skin); 7,264,886 (Water repellant compositions); 6,924,333 (Paint additives); 6,596,768 (Lipid-enriched ruminant feedstock); and 6,380,410 (Surfactants for detergents and cleaners).
- a triglyceride oil is optionally first hydrolyzed in a liquid medium such as water or sodium hydroxide so as to obtain glycerol and soaps.
- a liquid medium such as water or sodium hydroxide
- suitable triglyceride hydrolysis methods including, but not limited to, saponification, acid hydrolysis, alkaline hydrolysis, enzymatic hydrolysis (referred herein as splitting), and hydrolysis using hot-compressed water.
- a triglyceride oil need not be hydrolyzed in order to produce an oleochemical; rather, the oil may be converted directly to the desired
- the triglyceride oil may be directly converted to a methyl ester fatty acid through esterification.
- catalytic hydrolysis of the oil produced by methods disclosed herein occurs by splitting the oil into glycerol and fatty acids. As discussed above, the fatty acids may then be further processed through several other modifications to obtained derivative oleochemicals. For example, in one embodiment the fatty acids may undergo an amination reaction to produce fatty nitrogen compounds. In another embodiment, the fatty acids may undergo ozonolysis to produce mono- and dibasic-acids.
- hydrolysis may occur via the, splitting of oils produced herein to create oleochemicals.
- a triglyceride oil may be split before other processes is performed.
- suitable triglyceride splitting methods including, but not limited to, enzymatic splitting and pressure splitting.
- enzymatic oil splitting methods use enzymes, lipases, as biocatalysts acting on a water/oil mixture. Enzymatic splitting then slpits the oil or fat, respectively, is into glycerol and free fatty acids. The glycerol may then migrates into the water phase whereas the organic phase enriches with free fatty acids.
- the enzymatic splitting reactions generally take place at the phase boundary between organic and aqueous phase, where the enzyme is present only at the phase boundary. Triglycerides that meet the phase boundary then contribute to or participate in the splitting reaction. As the reaction proceeds, the occupation density or concentration of fatty acids still chemically bonded as glycerides, in comparison to free fatty acids, decreases at the phase boundary so that the reaction is slowed down. In certain embodiments, enzymatic splitting may occur at room temperature.
- One of ordinary skill in the art would know the suitable conditions for splitting oil into the desired fatty acids.
- the reaction speed can be accelerated by increasing the interface boundary surface.
- free fatty acids are then separated from the organic phase freed from enzyme, and the residue which still contains fatty acids chemically bonded as glycerides is fed back or recycled and mixed with fresh oil or fat to be subjected to splitting.
- recycled glycerides are then subjected to a further enzymatic splitting process.
- the free fatty acids are extracted from an oil or fat partially split in such a manner. In that way, if the chemically bound fatty acids (triglycerides) are returned or fed back into the splitting process, the enzyme consumption can be drastically reduced.
- the splitting degree is determined as the ratio of the measured acid value divided by the theoretically possible acid value which can be computed for a given oil or fat.
- the acid value is measured by means of titration according to standard common methods.
- the density of the aqueous glycerol phase can be taken as a measure for the splitting degree.
- the slitting process as described herein is also suitable for splitting the mono-, di- and triglyceride that are contained in the so-called soap-stock from the alkali refining processes of the produced oils.
- the soap-stock can be quantitatively converted without prior saponification of the neutral oils into the fatty acids.
- the fatty acids being chemically bonded in the soaps are released, preferably before splitting, through an addition of acid.
- a buffer solution is used in addition to water and enzyme for the splitting process.
- oils produced in accordance with the methods of the invention can also be subjected to saponification as a method of hydrolysis.
- Animal and plant oils are typically made of triacylglycerols (TAGs), which are esters of fatty acids with the trihydric alcohol, glycerol.
- TAGs triacylglycerols
- the glycerol in a TAG is removed, leaving three carboxylic acid anions that can associate with alkali metal cations such as sodium or potassium to produce fatty acid salts.
- alkali metal cations such as sodium or potassium
- the quantity of base (e.g., KOH) that is used in the reaction is determined by the desired degree of saponification. If the objective is, for example, to produce a soap product that comprises some of the oils originally present in the TAG composition, an amount of base insufficient to convert all of the TAGs to fatty acid salts is introduced into the reaction mixture. Normally, this reaction is performed in an aqueous solution and proceeds slowly, but may be expedited by the addition of heat. Precipitation of the fatty acid salts can be facilitated by addition of salts, such as water-soluble alkali metal halides (e.g., NaCl or KC1), to the reaction mixture.
- the base is an alkali metal hydroxide, such as NaOH or KOH.
- other bases such as alkanolamines, including for example triethanolamine and
- the lipid composition subjected to saponification is a tallow mimetic (i.e., lipid composition similar to that of tallow) produced as described herein, or a blend of a tallow mimetic with another triglyceride oil.
- the first step of chemical modification may be hydroprocessing to saturate double bonds, followed by deoxygenation at elevated temperature in the presence of hydrogen and a catalyst.
- hydrogenation and deoxygenation may occur in the same reaction.
- deoxygenation occurs before hydrogenation.
- Isomerization may then be optionally performed, also in the presence of hydrogen and a catalyst. Finally, gases and naphtha components can be removed if desired.
- gases and naphtha components can be removed if desired.
- the triglyceride oils are partially or completely deoxygenated.
- the deoxygenation reactions form desired products, including, but not limited to, fatty acids, fatty alcohols, polyols, ketones, and aldehydes.
- desired products including, but not limited to, fatty acids, fatty alcohols, polyols, ketones, and aldehydes.
- the deoxygenation reactions involve a combination of various different reaction pathways, including without limitation:
- a fatty alcohol may be converted to olefins through FCC reaction or to higher alkanes through a condensation reaction.
- One such chemical modification is hydrogenation, which is the addition of hydrogen to double bonds in the fatty acid constituents of glycerolipids or of free fatty acids.
- the hydrogenation process permits the transformation of liquid oils into semi-solid or solid fats, which may be more suitable for specific applications.
- Hydrogenation of oil produced by the methods described herein can be performed in conjunction with one or more of the methods and/or materials provided herein, as reported in the following: US Patent Nos. 7,288,278 (Food additives or medicaments); 5,346,724 (Lubrication products); 5,475,160 (Fatty alcohols); 5,091,116 (Edible oils); 6,808,737 (Structural fats for margarine and spreads); 5,298,637 (Reduced-calorie fat substitutes); 6,391,815 (Hydrogenation catalyst and sulfur adsorbent); 5,233,099 and 5,233,100 (Fatty alcohols); 4,584,139 (Hydrogenation catalysts); 6,057,375 (Foam suppressing agents); and 7,118,773 (Edible emulsion spreads).
- One skilled in the art will recognize that various processes may be used to hydrogenate carbohydrates.
- One suitable method includes contacting the carbohydrate with hydrogen or hydrogen mixed with a suitable gas and a catalyst under conditions sufficient in a hydrogenation reactor to form a hydrogenated product.
- the hydrogenation catalyst generally can include Cu, Re, Ni, Fe, Co, Ru, Pd, Rh, Pt, Os, Ir, and alloys or any combination thereof, either alone or with promoters such as W, Mo, Au, Ag, Cr, Zn, Mn, Sn, B, P, Bi, and alloys or any combination thereof.
- Other effective hydrogenation catalyst materials include either supported nickel or ruthenium modified with rhenium.
- the hydrogenation catalyst also includes any one of the supports, depending on the desired functionality of the catalyst.
- the hydrogenation catalysts may be prepared by methods known to those of ordinary skill in the art.
- the hydrogenation catalyst includes a supported Group VIII metal catalyst and a metal sponge material (e.g., a sponge nickel catalyst).
- Raney nickel provides an example of an activated sponge nickel catalyst suitable for use in this invention.
- the hydrogenation reaction in the invention is performed using a catalyst comprising a nickel-rhenium catalyst or a tungsten-modified nickel catalyst.
- a suitable catalyst for the hydrogenation reaction of the invention is a carbon-supported nickel-rhenium catalyst.
- a suitable Raney nickel catalyst may be prepared by treating an alloy of approximately equal amounts by weight of nickel and aluminum with an aqueous alkali solution, e.g., containing about 25 weight % of sodium hydroxide.
- the aluminum is selectively dissolved by the aqueous alkali solution resulting in a sponge shaped material comprising mostly nickel with minor amounts of aluminum.
- the initial alloy includes promoter metals (i.e., molybdenum or chromium) in the amount such that about 1 to 2 weight % remains in the formed sponge nickel catalyst.
- the hydrogenation catalyst is prepared using a solution of ruthenium(III) nitrosylnitrate, ruthenium (III) chloride in water to impregnate a suitable support material.
- the solution is then dried to form a solid having a water content of less than about 1% by weight.
- the solid may then be reduced at atmospheric pressure in a hydrogen stream at 300°C (uncalcined) or 400°C (calcined) in a rotary ball furnace for 4 hours. After cooling and rendering the catalyst inert with nitrogen, 5% by volume of oxygen in nitrogen is passed over the catalyst for 2 hours.
- the catalyst described includes a catalyst support.
- the catalyst support stabilizes and supports the catalyst.
- the type of catalyst support used depends on the chosen catalyst and the reaction conditions. Suitable supports for the invention include, but are not limited to, carbon, silica, silica-alumina, zirconia, titania, ceria, vanadia, nitride, boron nitride, heteropoly acids, hydroxyapatite, zinc oxide, chromia, zeolites, carbon nanotubes, carbon fullerene and any combination thereof.
- the catalysts used in this invention can be prepared using conventional methods known to those in the art. Suitable methods may include, but are not limited to, incipient wetting, evaporative impregnation, chemical vapor deposition, wash-coating, magnetron sputtering techniques, and the like.
- the hydrogenation reaction is conducted at temperatures of 80°C to 250°C, and preferably at 90°C to 200°C, and most preferably at 100°C to 150°C. In some embodiments, the hydrogenation reaction is conducted at pressures from 500 KPa to 14000 KPa.
- the hydrogen used in the hydrogenolysis reaction of the current invention may include external hydrogen, recycled hydrogen, in situ generated hydrogen, and any combination thereof.
- external hydrogen refers to hydrogen that does not originate from the biomass reaction itself, but rather is added to the system from another source.
- the starting carbohydrate it is desirable to convert the starting carbohydrate to a smaller molecule that will be more readily converted to desired higher hydrocarbons.
- One suitable method for this conversion is through a hydrogenolysis reaction.
- Various processes are known for performing hydrogenolysis of carbohydrates.
- One suitable method includes contacting a carbohydrate with hydrogen or hydrogen mixed with a suitable gas and a hydrogenolysis catalyst in a hydrogenolysis reactor under conditions sufficient to form a reaction product comprising smaller molecules or polyols.
- the term "smaller molecules or polyols" includes any molecule that has a smaller molecular weight, which can include a lesser number of carbon atoms or oxygen atoms than the starting carbohydrate.
- the reaction products include smaller molecules that include polyols and alcohols. Someone of ordinary skill in the art would be able to choose the appropriate method by which to carry out the hydrogenolysis reaction.
- a 5 and/or 6 carbon sugar or sugar alcohol may be converted to propylene glycol, ethylene glycol, and glycerol using a hydrogenolysis catalyst.
- the hydrogenolysis catalyst may include Cr, Mo, W, Re, Mn, Cu, Cd, Fe, Co, Ni, Pt, Pd, Rh, Ru, Ir, Os, and alloys or any combination thereof, either alone or with promoters such as Au, Ag, Cr, Zn, Mn, Sn, Bi, B, O, and alloys or any combination thereof.
- the hydrogenolysis catalyst may also include a carbonaceous pyropolymer catalyst containing transition metals (e.g., chromium, molybdemum, tungsten, rhenium, manganese, copper, cadmium) or Group VIII metals (e.g., iron, cobalt, nickel, platinum, palladium, rhodium, ruthenium, iridium, and osmium).
- transition metals e.g., chromium, molybdemum, tungsten, rhenium, manganese, copper, cadmium
- Group VIII metals e.g., iron, cobalt, nickel, platinum, palladium, rhodium, ruthenium, iridium, and osmium.
- the hydrogenolysis catalyst may include any of the above metals combined with an alkaline earth metal oxide or adhered to a catalytically active support.
- the catalyst described in the hydrogenolysis reaction may include a catalyst support
- the conditions for which to carry out the hydrogenolysis reaction will vary based on the type of starting material and the desired products. One of ordinary skill in the art, with the benefit of this disclosure, will recognize the appropriate conditions to use to carry out the reaction. In general, they hydrogenolysis reaction is conducted at temperatures of 110°C to 300°C, and preferably at 170°C to 220°C, and most preferably at 200°C to 225°C. In some embodiments, the hydrogenolysis reaction is conducted under basic conditions, preferably at a pH of 8 to 13, and even more preferably at a pH of 10 to 12.
- the hydrogenolysis reaction is conducted at pressures in a range between 60 KPa and 16500 KPa, and preferably in a range between 1700 KPa and 14000 KPa, and even more preferably between 4800 KPa and 11000 KPa.
- the hydrogen used in the hydrogenolysis reaction of the current invention can include external hydrogen, recycled hydrogen, in situ generated hydrogen, and any combination thereof.
- the reaction products discussed above may be converted into higher hydrocarbons through a condensation reaction in a condensation reactor.
- condensation of the reaction products occurs in the presence of a catalyst capable of forming higher hydrocarbons. While not intending to be limited by theory, it is believed that the production of higher hydrocarbons proceeds through a stepwise addition reaction including the formation of carbon-carbon, or carbon-oxygen bond.
- the resulting reaction products include any number of compounds containing these moieties, as described in more detail below.
- suitable condensation catalysts include an acid catalyst, a base catalyst, or an acid/base catalyst.
- the term "acid/base catalyst” refers to a catalyst that has both an acid and a base functionality.
- the condensation catalyst can include, without limitation, zeolites, carbides, nitrides, zirconia, alumina, silica, aluminosilicates, phosphates, titanium oxides, zinc oxides, vanadium oxides, lanthanum oxides, yttrium oxides, scandium oxides, magnesium oxides, cerium oxides, barium oxides, calcium oxides, hydroxides, heteropolyacids, inorganic acids, acid modified resins, base modified resins, and any combination thereof.
- the condensation catalyst can also include a modifier. Suitable modifiers include La, Y, Sc, P, B, Bi, Li, Na, K, Rb, Cs, Mg, Ca, Sr, Ba, and any combination thereof. In some embodiments, the condensation catalyst can also include a metal. Suitable metals include Cu, Ag, Au, Pt, Ni, Fe, Co, Ru, Zn, Cd, Ga, In, Rh, Pd, Ir, Re, Mn, Cr, Mo, W, Sn, Os, alloys, and any combination thereof.
- the catalyst described in the condensation reaction may include a catalyst support as described above for the hydrogenation reaction.
- the condensation catalyst is self-supporting.
- self-supporting means that the catalyst does not need another material to serve as support.
- the condensation catalyst in used in conjunction with a separate support suitable for suspending the catalyst.
- the condensation catalyst support is silica.
- the condensation reaction is carried out at a temperature at which the thermodynamics for the proposed reaction are favorable.
- the temperature for the condensation reaction will vary depending on the specific starting polyol or alcohol. In some embodiments, the temperature for the condensation reaction is in a range from 80°C to 500°C, and preferably from 125°C to 450°C, and most preferably from 125°C to 250°C.
- the condensation reaction is conducted at pressures in a range between 0 Kpa to 9000 KPa, and preferably in a range between 0 KPa and 7000 KPa, and even more preferably between 0 KPa and 5000 KPa.
- the higher alkanes formed by the invention include, but are not limited to, branched or straight chain alkanes that have from 4 to 30 carbon atoms, branched or straight chain alkenes that have from 4 to 30 carbon atoms, cycloalkanes that have from 5 to 30 carbon atoms, cycloalkenes that have from 5 to 30 carbon atoms, aryls, fused aryls, alcohols, and ketones.
- Suitable alkanes include, but are not limited to, butane, pentane, pentene, 2- methylbutane, hexane, hexene, 2-methylpentane, 3-methylpentane, 2,2,-dimethylbutane, 2,3- dimethylbutane, heptane, heptene, octane, octene, 2,2,4-trimethylpentane, 2,3-dimethyl hexane, 2,3,4-trimethylpentane, 2,3-dimethylpentane, nonane, nonene, decane, decene, undecane, undecene, dodecane, dodecene, tridecane, tridecene, tetradecane, tetradecene, pentadecane, pentadecene, nonyldecane, nonyldecene, eicosane, eicosen
- the cycloalkanes and the cycloalkenes are unsubstituted. In other embodiments, the cycloalkanes and cycloalkenes are mono-substituted. In still other embodiments, the cycloalkanes and cycloalkenes are multi-substituted.
- the substituted group includes, without limitation, a branched or straight chain alkyl having 1 to 12 carbon atoms, a branched or straight chain alkylene having 1 to 12 carbon atoms, a phenyl, and any combination thereof.
- Suitable cycloalkanes and cycloalkenes include, but are not limited to, cyclopentane, cyclopentene, cyclohexane, cyclohexene, methyl-cyclopentane, methyl-cyclopentene, ethyl- cyclopentane, ethyl-cyclopentene, ethyl-cyclohexane, ethyl-cyclohexene, isomers and any combination thereof.
- the aryls formed are unsubstituted. In another embodiment, the aryls formed are mono-substituted.
- the substituted group includes, without limitation, a branched or straight chain alkyl having 1 to 12 carbon atoms, a branched or straight chain alkylene having 1 to 12 carbon atoms, a phenyl, and any combination thereof.
- Suitable aryls for the invention include, but are not limited to, benzene, toluene, xylene, ethyl benzene, para xylene, meta xylene, and any combination thereof.
- the alcohols produced in the invention have from 4 to 30 carbon atoms.
- the alcohols are cyclic.
- the alcohols are branched.
- the alcohols are straight chained.
- Suitable alcohols for the invention include, but are not limited to, butanol, pentanol, hexanol, heptanol, octanol, nonanol, decanol, undecanol, dodecanol, tridecanol, tetradecanol, pentadecanol, hexadecanol, heptyldecanol, octyldecanol, nonyldecanol, eicosanol, uneicosanol, doeicosanol, trieicosanol, tetraeicosanol, and isomers thereof.
- the ketones produced in the invention have from 4 to 30 carbon atoms.
- the ketones are cyclic.
- the ketones are branched.
- the ketones are straight chained.
- Suitable ketones for the invention include, but are not limited to, butanone, pentanone, hexanone, heptanone, octanone, nonanone, decanone, undecanone, dodecanone, tridecanone, tetradecanone, pentadecanone, hexadecanone, heptyldecanone, octyldecanone, nonyldecanone, eicosanone, uneicosanone, doeicosanone, trieicosanone, tetraeicosanone, and isomers thereof.
- interesterification is another such chemical modification.
- Naturally produced glycerolipids do not have a uniform distribution of fatty acid constituents.
- interesterification refers to the exchange of acyl radicals between two esters of different glycerolipids.
- the interesterification process provides a mechanism by which the fatty acid constituents of a mixture of glycerolipids can be rearranged to modify the distribution pattern.
- Interesterification is a well-known chemical process, and generally comprises heating (to about 200°C) a mixture of oils for a period (e.g, 30 minutes) in the presence of a catalyst, such as an alkali metal or alkali metal alkylate (e.g., sodium methoxide).
- a catalyst such as an alkali metal or alkali metal alkylate (e.g., sodium methoxide).
- This process can be used to randomize the distribution pattern of the fatty acid constituents of an oil mixture, or can be directed to produce a desired distribution pattern.
- This method of chemical modification of lipids can be performed on materials provided herein, such as microbial biomass with a percentage of dry cell weight as lipid at least 20%.
- Directed interesterification in which a specific distribution pattern of fatty acids is sought, can be performed by maintaining the oil mixture at a temperature below the melting point of some TAGs which might occur. This results in selective crystallization of these TAGs, which effectively removes them from the reaction mixture as they crystallize. The process can be continued until most of the fatty acids in the oil have precipitated, for example.
- a directed interesterification process can be used, for example, to produce a product with a lower calorie content via the substitution of longer-chain fatty acids with shorter-chain counterparts.
- Directed interesterification can also be used to produce a product with a mixture of fats that can provide desired melting characteristics and structural features sought in food additives or products (e.g., margarine) without resorting to hydrogenation, which can produce unwanted trans isomers.
- Interesterification of oils produced by the methods described herein can be performed in conjuction with one or more of the methods and/or materials, or to produce products, as reported in the following: US Patent Nos.
- transesterification of the oil is followed by reaction of the transesterified product with polyol, as reported in US Patent No. 6,465,642, to produce polyol fatty acid polyesters.
- Such an esterification and separation process may comprise the steps as follows: reacting a lower alkyl ester with polyol in the presence of soap; removing residual soap from the product mixture; water- washing and drying the product mixture to remove impurities; bleaching the product mixture for refinement; separating at least a portion of the unreacted lower alkyl ester from the polyol fatty acid polyester in the product mixture; and recycling the separated unreacted lower alkyl ester.
- Transesterification can also be performed on microbial biomass with short chain fatty acid esters, as reported in U.S. Patent 6,278,006.
- transesterification may be performed by adding a short chain fatty acid ester to an oil in the presence of a suitable catalyst and heating the mixture.
- the oil comprises about 5% to about 90% of the reaction mixture by weight.
- the short chain fatty acid esters can be about 10% to about 50% of the reaction mixture by weight.
- Non-limiting examples of catalysts include base catalysts, sodium methoxide, acid catalysts including inorganic acids such as sulfuric acid and acidified clays, organic acids such as methane sulfonic acid, benzenesulfonic acid, and toluenesulfonic acid, and acidic resins such as Amberlyst 15. Metals such as sodium and magnesium, and metal hydrides also are useful catalysts.
- hydroxylation involves the addition of water to a double bond resulting in saturation and the incorporation of a hydroxyl moiety.
- the hydroxylation process provides a mechanism for converting one or more fatty acid constituents of a glycerolipid to a hydroxy fatty acid. Hydroxylation can be performed, for example, via the method reported in US Patent No. 5,576,027.
- Hydroxylated fatty acids including castor oil and its derivatives, are useful as components in several industrial applications, including food additives, surfactants, pigment wetting agents, defoaming agents, water proofing additives, plasticizing agents, cosmetic emulsifying and/or deodorant agents, as well as in electronics, pharmaceuticals, paints, inks, adhesives, and lubricants.
- fat may be heated, preferably to about 30-50°C combined with heptane and maintained at temperature for thirty minutes or more; acetic acid may then be added to the mixture followed by an aqueous solution of sulfuric acid followed by an aqueous hydrogen peroxide solution which is added in small increments to the mixture over one hour; after the aqueous hydrogen peroxide, the temperature may then be increased to at least about 60°C and stirred for at least six hours; after the stirring, the mixture is allowed to settle and a lower aqueous layer formed by the reaction may be removed while the upper heptane layer formed by the reaction may be washed with hot water having a temperature of about 60 °C; the washed heptane layer may then be neutralized with an aqueous potassium hydroxide solution to a pH of about 5 to 7 and then removed by distillation under vacuum; the reaction product may then be dried under vacuum at 100°C and the dried product steam
- Hydroxylation of microbial oils produced by the methods described herein can be performed in conjuction with one or more of the methods and/or materials, or to produce products, as reported in the following: US Patent Nos. 6,590,113 (Oil-based coatings and ink); 4,049,724 (Hydroxylation process); 6,113,971 (Olive oil butter); 4,992,189 (Lubricants and lube additives); 5,576,027 (Hydroxylated milk); and 6,869,597 (Cosmetics).
- the hydroxylation of ricinoleic acid provides a polyol.
- Estolides consist of a glycerolipid in which a hydroxylated fatty acid constituent has been esterified to another fatty acid molecule. Conversion of hydroxylated glycerolipids to estolides can be carried out by warming a mixture of glycerolipids and fatty acids and contacting the mixture with a mineral acid, as described by Isbell et al., JAOCS 71(2): 169-174 (1994). Estolides are useful in a variety of applications, including without limitation those reported in the following: US Patent Nos.
- olefin metathesis Another such chemical modification is olefin metathesis.
- a catalyst severs the alkylidene carbons in an alkene (olefin) and forms new alkenes by pairing each of them with different alkylidine carbons.
- the olefin metathesis reaction provides a mechanism for processes such as truncating unsaturated fatty acid alkyl chains at alkenes by ethenolysis, cross-linking fatty acids through alkene linkages by self-metathesis, and incorporating new functional groups on fatty acids by cross-metathesis with derivatized alkenes.
- olefin metathesis can transform unsaturated glycerolipids into diverse end products. These products include glycerolipid oligomers for waxes; short-chain glycerolipids for lubricants; homo- and hetero-bifunctional alkyl chains for chemicals and polymers; short-chain esters for biofuel; and short-chain hydrocarbons for jet fuel. Olefin metathesis can be performed on triacylglycerols and fatty acid derivatives, for example, using the catalysts and methods reported in U.S. Patent No. 7,119,216, US Patent Pub. No. 2010/0160506, and U.S. Patent Pub. No. 2010/0145086.
- Olefin metathesis of bio-oils generally comprises adding a solution of Ru catalyst at a loading of about 10 to 250 ppm under inert conditions to unsaturated fatty acid esters in the presence (cross-metathesis) or absence (self-metathesis) of other alkenes.
- the reactions are typically allowed to proceed from hours to days and ultimately yield a distribution of alkene products.
- Grubbs Catalyst dichloro[2(l-methylethoxy- a-0)phenyl] methylene- a- C] (tricyclohexyl-phosphine) in toluene at a catalyst loading of 222 ppm may be added to a vessel
- Olefin metathesis of oils produced by the methods described herein can be performed in conjunction with one or more of the methods and/or materials, or to produce products, as reported in the following: Patent App. PCT/US07/081427 (a-olefin fatty acids) and U.S. Patent App. Nos. 12/281,938 (petroleum creams), 12/281,931 (paintball gun capsules), 12/653,742 (plasticizers and lubricants), 12/422,096 (bifunctional organic compounds), and 11/795,052 (candle wax).
- Delipidated meal is a byproduct of preparing algal oil and is useful as animal feed for farm animals, e.g., ruminants, poultry, swine and aquaculture.
- the resulting meal although of reduced oil content, still contains high quality proteins, carbohydrates, fiber, ash, residual oil and other nutrients appropriate for an animal feed. Because the cells are predominantly lysed by the oil separation process, the delipidated meal is easily digestible by such animals.
- Delipidated meal can optionally be combined with other ingredients, such as grain, in an animal feed. Because delipidated meal has a powdery consistency, it can be pressed into pellets using an extruder or expander or another type of machine, which are commercially available.
- Castor oil is a naturally occurring oil isolated from castor beans. Hydrolysis of castor oil yields ricinoleic acid. The production of castor oil from castor beans is difficult because castor beans contain high amounts of ricin. Ricin is an extremely dangerous toxin listed as a schedule 1 compound in the Chemical Weapons Convention. Great care must therefore be taken in the production of castor oil from castor beans.
- a hydroxylated oil isolated from a microalgal cell is provided by an embodiment of the invention. In this way, ricinoleic acid can be produced.
- the hydroxylated oil is a hydroxylated triglyceride.
- the hydroxylated triglyceride of the present invention may be chemically similar to castor oil.
- Example 7 the invention provides a hydroxylated microbial oil.
- the oil of Example 7 when analyzed by GC/MS, showed that the inventors have produced ricinoleic acid (12-hydroxy-9-cis-octadecenoic acid) .
- a fatty acid in accordance with an embodiment of the invention is a hydroxylated fatty acid.
- One embodiment of the hydroxylated fatty acid is ricinoleic acid.
- the microbial hydroxylated oil or hydroxylated fatty acid can be further hydroxylated.
- ricinoleic acid is further hydroxylated, a fatty acid containing two hydroxyl groups, a polyol, is provided.
- the invention provides a composition prepared by reacting a polyol (e.g.,
- hydroxylated oil and/or a hydroxylated fatty acid with a compound that contains an isocyanate moiety.
- Polyurethanes using castor oil and an isocyanate have been produced. Polyurethanes are ubiquitous in the products we use today. Polyurethanes are found in automobiles, toys, atheletic equipment, consumer electronics, shoes, mattresses, cushions, adhesives, construction materials, and the like. Currently, polyurethanes made with castor oil are commercially available from BASF, Itoh Oil and others. Polyurethanes made with hydroxylated soybean oil are commercially available from Cargill, Dow, Bayer and others.
- ricinoleic acid produced by the microbial cells may be further processed into an oleochemical product, including a ricinoleic ester, ricinoleic amide, polyurethane, polyurethane foam, or polyurethane part according to methods known in the art. See, for example, US Patent Nos. 6194475, 4266617, 6403664, and 4058492, and US Patent Application No. 20100227151.
- Prototheca strains were cultivated to achieve a high percentage of oil by dry cell weight. Cryopreserved cells were thawed at room temperature and 500 ul of cells were added to 4.5 ml of medium (4.2 g/L K 2 HP0 4 , 3.1 g/L NaH 2 P0 4 , 0.24 g/L MgS0 4 -7H 2 0, 0.25 g/L Citric Acid monohydrate, 0.025 g/L CaCl 2 2H 2 0, 2g/L yeast extract) plus 2% glucose and grown for 7 days at 28 °C with agitation (200 rpm) in a 6-well plate.
- medium 4.2 g/L K 2 HP0 4 , 3.1 g/L NaH 2 P0 4 , 0.24 g/L MgS0 4 -7H 2 0, 0.25 g/L Citric Acid monohydrate, 0.025 g/L CaCl 2 2H 2 0, 2g/L yeast extract
- Dry cell weights were determined by centrifuging 1 ml of culture at 14,000 rpm for 5 min in a pre-weighed Eppendorf tube. The culture supernatant was discarded and the resulting cell pellet washed with 1 ml of deionized water. The culture was again centrifuged, the supernatant discarded, and the cell pellets placed at -80°C until frozen. Samples were then lyophilized for 24 hrs and dry cell weights calculated. For determination of total lipid in cultures, 3 ml of culture was removed and subjected to analysis using an Ankom system (Ankom Inc., Ard, NY) according to the manufacturer's protocol. Samples were subjected to solvent extraction with an Amkom XT 10 extractor according to the manufacturer's protocol. Total lipid was determined as the difference in mass between acid hydrolyzed dried samples and solvent extracted, dried samples. Percent oil dry cell weight measurements are shown in Table 10.
- Genomic DNA was isolated from algal biomass as follows. Cells (approximately 200 mg) were centifuged from liquid cultures 5 minutes at 14,000 x g. Cells were then resuspended in sterile distilled water, centrifuged 5 minutes at 14,000 x g and the supernatant discarded. A single glass bead ⁇ 2mm in diameter was added to the biomass and tubes were placed at -80°C for at least 15 minutes.
- Samples were removed and 150 ⁇ of grinding buffer (1% Sarkosyl, 0.25 M Sucrose, 50 mM NaCl, 20 mM EDTA, 100 mM Tris-HCl, pH 8.0, RNase A 0.5 ug/ul) was added. Pellets were resuspended by vortexing briefly, followed by the addition of 40 ul of 5M NaCl. Samples were vortexed briefly, followed by the addition of 66 ⁇ of 5% CTAB (Cetyl trimethylammonium bromide) and a final brief vortex. Samples were next incubated at 65 °C for 10 minutes after which they were centrifuged at 14,000 x g for 10 minutes.
- CTAB Cetyl trimethylammonium bromide
- the supernatant was transferred to a fresh tube and extracted once with 300 ⁇ of Phenol:Chloroform:Isoamyl alcohol 12: 12: 1, followed by centrifugation for 5 minutes at 14,000 x g.
- the resulting aqueous phase was transferred to a fresh tube containing 0.7 vol of isopropanol (-190 ⁇ ), mixed by inversion and incubated at room temperature for 30 minutes or overnight at 4°C.
- DNA was recovered via centrifugation at 14,000 x g for 10 minutes.
- the resulting pellet was then washed twice with 70% ethanol, followed by a final wash with 100% ethanol. Pellets were air dried for 20-30 minutes at room temperature followed by resuspension in 50 ⁇ of lOmM TrisCl, ImM EDTA (pH 8.0).
- TGTTGAAGAATGAGCCGGCGAC-3 ' (SEQ ID NO: 9) at lOmM stock concentration).
- This primer sequence runs from position 567-588 in Gen Bank accession no. L43357 and is highly conserved in higher plants and algal plastid genomes. This was followed by the addition of 0.4 ⁇ primer SZ02615 (5 ' -CAGTGAGCTATTACGCACTC-3 ' (SEQ ID NO: 10) at 10 mM stock concentration).
- SZ02615 5 ' -CAGTGAGCTATTACGCACTC-3 ' (SEQ ID NO: 10) at 10 mM stock concentration.
- This primer sequence is complementary to position 1112-1093 in Gen Bank accession no. L43357 and is highly conserved in higher plants and algal plastid genomes.
- 5 ⁇ of diluted total DNA and 3.2 ⁇ d3 ⁇ 40 were added.
- PCR reactions were run as follows: 98°C, 45" ; 98°C, 8" ; 53°C, 12" ; 72°C, 20" for 35 cycles followed by 72°C for 1 min and holding at 25 °C.
- 20 ⁇ of 10 mM Tris, pH 8.0 was added to each reaction, followed by extraction with 40 ⁇ of
- Purified plasmid DNA was sequenced in both directions using Ml 3 forward and reverse primers. In total, twelve Prototheca strains were selected to have their 23 S rRNA DNA sequenced and the sequences are listed in the Sequence Listing. A summary of the strains and Sequence Listing Numbers is included below. The sequences were analyzed for overall divergence from the UTEX 1435 (SEQ ID NO: 15) sequence. Two pairs emerged (UTEX 329/UTEX 1533 and UTEX
- Oil extracted from Prototheca moriformis was refined and bleached using standard vegetable oil processing methods. Briefly, crude oil extracted from Prototheca moriformis was clarified in a horizontal decanter, where the solids were separated from the oil. The clarified oil was then transferred to a tank with citric acid and water and left to settle for approximately 24 hours. After 24 hours, the mixture in the tank formed 2 separate layers. The bottom layer was composed of water and gums that were then removed by decantation prior to transferring the degummed oil into a bleaching tank. The oil was then heated along with another dose of citric acid. Bleaching clay was then added to the bleaching tank and the mixture was further heated under vacuum in order to evaporate off any water that was present.
- Chlorophyll (mcg/g) nd ⁇ 0.03 mcg/g
- Table 14 Elemental analysis of refined and bleached Prototheca moriformis oil.
- Prototheca strains were grown in proteose medium (2g/L yeast extract, 2.94mM NaN03, 0.17mM CaC12 » 2H20, 0.3mM MgS04 » 7H20, 0.4mM K2HP04, 1.28mM
- the cells were scraped from the plates with a rubber spatula, mixed with 100 ⁇ of medium and spread on plates containing the appropriate antibiotic selection. After 7-10 days of incubation at 25°C, colonies representing transformed cells were visible on the plates. Colonies were picked and spotted on selective (either antibiotic or carbon source) agar plates for a second round of selection.
- each of the above thioesterase constructs was transformed in to Prototheca moriformis (UTEX 1435) using biolistic particle bombardment.
- Other transformation methods including homologous recombination as disclosed in PCT
- the transit peptide for each of the higher plant thioesterase was replaced with an algal codon optimized transit peptide from Prototheca moriformis delta 12 fatty acid desaturase (SEQ ID NO: 48)) or from Chlorella protothecoides stearoyl ACP desaturase (SEQ ID NO: 49). All thioesterase constructs were driven by the Chlamydomanas reinhardtii beta-tubulin promoter/5 'UTR. Growth and lipid production of selected positive clones were compared to wildtype (untransformed) Prototheca moriformis (UTEX 1435). Wildtype and selected positive clones were grown on 2% glucose G418 plates. Lipid profiles analysis on selected positive clones for each construct is summarized below (expressed in Area ) in Table 15.
- the homologous DNA that was used was from the 6S genomic DNA sequence from Prototheca moriformis UTEX 1435 (donor sequences given in SEQ ID 92 and SEQ ID 84)
- the selection agent was the ability to grow on sucrose, using a codon optimized sucl gene from S. cereveisiae driven by the C. reinhardtii beta tubulin promoter.
- the native U. americana transit peptide was replaced by the Chlorella protothecoides (UTEX 250) stearoyl ACP desaturase transit peptide.
- the cDNA of this construct is listed in the Sequence Listing as SEQ ID NO: 50. Selection of positive clones was performed on 2% sucrose plates and the resulting cultures for lipid profile determination was also grown on 2% sucrose containing medium. A representative lipid profile for this Prototheca moriformis strain containing a homologously recombined heterologous U. americana thioesterase is summarized in Table 16.
- camphora, U. californica or U. americana thioesterase were assessed for novel lipid profiles.
- the C. hookeriana thioesterase containing clone achieved the following lipid profile when grown in 2% glucose, 25mg/ml G418 at 22°C: 5.10% C8:0; 18.28% C10:0; 0.41% C12:0; 1.76% C14:0; 16.31% C16:0; 1.40% C18:0; 40.49% C18: l; and 13.16% C18:2.
- the C. hookeriana thioesterase containing clone achieved the following lipid profile when grown in 2% glucose, 25mg/ml G418 at 22°C: 5.10% C8:0; 18.28% C10:0; 0.41% C12:0; 1.76% C14:0; 16.31% C16:0; 1.40% C18:0; 40.49% C18: l; and 13.16% C18:2.
- camphora thioesterase-containing clone (also containing an exogenous sucrose invertase) achieved the following lipid profile when grown in 2% sucrose at 25°C: 0.04% C10:0; 6.01% C12:0; 35.98% C14:0; 19.42 C16:0; 1.48% C18:0; 25.44% C18: l ; and 9.34% C18:2.
- calfornica thioesterase containing clone achieved the following lipid profile when grown in 2% glucose, 25-100 mg/ml G418 at 22°C: 0% C8:0; 0.11% C10:0; 34.01% C12:0; 5.75% C14:0; 14.02% C16:0; 1.10% C18:0; 28.93% C18: l; and 13.01% C18:2.
- americana thioesterase containing clone achieved the following lipid profile when grown in 2% glucose at 28°C: 1.54% C10:0; 0.43% C12:0; 7.56% C14:0; 39.45% C16:0; 2.49% C18:0; 38.49% C18: l; and 7.88% C18:2.
- thioesterases include a broad specificity thioesterase (04:0-08:0) from Myristicafragrans, a C16:0-preferring thioesterase from Garcinia mangostana, a C16:0-preferring thioesterase from Cuphea hookeriana, a C16:0-preferring thioesterase from Elaeis guiniensis, a 08:0- preferring thioesterase from Brassica napus, and a C 18: 1 -preferring thioesterase from Ricinus communis. Details of the expression constructs and the resulting transgenic clones from each of the above transgene/transformations are described below.
- a broad specificity thioesterase (04:0-08:0) thioesterase from Myristica fragrans was introduced into a Prototheca moriformis UTEX 1435 genetic background using methods described above.
- Two different expression constructs were tested, each containing a different plastid targeting sequences.
- the S. cerevisiae sucrose invertase gene suc2 was utilized as a selectable marker, conferring to positive transformants the ability to grow on plates with sucrose as the sole carbon source.
- Both expression constructs, pSZ1318 and pSZ1317 contained a 5' (SEQ ID NO: 82) and 3' (SEQ ID NO: 84) homologous
- S. cerevisiae suc2 sucrose invertase coding region under the control of C. reinhardtii ⁇ -tubulin promoter/5 'UTR and Chlorella vulgaris nitrate reductase 3' UTR.
- This S. cerevisiae suc2 expression cassette is listed as SEQ ID NO: 159.
- pSZ1318 contained the M. fragrans thioesterase coding region with the native transit peptide replaced with the transit peptide from Prototheca moriformis delta 12 FAD (SEQ ID NO:
- Positive clones were selected from each transformation and grown in medium with sucrose as the sole carbon source under nitrogen-limited conditions for lipid production. Lipid profiles of a subset of the positive clones selected were determined using direct transesterification methods described above and are summarized in Table 17.
- a C16:0-preferring thioesterase from Garcinia mangostana was introduced into a Prototheca moriformis UTEX 1435 genetic background, and the codon-optimized cDNA sequences and amino acid sequences are listed in the Sequence Listing as specified above.
- the expression construct contained a 5' (SEQ ID NO: 82) and 3' (SEQ ID NO: 84) homologous recombination targeting sequences (flanking the construct) to the 6S genomic region for integration into the nuclear genome and a S. cerevisiae suc2 sucrose invertase coding region under the control of C.
- This S. cerevisiae suc2 expression cassette is listed as SEQ ID NO: 159 and served as a selection marker.
- the G. manogstana coding region was under the control of the Prototheca moriformis Amt03 promoter/5 'UTR (SEQ ID NO: 89) and C. vulgaris nitrate reductase 3 'UTR. The G.
- Manogstana native transit peptide was also replaced with the transit peptide from C.protothecoides stearoyl desaturase (SEQ ID NO: 49) and the cDNA sequence of the thioesterase with the replaced transit peptide is listed as SEQ ID NO: 147.
- the entire Garcinia mangostana expression cassette was termed pSZ1452 and transformed into a Prototheca moriformis genetic background. Positive clones were screened on plates with sucrose as the sole carbon source. A subset of the positive clones were selected and grown under lipid production conditions and lipid profiles were determined using direct transesterification methods as described above. The lipid profiles of the selected clones are summarized in Table 18 below. [0437] Table 18. Lipid profiles of Garcinia mangostana C16:0-preferring thioesterase transgenic Prototheca cells.
- a C16:0-preferring thioesterase from Cuphea hookeriana was introduced into a Prototheca moriformis UTEX 1435 genetic background.
- Two expression constructs were created, one with the native Cuphea hookeriana C16-preferring thioesterase transit peptide sequence, termed pSZ1417, and a second where the native transit peptide sequence was replaced with the transit peptide from C. protothecoides stearoyl-ACP desaturase (SEQ ID NO: 49), termed pSZ1462.
- the coding sequence of the C. hookeriana thioesterase with the native transit peptide is listed as SEQ ID NO: 149 and the coding sequence of the C.
- hookeriana thioesterase with the replaced transit peptide is listed as SEQ ID NO: 160.
- Both expression constructs contained a 5' (SEQ ID NO: 82) and 3' (SEQ ID NO: 84) homologous recombination targeting sequences (flanking the construct) to the 6S genomic region for integration into the nuclear genome and a S. cerevisiae suc2 sucrose invertase coding region under the control of C. reinhardtii ⁇ -tubulin promoter/5 'UTR and Chlorella vulgaris nitrate reductase 3' UTR.
- This S. cerevisiae suc2 expression cassette is listed as SEQ ID NO: 159 and served as a selection marker. In both constructs, the C.
- hookeriana coding region was under the control of the Prototheca moriformis Amt03 promoter/5 'UTR (SEQ ID NO: 89) and C. vulgaris nitrate reductase 3 'UTR. Both constructs were transformed into a Prototheca moriformis genetic background and positive clones were screened on plates with sucrose as the sole carbon source. A subset of the positive clones were selected and grown under lipid production conditions and lipid profiles were determined using direct transesterification methods as described above. The lipid profiles of the selected clones are summarized in Table 19 below.
- Table 19 Lipid profiles of Cuphea hookeriana C16:0 preferring thioesterase transgenic Prototheca cells. Strain C10:0 C12:0 C14:0 C16:0 C18:0 C18:l C18:2 wildtype 0.01 0.03 1.17 25.86 2.84 58.33 9.16 pSZ1417 0.02 0.06 4.21 55.29 2.59 26.87 9.02 clone A
- E. guiniensis palmitoyl-ACP thioesterase was introduced into a Prototheca moriformis UTEX 1435 genetic background.
- the codon- optimized cDNA sequences and amino acid sequences are listed in the Sequence Listing as specified above.
- the two thioesterases share a significant level of amino acid identity (over 94%), but their respective roles in the African oil palm plant is still unclear.
- the construct encoding the E. guiniensis palmitoyl-ACP thioesterase was termed pSZ1437, and the construct encoding the E. guiniensis palmitoyl-ACP thioesterase PATE was termed pSZ1436.
- Both expression constructs contained a 5' (SEQ ID NO: 82) and 3' (SEQ ID NO: 84) homologous recombination targeting sequences (flanking the construct) to the 6S genomic region for integration into the nuclear genome and a S.
- S. cerevisiae suc2 sucrose invertase coding region under the control of C. reinhardtii ⁇ -tubulin promoter/5 'UTR and Chlorella vulgaris nitrate reductase 3' UTR.
- This S. cerevisiae suc2 expression cassette is listed as SEQ ID NO: 159 and served as a selection marker.
- the E. guiniensis thioesterase coding region was under the control of the Prototheca moriformis Amt03 promoter/5 'UTR (SEQ ID NO: 89) and C. vulgaris nitrate reductase 3'UTR.
- Table 20 Lipid profiles of Elaeis guiniensis C16:0 preferring thioesterase transgenic Prototheca cells.
- a C18:0-preferring thioesterase from Brassica napus was introduced into a Prototheca moriformis UTEX 1435 genetic background, and the codon-optimized cDNA sequences and amino acid sequences are listed in the Sequence Listing as specified above.
- the expression construct contained a 5' (SEQ ID NO: 82) and 3' (SEQ ID NO: 84) homologous recombination targeting sequences (flanking the construct) to the 6S genomic region for integration into the nuclear genome and a S. cerevisiae suc2 sucrose invertase coding region under the control of C.
- This S. cerevisiae suc2 expression cassette is listed as SEQ ID NO: 159 and served as a selection marker.
- the B. napus coding region was under the control of the Prototheca moriformis Amt03 promoter/5 'UTR (SEQ ID NO: 89) and C. vulgaris nitrate reductase 3 'UTR.
- the entire Brassica napus expression cassette was termed pSZ1358 and transformed into a Prototheca moriformis genetic background. Positive clones were screened on plates with sucrose as the sole carbon source. A subset of the positive clones were selected and grown under lipid production conditions and lipid profiles were determined using direct transesterification methods as described above. The lipid profiles of the selected clones are summarized in Table 21 below.
- Table 21 Lipid profiles of Brassica napus C18:0-preferring thioesterase transgenic Prototheca cells.
- a fatty acyl-ACP thioesterase from Ricinus communis was introduced into a Prototheca moriformis UTEX 1435 genetic background, and the codon-optimized cDNA sequences and amino acid sequences are listed in the Sequence Listing as specified above.
- the expression construct contained a 5' (SEQ ID NO: 82) and 3' (SEQ ID NO: 84) homologous recombination targeting sequences (flanking the construct) to the 6S genomic region for integration into the nuclear genome and a S. cerevisiae suc2 sucrose invertase coding region under the control of C.
- This S. cerevisiae suc2 expression cassette is listed as SEQ ID NO: 159 and served as a selection marker.
- the R. communis coding region was under the control of the Prototheca moriformis Amt03 promoter/5 'UTR (SEQ ID NO: 89) and C. vulgaris nitrate reductase 3 'UTR.
- the Ricinus communis native transit peptide was also replaced with the transit peptide from C.protothecoides stearoyl desaturase (SEQ ID NO: 49) and the cDNA sequence of the thioesterase with the replaced transit peptide is listed as SEQ ID NO: 155.
- the entire Ricinus communis expression cassette was termed pSZ1375 and transformed into a Prototheca moriformis genetic background. Positive clones were screened on plates with sucrose as the sole carbon source. A subset of the positive clones were selected and grown under lipid production conditions and lipid profiles were determined using direct transesterification methods as described above. The lipid profiles of the selected clones are summarized in Table 22 below.
- Table 22 Lipid profiles of Ricinus communis ACP- thioesterase transgenic Prototheca cells.
- Microalgae strain Prototheca moriformis (UTEX 1435) was transformed using the above disclosed methods to express multiple thioesterases in a single clone.
- the expression of multiple thioesterases in a single clone allows the microaglae to produce oils with fatty acid profiles completely different from those elaborated when any single thioesterase is expressed alone (as demonstrated in the preceding Examples).
- Prototheca moriformis (UTEX 1435) was first transformed with the Cinnamomum camphora thioesterase (a C14 preferring thioesterase) along with a sucrose invertase gene, the sucl from S.
- the DNA used for this homologous recombination construct is from the KE858 region of Prototheca moriformis genomic DNA as described in the Section III above. The relevant portion of this construct is listed in the Sequence Listing as SEQ ID NO: 51. Positive clones were screened on sucrose-containing plates.
- a positive clone was then re-transformed with one of three cassettes, each encoding resistence to the antibiotic G418 as well as an additional thioesterase: (1) thioesterase gene from Cuphea hookeriana (C8-10 preferring), SEQ ID NO: 52; (2) thioesterase gene from Umbellularia californica (C12 preferring), SEQ ID NO: 53; or thioesterase from Ulmus americana (broad; C10-C16 preferring), SEQ ID NO: 54. Included in the Sequence Listing is the sequence of the relevant portion of each construct. Clones expressing both thioesterase genes were screened on sucrose containing medium with 50 ⁇ g/ml G418. Positive clones were selected and growth and lipid profile were assayed. Table 23 summarizes the lipid profile of representative positive clones (expressed in Area %).
- Table 23 Lipid profiles of Prototheca moriformis transformed with multiple thioesterases.
- Double thioesterase clones with two homologous recombination constructs (one targeting the 6S region and the other targeting the KE858 region) containing the C. camphora thioestease were produced.
- a positive representative clone had a fatty acid profile of: 0% C8:0; 0.06% C10:0; 5.91% C12:0; 43.27% C14:0; 19.63% C16:0; 0.87% C18:0; 13.96% C18: l; and 13.78% C18:2, with a total saturates at 69.74%.
- This clone had a C12-C14 level at over 49%, which is over 37 times the C12-C14 level in wildtype cells.
- hookeriana ClO-preferring thioesterase accumulates anywhere from 3.66 to 8.65%, respectively.
- C8-C10 fatty acid levels are similar to coconut oil and palm kernel, however, the transgenic algal strains lack the significantly higher C12:0 fatty acids, and they have extremely high C16:0 (23% in transgenics versus 11-16% in coconut or palm kernel oil, respectively and/or 18: 1 (50-57% in transgenics versus 8-19% in coconut or palm kernel oil, respectively.
- CwFatB l (U56103): MVAAAASSAFFSVPTPGTSPKPGKFGNWPSSLSVPFKPDNGGFVKANASAHPKANGS AVNLKSGSLETPPRSFINQLPDLSMLLSKITTVFGAAEKQWKRPGMLVEPFGVDRIFQ DGVFFRQSFSIRSYEIGVDRTASIETLMNIFQETSLNHCKSIGLLNDGFGRTPEMCKRD LIWVVTKIQVEVNRYPTWGDTIEVNTWVSESGKNGMGRDWLISDCRTGEILIRATSV WAMMNQNTRRLSKFPYEVRQEIAPHFVDSAPVIEDDRKLHKLDVKTGDSIRDGLTPR WNDLDVNQHVNNVKYIGWILKSVPIEVFETQELCGVTLEYRRECGRDSVLESVTTM DPAKEGDRCVYQHLLRLEDGADITIGRTEWRPKNAGANGAISSGKTSNGNSVS (SEQ ID NO: 186)
- NAGTNRAIST SEQ ID NO: 1857
- Transformation of UTEX1435 with C. wrightii thioesterases In this example, UTEX 1435 strain was used as the recipient strain into which cassettes expressing the C. wrightii FatBl and FatB2 thioesterases were introduced.
- the transformation constructs contain a cassette allowing for selection on sucrose (the Saccharomyces cerevesiae suc2 gene) along with the thioesterases. Cells were transformed as previously described using biolistics. Cells were transformed directly on media containing 2% sucrose. Transformation constructs were made such that the expression of the thioesterases were driven either by the C. reinhardtii B-tubulin promoter or by the endogenous UTEX 1435 Amt3 promoter.
- TP1 encodes a transit peptide for Stearoyl ACP desaturase derived from UTEX250
- TP2 encodes a transit peptide for Stearoyl ACP desaturase from derived from UTEX 1435
- TP3 encodes a transit peptide of delta 12 Fatty Acid desaturase derived from UTEX 1435
- TP4 encodes a transit peptide of isopentenyl diphosphate synthase derived from UTEX 1435.
- Table 24 The constructs used in this example are listed in Table 24 below.
- Const.l CrbTub_suc2_nr::CrbTub_CwFatBl_nr-6S, designated as Const.l is given below.
- Relevant restriction sites are indicated in lowercase, bold and underlining and are 5 '-3' Sapl, Kpnl, AscI, Mfel, BamHI, EcoRI,SpeI, AscI, XhoI,SacI and Sapl, respectively.
- Sapl sites delimit the 5' and 3' ends of the transforming DNA. Underlined sequences at the 5' and 3' flanks of the construct represent genomic DNA from UTEX1435 that permit targeted integration of the transforming DNA via homologous recombination (6S region). Proceeding in the 5' to 3' direction, the C.
- the initiator ATG and terminator TGA of the thioesterase are indicated in uppercase, bold italicized text while the remainder of the coding region is indicated in lowercase italics.
- the predicted plastid targeting sequence of the thioesterase lies between the initiator ATG and the AscI site in the sequence.
- the C. vulgaris nitrate reductase 3 'UTR is indicated by bold text.
- TP1 (UTEX250 Stearoyl ACP Desaturase transit peptide sequence)
- TP2 (UTEX1435 Stearoyl ACP Desaturase transit peptide sequence) actas£ATGgcttccgcggcattcaccatgtcggcgtgccccgcgatgactggcagggcccctggggcacgtcgctccggacg gccagfcgccacccgccteagggggggcgcgccc (SEQ ID NO: 192)
- TP3 (UTEX1435 Deltal2 Fatty Acid Desaturase transit peptide sequence)
- TP4 (UTEX1435 Isopentenyl Diphospate Synthase transit peptide sequence)
- transgenic UTEX 1435 lines expressing CwFatB l (Const.1 & Const.3) with the native, higher plant transit peptide, show an impact primarily on C14:0 fatty acid accumulation and to a lesser extent on C12:0 fatty acid accumulation.
- CrbTub (Const.
- TP2 (UTEX 1435 Stearoyl ACP Desaturase chloroplast targeting sequence)
- TP3 (UTEX 1435 Delta 12 Fatty Acid Desaturase chloroplast targeting sequence) show a greater impact on C12:0 and C14:0 accumulation. It appears that these two transit peptides (TPl & TP2) are better at targeting the CwFatBl to the plastid in UTEX 1435.
- UTEX 1435 transgenic lines show a significantly lower C14:C16 ratio compared to the A. thaliana transgenic lines (Table 29).
- the C12:C14 and C14:C16 ratios in the UTEX 1435 transgenic lines generated with Const.2, 4, 9 are significantly different than the A. thaliana transgenic lines expressing the same thioesterase (Table 29).
- the expression of CwFatB l and CwFatB2 in UTEX 1435 generated an oil profile that is significantly different than that generated in transgenic lines of Arabidopsis expressing the same thioesterases.
- the oil profile in these UTEX 1435 transgenic lines is also distinctly different from that in wild type UTEX 1435.
- the modified oils produced by the transgenic lines described in this Example are also significantly different than the laurate rich oils generated in transgenic UTEX 1435 lines expressing a C12:0 specific thioesterase from Umbellularia californica (described previously).
- Table 25 Fatty acid profiles (expressed as area ) in UTEX1435, A.thaliana wild type (Ath) and A haliana transgenic lines expressing CwFatBl (CwFatBl -Ath) and CwFatB2 (CwFatB2-Ath) thioesterases.
Landscapes
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Genetics & Genomics (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biotechnology (AREA)
- General Engineering & Computer Science (AREA)
- Biomedical Technology (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- Microbiology (AREA)
- Molecular Biology (AREA)
- Medicinal Chemistry (AREA)
- Oil, Petroleum & Natural Gas (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Plant Pathology (AREA)
- Biophysics (AREA)
- Physics & Mathematics (AREA)
- Cell Biology (AREA)
- Polymers & Plastics (AREA)
- Nutrition Science (AREA)
- Food Science & Technology (AREA)
- Mycology (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Liquid Carbonaceous Fuels (AREA)
- Edible Oils And Fats (AREA)
- Coloring Foods And Improving Nutritive Qualities (AREA)
- Fats And Perfumes (AREA)
- Solid Fuels And Fuel-Associated Substances (AREA)
Priority Applications (14)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| SG2013058870A SG192594A1 (en) | 2011-02-02 | 2012-02-02 | Tailored oils produced from recombinant oleaginous microorganisms |
| AU2012212079A AU2012212079B2 (en) | 2011-02-02 | 2012-02-02 | Tailored oils produced from recombinant oleaginous microorganisms |
| KR1020197008914A KR102117225B1 (ko) | 2011-02-02 | 2012-02-02 | 재조합 유지성 미생물로부터 생산된 맞춤 오일 |
| MX2016015902A MX351063B (es) | 2011-02-02 | 2012-02-02 | Aceites adaptados producidos a partir de microorganismos oleaginosos recombinantes. |
| EP19191818.4A EP3643774A1 (en) | 2011-02-02 | 2012-02-02 | Tailored oils produced from recombinant oleaginous microorganisms |
| KR1020137023181A KR101964965B1 (ko) | 2011-02-02 | 2012-02-02 | 재조합 유지성 미생물로부터 생산된 맞춤 오일 |
| JP2013552645A JP6071904B2 (ja) | 2011-02-02 | 2012-02-02 | 組み換え油産生微生物から生成される用途に応じた油 |
| CA2825691A CA2825691C (en) | 2011-02-02 | 2012-02-02 | Tailored oils produced from recombinant oleaginous microorganisms |
| MX2013008651A MX344012B (es) | 2011-02-02 | 2012-02-02 | Aceites adaptados producidos a partir de microorganismos oleaginosos recombinantes. |
| EP12741997.6A EP2670855B1 (en) | 2011-02-02 | 2012-02-02 | Tailored oils produced from recombinant oleaginous microorganisms |
| CN201280007593.3A CN103827307A (zh) | 2011-02-02 | 2012-02-02 | 产自重组产油微生物的定制油 |
| BR112013019699A BR112013019699A2 (pt) | 2011-02-02 | 2012-02-02 | método de produção de um óleo natural, óleo natural, produto, célula recombinante, célula de microrganismo, e, alimento |
| AU2016247159A AU2016247159B2 (en) | 2011-02-02 | 2016-10-20 | Tailored oils produced from recombinant oleaginous microorganisms |
| AU2019200668A AU2019200668A1 (en) | 2011-02-02 | 2019-01-31 | Tailored oils produced from recombinant oleaginous microorganisms |
Applications Claiming Priority (8)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201161438969P | 2011-02-02 | 2011-02-02 | |
| US61/438,969 | 2011-02-02 | ||
| US201161476691P | 2011-04-18 | 2011-04-18 | |
| US61/476,691 | 2011-04-18 | ||
| US201161484458P | 2011-05-10 | 2011-05-10 | |
| US61/484,458 | 2011-05-10 | ||
| US201161548616P | 2011-10-18 | 2011-10-18 | |
| US61/548,616 | 2011-10-18 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2012106560A1 true WO2012106560A1 (en) | 2012-08-09 |
| WO2012106560A9 WO2012106560A9 (en) | 2013-01-24 |
Family
ID=46601075
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2012/023696 Ceased WO2012106560A1 (en) | 2011-02-02 | 2012-02-02 | Tailored oils produced from recombinant oleaginous microorganisms |
Country Status (11)
| Country | Link |
|---|---|
| US (5) | US9249436B2 (https=) |
| EP (2) | EP2670855B1 (https=) |
| JP (3) | JP6071904B2 (https=) |
| KR (2) | KR101964965B1 (https=) |
| CN (2) | CN110066836A (https=) |
| AU (3) | AU2012212079B2 (https=) |
| BR (1) | BR112013019699A2 (https=) |
| CA (1) | CA2825691C (https=) |
| MX (2) | MX351063B (https=) |
| SG (1) | SG192594A1 (https=) |
| WO (1) | WO2012106560A1 (https=) |
Cited By (43)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2013082186A2 (en) | 2011-11-28 | 2013-06-06 | Solazyme, Inc. | Genetically engineered microbial strains including prototheca lipid pathway genes |
| WO2013158938A1 (en) | 2012-04-18 | 2013-10-24 | Solazyme, Inc. | Tailored oils |
| US8592188B2 (en) | 2010-05-28 | 2013-11-26 | Solazyme, Inc. | Tailored oils produced from recombinant heterotrophic microorganisms |
| US8633012B2 (en) | 2011-02-02 | 2014-01-21 | Solazyme, Inc. | Tailored oils produced from recombinant oleaginous microorganisms |
| WO2014138593A2 (en) | 2013-03-08 | 2014-09-12 | Solazyme, Inc. | Oleaginous microbial lubricants |
| WO2014151904A1 (en) | 2013-03-15 | 2014-09-25 | Solazyme, Inc. | Thioesterases and cells for production of tailored oils |
| US8846352B2 (en) | 2011-05-06 | 2014-09-30 | Solazyme, Inc. | Genetically engineered microorganisms that metabolize xylose |
| WO2014176515A2 (en) | 2013-04-26 | 2014-10-30 | Solazyme, Inc. | Low polyunsaturated fatty acid oils and uses thereof |
| JP2014212732A (ja) * | 2013-04-25 | 2014-11-17 | 旭硝子株式会社 | リシノール酸産生酵母 |
| WO2014138732A3 (en) * | 2013-03-08 | 2014-12-04 | Bp Corporation North America Inc. | Microorganisms with altered fatty acid profiles for renewable materials and biofuel production |
| WO2015051319A2 (en) | 2013-10-04 | 2015-04-09 | Solazyme, Inc. | Tailored oils |
| US9066527B2 (en) | 2010-11-03 | 2015-06-30 | Solazyme, Inc. | Microbial oils with lowered pour points, dielectric fluids produced therefrom, and related methods |
| WO2015133305A1 (ja) * | 2014-03-03 | 2015-09-11 | 花王株式会社 | β-ケトアシル-ACPシンターゼを用いた脂質の製造方法 |
| WO2015164550A1 (en) | 2014-04-23 | 2015-10-29 | Solazyme, Inc. | Food-related uses of high-stability oil |
| CN105164252A (zh) * | 2013-01-29 | 2015-12-16 | 索拉兹米公司 | 变体硫酯酶及使用方法 |
| WO2016004401A1 (en) | 2014-07-03 | 2016-01-07 | Solazyme, Inc. | Lubricants and wellbore fluids |
| WO2016007862A2 (en) | 2014-07-10 | 2016-01-14 | Solazyme, Inc. | Novel ketoacyl acp synthase genes and uses thereof |
| US9290749B2 (en) | 2013-03-15 | 2016-03-22 | Solazyme, Inc. | Thioesterases and cells for production of tailored oils |
| US9353389B2 (en) | 2008-11-28 | 2016-05-31 | Solazyme, Inc. | Nucleic acids useful in the manufacture of oil |
| US9394550B2 (en) | 2014-03-28 | 2016-07-19 | Terravia Holdings, Inc. | Lauric ester compositions |
| JP2016523093A (ja) * | 2013-06-25 | 2016-08-08 | セレクティスCellectis | バイオ燃料生産のための改変された珪藻 |
| WO2016160999A1 (en) | 2015-03-31 | 2016-10-06 | Solazyme, Inc. | Microalgae adapted for heterotrophic culture conditions |
| WO2016164495A1 (en) | 2015-04-06 | 2016-10-13 | Solazyme, Inc. | Oleaginous microalgae having an lpaat ablation |
| US9518277B2 (en) | 2012-12-07 | 2016-12-13 | Terravia Holdings, Inc. | Genetically engineered microbial strains including Chlorella protothecoides lipid pathway genes |
| US9719114B2 (en) | 2012-04-18 | 2017-08-01 | Terravia Holdings, Inc. | Tailored oils |
| US9765368B2 (en) | 2014-07-24 | 2017-09-19 | Terravia Holdings, Inc. | Variant thioesterases and methods of use |
| US9783836B2 (en) | 2013-03-15 | 2017-10-10 | Terravia Holdings, Inc. | Thioesterases and cells for production of tailored oils |
| US9816079B2 (en) | 2013-01-29 | 2017-11-14 | Terravia Holdings, Inc. | Variant thioesterases and methods of use |
| WO2018067849A2 (en) | 2016-10-05 | 2018-04-12 | Terravia Holdings, Inc. | Novel acyltransferases, variant thioesterases, and uses thereof |
| US10098371B2 (en) | 2013-01-28 | 2018-10-16 | Solazyme Roquette Nutritionals, LLC | Microalgal flour |
| US10119947B2 (en) | 2013-08-07 | 2018-11-06 | Corbion Biotech, Inc. | Protein-rich microalgal biomass compositions of optimized sensory quality |
| US10125382B2 (en) | 2014-09-18 | 2018-11-13 | Corbion Biotech, Inc. | Acyl-ACP thioesterases and mutants thereof |
| US10138435B2 (en) | 2007-06-01 | 2018-11-27 | Corbion Biotech, Inc. | Renewable diesel and jet fuel from microbial sources |
| WO2020041521A1 (en) * | 2018-08-22 | 2020-02-27 | Corbion Biotech, Inc. | β-KETOACYL-ACP SYNTHASE II VARIANTS |
| US11118134B2 (en) | 2019-02-11 | 2021-09-14 | Checkerspot, Inc. | Triglyceride oil compositions |
| US11208369B2 (en) | 2018-08-30 | 2021-12-28 | Checkerspot, Inc. | Hydroformylated triglycerides and uses thereof |
| US11691382B2 (en) | 2019-12-18 | 2023-07-04 | Checkerspot, Inc. | Uses of microbial derived materials in polymer applications |
| US11873405B2 (en) | 2021-09-17 | 2024-01-16 | Checkerspot, Inc. | High oleic oil compositions and uses thereof |
| US11976212B2 (en) | 2021-12-01 | 2024-05-07 | Checkerspot, Inc. | Polyols, polyurethane dispersions, and uses thereof |
| US11981806B2 (en) | 2021-11-19 | 2024-05-14 | Checkerspot, Inc. | Recycled polyurethane formulations |
| US12059006B2 (en) | 2008-10-14 | 2024-08-13 | Corbion Biotech, Inc. | Microalgal flour |
| WO2026061738A1 (de) | 2024-09-23 | 2026-03-26 | Rheinisch-Westfälische Technische Hochschule Aachen, abgekürzt RWTH Aachen, Körperschaft des öffentlichen Rechts | Plattform zur herstellung mikrobieller triglyzeridmischungen mit einstellbarer zusammensetzung |
| US12600994B2 (en) | 2020-01-16 | 2026-04-14 | Corbion Biotech, Inc. | β-ketoacyl-ACP synthase IV variants |
Families Citing this family (34)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP2686404A4 (en) | 2011-03-17 | 2014-08-13 | Solazyme Inc | PYROLYTIC OIL AND OTHER COMBUSTIBLE COMPOSITIONS FROM MICROBIAL BIOMASS |
| US9163267B2 (en) * | 2012-04-11 | 2015-10-20 | REG Life Sciences, LLC | Metathesis transformations of microbially-produced fatty acids and fatty acid derivatives |
| US20130316364A1 (en) * | 2012-05-23 | 2013-11-28 | Lanzatech New Zealand Limited | Selection Method and Recombinant Microorganisms and uses Therefor |
| BR112015021763B1 (pt) | 2013-03-07 | 2021-06-08 | Genomatica, Inc | método de purificação de um álcool graxo (falc) |
| AU2014236594B2 (en) | 2013-03-14 | 2018-06-14 | The University Of Wyoming Research Corporation | Methods and systems for biological coal-to-biofuels and bioproducts |
| JP2016513977A (ja) | 2013-03-14 | 2016-05-19 | ザ ユニバーシティ オブ ワイオミング リサーチ コーポレーション | 化学合成独立栄養細菌を利用した二酸化炭素の変換システムおよび方法 |
| SI2984490T1 (sl) | 2013-06-14 | 2020-10-30 | Genomatica, Inc. | Metode proizvodnje derivatov omega hidroksilirane maščobne kisline |
| US10687218B2 (en) | 2013-12-03 | 2020-06-16 | Qualcomm Incorporated | Power metric optimization and uplink DM-RS design for LTE/LTE-A uplink transmissions in unlicensed spectrum |
| CN106604990B (zh) | 2014-06-16 | 2022-04-05 | 基因组股份公司 | 具有改进的特性的ω-羟化酶相关的融合多肽 |
| JP6573400B2 (ja) * | 2014-09-08 | 2019-09-11 | 公立大学法人兵庫県立大学 | 珪藻の新規形質転換ベクターおよびその含有する新規プロモーター配列 |
| WO2016105931A1 (en) | 2014-12-23 | 2016-06-30 | Bridgestone Americas Tire Operations, Llc | Oil-containing rubber compositions and related methods |
| US10494642B2 (en) * | 2015-04-28 | 2019-12-03 | Basf Agricultural Solutions Seed, Us Llc | Brassica plants with modified seed oil composition |
| JP6587468B2 (ja) * | 2015-09-11 | 2019-10-09 | 花王株式会社 | 脂質の製造方法 |
| WO2017101987A1 (en) | 2015-12-15 | 2017-06-22 | REG Life Sciences, LLC | Omega-hydroxylase-related fusion polypeptide variants with improved properties |
| US10650621B1 (en) | 2016-09-13 | 2020-05-12 | Iocurrents, Inc. | Interfacing with a vehicular controller area network |
| EP3619301A4 (en) | 2017-05-05 | 2021-03-03 | Purissima, Inc. | NEUROTRANSMITTERS AND THEIR MANUFACTURING PROCESSES |
| CN110885754B (zh) * | 2018-09-07 | 2021-11-12 | 中国石油化工股份有限公司 | 一种利用表面活性剂防治微藻培养过程中生物污染的方法 |
| CN111436499B (zh) * | 2018-12-29 | 2023-03-24 | 丰益(上海)生物技术研发中心有限公司 | 油脂组合物及其制备方法和用途 |
| CN110184084A (zh) * | 2019-05-27 | 2019-08-30 | 江苏大学 | 一种微藻与白土油热解制备生物油的方法及其系统 |
| CA3167348A1 (en) * | 2020-02-10 | 2021-08-19 | Vladimir YONG-GONZALEZ | Microbially produced palm oil substitutes |
| GB202005180D0 (en) * | 2020-04-08 | 2020-05-20 | Ge Healthcare Bio Sciences Ab | Methods for targeted integration |
| GB202005179D0 (en) * | 2020-04-08 | 2020-05-20 | Ge Healthcare Bio Sciences Ab | Methods for the selection of nucleic acid sequences |
| WO2022026341A1 (en) * | 2020-07-28 | 2022-02-03 | The Regents Of The University Of California | Expressing multiple genes from a single transcript in algae and plants |
| US20230329267A1 (en) * | 2020-08-31 | 2023-10-19 | Aak Ab (Publ) | A vegetable fat composition comprising c14 fatty acids and other saturated fatty acids |
| US20230404102A1 (en) * | 2020-11-12 | 2023-12-21 | C16 Biosciences, Inc. | Edible microbial oil |
| CN112576229B (zh) * | 2020-12-11 | 2023-01-24 | 大庆油田有限责任公司 | 一种利用微生物作用地下原油产甲烷方法 |
| KR102491250B1 (ko) | 2021-07-30 | 2023-01-20 | 류시창 | 승강식 피난기 |
| WO2023131656A1 (en) * | 2022-01-05 | 2023-07-13 | Biotrino Aps | Chlorella vulgaris strain with reduced chlorophyll content |
| WO2023133417A2 (en) * | 2022-01-05 | 2023-07-13 | Change Foods, Inc. | Dairy-like compositions |
| WO2023196923A1 (en) * | 2022-04-07 | 2023-10-12 | Checkerspot, Inc. | Ricinoleate oil production and uses thereof |
| WO2023212726A2 (en) * | 2022-04-29 | 2023-11-02 | Checkerspot, Inc. | Regiospecific incorporation of fatty acids in triglyceride oil |
| WO2024238964A1 (en) * | 2023-05-17 | 2024-11-21 | Yali Biosciences Inc. | Engineered yeast and use for production of triacylglycerol |
| CN116515890A (zh) * | 2023-05-25 | 2023-08-01 | 西北农林科技大学 | LuFAD8基因用于调节植物抗寒性和脂肪酸合成的应用 |
| CN120349907A (zh) * | 2025-04-28 | 2025-07-22 | 齐鲁工业大学(山东省科学院) | 一种高效制备10-羟基-2-癸烯酸的酿酒酵母工程菌及其构建方法与应用 |
Citations (119)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4049724A (en) | 1973-11-20 | 1977-09-20 | Atlantic Richfield Company | Osmium catalyzed organic hydroperoxide hydroxylation of olefinic compounds |
| US4058492A (en) | 1974-01-10 | 1977-11-15 | Bayer Aktiengesellschaft | Process for molding polyurethane foams |
| US4266617A (en) | 1979-02-23 | 1981-05-12 | Excel Industries, Inc. | Tractor with full-floating tool bar |
| US4288378A (en) | 1979-05-23 | 1981-09-08 | The Procter & Gamble Company | Method of preparing an enriched peanut oil peanut butter stabilizer |
| US4335156A (en) | 1980-09-19 | 1982-06-15 | Nabisco Brands, Inc. | Edible fat product |
| US4584139A (en) | 1983-01-31 | 1986-04-22 | Olin Corporation | Hydrogenation of long chain olefinic oils with Raney catalyst |
| US4603188A (en) | 1985-07-10 | 1986-07-29 | Itoh Seiyu Kabushiki Kaisha | Curable urethane composition |
| US4798793A (en) | 1983-09-05 | 1989-01-17 | Novo Industri A/S | Immobilized Mucor miehei lipase for transesterification |
| WO1989001032A1 (en) | 1987-07-31 | 1989-02-09 | Novo-Nordisk A/S | Immobilized, positionally non-specific lipase, its production and use |
| US4940845A (en) | 1984-05-30 | 1990-07-10 | Kao Corporation | Esterification process of fats and oils and enzymatic preparation to use therein |
| US4945050A (en) | 1984-11-13 | 1990-07-31 | Cornell Research Foundation, Inc. | Method for transporting substances into living cells and tissues and apparatus therefor |
| US4992189A (en) | 1990-02-07 | 1991-02-12 | Mobil Oil Corporation | Lubricants and lube additives from hydroxylation and esterification of lower alkene oligomers |
| US5080848A (en) | 1988-12-22 | 1992-01-14 | The Proctor & Gamble Company | Process for making concentrated surfactant granules |
| US5091116A (en) | 1986-11-26 | 1992-02-25 | Kraft General Foods, Inc. | Methods for treatment of edible oils |
| US5156963A (en) | 1987-09-28 | 1992-10-20 | Novo Nordisk A/S | Immobilization of lipase by adsorption on a particulate macroporous resin |
| US5233099A (en) | 1990-12-27 | 1993-08-03 | Kao Corporation | Process for producing alcohol |
| US5233100A (en) | 1990-12-27 | 1993-08-03 | Kao Corporation | Process for producing alcohol |
| US5258197A (en) | 1989-09-20 | 1993-11-02 | Nabisco, Inc. | Reduced calorie triglyceride mixtures |
| US5268192A (en) | 1991-07-16 | 1993-12-07 | Nabisco, Inc. | Low calorie nut products and process of making |
| US5298637A (en) | 1992-10-22 | 1994-03-29 | Arco Chemical Technology, L.P. | Process for producing a reduced calorie lipid composition |
| US5304664A (en) | 1988-10-20 | 1994-04-19 | Chemische Fabrik Stockhausen Gmbh | Process for the production of highly sulfated fatty acids and fatty acid derivatives |
| US5342768A (en) | 1988-11-16 | 1994-08-30 | Novo Nordisk A/S | Immobilization of thermostable microbial lipase by adsorption to macroporous inorganic carrier particles |
| US5346724A (en) | 1991-04-12 | 1994-09-13 | Nippon Oil Company, Ltd. | Oil and fat composition for lubricating food processing machines and use thereof |
| US5380894A (en) | 1991-03-01 | 1995-01-10 | The United States Of America As Represented By The Secretary Of Agriculture | Production of hydroxy fatty acids and estolide intermediates |
| US5391383A (en) | 1989-09-20 | 1995-02-21 | Nabisco, Inc. | Edible spray oil |
| US5427704A (en) | 1994-01-28 | 1995-06-27 | The Lubrizol Corporation | Triglyceride oils thickened with estolides of hydroxy-containing triglycerides |
| US5434278A (en) | 1989-09-20 | 1995-07-18 | Nabisco, Inc. | Synthesis of acetoglyceride fats |
| US5451332A (en) | 1994-01-28 | 1995-09-19 | The Lubrizol Corporation | Estolides of hydroxy-containing triglycerides that contain a performance additive |
| US5458795A (en) | 1994-01-28 | 1995-10-17 | The Lubrizol Corporation | Oils thickened with estolides of hydroxy-containing triglycerides |
| US5475160A (en) | 1994-11-07 | 1995-12-12 | Shell Oil Company | Process for the direct hydrogenation of triglycerides |
| US5506201A (en) | 1994-04-29 | 1996-04-09 | International Flavors & Fragrances Inc. | Formulation of a fat surfactant vehicle containing a fragrance |
| US5567359A (en) | 1989-12-29 | 1996-10-22 | The Proctor & Gamble Company | Ultra mild surfactant with good lather |
| US5576027A (en) | 1992-06-29 | 1996-11-19 | Amerchol Corporation | Hydroxylated milk glycerides |
| FI100248B (fi) | 1996-02-05 | 1997-10-31 | Fortum Oil Oy | Keskitisleen valmistus |
| US5686131A (en) | 1994-05-18 | 1997-11-11 | Snow Brand Milk Products Co., Ltd. | Edible oil or fat and edible oil or fat mixture |
| US5776741A (en) | 1994-02-21 | 1998-07-07 | Novo Nordisk A/S | Method of enzyme immobilization on a particulate silica carrier for synthesis inorganic media |
| US5833999A (en) | 1994-10-20 | 1998-11-10 | The Proctor & Gamble Company | Personal treatment compositions and /or cosmetic compositions containing enduring perfume |
| US5871988A (en) | 1993-10-28 | 1999-02-16 | Washington State University Research Foundation | DNA encoding limonene synthase from Mentha spicata |
| US5885440A (en) | 1996-10-01 | 1999-03-23 | Uop Llc | Hydrocracking process with integrated effluent hydrotreating zone |
| US5888947A (en) | 1995-06-06 | 1999-03-30 | Agro Management Group, Inc. | Vegetable oil lubricants for internal combustion engines and total loss lubrication |
| US5891697A (en) | 1997-09-25 | 1999-04-06 | Washington State University Research Foundation | Monoterpene synthases from common sage (Salvia officinalis) |
| US5900370A (en) | 1985-07-01 | 1999-05-04 | Bio-Technical Resources | Process for the production of ascorbic acid with prototheca |
| US5928696A (en) | 1994-08-16 | 1999-07-27 | Dr. Frische Gmbh | Process for extracting native products which are not water-soluble from native substance mixtures by centrifugal force |
| US5942479A (en) | 1995-05-27 | 1999-08-24 | The Proctor & Gamble Company | Aqueous personal cleansing composition with a dispersed oil phase comprising two specifically defined oil components |
| US5994114A (en) | 1996-04-15 | 1999-11-30 | Washington State University Research Foundation | Compositions and methods for taxol biosynthesis |
| US6020509A (en) | 1998-12-22 | 2000-02-01 | Condea Vista Company | Method for producing surfactant compositions |
| US6022577A (en) | 1990-12-07 | 2000-02-08 | Nabisco Technology Company | High stearic acid soybean oil blends |
| US6043072A (en) | 1998-11-05 | 2000-03-28 | Washington State University Research Foundation | Nucleic acids encoding Taxus geranylgeranyl diphosphate synthase, and methods of use |
| US6051539A (en) | 1998-07-02 | 2000-04-18 | Cargill, Inc. | Process for modifying unsaturated triacylglycerol oils resulting products and uses thereof |
| US6057375A (en) | 1995-02-01 | 2000-05-02 | Henkel Kommanditgesellschaft Auf Aktien | Use of alkoxylation products of epoxidized fats as antifoaming agents |
| US6080853A (en) | 1996-08-08 | 2000-06-27 | The Procter & Gamble Company | Polyol polyester synthesis |
| US6083731A (en) | 1997-06-24 | 2000-07-04 | Washington State University Research Foundation | Recombinant materials and methods for the production of limonene hydroxylases |
| US6086903A (en) | 1996-02-26 | 2000-07-11 | The Proctor & Gamble Company | Personal treatment compositions and/or cosmetic compositions containing enduring perfume |
| US6113971A (en) | 1994-07-25 | 2000-09-05 | Elmaleh; David R. | Olive oil butter |
| US6140302A (en) | 1997-03-12 | 2000-10-31 | Cognis Deutschland Gmbh | Method for producing anionic surfactant granulates |
| WO2000066750A2 (en) | 1999-05-03 | 2000-11-09 | Calgene Llc | Methods for producing plants with elevated oleic acid content |
| US6194475B1 (en) | 1998-12-21 | 2001-02-27 | Goldschmidt Ag | Use of metal salts of ricinoleic acid in producing polyurethane |
| US6217746B1 (en) | 1999-08-16 | 2001-04-17 | Uop Llc | Two stage hydrocracking process |
| US6265639B1 (en) | 1998-01-22 | 2001-07-24 | Washington State University Foundation | Gymnosperm nucleic acid molecules encoding sesquiterpene synthases and methods of use |
| US6268517B1 (en) | 2000-05-09 | 2001-07-31 | Condea Vista Company | Method for producing surfactant compositions |
| US6278006B1 (en) | 1999-01-19 | 2001-08-21 | Cargill, Incorporated | Transesterified oils |
| US6342380B1 (en) | 1998-02-02 | 2002-01-29 | The Regents Of The University Of California | Germacrene C synthase gene of Lycopersicon esculentum |
| US6342208B1 (en) | 1996-08-02 | 2002-01-29 | Plum Kerni Produktion A/S | Oil-in-water emulsion containing C10-C24 fatty acid derivatives for treating skin of mammals |
| WO2002008403A2 (en) | 2000-07-25 | 2002-01-31 | Calgene Llc | Nucleic acid sequences encoding beta-ketoacyl-acp synthase and uses thereof |
| US6380410B1 (en) | 1995-10-27 | 2002-04-30 | Basf Aktiengesellschaft | Fatty acid derivatives and their use as surfactants in detergents and cleaners |
| US6391815B1 (en) | 2000-01-18 | 2002-05-21 | Süd-Chemie Inc. | Combination sulphur adsorbent and hydrogenation catalyst for edible oils |
| US6395965B1 (en) | 1997-03-21 | 2002-05-28 | Restoragen, Inc. | Plant containing a gene construct comprising a chlorella virus promoter and a lac operator |
| US6398707B1 (en) | 2001-05-31 | 2002-06-04 | Wen-Teng Wu | Method of preparing lower alkyl fatty acids esters and in particular biodiesel |
| US6403664B1 (en) | 2000-06-20 | 2002-06-11 | Goldschmidt Ag | Combination of metal salts of ricinoleic acid with reactive amines in producing polyurethane forms |
| US6407044B2 (en) | 1998-01-28 | 2002-06-18 | The Proctor & Gamble Company | Aerosol personal cleansing emulsion compositions which contain low vapor pressure propellants |
| US6429014B1 (en) | 1997-07-11 | 2002-08-06 | Washington State University Research Foundation | Monoterpene synthases from grand fir (Abies grandis) |
| US6465642B1 (en) | 1997-02-07 | 2002-10-15 | The Procter & Gamble Company | Lower alkyl ester recycling in polyol fatty acid polyester synthesis |
| US6468955B1 (en) | 1998-05-01 | 2002-10-22 | The Proctor & Gamble Company | Laundry detergent and/or fabric care compositions comprising a modified enzyme |
| US6538169B1 (en) | 2000-11-13 | 2003-03-25 | Uop Llc | FCC process with improved yield of light olefins |
| US20030079249A1 (en) * | 2001-06-29 | 2003-04-24 | John Shanklin | Isoform of castor oleate hydroxylase |
| US6590113B1 (en) | 2002-03-26 | 2003-07-08 | Ronald T. Sleeter | Process for treating oils containing antioxidant compounds |
| US6596768B2 (en) | 2001-05-22 | 2003-07-22 | Church & Dwight Co., Inc. | Unsaturated lipid-enriched feedstock for ruminants |
| US6596155B1 (en) | 2000-09-26 | 2003-07-22 | Uop Llc | Hydrocracking process |
| US6630066B2 (en) | 1999-01-08 | 2003-10-07 | Chevron U.S.A. Inc. | Hydrocracking and hydrotreating separate refinery streams |
| US6692730B2 (en) | 2000-09-20 | 2004-02-17 | L'oreal | Washing composition comprising particles of aluminum oxide, at least one conditioning agent and at least one detergent surfactant |
| US6750048B2 (en) | 2000-01-19 | 2004-06-15 | Martek Biosciences Corporation | Solventless extraction process |
| US6770104B2 (en) | 2001-05-11 | 2004-08-03 | Cargill, Incorporated | Triacylglycerol based candle wax |
| US6808737B2 (en) | 2000-05-29 | 2004-10-26 | Premium Vegetable Oils Berhad | Trans free hard structural fat for margarine blend and spreads |
| US6869597B2 (en) | 2001-05-04 | 2005-03-22 | L'oreal S.A. | Cosmetic care or makeup composition for a keratin material comprising at least one photoprotective agent and at least one ester comprising an aromatic group |
| US6881873B2 (en) | 2001-08-29 | 2005-04-19 | Uop Llc | High-activity isomerization catalyst and process |
| US6924333B2 (en) | 2002-01-03 | 2005-08-02 | Archer-Daniels-Midland Company | Polyunsaturated fatty acids as part of reactive structures for latex paints: thickeners, surfactants, and dispersants |
| US6946430B2 (en) | 2001-03-28 | 2005-09-20 | Kao Corporation | Surfactant composition |
| US6977322B2 (en) | 2002-06-18 | 2005-12-20 | Uop Llc | Isomerization catalyst and processes |
| EP1640437A1 (en) | 2004-09-28 | 2006-03-29 | Neste Oil Oyj | Production of fuel components |
| US7041866B1 (en) | 2002-10-08 | 2006-05-09 | Uop Llc | Solid-acid isomerization catalyst and process |
| EP1681337A1 (en) | 2005-01-14 | 2006-07-19 | Neste Oil OYJ | Method for the manufacture of hydrocarbons |
| EP1682466A1 (en) | 2003-11-13 | 2006-07-26 | Neste Oil OYJ | Process for the hydrogenation of olefins |
| US7115173B2 (en) | 2000-05-11 | 2006-10-03 | The Procter & Gamble Company | Highly concentrated fabric softener compositions and articles containing such compositions |
| US7115760B2 (en) | 2002-11-01 | 2006-10-03 | Danisco A/S | Process for controlling the fatty acid chain composition of triglycerides and use thereof |
| US7118773B2 (en) | 2000-11-21 | 2006-10-10 | Lipton, Divison Of Conopco, Inc. | Edible spread containing a natural fat phase |
| US7119216B2 (en) | 2001-03-26 | 2006-10-10 | Dow Global Technologies Inc. | Metathesis of unsaturated fatty acid esters or unsaturated fatty acids with lower olefins |
| US7135290B2 (en) | 2003-04-12 | 2006-11-14 | Solazyme, Inc. | Methods and compositions for evolving hydrogenase genes |
| EP1741768A1 (en) | 2005-07-04 | 2007-01-10 | Neste Oil OYJ | Process for the manufacture of diesel range hydrocarbons |
| EP1741767A1 (en) | 2005-07-04 | 2007-01-10 | Neste Oil OYJ | Process for the manufacture of diesel range hydrocarbons |
| US7196124B2 (en) | 2003-01-08 | 2007-03-27 | Texas Tech University | Elastomeric material compositions obtained from castor oil and epoxidized soybean oil |
| EP1795576A1 (en) | 2005-12-12 | 2007-06-13 | Neste Oil OYJ | Process for the manufacture of hydrocarbons |
| US7232935B2 (en) | 2002-09-06 | 2007-06-19 | Fortum Oyj | Process for producing a hydrocarbon component of biological origin |
| US7238277B2 (en) | 2004-12-16 | 2007-07-03 | Chevron U.S.A. Inc. | High conversion hydroprocessing |
| US20070175091A1 (en) | 2006-02-02 | 2007-08-02 | Renewable Energy Group, Llc | Biodiesel cold filtration process |
| US7262158B1 (en) | 1999-07-01 | 2007-08-28 | Johnson & Johnson Companies, Inc. | Cleansing compositions comprising a liquid silicone and ester mixture |
| US7264886B2 (en) | 2002-05-14 | 2007-09-04 | Viance, Llc | Water repellent compositions for wood preservatives |
| US7288685B2 (en) | 2005-05-19 | 2007-10-30 | Uop Llc | Production of olefins from biorenewable feedstocks |
| US7288278B2 (en) | 2000-12-21 | 2007-10-30 | Aarhuskarlshamn Denmark A/S | Process for preparing vegetable oil fractions rich in non-tocolic, high-melting, unsaponifiable matter |
| WO2008002643A2 (en) | 2006-06-28 | 2008-01-03 | Cibus Llc | Fatty acid blends and uses therefor |
| US20080040822A1 (en) | 1999-01-14 | 2008-02-14 | Martek Biosciences Corporation | Pufa polyketide synthase systems and uses thereof |
| WO2008151149A2 (en) | 2007-06-01 | 2008-12-11 | Solazyme, Inc. | Production of oil in microorganisms |
| WO2010012093A1 (en) | 2008-08-01 | 2010-02-04 | Profero Energy Inc. | Methods and systems for gas production from a reservoir |
| WO2010063031A2 (en) | 2008-11-28 | 2010-06-03 | Solazyme, Inc. | Manufacturing of tailored oils in recombinant heterotrophic microorganisms |
| US20100145086A1 (en) | 2006-10-13 | 2010-06-10 | Elevance Renewable Sciences, Inc. | Synthesis of Terminal Alkenes From Internal Alkenes Via Olefin Metathesis |
| US20100160506A1 (en) | 2008-12-23 | 2010-06-24 | Margaret May-Som Wu | Production of synthetic hydrocarbon fluids, plasticizers and synthetic lubricant base stocks from renewable feedstocks |
| US20100227151A1 (en) | 2009-03-04 | 2010-09-09 | Jeffrey Philip Rowlands | Polyurethane foam |
| WO2011130576A1 (en) | 2010-04-14 | 2011-10-20 | Solazyme, Inc. | Oleaginous yeast food compositions |
| WO2011130578A2 (en) | 2010-04-14 | 2011-10-20 | Solazyme, Inc. | Lipid-rich microalgal flour food compositions |
| WO2011150411A1 (en) | 2010-05-28 | 2011-12-01 | Solazyme, Inc. | Food compositions comprising tailored oils |
Family Cites Families (266)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US2235056A (en) | 1938-03-04 | 1941-03-18 | Ici Ltd | Process for the recovery of glycerol from still residues from fermentation processes |
| US2383602A (en) | 1943-03-04 | 1945-08-28 | Colgate Palmolive Peet Co | Process for treatment of fatty glycerides |
| US2967700A (en) | 1955-03-01 | 1961-01-10 | Morris B Kallison | Whipping and aerating apparatus |
| US2874171A (en) | 1957-02-20 | 1959-02-17 | Upjohn Co | Recovery of ergosterol |
| US3142135A (en) | 1962-02-13 | 1964-07-28 | Grain Processing Corp | Production of carotenoids by the cultivation of algae |
| US3280502A (en) | 1962-11-07 | 1966-10-25 | Hoffmann La Roche | Process for the preparation of lutein |
| US3320693A (en) | 1964-09-11 | 1967-05-23 | Kk | Method of industral cultivation of unicellular green algae such as chlorella |
| US3475274A (en) | 1967-08-07 | 1969-10-28 | Commercial Solvents Corp | Production of riboflavin |
| US3962466A (en) | 1972-11-10 | 1976-06-08 | Dai-Nippon Sugar Manufacturing Co., Ltd. | Method for treatment of microorganisms |
| JPS5328989B2 (https=) | 1974-05-27 | 1978-08-17 | ||
| US4005062A (en) | 1974-08-16 | 1977-01-25 | Standard Oil Company (Indiana) | Process of preparing water-soluble whippable extract from microorganism protein material |
| US3957578A (en) | 1975-01-03 | 1976-05-18 | Hokkaido Sugar Co., Ltd. | Method for manufacture of α-galactosidase by microorganism |
| US4103039A (en) | 1976-08-18 | 1978-07-25 | Fuji Oil Company, Limited | Method for producing improved shea fat |
| FR2375319A1 (fr) | 1976-12-23 | 1978-07-21 | British Petroleum Co | Procede de traitement d'extraits lipidiques |
| US4182777A (en) | 1977-03-01 | 1980-01-08 | Standard Oil Company (Indiana) | Co-dried yeast whey food product and process |
| IL57712A (en) | 1979-07-03 | 1984-02-29 | Yissum Res Dev Co | Cultivation of halophilic algae of the dunaliella species for the production of fuel-like product |
| US4273790A (en) | 1979-11-19 | 1981-06-16 | Standard Brands Incorporated | Low-fat liquid spread and process |
| US4373434A (en) | 1980-11-24 | 1983-02-15 | Simon-Rosedowns Limited | Apparatus for the expansion of oil bearing seeds |
| JPS57150379A (en) | 1981-03-14 | 1982-09-17 | Kikujiro Ishiwatari | Crushing of cell membrane of chlorella |
| US4390561A (en) | 1981-11-04 | 1983-06-28 | The Procter & Gamble Company | Margarine oil product |
| US4519845A (en) | 1984-02-09 | 1985-05-28 | Uop Inc. | Separation of sucrose from molasses |
| US4627192B1 (en) | 1984-11-16 | 1995-10-17 | Sigco Res Inc | Sunflower products and methods for their production |
| US4755467A (en) | 1985-06-03 | 1988-07-05 | Unisearch Limited | Method for the production of sorbitol and gluconate |
| US5792631A (en) | 1985-07-01 | 1998-08-11 | Dcv, Inc. | Microbial process for the production of ascorbic acid using Chlorella protothecoides |
| US5001059A (en) | 1985-07-01 | 1991-03-19 | Bio-Technical Resources, Inc. | L-ascorbic acid production in microorganisms |
| US4673490A (en) | 1985-08-23 | 1987-06-16 | Fluor Corporation | Process for separating crude oil components |
| US5360730A (en) | 1987-06-05 | 1994-11-01 | Universal Foods Corporation | Zeaxanthin producing strains of Neospongiococcum Excentricum |
| FR2626584B1 (fr) | 1988-01-28 | 1990-07-13 | Agronomique Inst Nat Rech | Sequence ars efficace chez yarrowia lipolytica et procede pour sa preparation |
| US4992605A (en) | 1988-02-16 | 1991-02-12 | Craig Wayne K | Production of hydrocarbons with a relatively high cetane rating |
| US4901635A (en) | 1988-04-08 | 1990-02-20 | Anderson International Corp. | Apparatus and method for the continuous extrusion and partial deliquefaction of oleaginous materials |
| US5130242A (en) | 1988-09-07 | 1992-07-14 | Phycotech, Inc. | Process for the heterotrophic production of microbial products with high concentrations of omega-3 highly unsaturated fatty acids |
| US20060094089A1 (en) | 1988-09-07 | 2006-05-04 | Martek Biosciences Corporation | Process for the heterotrophic production of microbial products with high concentrations of omega-3 highly unsaturated fatty acids |
| US5340742A (en) | 1988-09-07 | 1994-08-23 | Omegatech Inc. | Process for growing thraustochytrium and schizochytrium using non-chloride salts to produce a microfloral biomass having omega-3-highly unsaturated fatty acids |
| US6680426B2 (en) | 1991-01-07 | 2004-01-20 | Auburn University | Genetic engineering of plant chloroplasts |
| US5693507A (en) | 1988-09-26 | 1997-12-02 | Auburn University | Genetic engineering of plant chloroplasts |
| WO1990013612A1 (en) | 1989-05-10 | 1990-11-15 | Davy Mckee (London) Limited | Multi-step hydrodesulphurisation process |
| DE4004800C2 (de) | 1990-02-13 | 2000-12-21 | Aventis Cropscience Gmbh | Im Habitus und Ertrag veränderte transgene Pflanzen |
| US5407957A (en) | 1990-02-13 | 1995-04-18 | Martek Corporation | Production of docosahexaenoic acid by dinoflagellates |
| US7053267B2 (en) | 1990-03-16 | 2006-05-30 | Calgene Llc | Plant seed oils |
| US5298421A (en) | 1990-04-26 | 1994-03-29 | Calgene, Inc. | Plant medium-chain-preferring acyl-ACP thioesterases and related methods |
| US5164308A (en) | 1990-05-21 | 1992-11-17 | Martek Corporation | Preparation of labelled triglyceride oils by cultivation of microorganisms |
| US5945585A (en) | 1990-12-20 | 1999-08-31 | E. I. Du Pont De Nemours And Company | Specific for palmitoyl, stearoyl and oleoyl-alp thioesters nucleic acid fragments encoding acyl-acp thiosesterase enzymes and the use of these fragments in altering plant oil composition |
| US5530186A (en) | 1990-12-20 | 1996-06-25 | E. I. Du Pont De Nemours And Company | Nucleotide sequences of soybean acyl-ACP thioesterase genes |
| CU22292A1 (es) | 1991-05-07 | 1995-01-31 | Cigb | Procedimiento para la obtencion a escala industrial de licores de fructosa-glucosa a partir de sacarosa e instalacion para el mismo |
| US5455167A (en) | 1991-05-21 | 1995-10-03 | Calgene Inc. | Medium-chain thioesterases in plants |
| US5270175A (en) | 1991-07-12 | 1993-12-14 | Dna Plant Technology Corporation | Methods and compositions for producing metabolic products for algae |
| JP3143636B2 (ja) | 1991-09-11 | 2001-03-07 | 株式会社サン・クロレラ | 細胞破裂によるクロレラ細胞壁の破砕方法 |
| DE4130986A1 (de) | 1991-09-18 | 1993-03-25 | Bayer Ag | Pinosylvinsynthase-gene |
| PH31293A (en) | 1991-10-10 | 1998-07-06 | Rhone Poulenc Agrochimie | Production of y-linolenic acid by a delta6-desaturage. |
| US6355861B1 (en) | 1991-10-10 | 2002-03-12 | Rhone-Poulenc Agrochimie | Production of gamma linolenic acid by a Δ6-desaturase |
| FR2686619B1 (fr) | 1992-01-28 | 1995-07-13 | Commissariat Energie Atomique | Procede de production selective de lipides poly-insatures a partir d'une culture de micro-algues du type porphyridium et cuve utilisee dans ce procede. |
| US5395455A (en) | 1992-03-10 | 1995-03-07 | Energy, Mines And Resources - Canada | Process for the production of anhydrosugars from lignin and cellulose containing biomass by pyrolysis |
| DE4209779C1 (https=) | 1992-03-26 | 1993-07-15 | Oelmuehle Leer Connemann Gmbh & Co., 2950 Leer, De | |
| RU2125796C1 (ru) | 1992-06-19 | 1999-02-10 | М.Нономура Артур | Способ промотирования роста растений и композиция, промотирующая рост растений |
| US6410281B1 (en) | 1992-07-10 | 2002-06-25 | Omegatech, Inc. | Reducing corrosion in a fermentor by providing sodium with a non-chloride sodium salt |
| JP3090810B2 (ja) | 1993-03-09 | 2000-09-25 | 日本碍子株式会社 | パルミトオレイン酸の製造方法 |
| GB2277052A (en) | 1993-04-14 | 1994-10-19 | Du Pont Canada | Polyurethane foam laminates |
| JPH078215A (ja) | 1993-04-30 | 1995-01-13 | Kawasaki Steel Corp | ドコサヘキサエン酸含有海洋性微細藻類食品素材およびその製造方法 |
| JPH078217A (ja) | 1993-06-29 | 1995-01-13 | Kawasaki Steel Corp | ドコサヘキサエン酸含有健康食品およびその製造方法 |
| JP3506740B2 (ja) | 1993-09-09 | 2004-03-15 | 日清オイリオ株式会社 | ドコサヘキサエン酸含有藻類の培養方法 |
| WO1995013390A2 (en) | 1993-11-10 | 1995-05-18 | Calgene, Inc. | Plant acyl acp thioesterase sequences |
| US5910630A (en) | 1994-04-06 | 1999-06-08 | Davies; Huw Maelor | Plant lysophosphatidic acid acyltransferases |
| US5563058A (en) | 1994-04-06 | 1996-10-08 | Calgene, Inc. | Plant lysophosphatidic acid acyltransferases |
| DE69535543T2 (de) | 1994-05-18 | 2008-04-30 | Bayer Bioscience Gmbh | Für enzyme, die die fähigkeit besitzen lineare alpha 1,4-glucane in pflanzen, pilzen und mikroorganismen zu synthesieren, kodierende dna sequenzen |
| US5756135A (en) | 1994-09-15 | 1998-05-26 | Robert D. Seeley Trust | Water insoluble yeast solids product and process of making same |
| US5680812A (en) | 1995-01-23 | 1997-10-28 | Linsgeseder; Helmut | Apparatus and method for the extraction of vegetable oils |
| US5685218A (en) | 1995-07-14 | 1997-11-11 | The French Oil Mill Machinery Co. | Method for treating oil-bearing material |
| US6255505B1 (en) | 1996-03-28 | 2001-07-03 | Gist-Brocades, B.V. | Microbial polyunsaturated fatty acid containing oil from pasteurised biomass |
| AR006830A1 (es) | 1996-04-26 | 1999-09-29 | Du Pont | Aceite de soja con alta estabilidad oxidativa |
| US5595965A (en) | 1996-05-08 | 1997-01-21 | The Lubrizol Corporation | Biodegradable vegetable oil grease |
| US6312623B1 (en) | 1996-06-18 | 2001-11-06 | Abb Power T&D Company Inc. | High oleic acid oil compositions and methods of making and electrical insulation fluids and devices comprising the same |
| US7109392B1 (en) | 1996-10-09 | 2006-09-19 | Cargill, Incorporated | Methods for increasing oleic acid content in seeds from transgenic plants containing a mutant delta 12 desaturase |
| ES2314988T3 (es) | 1997-01-24 | 2009-03-16 | Kirin Holdings Kabushiki Kaisha | Enzima beta-cetoacil-acp-sintetasa ii y gen que la codifica. |
| US6243725B1 (en) | 1997-05-21 | 2001-06-05 | Premier International, Ltd. | List building system |
| JP2001512029A (ja) | 1997-08-01 | 2001-08-21 | マーテック・バイオサイエンスィズ・コーポレーション | Dha含有栄養組成物およびそれらの製造方法 |
| US6344231B1 (en) | 1997-09-29 | 2002-02-05 | Nihon Tobacco Inc. | Yeast extract composition, yeast for obtaining the same, and process for producing yeast extract composition |
| ID28631A (id) | 1998-01-21 | 2001-06-21 | Univ Maryland Biotech Inst | Metoda untuk menyuburkan kehidupan larva ikan dengan bahan gizi makanan |
| US6139897A (en) | 1998-03-24 | 2000-10-31 | Kao Corporation | Oil or fat composition containing phytosterol |
| US20020012979A1 (en) | 1998-06-08 | 2002-01-31 | Alan Berry | Vitamin c production in microorganisms and plants |
| JP4579415B2 (ja) | 1998-07-06 | 2010-11-10 | ディーシーブイ・インコーポレイテッド・ドゥーイング・ビジネス・アズ・バイオ−テクニカル・リソーシィズ | ビタミン製造方法 |
| US6531303B1 (en) | 1998-07-06 | 2003-03-11 | Arkion Life Sciences Llc | Method of producing geranylgeraniol |
| US7511190B2 (en) | 1999-11-17 | 2009-03-31 | Mendel Biotechnology, Inc. | Polynucleotides and polypeptides in plants |
| JP2000136199A (ja) | 1998-10-29 | 2000-05-16 | Asahi Glass Co Ltd | シゾサッカロミセス・ポンベで使用可能なシグナルペプチド、分泌型発現ベクター、およびそれらを用いたタンパク質生産方法 |
| US6762345B1 (en) | 1998-12-03 | 2004-07-13 | E. I. Du Pont De Nemours And Company | Plant stearoyl desaturases |
| JP2000175696A (ja) | 1998-12-14 | 2000-06-27 | Yoshio Tanaka | ドナリエラ藻体の抽出方法 |
| US6166231A (en) | 1998-12-15 | 2000-12-26 | Martek Biosciences Corporation | Two phase extraction of oil from biomass |
| US6534261B1 (en) | 1999-01-12 | 2003-03-18 | Sangamo Biosciences, Inc. | Regulation of endogenous gene expression in cells using zinc finger proteins |
| AU4211600A (en) * | 1999-04-10 | 2000-11-14 | Maxygen, Inc. | Modified lipid production |
| AU4231600A (en) | 1999-04-12 | 2000-11-14 | Monsanto Technology Llc | Transgenic plants containing altered levels of sterol compounds and tocopherols |
| DE19926456A1 (de) | 1999-06-10 | 2000-12-14 | Norddeutsche Pflanzenzucht Han | Verfahren zur Erhöhung des Fettsäuregehalts in Pflanzensamen |
| DE10000978A1 (de) | 2000-01-12 | 2001-07-26 | Gvs Ges Fuer Erwerb Und Verwer | Verfahren zur Erhöhung des Gehalts an Fettsäuren in Pflanzen und Mikroorganismen |
| US6338866B1 (en) | 2000-02-15 | 2002-01-15 | Applied Food Biotechnology, Inc. | Pet foods using algal or fungal waste containing fatty acids |
| GB0007651D0 (en) | 2000-03-29 | 2000-05-17 | Ascorbex Ltd | Gene sequence |
| CA2404900A1 (en) | 2000-04-21 | 2001-11-01 | Martek Biosciences Corporation | Trophic conversion of obligate phototrophic algae through metabolic engineering |
| US20020178467A1 (en) | 2000-05-12 | 2002-11-28 | Katayoon Dehesh | Plastid transit peptide sequences for efficient plastid targeting |
| EP1178118A1 (en) | 2000-08-02 | 2002-02-06 | Dsm N.V. | Isolation of microbial oils |
| JP2002125601A (ja) | 2000-10-25 | 2002-05-08 | Kurorera Kogyo Kk | 動物性プランクトン用餌料とその製造方法及び動物性プランクトンの培養方法 |
| AU2002224445A1 (en) | 2000-10-26 | 2002-05-06 | Joe E. Guyer | Method of generating and recovering gas from subsurface formations of coal, carbonaceous shale and organic-rich shales |
| US7081567B2 (en) | 2000-12-03 | 2006-07-25 | Lexun Xue | Transgenic dunaliella salina as a bioreactor |
| US20020144455A1 (en) | 2001-01-06 | 2002-10-10 | Bertrand Jerome C. | Non sooting candle composition |
| AU2002307432A1 (en) | 2001-04-20 | 2002-11-05 | Cargill, Incorporated | Production of alpha-lipoic acid |
| US6620427B2 (en) | 2001-04-24 | 2003-09-16 | Abbott Laboratories | Method for improving bone mineralization |
| US20030082595A1 (en) | 2001-08-03 | 2003-05-01 | Bo Jiang | Nucleic acids of aspergillus fumigatus encoding industrial enzymes and methods of use |
| US6867308B2 (en) | 2001-09-19 | 2005-03-15 | Archer-Daniels-Midland Company | Process for separation of tocopherols |
| JP3816774B2 (ja) | 2001-10-01 | 2006-08-30 | 独立行政法人科学技術振興機構 | 炭化水素資化微細藻類およびそれを用いたバイオレメディエーション方法 |
| DE60325457D1 (de) | 2002-01-23 | 2009-02-05 | Royal Nedalco B V | Fermentation von pentosezuckern |
| US7314974B2 (en) | 2002-02-21 | 2008-01-01 | Monsanto Technology, Llc | Expression of microbial proteins in plants for production of plants with improved properties |
| US20030229237A1 (en) | 2002-04-02 | 2003-12-11 | Haas Michael J. | In situ production of fatty acid alkyl esters |
| WO2003092628A2 (en) | 2002-05-03 | 2003-11-13 | Martek Biosciences Corporation | High-quality lipids and methods for producing by enzymatic liberation from biomass |
| US20030211594A1 (en) | 2002-05-07 | 2003-11-13 | Rosebrook Donald Ian | Microalgae for remediation of waste and method of culturing the same |
| JP2005530506A (ja) | 2002-06-21 | 2005-10-13 | モンサント テクノロジー エルエルシー | 改変された脂肪酸組成を持つ植物の生成のためのチオエステラーゼ関連核酸配列およびその使用方法 |
| EP2338510A1 (en) | 2002-07-19 | 2011-06-29 | Novartis Pharma AG | Vaccine compositions containing amyloid beta1-6 antigen arrays |
| US20040074760A1 (en) | 2002-10-17 | 2004-04-22 | Carnegie Mellon University | Production of biofuels |
| AU2003295624A1 (en) | 2002-11-18 | 2004-06-15 | Monsanto Technology, Llc | Production of increased oil and protein in plants by the disruption of the phenylpropanoid pathway |
| CA2513289A1 (en) | 2003-01-20 | 2004-08-05 | Sungene Gmbh & Co. Kgaa | Expression cassette with promotors of starch synthesis 3 for the expression of nucleic acids in plant tissue containing starch |
| EP3202899B1 (en) | 2003-01-28 | 2020-10-21 | Cellectis | Custom-made meganuclease and use thereof |
| ATE531806T1 (de) | 2003-03-03 | 2011-11-15 | Meiji Seika Kaisha | Transgene pflanze mit darin angereichertem fructooligosaccharid und verfahren zur konstruktion davon |
| US7125672B2 (en) | 2003-05-07 | 2006-10-24 | E. I. Du Pont De Nemours And Company | Codon-optimized genes for the production of polyunsaturated fatty acids in oleaginous yeasts |
| US7238482B2 (en) | 2003-05-07 | 2007-07-03 | E. I. Du Pont De Nemours And Company | Production of polyunsaturated fatty acids in oleaginous yeasts |
| US7032664B2 (en) | 2004-06-02 | 2006-04-25 | Halliburton Energy Services, Inc. | Nanocomposite particulates and methods of using nanocomposite particulates |
| US7259255B2 (en) | 2003-06-25 | 2007-08-21 | E. I. Du Pont De Nemours And Company | Glyceraldehyde-3-phosphate dehydrogenase and phosphoglycerate mutase promoters for gene expression in oleaginous yeast |
| EP1642959B1 (en) | 2003-07-09 | 2010-05-19 | The Nisshin OilliO Group, Ltd. | Process for producing symmetrical triglyceride |
| EP1673457B1 (en) | 2003-08-25 | 2011-05-18 | Funzyme Biotechnologies SA | Novel fungal proteins and nucleic acids encoding same |
| PE20050398A1 (es) | 2003-09-22 | 2005-06-03 | Rosales Jose Antonio Socla | Proceso y purificacion de las xantofilas de marigold |
| US20060048240A1 (en) | 2004-04-01 | 2006-03-02 | Nickolai Alexandrov | Sequence-determined DNA fragments and corresponding polypeptides encoded thereby |
| BRPI0415046A (pt) | 2003-10-02 | 2006-12-12 | Univ Mississippi | produção de biodiesel e outras substáncias quìmicas valiosas a partir de resìduos de plantas de tratamento de água residual |
| AU2004290051A1 (en) * | 2003-11-12 | 2005-05-26 | E.I. Dupont De Nemours And Company | Delta-15 desaturases suitable for altering levels of polyunsaturated fatty acids in oilseed plants and oleaginous yeast |
| US7504259B2 (en) | 2003-11-12 | 2009-03-17 | E. I. Du Pont De Nemours And Company | Δ12 desaturases suitable for altering levels of polyunsaturated fatty acids in oleaginous yeast |
| KR100913626B1 (ko) | 2003-11-20 | 2009-08-24 | 솔베이(소시에떼아노님) | 염소화된 유기 화합물의 제조 방법 |
| WO2005063995A2 (en) | 2003-12-23 | 2005-07-14 | Basf Plant Science Gmbh | Sugar and lipid metabolism regulators in plants vi |
| CN1238469C (zh) | 2004-01-16 | 2006-01-25 | 清华大学 | 有机介质反应体系中脂肪酶转化油脂生产生物柴油新工艺 |
| US7063957B2 (en) | 2004-03-26 | 2006-06-20 | The University Of Hong Kong | Methods for production of astaxanthin from the green microalgae Chlorella in dark-heterotrophic cultures |
| CN101018862B (zh) * | 2004-04-22 | 2013-10-09 | 联邦科学技术研究组织 | 用重组细胞合成长链多不饱和脂肪酸 |
| US20080194029A1 (en) * | 2004-05-07 | 2008-08-14 | Peter Hegemann | Method for Increasing the Ratio of Homologous to Non-Homologous Recombination |
| US7364883B2 (en) | 2004-05-07 | 2008-04-29 | Yeastern Biotech Co., Ltd. | Process for producing poly-unsaturated fatty acids by oleaginous yeasts |
| EP1766037B1 (en) | 2004-05-12 | 2015-07-01 | Transworld Technologies Limited | Generation of hydrogen from hydrocarbon-bearing materials |
| US7214297B2 (en) | 2004-06-28 | 2007-05-08 | Applied Materials, Inc. | Substrate support element for an electrochemical plating cell |
| US20060075522A1 (en) | 2004-07-31 | 2006-04-06 | Jaclyn Cleveland | Genes and uses for plant improvement |
| WO2006036864A2 (en) | 2004-09-22 | 2006-04-06 | Ceres, Inc. | Promoter, promoter control elements, and combinations, and uses thereof |
| GB0421937D0 (en) | 2004-10-02 | 2004-11-03 | Univ York | Acyl CoA synthetases |
| US7678931B2 (en) | 2004-10-22 | 2010-03-16 | Martek Biosciences Corporation | Process for preparing materials for extraction |
| US7879591B2 (en) | 2004-11-04 | 2011-02-01 | E.I. Du Pont De Nemours And Company | High eicosapentaenoic acid producing strains of Yarrowia lipolytica |
| US7550286B2 (en) | 2004-11-04 | 2009-06-23 | E. I. Du Pont De Nemours And Company | Docosahexaenoic acid producing strains of Yarrowia lipolytica |
| US7189559B2 (en) | 2004-11-04 | 2007-03-13 | E. I. Du Pont De Nemours And Company | Mortierella alpina lysophosphatidic acid acyltransferase homolog for alteration of polyunsaturated fatty acids and oil content in oleaginous organisms |
| US8685679B2 (en) | 2004-11-04 | 2014-04-01 | E I Du Pont De Nemours And Company | Acyltransferase regulation to increase the percent of polyunsaturated fatty acids in total lipids and oils of oleaginous organisms |
| US20060225341A1 (en) | 2004-12-20 | 2006-10-12 | Rodolfo Rohr | Production of biodiesel |
| EP1838522A4 (en) | 2004-12-30 | 2011-03-09 | Sun Drilling Products Corp | NANOCOMPOSITE THERMOSHELL PARTICLES, PROCESS FOR PRODUCING THE SAME, AND USE IN OIL AND NATURAL GAS DRILLING APPLICATIONS |
| DE102005003624A1 (de) | 2005-01-26 | 2006-07-27 | Nutrinova Nutrition Specialties & Food Ingredients Gmbh | Herstellung und Anwendung eines antioxidativ wirksamen Extraktes aus Crypthecodinium sp. |
| US7692049B2 (en) | 2005-01-31 | 2010-04-06 | Exxonmobil Chemical Patents Inc. | Hydrocarbon compositions useful for producing fuels and methods of producing the same |
| WO2006092449A2 (en) | 2005-03-02 | 2006-09-08 | Metanomics Gmbh | Process for the production of fine chemicals |
| CN103589650A (zh) | 2005-03-18 | 2014-02-19 | 米克罗比亚公司 | 产油酵母和真菌中类胡萝卜素的产生 |
| US20060223153A1 (en) | 2005-04-05 | 2006-10-05 | Luca Technologies, Llc | Generation of materials with enhanced hydrogen content from anaerobic microbial consortia |
| US7426960B2 (en) | 2005-05-03 | 2008-09-23 | Luca Technologies, Inc. | Biogenic fuel gas generation in geologic hydrocarbon deposits |
| CN101227900A (zh) | 2005-05-11 | 2008-07-23 | 高级生物营养公司 | 稳定形式的鱼油 |
| WO2006124598A2 (en) | 2005-05-12 | 2006-11-23 | Martek Biosciences Corporation | Biomass hydrolysate and uses and production thereof |
| EP1928994A2 (en) | 2005-08-25 | 2008-06-11 | Solix Biofuels, Inc. | Method, apparatus and system for biodiesel production from algae |
| WO2007027669A1 (en) | 2005-08-29 | 2007-03-08 | Cps Biofuels, Inc. | Improved biodiesel fuel, additives, and lubbricants |
| FR2890961B1 (fr) | 2005-09-21 | 2007-11-23 | Inst Francais Du Petrole | Procede perfectionne de fabrication d'esters ethyliques a partir de corps gras d'origine naturelle |
| BRPI0616573A2 (pt) | 2005-09-27 | 2009-11-24 | Univ Cornell | ácidos nucléicos e proteìnas associados com a degradação de sacarose no café |
| US8163675B2 (en) | 2005-10-20 | 2012-04-24 | Akzo Nobel N.V. | Emulsifier based on polyamines and fatty acid/maleic anhydride |
| US20070166266A1 (en) | 2006-01-19 | 2007-07-19 | Solazyme, Inc. | Methods and compositions for improving the health and appearance of skin |
| US20070167396A1 (en) | 2006-01-19 | 2007-07-19 | Solazyme, Inc. | Methods and compositions for cholesterol reduction in mammals |
| US20090274736A1 (en) | 2006-01-19 | 2009-11-05 | Solazyme Inc. | Nutraceutical Compositions From Microalgae And Related Methods of Production And Administration |
| US20070218183A1 (en) | 2006-03-14 | 2007-09-20 | Bunge Oils, Inc. | Oil composition of conjugated linoleic acid |
| KR101524398B1 (ko) | 2006-03-15 | 2015-06-04 | 디에스엠 아이피 어셋츠 비.브이. | Pufa 폴리케티드 신타제 시스템을 이용한 이종 생물체내 다불포화 지방산의 제조 |
| CN100590186C (zh) | 2006-03-17 | 2010-02-17 | 中国科学院大连化学物理研究所 | 一种生产生物油脂和生物柴油的方法 |
| AU2007235419A1 (en) | 2006-04-03 | 2007-10-18 | Advanced Bionutrition Corporation | Feed formulations containing docosahexaenoic acid |
| US20100248322A1 (en) | 2006-04-05 | 2010-09-30 | Luca Technologies, Inc. | Chemical amendments for the stimulation of biogenic gas generation in deposits of carbonaceous material |
| US7309602B2 (en) | 2006-04-13 | 2007-12-18 | Ambrozea, Inc. | Compositions and methods for producing fermentation products and residuals |
| BRPI0709946A2 (pt) | 2006-04-13 | 2011-08-02 | Ambrozea Inc | composições e métodos para produzir produtos e resìduos de fermentação |
| WO2007134294A2 (en) | 2006-05-12 | 2007-11-22 | Arizona Board Of Regents, A Body Corporate Of The State Of Az Acting For & On Behalf Of Az State Unviversity | Novel chlorella species and uses therefor |
| EP2035553A1 (en) | 2006-06-06 | 2009-03-18 | Total Raffinage Marketing | Lysophosphatidic acid acyltransferase genes and uses thereof |
| CN101108997B (zh) | 2006-07-19 | 2010-07-21 | 中国科学院大连化学物理研究所 | 一种微生物油脂的制备方法 |
| EP2082016A1 (en) | 2006-09-14 | 2009-07-29 | Biofuelbox Corporation | Methods of robust and efficient conversion of cellular lipids to biofuels |
| CN101528913B (zh) | 2006-09-18 | 2013-02-13 | 亚利桑那董事会,代表亚利桑那州立大学行事的亚利桑那州法人团体 | 藻类中链长脂肪酸和烃 |
| JP2008081559A (ja) | 2006-09-26 | 2008-04-10 | Nippon Shokubai Co Ltd | バイオディーゼル燃料組成物およびその製造方法 |
| EP2074214A2 (en) | 2006-09-28 | 2009-07-01 | Microbia, Inc. | Production of sterols in oleaginous yeast and fungi |
| US9101161B2 (en) | 2006-11-02 | 2015-08-11 | The Coca-Cola Company | High-potency sweetener composition with phytoestrogen and compositions sweetened therewith |
| WO2008060571A2 (en) | 2006-11-13 | 2008-05-22 | Aurora Biofuels, Inc. | Methods and compositions for production and purification of biofuel from plants and microalgae |
| ITMI20062193A1 (it) | 2006-11-15 | 2008-05-16 | Eni Spa | Processo per produrre frazioni idrocarburiche da miscele di origine biologica |
| JP4820277B2 (ja) | 2006-12-20 | 2011-11-24 | 花王株式会社 | ケトン体及び/又は2級アルコールの製造法 |
| JP2008178871A (ja) | 2006-12-28 | 2008-08-07 | Tohoku Techno Arch Co Ltd | 強塩基性陰イオン交換樹脂の再生方法 |
| WO2008083351A2 (en) | 2006-12-29 | 2008-07-10 | Genifuel Corporation | Controlled growth environments for algae cultivation |
| US7977076B2 (en) | 2006-12-29 | 2011-07-12 | Genifuel Corporation | Integrated processes and systems for production of biofuels using algae |
| BRPI0807237A2 (pt) | 2007-02-02 | 2014-04-29 | Kirin Holdings Kk | Dna que codifica xilitol desidrogenase, construção de ácido nucléico, vetores, microorganismos e métodos para produzir xilitol desigrogenase e etanol |
| US8129512B2 (en) | 2007-04-12 | 2012-03-06 | Pioneer Hi-Bred International, Inc. | Methods of identifying and creating rubisco large subunit variants with improved rubisco activity, compositions and methods of use thereof |
| NZ578234A (en) | 2007-05-02 | 2012-12-21 | Ouro Fino Participacoes E Empreendimentos S A | Process to produce biodiesel and/or fuel oil |
| JP5628024B2 (ja) | 2007-05-15 | 2014-11-19 | ダウ グローバル テクノロジーズ エルエルシー | 高弾性発泡体 |
| US8801975B2 (en) | 2007-05-17 | 2014-08-12 | Cooper Industries, Llc | Vegetable oil dielectric fluid composition |
| US7914832B2 (en) | 2007-06-01 | 2011-03-29 | Kyoto Eiyo Co., Ltd. | Method for producing chlorella fermented food |
| EP2635691B1 (en) | 2007-06-12 | 2016-08-24 | CPS Biofuels, Inc. | Production of gasoline from fermentable feedstocks |
| US20090018300A1 (en) | 2007-07-11 | 2009-01-15 | Archer-Daniels-Midland Company | Monomers and polymers from bioderived carbon |
| CN101092353B (zh) | 2007-07-12 | 2010-12-01 | 上海交通大学 | 动植物油脂转化脂肪酸单酯的制备方法 |
| EA023523B1 (ru) | 2007-08-31 | 2016-06-30 | Мартек Биосайнсиз Корпорейшн | Твердые жировые композиции, содержащие полиненасыщенные жирные кислоты, и способы их получения и использования |
| US20090176272A1 (en) | 2007-09-12 | 2009-07-09 | Kuehnle Agrosystems, Inc. | Expression of nucleic acid sequences for production of biofuels and other products in algae and cyanobacteria |
| CN101874117A (zh) | 2007-09-12 | 2010-10-27 | 马太克生物科学公司 | 生物油及其制备与应用 |
| US20090117253A1 (en) | 2007-10-03 | 2009-05-07 | E. I. Du Pont De Nemours And Company | Peroxisome biogenesis factor protein (pex) disruptions for altering polyunsaturated fatty acids and total lipid content in oleaginous eukaryotic organisms |
| CA2704371A1 (en) | 2007-11-01 | 2009-05-07 | Wake Forest University School Of Medicine | Compositions and methods for prevention and treatment of mammalian diseases |
| FR2924126B1 (fr) | 2007-11-28 | 2011-04-15 | Roquette Freres | Nouveau procede de culture d'une microalgue heterotrophe |
| US8815567B2 (en) | 2007-11-30 | 2014-08-26 | E I Du Pont De Nemours And Company | Coenzyme Q10 production in a recombinant oleaginous yeast |
| US20090145392A1 (en) | 2007-11-30 | 2009-06-11 | Clark Richard Hugh | Fuel formulations |
| MX2010006539A (es) | 2007-12-11 | 2011-02-23 | Synthetic Genomics Inc | Secrecion de acidos grasos por parte de microorganismos fotosinteticos. |
| GB0724720D0 (en) | 2007-12-19 | 2008-01-30 | Ici Plc | Triglyceride macromonomers |
| WO2009105620A1 (en) | 2008-02-20 | 2009-08-27 | Cco Technology, Ltd. | Selective short chain monounsaturated oils |
| CN101230364A (zh) | 2008-02-25 | 2008-07-30 | 清华大学 | 一种利用异养小球藻高密度发酵生产生物柴油的方法 |
| US8048654B2 (en) | 2010-06-09 | 2011-11-01 | Joule Unlimited Technologies, Inc. | Methods and compositions for the recombinant biosynthesis of fatty acids and esters |
| US8598378B2 (en) | 2008-03-14 | 2013-12-03 | University Of Hawaii | Methods and compositions for extraction and transesterification of biomass components |
| US8043496B1 (en) | 2008-03-18 | 2011-10-25 | Peter Allen Schuh | System for extracting oil from algae |
| WO2009124070A1 (en) | 2008-03-31 | 2009-10-08 | Kuehnle Agrosystems, Inc. | Nuclear based expression of genes for production of biofuels and process co-products in algae |
| CA2720828C (en) | 2008-04-09 | 2017-03-21 | Solazyme, Inc. | Direct chemical modification of microbial biomass and microbial oils |
| US20100170144A1 (en) | 2008-04-09 | 2010-07-08 | Solazyme, Inc. | Hydroprocessing Microalgal Oils |
| US20110065821A1 (en) | 2008-05-13 | 2011-03-17 | Cargill, Incorporated | Polyol made from partialy hydrogenated, fully epoxidized natural oils |
| CN101280328B (zh) | 2008-05-27 | 2011-06-29 | 清华大学 | 一种从自养到异养两步培养小球藻生产生物柴油的方法 |
| US8435790B2 (en) | 2008-07-25 | 2013-05-07 | The Regents Of The University Of California | Methods of modulating lipid concentrations in eukaryotic cells |
| NZ590750A (en) | 2008-07-28 | 2012-12-21 | Univ Massachusetts | Methods and compositions for improving the production of products in microorganisms, especially clostridium phytofermentans |
| US8273694B2 (en) | 2008-07-28 | 2012-09-25 | Jeffrey A Brown | Synthetic compositions obtained from algae |
| US20100035309A1 (en) | 2008-08-06 | 2010-02-11 | Luca Technologies, Inc. | Analysis and enhancement of metabolic pathways for methanogenesis |
| US8927475B2 (en) | 2008-08-08 | 2015-01-06 | The Dial Corporation | Consumer products comprising algae derived ingredients |
| WO2010019813A2 (en) | 2008-08-13 | 2010-02-18 | Sapphire Energy, Inc. | Production of fatty actds by genetically modified photosynthetic organisms |
| BRPI0913818A2 (pt) | 2008-10-03 | 2017-03-28 | Agrisoma Biosciences Inc | método de produção de plantas transgênicas, planta transgênica e método de produção de óleo |
| KR101717569B1 (ko) | 2008-10-07 | 2017-03-17 | 알이지 라이프 사이언시스, 엘엘씨 | 지방족 알데히드를 생산하기 위한 방법과 조성물들 |
| US20100297292A1 (en) | 2008-10-14 | 2010-11-25 | Solazyme, Inc. | Reduced Pigmentation Microalgae Strains and Products Therefrom |
| US20100297296A1 (en) | 2008-10-14 | 2010-11-25 | Solazyme, Inc. | Healthier Baked Goods Containing Microalgae |
| US20100303961A1 (en) | 2008-10-14 | 2010-12-02 | Solazyme, Inc. | Methods of Inducing Satiety |
| US20100303957A1 (en) | 2008-10-14 | 2010-12-02 | Solazyme, Inc. | Edible Oil and Processes for Its Production from Microalgae |
| US20100297331A1 (en) | 2008-10-14 | 2010-11-25 | Solazyme, Inc. | Reduced Fat Foods Containing High-Lipid Microalgae with Improved Sensory Properties |
| US20130122180A1 (en) | 2008-10-14 | 2013-05-16 | Solazyme, Inc. | Microalgal Food Compositions |
| US20100297295A1 (en) | 2008-10-14 | 2010-11-25 | Solazyme, Inc. | Microalgae-Based Beverages |
| CN102271525B (zh) | 2008-10-14 | 2015-01-07 | 索拉兹米公司 | 微藻生物质的食品组合物 |
| US20100303990A1 (en) | 2008-10-14 | 2010-12-02 | Solazyme, Inc. | High Protein and High Fiber Algal Food Materials |
| US20100297323A1 (en) | 2008-10-14 | 2010-11-25 | Solazyme, Inc. | Gluten-free Foods Containing Microalgae |
| US20100303989A1 (en) | 2008-10-14 | 2010-12-02 | Solazyme, Inc. | Microalgal Flour |
| US20120128851A1 (en) | 2008-10-14 | 2012-05-24 | Solazyme, Inc | Novel microalgal food compositions |
| US20100297325A1 (en) | 2008-10-14 | 2010-11-25 | Solazyme, Inc. | Egg Products Containing Microalgae |
| WO2010068921A2 (en) | 2008-12-11 | 2010-06-17 | Bio Architecture Lab, Inc. | Biosynthesis of commodity chemicals |
| CA3055144C (en) | 2008-12-23 | 2022-07-19 | REG Life Sciences, LLC | Methods and compositions related to thioesterase enzymes |
| US20100196575A1 (en) | 2009-01-30 | 2010-08-05 | Solae, Llc | Melting Vegetable Protein Based Substitute Cheese |
| CN101824440A (zh) | 2009-03-04 | 2010-09-08 | 中国科学院大连化学物理研究所 | 一种微生物油脂的分离方法 |
| EP2411481B1 (en) | 2009-03-27 | 2016-08-03 | E. I. du Pont de Nemours and Company | Dielectric heat-transfer fluid |
| KR101899933B1 (ko) | 2009-04-14 | 2018-09-19 | 테라비아 홀딩스 인코포레이티드 | 신규의 미세 조류 식품 조성물 |
| SG10201401472YA (en) | 2009-04-14 | 2014-08-28 | Solazyme Inc | Methods Of Microbial Oil Extraction And Separation |
| EP2430166A1 (en) | 2009-05-13 | 2012-03-21 | BASF Plant Science Company GmbH | Acyltransferases and uses thereof in fatty acid production |
| EP2470665A4 (en) | 2009-08-28 | 2013-04-17 | Phycal Inc | BIOFUEL FROM RECOMBINANT OIL-CONTAINING ALGAE USING SUGAR CARBON SOURCES |
| CA3056664A1 (en) | 2009-09-25 | 2011-03-31 | Alfred Gaertner | Production of fatty acid derivatives in recombinant bacterial cells expressing an ester synthase variant |
| EP2327776A1 (en) | 2009-11-30 | 2011-06-01 | Institut National De La Recherche Agronomique | Method for the production of Very Long Chain Fatty Acids (VLCFA) by fermentation with a recombinant Yarrowia sp |
| CN102984935B (zh) | 2009-12-18 | 2016-01-13 | 嘉吉公司 | 产生具有低总饱和脂肪酸含量的油的芸苔属植物 |
| ES2651313T3 (es) | 2009-12-28 | 2018-01-25 | Dsm Ip Assets B.V. | Traustoquítridos recombinantes que crecen en xilosa, y composiciones, métodos de preparación y usos de los mismos |
| WO2011082253A2 (en) | 2009-12-30 | 2011-07-07 | Board Of Trustees Of Michigan State University | A method to produce acetyldiacylglycerols (ac-tags) by expression ofan acetyltransferase gene isolated from euonymus alatus (burning bush) |
| BR112012026242A2 (pt) | 2010-04-14 | 2019-09-24 | Solazyme Inc | método para produção de óleo e óleo isolado de levedura oleaginosa |
| EP2635663B1 (en) | 2010-11-03 | 2019-05-08 | Corbion Biotech, Inc. | Microbial oils with lowered pour points, dielectric fluids produced therefrom, and related methods |
| US8530207B2 (en) | 2010-12-23 | 2013-09-10 | Exxonmobil Research And Engineering Company | Photosynthetic microorganisms comprising exogenous prokaryotic acyl-ACP thioesterases and methods for producing fatty acids |
| KR101964965B1 (ko) | 2011-02-02 | 2019-04-03 | 테라비아 홀딩스 인코포레이티드 | 재조합 유지성 미생물로부터 생산된 맞춤 오일 |
| WO2012145626A1 (en) | 2011-04-22 | 2012-10-26 | Ancora Pharmaceuticals Inc. | Synthetic oligosaccharides for staphylococcus vaccine |
| MX339607B (es) | 2011-05-06 | 2016-05-31 | Solazyme Inc | Microorganismos geneticamente modificados que metabolizan xilosa. |
| US9328351B2 (en) | 2011-11-28 | 2016-05-03 | Solazyme, Inc. | Genetically engineered microbial strains including Prototheca lipid pathway genes |
| IN2014DN05883A (https=) | 2011-12-23 | 2015-05-22 | Solazyme Inc | |
| US9719114B2 (en) | 2012-04-18 | 2017-08-01 | Terravia Holdings, Inc. | Tailored oils |
| US8945908B2 (en) | 2012-04-18 | 2015-02-03 | Solazyme, Inc. | Tailored oils |
| CA2903494A1 (en) | 2013-03-08 | 2014-09-12 | Solazyme, Inc. | Oleaginous microbial lubricants |
| EP2993993A2 (en) | 2013-04-26 | 2016-03-16 | Solazyme, Inc. | Low polyunsaturated fatty acid oils and uses thereof |
| MX369685B (es) | 2013-10-04 | 2019-11-19 | Terravia Holdings Inc | Aceites adaptables. |
| WO2015149026A1 (en) | 2014-03-28 | 2015-10-01 | Solazyme, Inc. | Lauric ester compositions |
| US9969990B2 (en) | 2014-07-10 | 2018-05-15 | Corbion Biotech, Inc. | Ketoacyl ACP synthase genes and uses thereof |
| US9765368B2 (en) | 2014-07-24 | 2017-09-19 | Terravia Holdings, Inc. | Variant thioesterases and methods of use |
| CN107960101A (zh) | 2015-04-06 | 2018-04-24 | 柯碧恩生物技术公司 | 具有lpaat消融的产油微藻 |
| CN108368525A (zh) | 2015-09-28 | 2018-08-03 | 柯碧恩生物技术公司 | 具有不对称的甘油三酯分子的甘油三酯油 |
-
2012
- 2012-02-02 KR KR1020137023181A patent/KR101964965B1/ko not_active Expired - Fee Related
- 2012-02-02 BR BR112013019699A patent/BR112013019699A2/pt not_active Application Discontinuation
- 2012-02-02 EP EP12741997.6A patent/EP2670855B1/en active Active
- 2012-02-02 CA CA2825691A patent/CA2825691C/en active Active
- 2012-02-02 CN CN201910164460.0A patent/CN110066836A/zh active Pending
- 2012-02-02 EP EP19191818.4A patent/EP3643774A1/en not_active Withdrawn
- 2012-02-02 KR KR1020197008914A patent/KR102117225B1/ko not_active Expired - Fee Related
- 2012-02-02 US US13/365,253 patent/US9249436B2/en active Active
- 2012-02-02 CN CN201280007593.3A patent/CN103827307A/zh active Pending
- 2012-02-02 AU AU2012212079A patent/AU2012212079B2/en active Active
- 2012-02-02 JP JP2013552645A patent/JP6071904B2/ja active Active
- 2012-02-02 SG SG2013058870A patent/SG192594A1/en unknown
- 2012-02-02 WO PCT/US2012/023696 patent/WO2012106560A1/en not_active Ceased
- 2012-02-02 MX MX2016015902A patent/MX351063B/es unknown
- 2012-02-02 MX MX2013008651A patent/MX344012B/es active IP Right Grant
- 2012-07-12 US US13/547,457 patent/US8852885B2/en not_active Expired - Fee Related
- 2012-10-11 US US13/650,024 patent/US8633012B2/en active Active
-
2015
- 2015-12-18 US US14/974,983 patent/US10100341B2/en active Active
-
2016
- 2016-07-25 JP JP2016145348A patent/JP6513058B2/ja active Active
- 2016-10-20 AU AU2016247159A patent/AU2016247159B2/en active Active
-
2018
- 2018-03-28 JP JP2018061680A patent/JP2018099138A/ja active Pending
- 2018-09-07 US US16/125,580 patent/US20190100780A1/en not_active Abandoned
-
2019
- 2019-01-31 AU AU2019200668A patent/AU2019200668A1/en not_active Abandoned
Patent Citations (125)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4049724A (en) | 1973-11-20 | 1977-09-20 | Atlantic Richfield Company | Osmium catalyzed organic hydroperoxide hydroxylation of olefinic compounds |
| US4058492A (en) | 1974-01-10 | 1977-11-15 | Bayer Aktiengesellschaft | Process for molding polyurethane foams |
| US4266617A (en) | 1979-02-23 | 1981-05-12 | Excel Industries, Inc. | Tractor with full-floating tool bar |
| US4288378A (en) | 1979-05-23 | 1981-09-08 | The Procter & Gamble Company | Method of preparing an enriched peanut oil peanut butter stabilizer |
| US4335156A (en) | 1980-09-19 | 1982-06-15 | Nabisco Brands, Inc. | Edible fat product |
| US4584139A (en) | 1983-01-31 | 1986-04-22 | Olin Corporation | Hydrogenation of long chain olefinic oils with Raney catalyst |
| US4798793A (en) | 1983-09-05 | 1989-01-17 | Novo Industri A/S | Immobilized Mucor miehei lipase for transesterification |
| US4940845A (en) | 1984-05-30 | 1990-07-10 | Kao Corporation | Esterification process of fats and oils and enzymatic preparation to use therein |
| US4945050A (en) | 1984-11-13 | 1990-07-31 | Cornell Research Foundation, Inc. | Method for transporting substances into living cells and tissues and apparatus therefor |
| US5900370A (en) | 1985-07-01 | 1999-05-04 | Bio-Technical Resources | Process for the production of ascorbic acid with prototheca |
| US4603188A (en) | 1985-07-10 | 1986-07-29 | Itoh Seiyu Kabushiki Kaisha | Curable urethane composition |
| US5091116A (en) | 1986-11-26 | 1992-02-25 | Kraft General Foods, Inc. | Methods for treatment of edible oils |
| WO1989001032A1 (en) | 1987-07-31 | 1989-02-09 | Novo-Nordisk A/S | Immobilized, positionally non-specific lipase, its production and use |
| US5156963A (en) | 1987-09-28 | 1992-10-20 | Novo Nordisk A/S | Immobilization of lipase by adsorption on a particulate macroporous resin |
| US5304664A (en) | 1988-10-20 | 1994-04-19 | Chemische Fabrik Stockhausen Gmbh | Process for the production of highly sulfated fatty acids and fatty acid derivatives |
| US5342768A (en) | 1988-11-16 | 1994-08-30 | Novo Nordisk A/S | Immobilization of thermostable microbial lipase by adsorption to macroporous inorganic carrier particles |
| US5080848A (en) | 1988-12-22 | 1992-01-14 | The Proctor & Gamble Company | Process for making concentrated surfactant granules |
| US5391383A (en) | 1989-09-20 | 1995-02-21 | Nabisco, Inc. | Edible spray oil |
| US5434278A (en) | 1989-09-20 | 1995-07-18 | Nabisco, Inc. | Synthesis of acetoglyceride fats |
| US5258197A (en) | 1989-09-20 | 1993-11-02 | Nabisco, Inc. | Reduced calorie triglyceride mixtures |
| US5567359A (en) | 1989-12-29 | 1996-10-22 | The Proctor & Gamble Company | Ultra mild surfactant with good lather |
| US4992189A (en) | 1990-02-07 | 1991-02-12 | Mobil Oil Corporation | Lubricants and lube additives from hydroxylation and esterification of lower alkene oligomers |
| US6022577A (en) | 1990-12-07 | 2000-02-08 | Nabisco Technology Company | High stearic acid soybean oil blends |
| US5233099A (en) | 1990-12-27 | 1993-08-03 | Kao Corporation | Process for producing alcohol |
| US5233100A (en) | 1990-12-27 | 1993-08-03 | Kao Corporation | Process for producing alcohol |
| US5380894A (en) | 1991-03-01 | 1995-01-10 | The United States Of America As Represented By The Secretary Of Agriculture | Production of hydroxy fatty acids and estolide intermediates |
| US5346724A (en) | 1991-04-12 | 1994-09-13 | Nippon Oil Company, Ltd. | Oil and fat composition for lubricating food processing machines and use thereof |
| US5268192A (en) | 1991-07-16 | 1993-12-07 | Nabisco, Inc. | Low calorie nut products and process of making |
| US5576027A (en) | 1992-06-29 | 1996-11-19 | Amerchol Corporation | Hydroxylated milk glycerides |
| US5298637A (en) | 1992-10-22 | 1994-03-29 | Arco Chemical Technology, L.P. | Process for producing a reduced calorie lipid composition |
| US5871988A (en) | 1993-10-28 | 1999-02-16 | Washington State University Research Foundation | DNA encoding limonene synthase from Mentha spicata |
| US5458795A (en) | 1994-01-28 | 1995-10-17 | The Lubrizol Corporation | Oils thickened with estolides of hydroxy-containing triglycerides |
| US5451332A (en) | 1994-01-28 | 1995-09-19 | The Lubrizol Corporation | Estolides of hydroxy-containing triglycerides that contain a performance additive |
| US5427704A (en) | 1994-01-28 | 1995-06-27 | The Lubrizol Corporation | Triglyceride oils thickened with estolides of hydroxy-containing triglycerides |
| US5776741A (en) | 1994-02-21 | 1998-07-07 | Novo Nordisk A/S | Method of enzyme immobilization on a particulate silica carrier for synthesis inorganic media |
| US5506201A (en) | 1994-04-29 | 1996-04-09 | International Flavors & Fragrances Inc. | Formulation of a fat surfactant vehicle containing a fragrance |
| US5686131A (en) | 1994-05-18 | 1997-11-11 | Snow Brand Milk Products Co., Ltd. | Edible oil or fat and edible oil or fat mixture |
| US6113971A (en) | 1994-07-25 | 2000-09-05 | Elmaleh; David R. | Olive oil butter |
| US5928696A (en) | 1994-08-16 | 1999-07-27 | Dr. Frische Gmbh | Process for extracting native products which are not water-soluble from native substance mixtures by centrifugal force |
| US5833999A (en) | 1994-10-20 | 1998-11-10 | The Proctor & Gamble Company | Personal treatment compositions and /or cosmetic compositions containing enduring perfume |
| US5475160A (en) | 1994-11-07 | 1995-12-12 | Shell Oil Company | Process for the direct hydrogenation of triglycerides |
| US6057375A (en) | 1995-02-01 | 2000-05-02 | Henkel Kommanditgesellschaft Auf Aktien | Use of alkoxylation products of epoxidized fats as antifoaming agents |
| US5942479A (en) | 1995-05-27 | 1999-08-24 | The Proctor & Gamble Company | Aqueous personal cleansing composition with a dispersed oil phase comprising two specifically defined oil components |
| US5888947A (en) | 1995-06-06 | 1999-03-30 | Agro Management Group, Inc. | Vegetable oil lubricants for internal combustion engines and total loss lubrication |
| US6380410B1 (en) | 1995-10-27 | 2002-04-30 | Basf Aktiengesellschaft | Fatty acid derivatives and their use as surfactants in detergents and cleaners |
| FI100248B (fi) | 1996-02-05 | 1997-10-31 | Fortum Oil Oy | Keskitisleen valmistus |
| US6086903A (en) | 1996-02-26 | 2000-07-11 | The Proctor & Gamble Company | Personal treatment compositions and/or cosmetic compositions containing enduring perfume |
| US6610527B1 (en) | 1996-04-15 | 2003-08-26 | Washington State University Research Foundation | Compositions and methods for Taxol biosynthesis |
| US6114160A (en) | 1996-04-15 | 2000-09-05 | Washington State University Research Foundation | Compositions and methods for taxol biosynthesis |
| US5994114A (en) | 1996-04-15 | 1999-11-30 | Washington State University Research Foundation | Compositions and methods for taxol biosynthesis |
| US6342208B1 (en) | 1996-08-02 | 2002-01-29 | Plum Kerni Produktion A/S | Oil-in-water emulsion containing C10-C24 fatty acid derivatives for treating skin of mammals |
| US6080853A (en) | 1996-08-08 | 2000-06-27 | The Procter & Gamble Company | Polyol polyester synthesis |
| US5885440A (en) | 1996-10-01 | 1999-03-23 | Uop Llc | Hydrocracking process with integrated effluent hydrotreating zone |
| US6465642B1 (en) | 1997-02-07 | 2002-10-15 | The Procter & Gamble Company | Lower alkyl ester recycling in polyol fatty acid polyester synthesis |
| US6140302A (en) | 1997-03-12 | 2000-10-31 | Cognis Deutschland Gmbh | Method for producing anionic surfactant granulates |
| US6395965B1 (en) | 1997-03-21 | 2002-05-28 | Restoragen, Inc. | Plant containing a gene construct comprising a chlorella virus promoter and a lac operator |
| US6083731A (en) | 1997-06-24 | 2000-07-04 | Washington State University Research Foundation | Recombinant materials and methods for the production of limonene hydroxylases |
| US6194185B1 (en) | 1997-06-24 | 2001-02-27 | Washington State University Research Foundation | Recombinant materials and methods for production of limonene hydroxylases |
| US6429014B1 (en) | 1997-07-11 | 2002-08-06 | Washington State University Research Foundation | Monoterpene synthases from grand fir (Abies grandis) |
| US5891697A (en) | 1997-09-25 | 1999-04-06 | Washington State University Research Foundation | Monoterpene synthases from common sage (Salvia officinalis) |
| US6451576B1 (en) | 1998-01-22 | 2002-09-17 | Washington State University Research Foundation | Sesquiterpene synthases from grand fir (Abies grandis), and methods of use |
| US6265639B1 (en) | 1998-01-22 | 2001-07-24 | Washington State University Foundation | Gymnosperm nucleic acid molecules encoding sesquiterpene synthases and methods of use |
| US6407044B2 (en) | 1998-01-28 | 2002-06-18 | The Proctor & Gamble Company | Aerosol personal cleansing emulsion compositions which contain low vapor pressure propellants |
| US6342380B1 (en) | 1998-02-02 | 2002-01-29 | The Regents Of The University Of California | Germacrene C synthase gene of Lycopersicon esculentum |
| US6468955B1 (en) | 1998-05-01 | 2002-10-22 | The Proctor & Gamble Company | Laundry detergent and/or fabric care compositions comprising a modified enzyme |
| US6051539A (en) | 1998-07-02 | 2000-04-18 | Cargill, Inc. | Process for modifying unsaturated triacylglycerol oils resulting products and uses thereof |
| US6043072A (en) | 1998-11-05 | 2000-03-28 | Washington State University Research Foundation | Nucleic acids encoding Taxus geranylgeranyl diphosphate synthase, and methods of use |
| US6194475B1 (en) | 1998-12-21 | 2001-02-27 | Goldschmidt Ag | Use of metal salts of ricinoleic acid in producing polyurethane |
| US6020509A (en) | 1998-12-22 | 2000-02-01 | Condea Vista Company | Method for producing surfactant compositions |
| US6630066B2 (en) | 1999-01-08 | 2003-10-07 | Chevron U.S.A. Inc. | Hydrocracking and hydrotreating separate refinery streams |
| US20080040822A1 (en) | 1999-01-14 | 2008-02-14 | Martek Biosciences Corporation | Pufa polyketide synthase systems and uses thereof |
| US6278006B1 (en) | 1999-01-19 | 2001-08-21 | Cargill, Incorporated | Transesterified oils |
| WO2000066750A2 (en) | 1999-05-03 | 2000-11-09 | Calgene Llc | Methods for producing plants with elevated oleic acid content |
| US7262158B1 (en) | 1999-07-01 | 2007-08-28 | Johnson & Johnson Companies, Inc. | Cleansing compositions comprising a liquid silicone and ester mixture |
| US6217746B1 (en) | 1999-08-16 | 2001-04-17 | Uop Llc | Two stage hydrocracking process |
| US6391815B1 (en) | 2000-01-18 | 2002-05-21 | Süd-Chemie Inc. | Combination sulphur adsorbent and hydrogenation catalyst for edible oils |
| US6750048B2 (en) | 2000-01-19 | 2004-06-15 | Martek Biosciences Corporation | Solventless extraction process |
| US6268517B1 (en) | 2000-05-09 | 2001-07-31 | Condea Vista Company | Method for producing surfactant compositions |
| US7115173B2 (en) | 2000-05-11 | 2006-10-03 | The Procter & Gamble Company | Highly concentrated fabric softener compositions and articles containing such compositions |
| US6808737B2 (en) | 2000-05-29 | 2004-10-26 | Premium Vegetable Oils Berhad | Trans free hard structural fat for margarine blend and spreads |
| US6403664B1 (en) | 2000-06-20 | 2002-06-11 | Goldschmidt Ag | Combination of metal salts of ricinoleic acid with reactive amines in producing polyurethane forms |
| WO2002008403A2 (en) | 2000-07-25 | 2002-01-31 | Calgene Llc | Nucleic acid sequences encoding beta-ketoacyl-acp synthase and uses thereof |
| US6692730B2 (en) | 2000-09-20 | 2004-02-17 | L'oreal | Washing composition comprising particles of aluminum oxide, at least one conditioning agent and at least one detergent surfactant |
| US6596155B1 (en) | 2000-09-26 | 2003-07-22 | Uop Llc | Hydrocracking process |
| US6538169B1 (en) | 2000-11-13 | 2003-03-25 | Uop Llc | FCC process with improved yield of light olefins |
| US7118773B2 (en) | 2000-11-21 | 2006-10-10 | Lipton, Divison Of Conopco, Inc. | Edible spread containing a natural fat phase |
| US7288278B2 (en) | 2000-12-21 | 2007-10-30 | Aarhuskarlshamn Denmark A/S | Process for preparing vegetable oil fractions rich in non-tocolic, high-melting, unsaponifiable matter |
| US7119216B2 (en) | 2001-03-26 | 2006-10-10 | Dow Global Technologies Inc. | Metathesis of unsaturated fatty acid esters or unsaturated fatty acids with lower olefins |
| US6946430B2 (en) | 2001-03-28 | 2005-09-20 | Kao Corporation | Surfactant composition |
| US6869597B2 (en) | 2001-05-04 | 2005-03-22 | L'oreal S.A. | Cosmetic care or makeup composition for a keratin material comprising at least one photoprotective agent and at least one ester comprising an aromatic group |
| US6770104B2 (en) | 2001-05-11 | 2004-08-03 | Cargill, Incorporated | Triacylglycerol based candle wax |
| US6596768B2 (en) | 2001-05-22 | 2003-07-22 | Church & Dwight Co., Inc. | Unsaturated lipid-enriched feedstock for ruminants |
| US6398707B1 (en) | 2001-05-31 | 2002-06-04 | Wen-Teng Wu | Method of preparing lower alkyl fatty acids esters and in particular biodiesel |
| US20030079249A1 (en) * | 2001-06-29 | 2003-04-24 | John Shanklin | Isoform of castor oleate hydroxylase |
| US6881873B2 (en) | 2001-08-29 | 2005-04-19 | Uop Llc | High-activity isomerization catalyst and process |
| US6924333B2 (en) | 2002-01-03 | 2005-08-02 | Archer-Daniels-Midland Company | Polyunsaturated fatty acids as part of reactive structures for latex paints: thickeners, surfactants, and dispersants |
| US6590113B1 (en) | 2002-03-26 | 2003-07-08 | Ronald T. Sleeter | Process for treating oils containing antioxidant compounds |
| US7264886B2 (en) | 2002-05-14 | 2007-09-04 | Viance, Llc | Water repellent compositions for wood preservatives |
| US6977322B2 (en) | 2002-06-18 | 2005-12-20 | Uop Llc | Isomerization catalyst and processes |
| US7232935B2 (en) | 2002-09-06 | 2007-06-19 | Fortum Oyj | Process for producing a hydrocarbon component of biological origin |
| US7041866B1 (en) | 2002-10-08 | 2006-05-09 | Uop Llc | Solid-acid isomerization catalyst and process |
| US7115760B2 (en) | 2002-11-01 | 2006-10-03 | Danisco A/S | Process for controlling the fatty acid chain composition of triglycerides and use thereof |
| US7196124B2 (en) | 2003-01-08 | 2007-03-27 | Texas Tech University | Elastomeric material compositions obtained from castor oil and epoxidized soybean oil |
| US7135290B2 (en) | 2003-04-12 | 2006-11-14 | Solazyme, Inc. | Methods and compositions for evolving hydrogenase genes |
| EP1682466A1 (en) | 2003-11-13 | 2006-07-26 | Neste Oil OYJ | Process for the hydrogenation of olefins |
| EP1640437A1 (en) | 2004-09-28 | 2006-03-29 | Neste Oil Oyj | Production of fuel components |
| US7238277B2 (en) | 2004-12-16 | 2007-07-03 | Chevron U.S.A. Inc. | High conversion hydroprocessing |
| EP1681337A1 (en) | 2005-01-14 | 2006-07-19 | Neste Oil OYJ | Method for the manufacture of hydrocarbons |
| US7288685B2 (en) | 2005-05-19 | 2007-10-30 | Uop Llc | Production of olefins from biorenewable feedstocks |
| EP1741767A1 (en) | 2005-07-04 | 2007-01-10 | Neste Oil OYJ | Process for the manufacture of diesel range hydrocarbons |
| EP1741768A1 (en) | 2005-07-04 | 2007-01-10 | Neste Oil OYJ | Process for the manufacture of diesel range hydrocarbons |
| EP1795576A1 (en) | 2005-12-12 | 2007-06-13 | Neste Oil OYJ | Process for the manufacture of hydrocarbons |
| US20070175091A1 (en) | 2006-02-02 | 2007-08-02 | Renewable Energy Group, Llc | Biodiesel cold filtration process |
| WO2008002643A2 (en) | 2006-06-28 | 2008-01-03 | Cibus Llc | Fatty acid blends and uses therefor |
| US20100145086A1 (en) | 2006-10-13 | 2010-06-10 | Elevance Renewable Sciences, Inc. | Synthesis of Terminal Alkenes From Internal Alkenes Via Olefin Metathesis |
| WO2008151149A2 (en) | 2007-06-01 | 2008-12-11 | Solazyme, Inc. | Production of oil in microorganisms |
| US20100323414A1 (en) * | 2007-06-01 | 2010-12-23 | Solazyme, Inc. | Production of Oil in Microorganisms |
| WO2010012093A1 (en) | 2008-08-01 | 2010-02-04 | Profero Energy Inc. | Methods and systems for gas production from a reservoir |
| US20100151539A1 (en) * | 2008-11-28 | 2010-06-17 | Solazyme, Inc. | Recombinant Microalgae Cells Producing Novel Oils |
| WO2010063031A2 (en) | 2008-11-28 | 2010-06-03 | Solazyme, Inc. | Manufacturing of tailored oils in recombinant heterotrophic microorganisms |
| US20100160506A1 (en) | 2008-12-23 | 2010-06-24 | Margaret May-Som Wu | Production of synthetic hydrocarbon fluids, plasticizers and synthetic lubricant base stocks from renewable feedstocks |
| US20100227151A1 (en) | 2009-03-04 | 2010-09-09 | Jeffrey Philip Rowlands | Polyurethane foam |
| WO2011130576A1 (en) | 2010-04-14 | 2011-10-20 | Solazyme, Inc. | Oleaginous yeast food compositions |
| WO2011130578A2 (en) | 2010-04-14 | 2011-10-20 | Solazyme, Inc. | Lipid-rich microalgal flour food compositions |
| WO2011150411A1 (en) | 2010-05-28 | 2011-12-01 | Solazyme, Inc. | Food compositions comprising tailored oils |
Non-Patent Citations (113)
| Title |
|---|
| "Gen Bank", Database accession no. U56103 |
| "Gen Bank", Database accession no. U56104 |
| "GenBank", Database accession no. AA018435 |
| "Genbank", Database accession no. AAA33122 |
| "Genbank", Database accession no. AAA37647 |
| "Genbank", Database accession no. AAA53047 |
| "Genbank", Database accession no. AAA74319 |
| "Genbank", Database accession no. AAA75528 |
| "Genbank", Database accession no. AAA81471 |
| "GenBank", Database accession no. AAB67840.1 |
| "GenBank", Database accession no. AAC49010.1 |
| "Genbank", Database accession no. AAD422220.2 |
| "GenBank", Database accession no. AAF15308 |
| "Genbank", Database accession no. AAF20201 |
| "Genbank", Database accession no. AAK60610 |
| "Genbank", Database accession no. AAK60611 |
| "Genbank", Database accession no. AAK60612 |
| "Genbank", Database accession no. AAK60613 |
| "GenBank", Database accession no. AAL68983 |
| "GenBank", Database accession no. AAL91174 |
| "GenBank", Database accession no. AAW88762.1 |
| "Genbank", Database accession no. AAY86086 |
| "Genbank", Database accession no. AB094442 |
| "GenBank", Database accession no. ABF50053 |
| "GenBank", Database accession no. ABJ90469.2 |
| "Genbank", Database accession no. ABM45911 |
| "GenBank", Database accession no. ACQ41833.1 |
| "GenBank", Database accession no. ADK23940.1 |
| "GenBank", Database accession no. ADM48789 |
| "GenBank", Database accession no. AF205791 |
| "Genbank", Database accession no. AOTOF8 |
| "GenBank", Database accession no. AY646197 |
| "Genbank", Database accession no. BAA11024 |
| "Genbank", Database accession no. BAA57908 |
| "Genbank", Database accession no. BAA94752 |
| "GenBank", Database accession no. BAD89862 |
| "GENBANK", Database accession no. CAA03710 |
| "Genbank", Database accession no. CAA06839 |
| "Genbank", Database accession no. CAA43322 |
| "Genbank", Database accession no. CAA53390 |
| "GenBank", Database accession no. CAA71199 |
| "Genbank", Database accession no. CAB75874 |
| "Genbank", Database accession no. CAB92307 |
| "Genbank", Database accession no. CAB95010 |
| "Genbank", Database accession no. CAD91334 |
| "Genbank", Database accession no. CAF05587 |
| "GenBank", Database accession no. CBI27767 |
| "Genbank", Database accession no. NP _415392 |
| "Genbank", Database accession no. NP 012104 |
| "Genbank", Database accession no. NP 035610 |
| "Genbank", Database accession no. NP_045833 |
| "Genbank", Database accession no. NP_113747 |
| "Genbank", Database accession no. NP-849041 |
| "Genbank", Database accession no. P26420 |
| "Genbank", Database accession no. P26984 |
| "Genbank", Database accession no. P44857 |
| "Genbank", Database accession no. P51280 |
| "Genbank", Database accession no. Q1XDM1 |
| "Genbank", Database accession no. Q38710 |
| "Genbank", Database accession no. Q9WTN3 |
| "Genbank", Database accession no. YP_536879 |
| "Genbank", Database accession no. YP_537052 |
| "Genbank", Database accession no. YP-874433 |
| "Genbank", Database accession no. ZP 00513891 |
| "NCBI", Database accession no. P04824 |
| "NCBI", Database accession no. Q9UUZ4 |
| "The effect of fatty acid composition on the acrylation kinetics of epoxidized triacylglycerols", JOURNAL OF THE AMERICAN OIL CHEMISTS' SOCIETY, vol. 79, no. 1, 2001, pages 59 - 63 |
| "US Pharmacopeias Food and Chemicals Codes", 2010 |
| ADV. VIRUS RES., vol. 66, 2006, pages 293 - 336 |
| ANNU. REV. MICROBIOL., vol. 53, 1999, pages 447 - 94 |
| BIOCHEM BIOPHYS RES COMMUN., vol. 204, no. l, 14 October 1994 (1994-10-14), pages 187 - 94 |
| CHEN; OROZCO, NUCLEIC ACIDS RES., vol. 16, 1988, pages 8411 |
| CIFERRI, O., NATURE, vol. 178, 1956, pages 1475 - 1476 |
| DAWSON ET AL., CURRENT MICROBIOLOGY, vol. 35, 1997, pages 356 - 362 |
| FEMS MICROBIOLOGY LETTERS, vol. 180, 1999, pages 45 - 53 |
| FREE RADICAL BIOLOGY AND MEDICINE, vol. 37, no. 1, 2004, pages 104 - 114 |
| FRENZ ET AL., ENZYME MICROB. TECHNOL., vol. 11, 1989, pages 717 |
| FROMM ET AL., PROC. NAT'L. ACAD. SCI. (USA, vol. 82, 1985, pages 5824 5828 |
| HAWKINS ET AL., CURRENT MICROBIOLOGY, vol. 38, 1999, pages 335 - 341 |
| HILLEN ET AL., BIOTECHNOLOGY AND BIOENGINEERING, vol. XXIV, 1982, pages 193 - 205 |
| HUANG ET AL., APPL. MICROBIOL. BIOTECHNOL., vol. 72, 2007, pages 197 - 205 |
| INOUE ET AL., BIOMASS BIOENERGY, vol. 6, no. 4, 1993, pages 269 - 274 |
| ISBELL ET AL., JAOCS, vol. 71, no. 2, 1994, pages 169 - 174 |
| J MICROBIOL., vol. 43, no. 4, August 2005 (2005-08-01), pages 361 - 5 |
| J. VIROL., vol. 80, no. 5, March 2006 (2006-03-01), pages 2437 - 44 |
| JOHN SHEEHAN; TERRI DUNAHAY; JOHN BENEMANN; PAUL ROESSLER, A LOOK BACK AT THE U.S. DEPARTMENT OF ENERGY'S AQUATIC SPECIES PROGRAM: BIODIESEL FROM ALGAE, NREL/TP-580-24190, 1998 |
| KIM ET AL., MAR. BIOTECHNOL., vol. 4, 2002, pages 63 - 73 |
| LEONARD ET AL., PLANT J., vol. 13, no. 5, 1998, pages 621 - 8 |
| LEONARD ET AL., PLANT MOL. BIOL., vol. 34, no. 4, 1997, pages 669 - 79 |
| MAR BIOTECHNOL (NY, vol. 4, no. 1, January 2002 (2002-01-01), pages 63 - 73 |
| MARUYAMA ET AL., BIOTECHNOLOGY TECHNIQUES, vol. 8, 2004, pages 821 - 826 |
| MENDES ET AL., INORGANICA CHIMICA ACTA, vol. 356, 2003, pages 328 - 334 |
| METZGER ET AL., APPL MICROBIOL BIOTECHNOL, vol. 66, 2005, pages 486 - 496 |
| MIAO; WU, BIOSOURCE TECHNOLOGY, vol. 97, 2006, pages 841 - 846 |
| MINOWA ET AL., FUEL, vol. 74, no. 12, 1995, pages 1735 - 1738 |
| MOL GEN GENET., vol. 252, no. 5, 16 October 1996 (1996-10-16), pages 572 - 9 |
| NATIONAL RESEARCH COUNCIL: FAT CONTENT AND COMPOSITION OF ANIMAL PRODUCTS, 1976 |
| NUCLEIC ACIDS SYMP. SER., vol. 44, 2000, pages 161 - 2 |
| ODA Y ET AL.: "Degradation of Polylactide by Commercial Proteases", JOURNAL OF POLYMERS AND THE ENVIRONMENT, vol. 8, no. 1, January 2000 (2000-01-01), pages 29 - 32, XP002743808, DOI: doi:10.1023/A:1010120128048 |
| PLANT CELL REP., vol. 23, no. 10-11, March 2005 (2005-03-01), pages 727 - 35 |
| PLANT JOURNAL, vol. 14, no. 4, 1998, pages 441 - 447 |
| PLANT MOL BIOL., vol. 26, no. 1, October 1994 (1994-10-01), pages 85 - 93 |
| PORE, APP. MICROBIOLOGY, vol. 26, 1973, pages 648 - 649 |
| PROC NATL ACAD SCI USA, vol. 102, no. 17, 26 April 2005 (2005-04-26), pages 6225 - 30 |
| PROTIST, vol. 155, no. 4, December 2004 (2004-12-01), pages 381 - 93 |
| SANFORD, TRENDS IN BIOTECH., vol. 6, 1988, pages 299 302 |
| SAWAYAMA ET AL., BIOMASS AND BIOENERGY, vol. 17, 1999, pages 33 - 39 |
| VIROLOGY, vol. 230, 1997, pages 361 - 368 |
| VIROLOGY, vol. 257, no. 1, 25 April 1999 (1999-04-25), pages 15 - 23 |
| VIROLOGY, vol. 260, 1999, pages 308 - 315 |
| VIROLOGY, vol. 263, 1999, pages 376 - 387 |
| VIROLOGY, vol. 318, no. l, 5 January 2004 (2004-01-05), pages 214 - 23 |
| VIROLOGY, vol. 326, no. 1, 15 August 2004 (2004-08-15), pages 150 - 9 |
Cited By (96)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10138435B2 (en) | 2007-06-01 | 2018-11-27 | Corbion Biotech, Inc. | Renewable diesel and jet fuel from microbial sources |
| US12059006B2 (en) | 2008-10-14 | 2024-08-13 | Corbion Biotech, Inc. | Microalgal flour |
| US9353389B2 (en) | 2008-11-28 | 2016-05-31 | Solazyme, Inc. | Nucleic acids useful in the manufacture of oil |
| US10006034B2 (en) | 2010-05-28 | 2018-06-26 | Corbion Biotech, Inc. | Recombinant microalgae including keto-acyl ACP synthase |
| US9657299B2 (en) | 2010-05-28 | 2017-05-23 | Terravia Holdings, Inc. | Tailored oils produced from recombinant heterotrophic microorganisms |
| US9255282B2 (en) | 2010-05-28 | 2016-02-09 | Solazyme, Inc. | Tailored oils produced from recombinant heterotrophic microorganisms |
| US8592188B2 (en) | 2010-05-28 | 2013-11-26 | Solazyme, Inc. | Tailored oils produced from recombinant heterotrophic microorganisms |
| US9279136B2 (en) | 2010-05-28 | 2016-03-08 | Solazyme, Inc. | Methods of producing triacylglyceride compositions comprising tailored oils |
| US8765424B2 (en) | 2010-05-28 | 2014-07-01 | Solazyme, Inc. | Tailored oils produced from recombinant heterotrophic microorganisms |
| US9109239B2 (en) | 2010-05-28 | 2015-08-18 | Solazyme, Inc. | Hydroxylated triacylglycerides |
| US10167489B2 (en) | 2010-11-03 | 2019-01-01 | Corbion Biotech, Inc. | Microbial oils with lowered pour points, dielectric fluids produced therefrom, and related methods |
| US10344305B2 (en) | 2010-11-03 | 2019-07-09 | Corbion Biotech, Inc. | Microbial oils with lowered pour points, dielectric fluids produced therefrom, and related methods |
| US9066527B2 (en) | 2010-11-03 | 2015-06-30 | Solazyme, Inc. | Microbial oils with lowered pour points, dielectric fluids produced therefrom, and related methods |
| US9388435B2 (en) | 2010-11-03 | 2016-07-12 | Terravia Holdings, Inc. | Microbial oils with lowered pour points, dielectric fluids produced therefrom, and related methods |
| US8633012B2 (en) | 2011-02-02 | 2014-01-21 | Solazyme, Inc. | Tailored oils produced from recombinant oleaginous microorganisms |
| US10100341B2 (en) | 2011-02-02 | 2018-10-16 | Corbion Biotech, Inc. | Tailored oils produced from recombinant oleaginous microorganisms |
| US8852885B2 (en) | 2011-02-02 | 2014-10-07 | Solazyme, Inc. | Production of hydroxylated fatty acids in Prototheca moriformis |
| US9249436B2 (en) | 2011-02-02 | 2016-02-02 | Solazyme, Inc. | Tailored oils produced from recombinant oleaginous microorganisms |
| US9499845B2 (en) | 2011-05-06 | 2016-11-22 | Terravia Holdings, Inc. | Genetically engineered microorganisms that metabolize xylose |
| US8846352B2 (en) | 2011-05-06 | 2014-09-30 | Solazyme, Inc. | Genetically engineered microorganisms that metabolize xylose |
| US9649368B2 (en) | 2011-11-28 | 2017-05-16 | Terravia Holdings, Inc. | Genetically engineered microbial strains including prototheca lipid pathway genes |
| US9328351B2 (en) | 2011-11-28 | 2016-05-03 | Solazyme, Inc. | Genetically engineered microbial strains including Prototheca lipid pathway genes |
| WO2013082186A2 (en) | 2011-11-28 | 2013-06-06 | Solazyme, Inc. | Genetically engineered microbial strains including prototheca lipid pathway genes |
| EP3550025A1 (en) | 2012-04-18 | 2019-10-09 | Corbion Biotech, Inc. | Tailored oils |
| US8945908B2 (en) | 2012-04-18 | 2015-02-03 | Solazyme, Inc. | Tailored oils |
| WO2013158938A1 (en) | 2012-04-18 | 2013-10-24 | Solazyme, Inc. | Tailored oils |
| US11401538B2 (en) | 2012-04-18 | 2022-08-02 | Corbion Biotech, Inc. | Structuring fats and methods of producing structuring fats |
| US9909155B2 (en) | 2012-04-18 | 2018-03-06 | Corbion Biotech, Inc. | Structuring fats and methods of producing structuring fats |
| US9249441B2 (en) | 2012-04-18 | 2016-02-02 | Solazyme, Inc. | Tailored oils |
| US9200307B2 (en) | 2012-04-18 | 2015-12-01 | Solazyme, Inc. | Tailored oils |
| US10683522B2 (en) | 2012-04-18 | 2020-06-16 | Corbion Biotech, Inc. | Structuring fats and methods of producing structuring fats |
| US9719114B2 (en) | 2012-04-18 | 2017-08-01 | Terravia Holdings, Inc. | Tailored oils |
| US9068213B2 (en) | 2012-04-18 | 2015-06-30 | Solazyme, Inc. | Microorganisms expressing ketoacyl-CoA synthase and uses thereof |
| US8846375B2 (en) | 2012-04-18 | 2014-09-30 | Solazyme, Inc. | Tailored oils |
| US9551017B2 (en) | 2012-04-18 | 2017-01-24 | Terravia Holdings, Inc. | Structuring fats and methods of producing structuring fats |
| US9102973B2 (en) | 2012-04-18 | 2015-08-11 | Solazyme, Inc. | Tailored oils |
| US10287613B2 (en) | 2012-04-18 | 2019-05-14 | Corbion Biotech, Inc. | Structuring fats and methods of producing structuring fats |
| US9518277B2 (en) | 2012-12-07 | 2016-12-13 | Terravia Holdings, Inc. | Genetically engineered microbial strains including Chlorella protothecoides lipid pathway genes |
| US10264809B2 (en) | 2013-01-28 | 2019-04-23 | Corbion Biotech, Inc. | Microalgal flour |
| US10098371B2 (en) | 2013-01-28 | 2018-10-16 | Solazyme Roquette Nutritionals, LLC | Microalgal flour |
| CN105164252B (zh) * | 2013-01-29 | 2018-11-27 | 柯碧恩生物技术公司 | 变体硫酯酶及使用方法 |
| US9816079B2 (en) | 2013-01-29 | 2017-11-14 | Terravia Holdings, Inc. | Variant thioesterases and methods of use |
| US9567615B2 (en) | 2013-01-29 | 2017-02-14 | Terravia Holdings, Inc. | Variant thioesterases and methods of use |
| JP2016508717A (ja) * | 2013-01-29 | 2016-03-24 | ソラザイム, インコーポレイテッドSolazyme Inc | 変異チオエステラーゼ及び使用方法 |
| CN105164252A (zh) * | 2013-01-29 | 2015-12-16 | 索拉兹米公司 | 变体硫酯酶及使用方法 |
| WO2014138593A2 (en) | 2013-03-08 | 2014-09-12 | Solazyme, Inc. | Oleaginous microbial lubricants |
| WO2014138732A3 (en) * | 2013-03-08 | 2014-12-04 | Bp Corporation North America Inc. | Microorganisms with altered fatty acid profiles for renewable materials and biofuel production |
| WO2014151904A1 (en) | 2013-03-15 | 2014-09-25 | Solazyme, Inc. | Thioesterases and cells for production of tailored oils |
| US10557114B2 (en) | 2013-03-15 | 2020-02-11 | Corbion Biotech, Inc. | Thioesterases and cells for production of tailored oils |
| US9290749B2 (en) | 2013-03-15 | 2016-03-22 | Solazyme, Inc. | Thioesterases and cells for production of tailored oils |
| US9783836B2 (en) | 2013-03-15 | 2017-10-10 | Terravia Holdings, Inc. | Thioesterases and cells for production of tailored oils |
| JP2014212732A (ja) * | 2013-04-25 | 2014-11-17 | 旭硝子株式会社 | リシノール酸産生酵母 |
| US9249252B2 (en) | 2013-04-26 | 2016-02-02 | Solazyme, Inc. | Low polyunsaturated fatty acid oils and uses thereof |
| WO2015163939A1 (en) | 2013-04-26 | 2015-10-29 | Solazyme, Inc. | Ring opening of epoxidized fatty acid esters |
| WO2014176515A2 (en) | 2013-04-26 | 2014-10-30 | Solazyme, Inc. | Low polyunsaturated fatty acid oils and uses thereof |
| JP2016523093A (ja) * | 2013-06-25 | 2016-08-08 | セレクティスCellectis | バイオ燃料生産のための改変された珪藻 |
| US10119947B2 (en) | 2013-08-07 | 2018-11-06 | Corbion Biotech, Inc. | Protein-rich microalgal biomass compositions of optimized sensory quality |
| JP2016538826A (ja) * | 2013-10-04 | 2016-12-15 | テラヴィア ホールディングス, インコーポレイテッド | 調整油 |
| WO2015051319A2 (en) | 2013-10-04 | 2015-04-09 | Solazyme, Inc. | Tailored oils |
| US10053715B2 (en) | 2013-10-04 | 2018-08-21 | Corbion Biotech, Inc. | Tailored oils |
| JPWO2015133305A1 (ja) * | 2014-03-03 | 2017-04-06 | 花王株式会社 | β−ケトアシル−ACPシンターゼを用いた脂質の製造方法 |
| WO2015133305A1 (ja) * | 2014-03-03 | 2015-09-11 | 花王株式会社 | β-ケトアシル-ACPシンターゼを用いた脂質の製造方法 |
| US10066248B2 (en) | 2014-03-03 | 2018-09-04 | Kao Corporation | Method of producing lipid by using β-ketoacyl-ACP synthase |
| US9394550B2 (en) | 2014-03-28 | 2016-07-19 | Terravia Holdings, Inc. | Lauric ester compositions |
| US9796949B2 (en) | 2014-03-28 | 2017-10-24 | Terravia Holdings, Inc. | Lauric ester compositions |
| WO2015164550A1 (en) | 2014-04-23 | 2015-10-29 | Solazyme, Inc. | Food-related uses of high-stability oil |
| WO2016004401A1 (en) | 2014-07-03 | 2016-01-07 | Solazyme, Inc. | Lubricants and wellbore fluids |
| EP3620517A2 (en) | 2014-07-10 | 2020-03-11 | Corbion Biotech, Inc. | Ketoacyl acp synthase genes and uses thereof |
| US9969990B2 (en) | 2014-07-10 | 2018-05-15 | Corbion Biotech, Inc. | Ketoacyl ACP synthase genes and uses thereof |
| WO2016007862A2 (en) | 2014-07-10 | 2016-01-14 | Solazyme, Inc. | Novel ketoacyl acp synthase genes and uses thereof |
| US10316299B2 (en) | 2014-07-10 | 2019-06-11 | Corbion Biotech, Inc. | Ketoacyl ACP synthase genes and uses thereof |
| US10570428B2 (en) | 2014-07-24 | 2020-02-25 | Corbion Biotech, Inc. | Variant thioesterases and methods of use |
| US10246728B2 (en) | 2014-07-24 | 2019-04-02 | Corbion Biotech, Inc. | Variant thioesterases and methods of use |
| US9765368B2 (en) | 2014-07-24 | 2017-09-19 | Terravia Holdings, Inc. | Variant thioesterases and methods of use |
| EP3660149A1 (en) | 2014-07-24 | 2020-06-03 | Corbion Biotech, Inc. | Variant thioesterases and methods of use |
| US10760106B2 (en) | 2014-07-24 | 2020-09-01 | Corbion Biotech, Inc. | Variant thioesterases and methods of use |
| US10125382B2 (en) | 2014-09-18 | 2018-11-13 | Corbion Biotech, Inc. | Acyl-ACP thioesterases and mutants thereof |
| US11352602B2 (en) | 2015-03-31 | 2022-06-07 | Corbion Biotech, Inc. | Microalgae adapted for heterotrophic culture conditions |
| EP3447124A1 (en) | 2015-03-31 | 2019-02-27 | Corbion Biotech, Inc. | Microalgae adapted for heterotrophic culture conditions |
| WO2016160999A1 (en) | 2015-03-31 | 2016-10-06 | Solazyme, Inc. | Microalgae adapted for heterotrophic culture conditions |
| WO2016164495A1 (en) | 2015-04-06 | 2016-10-13 | Solazyme, Inc. | Oleaginous microalgae having an lpaat ablation |
| WO2018067849A2 (en) | 2016-10-05 | 2018-04-12 | Terravia Holdings, Inc. | Novel acyltransferases, variant thioesterases, and uses thereof |
| US11618890B2 (en) | 2018-08-22 | 2023-04-04 | Corbion Biotech, Inc. | Beta-ketoacyl-ACP synthase II variants |
| WO2020041521A1 (en) * | 2018-08-22 | 2020-02-27 | Corbion Biotech, Inc. | β-KETOACYL-ACP SYNTHASE II VARIANTS |
| US11208369B2 (en) | 2018-08-30 | 2021-12-28 | Checkerspot, Inc. | Hydroformylated triglycerides and uses thereof |
| US11673850B2 (en) | 2018-08-30 | 2023-06-13 | Checkerspot, Inc. | Hydroformylated triglycerides and uses thereof |
| US11118134B2 (en) | 2019-02-11 | 2021-09-14 | Checkerspot, Inc. | Triglyceride oil compositions |
| US11667870B2 (en) | 2019-02-11 | 2023-06-06 | Checkerspot, Inc. | Triglyceride oil compositions |
| US11691382B2 (en) | 2019-12-18 | 2023-07-04 | Checkerspot, Inc. | Uses of microbial derived materials in polymer applications |
| US12257818B2 (en) | 2019-12-18 | 2025-03-25 | Checkerspot, Inc. | Uses of microbial derived materials in polymer applications |
| US12600994B2 (en) | 2020-01-16 | 2026-04-14 | Corbion Biotech, Inc. | β-ketoacyl-ACP synthase IV variants |
| US11873405B2 (en) | 2021-09-17 | 2024-01-16 | Checkerspot, Inc. | High oleic oil compositions and uses thereof |
| US12180361B2 (en) | 2021-11-19 | 2024-12-31 | Checkerspot, Inc. | Recycled polyurethane formulations |
| US11981806B2 (en) | 2021-11-19 | 2024-05-14 | Checkerspot, Inc. | Recycled polyurethane formulations |
| US11976212B2 (en) | 2021-12-01 | 2024-05-07 | Checkerspot, Inc. | Polyols, polyurethane dispersions, and uses thereof |
| WO2026061738A1 (de) | 2024-09-23 | 2026-03-26 | Rheinisch-Westfälische Technische Hochschule Aachen, abgekürzt RWTH Aachen, Körperschaft des öffentlichen Rechts | Plattform zur herstellung mikrobieller triglyzeridmischungen mit einstellbarer zusammensetzung |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US10100341B2 (en) | Tailored oils produced from recombinant oleaginous microorganisms | |
| JP6542283B2 (ja) | 組み換え従属栄養性微生物から産生された用途に応じた油 | |
| BR112012030333B1 (pt) | Célula de microalga, e, métodos para produzir uma composição de óleo de triglicerídeo de microalga, e para preparar um produto à base de óleo |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 12741997 Country of ref document: EP Kind code of ref document: A1 |
|
| DPE1 | Request for preliminary examination filed after expiration of 19th month from priority date (pct application filed from 20040101) | ||
| ENP | Entry into the national phase |
Ref document number: 2825691 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2013/008651 Country of ref document: MX |
|
| ENP | Entry into the national phase |
Ref document number: 2013552645 Country of ref document: JP Kind code of ref document: A |
|
| REEP | Request for entry into the european phase |
Ref document number: 2012741997 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2012741997 Country of ref document: EP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2012212079 Country of ref document: AU Date of ref document: 20120202 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20137023181 Country of ref document: KR Kind code of ref document: A |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112013019699 Country of ref document: BR |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01E Ref document number: 112013019699 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 112013019699 Country of ref document: BR Kind code of ref document: A2 Effective date: 20130801 |