WO2001052885A1 - Outer membrane vesicle (omv) vaccine comprising n. meningitidis serogroup b outer membrane proteins - Google Patents

Outer membrane vesicle (omv) vaccine comprising n. meningitidis serogroup b outer membrane proteins Download PDF

Info

Publication number
WO2001052885A1
WO2001052885A1 PCT/IB2001/000166 IB0100166W WO0152885A1 WO 2001052885 A1 WO2001052885 A1 WO 2001052885A1 IB 0100166 W IB0100166 W IB 0100166W WO 0152885 A1 WO0152885 A1 WO 0152885A1
Authority
WO
WIPO (PCT)
Prior art keywords
protein
immunogenic fragment
composition
protein disclosed
gene
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/IB2001/000166
Other languages
English (en)
French (fr)
Inventor
Mariagrazia Pizza
Rino Rappuoli
Marzia Giuliani
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
GSK Vaccines SRL
Original Assignee
Chiron SRL
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from GB0001067A external-priority patent/GB0001067D0/en
Priority claimed from GBGB0005699.4A external-priority patent/GB0005699D0/en
Priority to US10/181,600 priority Critical patent/US8273360B2/en
Priority to DK01942562.8T priority patent/DK1248647T3/da
Priority to MXPA02006962A priority patent/MXPA02006962A/es
Priority to AT01942562T priority patent/ATE476988T1/de
Priority to CA2397508A priority patent/CA2397508C/en
Priority to JP2001552932A priority patent/JP2003520248A/ja
Priority to CN018059201A priority patent/CN1416352B/zh
Priority to BR0107679-5A priority patent/BR0107679A/pt
Application filed by Chiron SRL filed Critical Chiron SRL
Priority to AU28754/01A priority patent/AU784518B2/en
Priority to EP01942562A priority patent/EP1248647B1/en
Priority to BRPI0107679A priority patent/BRPI0107679B8/pt
Priority to DE60142772T priority patent/DE60142772D1/de
Priority to NZ520466A priority patent/NZ520466A/en
Publication of WO2001052885A1 publication Critical patent/WO2001052885A1/en
Anticipated expiration legal-status Critical
Priority to AU2009200692A priority patent/AU2009200692B2/en
Priority to US13/591,138 priority patent/US20120328643A1/en
Priority to US14/882,320 priority patent/US20160030546A1/en
Priority to US14/961,725 priority patent/US20160082098A1/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/02Bacterial antigens
    • A61K39/095Neisseria
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04Antibacterial agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/14Antivirals for RNA viruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/20Antivirals for DNA viruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/04Immunostimulants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/54Medicinal preparations containing antigens or antibodies characterised by the route of administration
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55505Inorganic adjuvants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/60Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
    • A61K2039/6031Proteins
    • A61K2039/6068Other bacterial proteins, e.g. OMP
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/70Multivalent vaccine
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02ATECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Definitions

  • This invention relates to vaccines against Neisseria meningitidis, serogroup B (NmB).
  • Neisseria meningitidis is a non-motile, Gram-negative diplococcus human pathogen. It colonises the pharynx, causing meningitis and, occasionally, septicaemia in the absence of meningitis. In the United States the attack rate is 0.6-1 per 100,000 persons per year, and it can be much greater during outbreaks (see Lieberman et al. (1996) JAMA 275(19): 1499-1503; Schuchat et al (1997) N Engl J Med 337(14):970-976). In developing countries, endemic disease rates are much higher and during epidemics incidence rates can reach 500 cases per 100,000 persons per year. Mortality is extremely high, at 10-20% in the United States, and much higher in developing countries. Following the introduction of the conjugate vaccine against Haemophilus influenzae, N. meningitidis is the major cause of bacterial meningitis at all ages in the United States (Schuchat et al (1997) supra).
  • the meningococcal vaccine currently in use is a tetravalent polysaccharide vaccine composed of serogroups A, C, Y and W135. Following the success of the vaccination against H.in ⁇ uenzae, however, conjugate vaccines against serogroups A and C have been developed
  • Serogroup B remains a problem, however, and it is currently responsible for approximately 50% of total meningitis in the United States, Europe, and South America.
  • the polysaccharide approach cannot be used because the menB capsular polysaccharide is a polymer of ⁇ (2-8)- linked N-acetyl neuraminic acid that is also present in mammalian tissue. This results in tolerance to the antigen; indeed, if a response were elicited, it would be anti-self, and therefore undesirable.
  • the capsular polysaccharide has, for instance, been chemically modified substituting the N-acetyl groups with N-propionyl groups, leaving the specific antigenicity unaltered (Romero & Outschoorn (1994) Clin Microbiol Rev 7(4):559-575).
  • OMV outer-membrane vesicle
  • composition comprising (a) a NmB outer membrane preparation, and (b) an immunogenic component selected from one or more of the following: • a protein disclosed in WO99/57280, or an immunogenic fragment thereof;
  • Neisseria meningitidis protein PorA TbpA, TbpB, PilC, OpA, or Omp85.
  • composition comprises a protein disclosed in WO99/24578
  • said protein preferably comprises an amino acid sequence selected from the group consisting of SEQ IDs 2, 4, 6, 8, 10,
  • composition comprises a protein disclosed in WO99/36544
  • said protein preferably comprises an amino acid sequence selected from the group consisting of SEQ IDs 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, 88, & 90, as disclosed in WO99/36544 (or a protein comprising an immunogenic fragment of one or more of these SEQ IDs, or a protein comprising a sequence having sequence identity (preferably greater than 50% eg. 60%, 70%, 80%, 90%, 95%, 99% or more) to one of these SEQ IDs).
  • composition comprises a protein disclosed in Tettelin et al. ⁇ i.e. a protein encoded by one of the genes disclosed therein)
  • said protein preferably comprises an amino acid sequence selected from the group consisting of NMB0001 to NMB2160 (or a protein comprising an immunogenic fragment of one or more of these 2160 genes, or a protein comprising a sequence having sequence identity (preferably greater than 50% eg. 60%, 70%, 80%, 90%, 95%, 99% or more) to one of these 2160 genes).
  • composition comprises a protein disclosed in Parkhill et al.
  • said protein preferably comprises an amino acid sequence selected from the group consisting of the 2121 coding sequences disclosed therein (or a protein comprising an immunogenic fragment of one or more of these 2121 sequences, or a protein comprising a sequence having sequence identity (preferably greater than 50% eg. 60%, 70%, 80%, 90%, 95%, 99% or more) to one of these 2121 sequences).
  • composition comprises a protein disclosed in WO99/57280
  • said protein preferably comprises an amino acid sequence selected from the group consisting of SEQ IDs 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, , 66,
  • composition comprises a protein disclosed in WO99/28273
  • said protein is preferably the protein disclosed in Figure 4 or Figure 13 of WO97/28273.
  • said protein preferably comprises an amino acid sequence selected from the group consisting of SEQ IDs 1-8 disclosed in WO96/29412 (or a protein comprising an immunogenic fragment of one or more of these SEQ IDs, or a protein comprising a sequence having sequence identity (preferably greater than 50% eg. 60%, 70%, 80%, 90%, 95%, 99% or more) to one of these SEQ IDs).
  • composition comprises a protein disclosed in WO95/03413, said protein preferably comprises an amino acid sequence selected from the group consisting of SEQ IDs 1-23 disclosed in WO95/03413 (or a protein comprising an immunogenic fragment of one or more of these SEQ IDs, or a protein comprising a sequence having sequence identity (preferably greater than 50% eg. 60%, 70%, 80%, 90%, 95%, 99% or more) to one of these SEQ IDs).
  • composition comprises a protein disclosed in WO99/31132
  • said protein preferably comprises an amino acid sequence selected from the group consisting of SEQ ID 2 disclosed in WO99/31132 (or a protein comprising an immunogenic fragment of SEQ ID 2, or a protein comprising a sequence having sequence identity (preferably greater than 50% eg. 60%, 70%, 80%, 90%, 95%, 99% or more) to SEQ ID 2).
  • composition comprises a protein disclosed in WO99/58683
  • said protein preferably comprises an amino acid sequence selected from the group consisting of SEQ ID 2 or SEQ ID 4 disclosed in WO99/58683 (or a protein comprising an immunogenic fragment of SEQ ID 2 or SEQ ED 4, or a protein comprising a sequence having sequence identity (preferably greater than 50% eg. 60%, 70%, 80%, 90%, 95%, 99% or more) to SEQ ID 2 or SEQ ID 4).
  • composition comprises a protein disclosed in WO99/55873
  • said protein preferably comprises an amino acid sequence selected from the group consisting of SEQ ID 2 or SEQ ID 4 disclosed in WO99/55873 (or a protein comprising an immunogenic fragment of SEQ ID 2 or SEQ D 4, or a protein comprising a sequence having sequence identity (preferably greater than 50% eg. 60%, 70%, 80%, 90%, 95%, 99% or more) to SEQ ID 2 or SEQ ID 4).
  • Preferred proteins for component (b) are: • protein '919', typified by SEQ IDs 3069-3074 and 3207-3241 of WO99/57280 (see also Figure 23 and Example 15 therein).
  • protein 'ORF40' typified by example 1 (SEQ IDs 1-6) of WO99/36544 (see also Figure 1 of WO00/66741; see also WO99/31132 and WO99/58683).
  • Component (b) of the composition is preferably a NmB protein. It is preferred that component (b) includes a protein from a different NmB strain from that from which the OMV of component (a) is derived i.e. the OMV in component (a) is preferably supplemented by immunogenic component (b) from a different NmB strain.
  • One or more of the components may be adsorbed on Al(OH) 3 .
  • compositions of the invention include a NmB outer membrane preparation as component (a). This is preferably in the form of outer membrane vesicles (OMVs).
  • OMVs outer membrane vesicles
  • OMVs from NmB The preparation of OMVs from NmB is well-known in the art. Methods for obtaining suitable preparations are disclosed in, for instance: Claassen et al. [Vaccine (1996) 14:1001-1008]; Cartwright et al. [Vaccine (1999) 17:2612-2619]; Peeters et al. [Vaccine (1996) 14: 1009- 1015]; Fu et al. [Biotechnology NY (1995) 12:170-74]; Davies et al. [J.Immunol.Meth. (1990) 134:215-225]; Saunders et al. [Infect. Immun. (1999) 67: 113-119]; Draabick et al.
  • OMVs are preferably a deoxycholate extract from NmB (i.e. obtained from NmB by deoxycholate extraction).
  • the preferred extraction protocol is that described by Fredriksen et al. [Production, characterization and control of MenB -vaccine "Folkehelsa”: an outer membrane vesicle vaccine against group B meningococcal disease (1991) NIPH Ann. 14(2):67-80].
  • a preferred strain from which to extract OMVs is the 44/76 strain (B:15:P1.7,16:P5.5:L3,7,9) of N. meningitidis.
  • OMV component Further details of the OMV component can be found in, for instance, Bjune et al. [Lancet (1991) 338(8775): 1093-96], or Fredriksen et al. [Characterization of high molecular weight component in MenB-vaccine 'Folkehelsa', an outer membrane vesicle vaccine against group B meningococcal disease. Pages 818-824 of Pathobiology and immunobiology of Neisseriaceae (eds. Conde-Glez et al.) ISBN 968-6502-13-0].
  • the OMV component may be adsorbed to aluminium hydroxide adjuvant.
  • a preferred protein:adjuvant ratio is 1:67 (wt/wt).
  • a typical dose of vaccine for a human contains 25 ⁇ g protein, 2 ⁇ g LPS and 1.67mg Al(OH) 3 , and can be injected in 0.5ml volumes into the deltoid muscle.
  • the OMV component (e.g. as obtained by deoxycholate extraction) may be treated to remove certain components. For instance, pyrogens or toxic components may be removed (e.g. LPS).
  • the OMV component should retain the 80kDa antigenic component described by Fredriksen et al. [pages 818-824 of Pathobiology and immunobiology of Neisseriaceae],
  • the OMV component should retain a protein comprising one or more of the following amino acid sequences: SEQ ID 3, SEQ ID 5, SEQ ID 7, SEQ ID 9, SEQ ID 11, SEQ ID 13 [or (i) a protein having sequence identity to SEQ ID 3, SEQ ID 5, SEQ ID 7, SEQ ID 9, SEQ ID 11, or SEQ ID 13 - depending on the particular SEQ ID, the degree of sequence identity is preferably greater than 50% (eg.
  • n is 7 or more (eg. 8, 10, 12, 14, 16, 18, 20 or more).
  • Components (a) and (b) can be combined by simply mixing component (a) with an outer- membrane preparation (e.g. by mixing ORF4 with Norwegian OMVs).
  • component (a) in its outer membrane - an outer-membrane preparation from such a recombinant bacterium will comprise both component (a) and component (b).
  • Suitable bacteria for manipulation in this way include Neisseria meningitidis (any serogroup or strain), Neisseria lactamica, Neisseria cinerea or any other non-typable Neisseria.
  • Other Gram-negative bacteria can also be used, such as E.coli, Salmonella, Shigella, Bordetella, Yersinia, Helicobacter, etc. Transformation methods are well known in the art.
  • composition of the invention may also comprise one or more of the following components:
  • Preferred examples of these optional components are: • a polysaccharide antigen against Neisseria meningitidis serogroup A;
  • a protective antigen against diphtheria consisting of a diphtheria toxoid, such as the CRM 197 mutant [eg. Del Guidice et al. (1998) Molecular Aspects of Medicine 19: 1 -70].
  • a protective antigen against tetanus consisting of a tetanus toxoid [eg. Wassilak & Orenstein, Chapter 4 of Vaccines (eds. Plotkin & Mortimer), 1988]
  • a protective antigen against whooping cough comprising pertussis holotoxin (PT) and filamentous haemagglutinin (FHA); optionally further comprising pertactin and/or agglutinogens 2 and 3 [eg. Gustafsson et al. (1996) N. Engl. J. Med. 334:349-355; Rappuoli et /. (1991) TIBTECH 9:232-238].
  • a protective antigen against H.pylori comprising one or more of CagA (eg.
  • WO93/18150 eg. WO93/18150
  • NAP eg. WO99/53310
  • HopX eg. WO98/04702
  • HopY eg. WO98/04702
  • a protective antigen against hepatitis B virus consisting of a HBV surface antigen and/or a HBV core antigen.
  • composition comprises an antigen against diphtheria, it preferably also comprises antigens against tetanus and polio. Where the composition comprises an antigen against tetanus, it preferably also comprises antigens against diphtheria and polio. Where the composition comprises an antigen against polio, it preferably also comprises antigens against diphtheria and tetanus.
  • Pertussis toxin is a toxic protein and, when present in the composition, it is preferably detoxified. Detoxification may be by chemical and/or genetic means. A preferred detoxified mutant is the 9K/129G double mutant [eg. Rappuoli (1997) Nature Medicine 3:374-376].
  • composition includes a protein that exists in different nascent and mature forms
  • the mature form of the protein is preferably used.
  • NspA is included, (WO96/29412; see also Martin et al. (1997) J. Exp. Med 185 1173-1183) the mature form of the protein lacking the signal peptide is preferably used.
  • composition includes a polysaccharide antigen
  • the polysaccharide is preferably conjugated to a carrier protein.
  • composition of the invention is preferably a vaccine.
  • Vaccines according to the invention may either be prophylactic (ie. to prevent infection) or therapeutic (ie. to treat disease after infection).
  • the invention also provides the compositions of the invention for use as medicaments (preferably as vaccines) or as diagnostic reagents. It also provides the use of a composition according to the invention in the manufacture of: (i) a medicament for treating or preventing infection due to Neisserial bacteria; (ii) a diagnostic reagent for detecting the presence of Neisserial bacteria or of antibodies raised against Neisserial bacteria; and/or (iii) a reagent which can raise antibodies against Neisserial bacteria.
  • Said Neisserial bacteria may be any species or strain (such as N.gonorrhoeae) but are preferably N. meningitidis, especially serogroup B (NmB).
  • the invention also provides a method of treating a patient, comprising administering to the patient a therapeutically effective amount of a composition according to the invention.
  • the method is preferably immunisation.
  • the invention provides various processes.
  • a process for producing a composition of the invention comprising the step of extraction (e.g. deoxycholate extraction) of OMVs from N. meningitidis.
  • extraction e.g. deoxycholate extraction
  • Proteins used with the invention can be prepared by various means ⁇ eg. recombinant expression, purification from cell culture, chemical synthesis etc.) and in various forms (eg. native, fusions etc.). They are preferably prepared in substantially pure form (ie. substantially free from other Neisseria or host cell proteins).
  • Nucleic acid used with the invention can be prepared in many ways (eg. by chemical synthesis, from genomic or cDNA libraries, from the organism itself etc.) and can take various forms (eg. single stranded, double stranded, vectors, probes etc.).
  • the term "nucleic acid” includes DNA and RNA , and also their analogues, such as those containing modified backbones, and also peptide nucleic acids (PNA ) etc.
  • a composition containing X is "substantially free of Y when at least 85% by weight of the total X+Y in the composition is X .
  • X comprises at least about 90% by weight of the total of X+Y in the composition, more preferably at least about 95% or even 99% by weight.
  • composition comprising X may consist exclusively of X or may include something additional to X, such as X+Y .
  • heterologous refers to two biological components that are not found together in nature.
  • the components may be host cells, genes, or regulatory regions, such as promoters.
  • heterologous components are not found together in nature, they can function together, as when a promoter heterologous to a gene is operably linked to the gene.
  • Another example is where a Neisserial sequence is heterologous to a mouse host cell.
  • a further examples would be two epitopes from the same or different proteins which have been assembled in a single protein in an arrangement not found in nature.
  • An "origin of replication” is a polynucleotide sequence that initiates and regulates replication of polynucleotides, such as an expression vector.
  • the origin of replication behaves as an autonomous unit of polynucleotide replication w ithin a cell, capable of replication under its own control.
  • a n origin of replication may be needed for a vector to replicate in a particular host cell. W ith certain origins of replication, an expression vector can be reproduced at a high copy number in the presence of the appropriate proteins within the cell. Examples of origins are the autonomously replicating sequences, which are effective in yeast; and the viral T-antigen, effective in COS-7 cells.
  • an "allelic variant" of a nucleic acid molecule, or region, for which nucleic acid sequence is provided herein is a nucleic acid molecule, or region, that occurs essentially at the same locus in the genome of another or second isolate, and that, due to natural variation caused by, for example, mutation or recombination, has a similar but not identical nucleic acid sequence.
  • a coding region allelic variant typically encodes a protein having similar activity to that of the protein encoded by the gene to which it is being compared.
  • An allelic variant can also comprise an alteration in the 5' or 3' untranslated regions of the gene, such as in regulatory control regions (eg. see US patent 5,753,235).
  • Neisserial nucleotide sequences can be expressed in a variety of different expression systems; for example those used with mammalian cells, baculoviruses, plants, bacteria, and yeast. i. M ammalian Systems
  • a mammalian promoter is any DNA sequence capable of binding mammalian RNA polymerase and initiating the downstream (3') transcription of a coding sequence (eg. structural gene) into mRNA .
  • a promoter will have a transcription initiating region, which is usually placed proximal to the 5' end of the coding sequence, and a TA TA box, usually located 25-30 base pairs (bp) upstream of the transcription initiation site.
  • the TATA box is thought to direct RNA polymerase II to begin RNA synthesis at the correct site.
  • a mammalian promoter will also contain an upstream promoter element, usually located within 100 to 200 bp upstream of the TATA box.
  • An upstream promoter element determines the rate at which transcription is initiated and can act in either orientation [Sambrook et al. (1989) "Expression of Cloned Genes in M ammalian Cells.” In Molecular Cloning: A Laboratory Manual, 2nd ed.].
  • M ammalian viral genes are often highly expressed and have a broad host range; therefore sequences encoding mammalian viral genes provide particularly useful promoter sequences. Examples include the SV40 early promoter, mouse mammary tumor virus LTR promoter, adenovirus major late promoter (Ad M LP), and herpes simplex virus promoter. In addition, sequences derived from non-viral genes, such as the murine metallotheionein gene, also provide useful promoter sequences. Expression may be either constitutive or regulated (inducible), depending on the promoter can be induced with glucocorticoid in hormone-responsive cells.
  • Enhancer is a regulatory DNA sequence that can stimulate transcription up to 1000-fold when linked to homologous or heterologous promoters, with synthesis beginning at the normal RNA start site. Enhancers are also active when they are placed upstream or downstream from the transcription initiation site, in either normal or flipped orientation, or at a distance of more than 1000 nucleotides from the promoter [M aniatis et al. ( 1987) Science 236: 1237 ; Alberts et al. (1989) Molecular Biology of the Cell, 2nd ed.]. Enhancer elements derived from viruses may be particularly useful, because they usually have a broader host range.
  • Examples include the SV40 early gene enhancer [Dijkema et al (1985) EMBO J. 4:161 ) and the enhancer/promoters derived from the long terminal repeat (LTR) of the Rous Sarcoma V irus [Gorman et al. (1982b) Proc. Natl. Acad. Sci. 79:6111] and from human cytomegalovirus [Boshart et al. (1985) Cell 47 :521 ]. Additionally, some enhancers are regulatable and become active only in the presence of an inducer, such as a hormone or metal ion [Sassone-Corsi and Borelli (1986) Trends Genet. 2:215 ; M aniatis et al.
  • an inducer such as a hormone or metal ion
  • a DNA molecule may be expressed intracellularly in mammalian cells.
  • a promoter sequence may be directly linked with the DNA molecule, in which case the first amino acid at the N-terminus of the recombinant protein will always be a methionine, which is encoded by the ATG start codon. If desired, the N-terminus may be cleaved from the protein by in vitro incubation with cyanogen bromide.
  • foreign proteins can also be secreted from the cell into the growth media by creating chimeric DNA molecules that encode a fusion protein comprised of a leader sequence fragment that provides for secretion of the foreign protein in mammalian cells.
  • a leader sequence fragment that provides for secretion of the foreign protein in mammalian cells.
  • processing sites encoded between the leader fragment and the foreign gene that can be cleaved either in vivo or in vitro.
  • the leader sequence fragment usually encodes a signal peptide comprised of hydrophobic amino acids which direct the secretion of the protein from the cell.
  • the adenovirus triparite leader is an example of a leader sequence that provides for secretion of a foreign protein in mammalian cells.
  • transcription termination and polyadenylation sequences recognized by mammalian cells are regulatory regions located 3' to the translation stop codon and thus, together with the promoter elements, flank the coding sequence.
  • the 3' terminus of the mature mRNA is formed by site-specific post- transcriptional cleavage and polyadenylation [B irnstiel et al. (1985) Cell 41 -349; Proudfoot and W hitelaw (1988) "Termination and 3' end processing of eukaryotic RNA . In Transcription and splicing (ed. B .D . Hames and D .M . Glover); Proudfoot (1989) Trends Biochem. Sci. 74:105].
  • transcription terminater/polyadenylation signals include those derived from SV40 [Sambrook et al (1989) "Expression of cloned genes in cultured mammalian cells.” In Molecular Cloning: A Laboratory Manual].
  • Enhancers, introns with functional splice donor and acceptor sites, and leader sequences may also be included in an expression construct, if desired.
  • Expression constructs are often maintained in a replicon, such as an extrachromosomal element (eg. plasmids) capable of stable maintenance in a host, such as mammalian cells or bacteria.
  • M ammalian replication systems include those derived from animal viruses, which require trans-acting factors to replicate.
  • plasmids containing the replication systems of papovaviruses such as SV40 [Gluzman (1981 ) Cell 23: 175] or polyomavirus, replicate to extremely high copy number in the presence of the appropriate viral T antigen.
  • mammalian replicons include those derived from bovine papillomavirus and Epstein-B arr virus.
  • the replicon may have two replicaton systems, thus allowing it to be maintained, for example, in mammalian cells for expression and in a prokaryotic host for cloning and amplification.
  • mammalian-bacteria shuttle vectors include pM T2 [Kaufman et al. (1989) Mol. Cell. Biol.
  • M ethods for introduction of heterologous polynucleotides into mammalian cells include dextran-mediated transfection, calcium phosphate precipitation, polybrene mediated transfection, protoplast fusion, electroporation, encapsulation of the polynucleotide(s) in liposomes, and direct microinjection of the DNA into nuclei.
  • M ammalian cell lines available as hosts for expression are known in the art and include many immortalized cell lines available from the American Type Culture Collection (ATCC), including but not limited to, Chinese hamster ovary (CHO) cells, HeLa cells, baby hamster kidney (B H K) cells, monkey kidney cells (COS), human hepatocellular carcinoma cells (eg. Hep G2), and a number of other cell lines.
  • ATCC American Type Culture Collection
  • CHO Chinese hamster ovary
  • HeLa cells HeLa cells
  • B H K baby hamster kidney
  • COS monkey kidney cells
  • human hepatocellular carcinoma cells eg. Hep G2
  • the polynucleotide encoding the protein can also be inserted into a suitable insect expression vector, and is operably linked to the control elements w ithin that vector.
  • Vector construction employs techniques which are known in the art.
  • the components of the expression system include a transfer vector, usually a bacterial plasm id, which contains both a fragment of the baculovirus genome, and a convenient restriction site for insertion of the heterologous gene or genes to be expressed; a wild type baculovirus with a sequence homologous to the baculovirus-specific fragment in the transfer vector (this allows for the homologous recombination of the heterologous gene in to the baculovirus genome); and appropriate insect host cells and growth media.
  • a transfer vector usually a bacterial plasm id, which contains both a fragment of the baculovirus genome, and a convenient restriction site for insertion of the heterologous gene or genes to be expressed
  • a wild type baculovirus with a sequence homologous to the baculovirus-specific fragment in the transfer vector this allows for the homologous recombination of the heterologous gene in to the baculovirus genome
  • the vector and the wild type viral genome are transfected into an insect host cell where the vector and viral genome are allowed to recombine.
  • the packaged recombinant virus is expressed and recombinant plaques are identified and purified.
  • M aterials and methods for baculovirus/insect cell expression systems are commercially available in kit form from , inter alia, Invitrogen, San Diego CA ("M axB ac" kit). These techniques are generally known to those skilled in the art and fully described in Summers and Smith, Texas Agricultural Experiment Station Bulletin No. 1555 ( 1987) (hereinafter "Summers and Smith").
  • transplacement construct Prior to inserting the DNA sequence encoding the protein into the baculovirus genome, the above described components, comprising a promoter, leader (if desired), coding sequence of interest, and transcription termination sequence, are usually assembled into an intermediate transplacement construct (transfer vector).
  • This construct may contain a single gene and operably linked regulatory elements; multiple genes, each with its owned set of operably linked regulatory elements; or multiple genes, regulated by the same set of regulatory elements.
  • Intermediate transplacement constructs are often maintained in a replicon, such as an extrachromosomal element (eg. plasmids) capable of stable maintenance in a host, such as a bacterium .
  • the replicon will have a replication system, thus allowing it to be maintained in a suitable host for cloning and amplification.
  • the most commonly used transfer vector for introducing foreign genes into AcNPV is pAc373.
  • the plasmid usually also contains the polyhedrin polyadenylation signal (M iller et al. (1988) Ann. Rev. Microbiol, 42:111) and a prokaryotic ampicillin-resistance (amp) gene and origin of replication for selection and propagation in E. coli.
  • B aculovirus transfer vectors usually contain a baculovirus promoter.
  • a baculovirus promoter is any DNA sequence capable of binding a baculovirus RNA polymerase and initiating the downstream (5' to 3') transcription of a coding sequence (eg. structural gene) into mRNA .
  • a promoter will have a transcription initiation region which is usually placed proximal to the 5' end of the coding sequence. This transcription initiation region usually includes an RNA polymerase binding site and a transcription initiation site.
  • a baculovirus transfer vector may also have a second domain called an enhancer, which, if present, is usually distal to the structural gene. Expression may be either regulated or constitutive.
  • Structural genes abundantly transcribed at late times in a viral infection cycle, provide particularly useful promoter sequences. Examples include sequences derived from the gene encoding the viral polyhedron protein, Friesen et al., (1986) "The Regulation of B aculovirus Gene Expression,” in: The Molecular Biology of Baculoviruses (ed. W alter Doerfler); EPO Publ. Nos. 127 839 and 155 476; and the gene encoding the plO protein, V lak et al., (1988), J. Gen. Virol. 69:765.
  • DNA encoding suitable signal sequences can be derived from genes for secreted insect or baculovirus proteins, such as the baculovirus polyhedrin gene (Carbonell et al. (1988) Gene, 73:409).
  • the signals for mammalian cell posttranslational modifications such as signal peptide cleavage, proteolytic cleavage, and phosphorylation
  • the signals required for secretion and nuclear accumulation also appear to be conserved between the invertebrate cells and vertebrate cells
  • leaders of non-insect origin such as those derived from genes encoding human -interferon, M aeda et al., (1985), Nature 575:592; human gastrin-releasing peptide, Lebacq-Verheyden et al., (1988), Molec.
  • a recombinant polypeptide or polyprotein may be expressed intracellularly or, if it is expressed with the proper regulatory sequences, it can be secreted.
  • a fter insertion of the DNA sequence and/or the gene encoding the expression product precursor of the protein, an insect cell host is co-transformed with the heterologous DNA of the transfer vector and the genomic DNA of wild type baculovirus - usually by co-transfection.
  • the promoter and transcription termination sequence of the construct will usually comprise a 2-5kb section of the baculovirus genome.
  • M ethods for introducing heterologous DNA into the desired site in the baculovirus virus are known in the art. (See Summers and Smith supra; Ju et al. (1987); Smith et al., Mol. Cell. Biol. (1983) 5:2156; and Luckow and Summers (1989)).
  • the insertion can be into a gene such as the polyhedrin gene, by homologous double crossover recombination; insertion can also be into a restriction enzyme site engineered into the desired baculovirus gene. M iller et al, (1989), Bioessays 4:91.
  • the DNA sequence, when cloned in place of the polyhedrin gene in the expression vector, is flanked both 5' and 3' by polyhedrin-specific sequences and is positioned downstream of the polyhedrin promoter.
  • the newly formed baculovirus expression vector is subsequently packaged into an infectious recombinant baculovirus. Homologous recombination occurs at low frequency (between about 1 % and about 5% ); thus, the majority of the virus produced after cotransfection is still wild-type virus. Therefore, a method is necessary to identify recombinant viruses.
  • a n advantage of the expression system is a visual screen allowing recombinant viruses to be distinguished.
  • the polyhedrin protein which is produced by the native virus, is produced at very high levels in the nuclei of infected cells at late times after viral infection. Accumulated polyhedrin protein forms occlusion bodies that also contain embedded particles.
  • occlusion bodies up to 15 ⁇ m in size, are highly refractile, giving them a bright shiny appearance that is readily visualized under the light microscope.
  • Cells infected with recombinant viruses lack occlusion bodies.
  • the transfection supernatant is plaqued onto a monolayer of insect cells by techniques known to those skilled in the art. Namely, the plaques are screened under the light microscope for the presence (indicative of wild-type virus) or absence (indicative of recombinant virus) of occlusion bodies.
  • Recombinant baculovirus expression vectors have been developed for infection into several insect cells.
  • recombinant baculoviruses have been developed for, inter alia: Aedes aegypti , Autographa californica, Bombyx mori, Drosophila melanogaster, Spodoptera frugiperda, and Trichoplusia ni (W O 89/046699; Carbonell et al, (1985) J. Virol. 56: 153 ; W right (1986) Nature 527 :718; Smith et al, (1983) Mol. Cell. Biol.
  • the modified insect cells may then be grown in an appropriate nutrient medium, which allows for stable maintenance of the plasmid(s) present in the modified insect host.
  • the expression product gene is under inducible control, the host may be grown to high density, and expression induced.
  • the product will be continuously expressed into the medium and the nutrient medium must be continuously circulated, while removing the product of interest and augmenting depleted nutrients.
  • the product may be purified by such techniques as chromatography, eg. HPLC , affinity chromatography, ion exchange chromatography, etc.; electrophoresis; density gradient centrifugation; solvent extraction, or the like.
  • the product may be further purified, as required, so as to remove substantially any insect proteins which are also secreted in the medium or result from lysis of insect cells, so as to provide a product which is at least substantially free of host debris, eg. proteins, lipids and polysaccharides.
  • host debris eg. proteins, lipids and polysaccharides.
  • recombinant host cells derived from the transformants are incubated under conditions which allow expression of the recombinant protein encoding sequence. These conditions will vary, dependent upon the host cell selected. However, the conditions are readily ascertainable to those of ordinary skill in the art, based upon what is known in the art. iii. Plant Systems
  • a desired polynucleotide sequence is inserted into an expression cassette comprising genetic regulatory elements designed for operation in plants.
  • the expression cassette is inserted into a desired expression vector with companion sequences upstream and downstream from the expression cassette suitable for expression in a plant host.
  • the companion sequences will be of plasmid or viral origin and provide necessary characteristics to the vector to permit the vectors to move DNA from an original cloning host, such as bacteria, to the desired plant host.
  • the basic bacterial/plant vector construct will preferably provide a broad host range prokaryote replication origin; a prokaryote selectable marker; and, for Agrobacterium transformations, T DNA sequences for Agrobacterium-mediated transfer to plant chromosomes.
  • the heterologous gene is not readily amenable to detection
  • the construct will preferably also have a selectable marker gene suitable for determining if a plant cell has been transformed.
  • a selectable marker gene suitable for determining if a plant cell has been transformed is found in W ilmink and Dons, 1993, Plant Mol. Biol. Reptr, 1 1 (2): 165- 185.
  • Sequences suitable for permitting integration of the heterologous sequence into the plant genome are also recommended. These might include transposon sequences and the like for homologous recombination as well as Ti sequences which permit random insertion of a heterologous expression cassette into a plant genome. Suitable prokaryote selectable m arkers include resistance toward antibiotics such as ampicillin or tetracycline. Other DNA sequences encoding additional functions may also be present in the vector, as is known in the art.
  • the nucleic acid molecules of the subject invention may be included into an expression cassette for expression of the protein(s) of interest.
  • the recombinant expression cassette will contain in addition to the heterologous protein encoding sequence the following elements, a promoter region, plant 5' untranslated sequences, initiation codon depending upon whether or not the structural gene comes equipped with one, and a transcription and translation termination sequence.
  • Unique restriction enzyme sites at the 5' and 3' ends of the cassette allow for easy insertion into a pre-existing vector.
  • a heterologous coding sequence may be for any protein relating to the present invention.
  • the sequence encoding the protein of interest will encode a signal peptide which allows processing and translocation of the protein, as appropriate, and will usually lack any sequence which m ight result in the binding of the desired protein of the invention to a membrane. Since, for the most part, the transcriptional initiation region will be for a gene which is expressed and translocated during germination, by employing the signal peptide which provides for translocation, one may also provide for translocation of the protein of interest. In this way, the protein(s) of interest w ill be translocated from the cells in which they are expressed and may be efficiently harvested.
  • site-directed mutagenesis of the "intron" region may be conducted to prevent losing a portion of the genetic message as a false intron code, Reed and M aniatis, Oe// 41 :95-105, 1985.
  • the vector can be microinjected directly into plant cells by use of micropipettes to mechanically transfer the recombinant DNA . Crossway, Mol. Gen. Genet, 202:179- 185, 1985.
  • the genetic material may also be transferred into the plant cell by using polyethylene glycol, Krens, et al. Nature, 296, 72-74, 1982.
  • Another method of introduction of nucleic acid segments is high velocity ballistic penetration by small particles with the nucleic acid either within the matrix of small beads or particles, or on the surface, Klein, et al.
  • the vector may also be introduced into the plant cells by electroporation.
  • electroporation fromm et al, Proc. Natl Acad. Sci. USA 82:5824, 1985.
  • plant protoplasts are electroporated in the presence of plasmids containing the gene construct. Electrical impulses of high field strength reversibly permeabilize biomembranes allowing the introduction of the plasmids. Electroporated plant protoplasts reform the cell wall, divide, and form plant callus.
  • All plants from which protoplasts can be isolated and cultured to give whole regenerated plants can be transformed by the present invention so that whole plants are recovered which contain the transferred gene. It is known that practically all plants can be regenerated from cultured cells or tissues, including but not limited to all major species of sugarcane, sugar beet, cotton, fruit and other trees, legumes and vegetables.
  • Some suitable plants include, for example, species from the genera Fragaria, Lotus, Medicago, Onobrychis, Trifolium, Trigonella, Vigna, Citrus, Linum, Geranium, Manihot, Daucus, Arabidopsis, Brassica, Raphanus, Sinapis, Atropa, Capsicum, Datura, Hyoscyamus, Lycopersion, Nicotiana, Solanum , Petunia, Digitalis, Majorana, Cichorium, Helianthus, Lactuca, Bromus, Asparagus, Antirrhinum, Hererocallis, Nemesia, Pelargonium, Panicum, Pennisetum, Ranunculus, Senecio, Salpiglossis, Cucumis, Browaalia, Glycine, Lolium , lea, Triticum, Sorghum, and Datura.
  • M eans for regeneration vary from species to species of plants, but generally a suspension of transformed protoplasts containing copies of the heterologous gene is first provided. Callus tissue is formed and shoots may be induced from callus and subsequently rooted. A lternatively, embryo formation can be induced from the protoplast suspension. These embryos germinate as natural embryos to form plants.
  • the culture media will generally contain various amino acids and hormones, such as auxin and cytokinins. It is also advantageous to add glutamic acid and proline to the medium, especially for such species as corn and alfalfa. Shoots and roots normally develop simultaneously. Efficient regeneration will depend on the medium, on the genotype, and on the history of the culture. If these three variables are controlled, then regeneration is fully reproducible and repeatable.
  • the desired protein of the invention may be excreted or alternatively, the protein may be extracted from the whole plant. Where the desired protein of the invention is secreted into the medium , it may be collected. Alternatively, the embryos and embryoless-half seeds or other plant tissue may be mechanically disrupted to release any secreted protein between cells and tissues. The mixture may be suspended in a buffer solution to retrieve soluble proteins. Conventional protein isolation and purification methods will be then used to purify the recombinant protein. Parameters of time, temperature pH , oxygen, and volumes will be adjusted through routine methods to optimize expression and recovery of heterologous protein. iv. B acterial Systems
  • a bacterial promoter is any DNA sequence capable of binding bacterial RNA polymerase and initiating the downstream (3' ) transcription of a coding sequence (eg. structural gene) into mRNA .
  • a promoter will have a transcription initiation region which is usually placed proximal to the 5 ' end of the coding sequence. This transcription initiation region usually includes an RNA polymerase binding site and a transcription initiation site.
  • a bacterial promoter may also have a second domain called an operator, that may overlap an adjacent RNA polymerase binding site at which RNA synthesis begins. The operator permits negative regulated (inducible) transcription, as a gene repressor protein may bind the operator and thereby inhibit transcription of a specific gene.
  • Constitutive expression may occur in the absence of negative regulatory elements, such as the operator.
  • positive regulation may be achieved by a gene activator protein binding sequence, which, if present is usually proximal (5') to the RNA polymerase binding sequence.
  • An example of a gene activator protein is the catabolite activator protein (CAP), which helps initiate transcription of the lac operon in Escherichia coli (E. coli) [Raibaud et al. (1984) Annu. Rev. Genet. 78:173].
  • Regulated expression may therefore be either positive or negative, thereby either enhancing or reducing transcription.
  • Sequences encoding metabolic pathway enzymes provide particularly useful promoter sequences. Examples include promoter sequences derived from sugar metabolizing enzymes, such as galactose, lactose (lac) [Chang et al. (1977) Nature 798: 1056], and maltose. Additional examples include promoter sequences derived from biosynthetic enzymes such as tryptophan (trp) [Goeddel et al. ( 1980) Nuc. Acids Res. 8:4057 ; Yelverton et al. (1981 ) Nucl. Acids Res. 9:731 ; US patent 4,738,921 ; EP-A-0036776 and EP-A -0121775].
  • sugar metabolizing enzymes such as galactose, lactose (lac) [Chang et al. (1977) Nature 798: 1056]
  • Additional examples include promoter sequences derived from biosynthetic enzymes such as tryptophan (trp) [
  • synthetic promoters which do not occur in nature also function as bacterial promoters.
  • transcription activation sequences of one bacterial or bacteriophage promoter may be joined with the operon sequences of another bacterial or bacteriophage promoter, creating a synthetic hybrid promoter [US patent 4,551 ,433].
  • the tac promoter is a hybrid trp-lac promoter comprised of both trp promoter and lac operon sequences that is regulated by the lac repressor [Amann et al. (1983) Gene 25:167; de Boer et al. (1983) Proc. Natl. Acad. Sci. 80:21 ].
  • a bacterial promoter can include naturally occurring promoters of non-bacterial origin that have the ability to bind bacterial RNA polymerase and initiate transcription.
  • a naturally occurring promoter of non-bacterial origin can also be coupled with a compatible RNA polymerase to produce high levels of expression of some genes in prokaryotes.
  • the bacteriophage T7 RNA polymerase/promoter system is an example of a coupled promoter system [Studier et al. (1986) J. Mol. Biol. 789: 1 13 ; Tabor et al. (1985) Proc Natl. Acad. Sci. 82:1074].
  • a hybrid promoter can also be comprised of a bacteriophage promoter and an E.
  • an efficient ribosome binding site is also useful for the expression of foreign genes in prokaryotes.
  • the ribosome binding site is called the Shine- Dalgarno (SD) sequence and includes an initiation codon (ATG) and a sequence 3-9 nucleotides in length located 3-1 1 nucleotides upstream of the initiation codon [Shine et al. (1975) Nature 254:34].
  • SD sequence is thought to promote binding of mRNA to the ribosome by the pairing of bases between the SD sequence and the 3' and of E. coli 16S rRNA [Steitz et al.
  • a DNA molecule may be expressed intracellularly.
  • a promoter sequence may be directly linked with the DNA molecule, in which case the first amino acid at the N-terminus will always be a methionine, which is encoded by the A TG start codon.
  • methionine at the N-terminus may be cleaved from the protein by in vitro incubation with cyanogen bromide or by either in vivo on in vitro incubation with a bacterial methionine N-terminal peptidase (EPO-A-O 219 237).
  • Fusion proteins provide an alternative to direct expression. Usually, a DNA sequence encoding the N- terminal portion of an endogenous bacterial protein, or other stable protein, is fused to the 5' end of heterologous coding sequences. Upon expression, this construct will provide a fusion of the two amino acid sequences.
  • the bacteriophage lambda cell gene can be linked at the 5' terminus of a foreign gene and expressed in bacteria.
  • the resulting fusion protein preferably retains a site for a processing enzyme (factor Xa) to cleave the bacteriophage protein from the foreign gene [Nagai et al. (1984) Nature 309:810]. Fusion proteins can also be made with sequences from the lad [Jia et al.
  • the DNA sequence at the junction of the two amino acid sequences may or may not encode a cleavable site.
  • a ubiquitin fusion protein is made with the ubiquitin region that preferably retains a site for a processing enzyme (eg. ubiquitin specific processing-protease) to cleave the ubiquitin from the foreign protein.
  • a processing enzyme eg. ubiquitin specific processing-protease
  • foreign proteins can also be secreted from the cell by creating chimeric DNA molecules that encode a fusion protein comprised of a signal peptide sequence fragment that provides for secretion of the foreign protein in bacteria [US patent 4,336,336].
  • the signal sequence fragment usually encodes a signal peptide comprised of hydrophobic amino acids which direct the secretion of the protein from the cell.
  • the protein is either secreted into the growth media (gram-positive bacteria) or into the periplasmic space, located between the inner and outer membrane of the cell (gram-negative bacteria).
  • processing sites which can be cleaved either in vivo or in vitro encoded between the signal peptide fragment and the foreign gene.
  • DNA encoding suitable signal sequences can be derived from genes for secreted bacterial proteins, such as the E. coli outer membrane protein gene (ompA) [M asui et al. (1983), in: Experimental Manipulation of Gene Expression; Ghrayeb et al. (1984) EMBO J. 3:2437] and the E. coli alkaline phosphatase signal sequence (phoA) [Oka et al. (1985) Proc. Natl. Acad. Sci. 82:7212].
  • the signal sequence of the alpha-am ylase gene from various B acillus strains can be used to secrete heterologous proteins from B. subtilis [Palva et al. (1982) Proc. Natl. Acad. Sci. USA 79:5582; EP-A-0 244 042].
  • transcription termination sequences recognized by bacteria are regulatory regions located 3' to the translation stop codon, and thus together with the promoter flank the coding sequence. These sequences direct the transcription of an mRNA which can be translated into the polypeptide encoded by the DNA .
  • Transcription termination sequences frequently include DNA sequences of about 50 nucleotides capable of forming stem loop structures that aid in terminating transcription. Examples include transcription termination sequences derived from genes with strong promoters, such as the trp gene in E. coli as well as other biosynthetic genes.
  • the above described components comprising a promoter, signal sequence (if desired), coding sequence of interest, and transcription termination sequence, are put together into expression constructs.
  • Expression constructs are often maintained in a replicon, such as an extrachromosomal element (eg. plasmids) capable of stable maintenance in a host, such as bacteria.
  • the replicon will have a replication system, thus allowing it to be maintained in a prokaryotic host either for expression or for cloning and amplification.
  • a replicon may be either a high or low copy number plasmid.
  • a high copy number plasmid will generally have a copy number ranging from about 5 to about 200, and usually about 10 to about 150.
  • a host containing a high copy number plasmid will preferably contain at least about 10, and more preferably at least about 20 plasmids.
  • Either a high or low copy number vector may be selected, depending upon the effect of the vector and the foreign protein on the host.
  • the expression constructs can be integrated into the bacterial genome with an integrating vector.
  • Integrating vectors usually contain at least one sequence homologous to the bacterial chromosome that allows the vector to integrate. Integrations appear to result from recombinations between homologous DNA in the vector and the bacterial chromosome.
  • integrating vectors constructed with DNA from various B acillus strains integrate into the B acillus chromosome (EP-A- 0 127 328).
  • Integrating vectors may also be comprised of bacteriophage or transposon sequences.
  • extrachromosomal and integrating expression constructs may contain selectable markers to allow for the selection of bacterial strains that have been transformed.
  • Selectable markers can be expressed in the bacterial host and may include genes which render bacteria resistant to drugs such as ampicillin, chloramphenicol, erythromycin, kanamycin (neomycin), and tetracycline [Davies et al. (1978) Annu. Rev. Microbiol. 52:469].
  • Selectable markers may also include biosynthetic genes, such as those in the histidine, tryptophan, and leucine biosynthetic pathways.
  • Transformation vectors are usually comprised of a selectable market that is either maintained in a replicon or developed into an integrating vector, as described above.
  • Expression and transformation vectors either extra-chromosomal replicons or integrating vectors, have been developed for transformation into many bacteria.
  • expression vectors have been developed for, inter alia, the following bacteria: B acillus subtilis [Palva et al. (1982) Proc. Natl. Acad. Sci.
  • M ethods of introducing exogenous DNA into bacterial hosts are well-known in the art, and usually include either the transformation of bacteria treated with CaCh or other agents, such as divalent cations and DM SO. DNA can also be introduced into bacterial cells by electroporation. Transformation procedures usually vary with the bacterial species to be transformed. See eg. [M asson et al. (1989) FEMS Microbiol. Lett. 60:273 ; Palva et al. (1982) Proc. Natl. Acad. Sci. USA 79:5582; EP-A-0 036 259 and EP- A-0 063 953; W O 84/04541 , Bacillus], [M iller et al. (1988) Proc.
  • a yeast promoter is any DNA sequence capable of binding yeast RNA polymerase and initiating the downstream (3') transcription of a coding sequence (eg. structural gene) into mRNA .
  • a promoter will have a transcription initiation region which is usually placed proximal to the 5' end of the coding sequence. This transcription initiation region usually includes an RNA polymerase binding site (the "TA TA B ox") and a transcription initiation site.
  • a yeast promoter may also have a second domain called an upstream activator sequence (UAS), which, if present, is usually distal to the structural gene. The UA S permits regulated (inducible) expression. Constitutive expression occurs in the absence of a UAS.
  • Regulated expression may be either positive or negative, thereby either enhancing or reducing transcription.
  • Yeast is a fermenting organism with an active metabolic pathway, therefore sequences encoding enzymes in the metabolic pathway provide particularly useful promoter sequences. Examples include alcohol dehydrogenase (AD H) (EP-A -0 284 044), enolase, glucokinase, glucose-6-phosphate isomerase, glyceraldehyde-3-phosphate-dehydrogenase (GAP or GA PDH), hexokinase, phosphofructokinase, 3- phosphoglycerate mutase, and pyruvate kinase (PyK) (EPO-A-O 329 203).
  • the yeast PH05 gene encoding acid phosphatase, also provides useful promoter sequences [M yanohara et al. (1983) Proc. Natl. Acad. Sci. USA 80:1 ].
  • yeast promoters which do not occur in nature also function as yeast promoters.
  • UA S sequences of one yeast promoter may be joined with the transcription activation region of another yeast promoter, creating a synthetic hybrid promoter.
  • hybrid promoters include the ADH regulatory sequence linked to the GAP transcription activation region (US Patent Nos. 4,876,197 and 4,880,734).
  • hybrid promoters include promoters which consist of the regulatory sequences of either the ADH2, GAL4, GAL10, OR PH05 genes, combined with the transcriptional activation region of a glycolytic enzyme gene such as GAP or PyK (EP-A-0 164 556).
  • a yeast promoter can include naturally occurring promoters of non-yeast origin that have the ability to bind yeast RNA polymerase and initiate transcription. Examples of such promoters include, inter alia, [Cohen et al. (1980) Proc. Natl. Acad. Sci. USA 77:1078; Henikoff et al. (1981) Nature 285:835 ; Hollenberg et al. (1981 ) Curr. Topics Microbiol. Immunol. 96: 1 19; Hollenberg et al. ( 1979) "The Expression of B acterial Antibiotic Resistance Genes in the Yeast Saccharomyces cerevisiae," in: Plasmids of Medical, Environmental and Commercial Importance (eds.
  • a DNA molecule may be expressed intracellularly in yeast.
  • a promoter sequence may be directly linked with the DNA molecule, in which case the first amino acid at the N-terminus of the recombinant protein will always be a methionine, which is encoded by the ATG start codon. If desired, methionine at the N- terminus may be cleaved from the protein by in vitro incubation with cyanogen bromide.
  • Fusion proteins provide an alternative for yeast expression systems, as well as in mammalian, baculovirus, and bacterial expression systems.
  • a DNA sequence encoding the N-terminal portion of an endogenous yeast protein, or other stable protein is fused to the 5' end of heterologous coding sequences.
  • this construct will provide a fusion of the two amino acid sequences.
  • the yeast or human superoxide dismutase (SOD) gene can be linked at the 5' terminus of a foreign gene and expressed in yeast.
  • the DNA sequence at the junction of the two amino acid sequences may or may not encode a cleavable site. See eg. EP-A -0 196 056.
  • a ubiquitin fusion protein is made with the ubiquitin region that preferably retains a site for a processing enzyme (eg. ubiquitin-specific processing protease) to cleave the ubiquitin from the foreign protein.
  • a processing enzyme eg. ubiquitin-specific processing protease
  • native foreign protein can be isolated (eg. W O88/024066).
  • foreign proteins can also be secreted from the cell into the growth media by creating chimeric DNA molecules that encode a fusion protein comprised of a leader sequence fragment that provide for secretion in yeast of the foreign protein.
  • a leader sequence fragment that provide for secretion in yeast of the foreign protein.
  • processing sites encoded between the leader fragment and the foreign gene that can be cleaved either in vivo or in vitro.
  • the leader sequence fragment usually encodes a signal peptide comprised of hydrophobic am ino acids which direct the secretion of the protein from the cell.
  • DNA encoding suitable signal sequences can be derived from genes for secreted yeast proteins, such as the yeast invertase gene (EP-A -0 012 873; JPO . 62,096,086) and the A -factor gene (U S patent 4,588,684).
  • yeast invertase gene EP-A -0 012 873; JPO . 62,096,086) and the A -factor gene (U S patent 4,588,684).
  • leaders of non-yeast origin such as an interferon leader, exist that also provide for secretion in yeast (EP-A -0 060 057).
  • a preferred class of secretion leaders are those that employ a fragment of the yeast alpha-factor gene, which contains both a "pre" signal sequence, and a "pro” region.
  • the types of alpha-factor fragments that can be employed include the full-length pre-pro alpha factor leader (about 83 amino acid residues) as well as truncated alpha-factor leaders (usually about 25 to about 50 amino acid residues) (US Patents 4,546,083 and 4,870,008 ; EP-A-0 324 274).
  • Additional leaders employing an alpha-factor leader fragment that provides for secretion include hybrid alpha-factor leaders made with a presequence of a first yeast, but a pro-region from a second yeast alphafactor. (eg. see W O 89/02463.)
  • transcription termination sequences recognized by yeast are regulatory regions located 3' to the translation stop codon, and thus together with the promoter flank the coding sequence. These sequences direct the transcription of an mRNA which can be translated into the polypeptide encoded by the DNA . Examples of transcription terminator sequence and other yeast-recognized termination sequences, such as those coding for glycoly tic enzymes.
  • Expression constructs are often maintained in a replicon, such as an extrachromosomal element (eg. plasmids) capable of stable maintenance in a host, such as yeast or bacteria.
  • the replicon may have two replication systems, thus allowing it to be maintained, for example, in yeast for expression and in a prokaryotic host for cloning and amplification.
  • yeast-bacteria shuttle vectors include YEp24 [Botstein et al. (1979) Gene 8:17-24], pC l/1 [Brake et al. (1984) Proc. Natl. Acad. Sci USA 87 :4642-4646], and
  • a replicon may be either a high or low copy number plasmid.
  • a high copy number plasmid w ill generally have a copy number ranging from about 5 to about 200, and usually about 10 to about 150.
  • a host containing a high copy number plasmid will preferably have at least about 10, and more preferably at least about 20. Enter a high or low copy number vector may be selected, depending upon the effect of the vector and the foreign protein on the host. See eg. Brake et al, supra.
  • the expression constructs can be integrated into the yeast genome with an integrating vector.
  • Integrating vectors usually contain at least one sequence homologous to a yeast chromosome that allows the vector to integrate, and preferably contain two homologous sequences flanking the expression construct. Integrations appear to result from recombinations between homologous DNA in the vector and the yeast chromosome [Orr-W eaver et al. (1983) Methods in Enzymol. 707 :228-245].
  • An integrating vector may be directed to a specific locus in yeast by selecting the appropriate homologous sequence for inclusion in the vector. See Orr-W eaver et al., supra.
  • One or more expression construct may integrate, possibly affecting levels of recombinant protein produced [Rine et al. ( 1983) Proc. Natl. Acad. Sci. USA 80:6750].
  • the chromosomal sequences included in the vector can occur either as a single segment in the vector, which results in the integration of the entire vector, or two segments homologous to adjacent segments in the chromosome and flanking the expression construct in the vector, which can result in the stable integration of only the expression construct.
  • extrachromosomal and integrating expression constructs may contain selectable markers to allow for the selection of yeast strains that have been transformed.
  • Selectable markers may include biosynthetic genes that can be expressed in the yeast host, such as ADE2, HIS4, LEU2, TRP1 , and ALG 7, and the G418 resistance gene, which confer resistance in yeast cells to tunicamycin and G418, respectively.
  • a suitable selectable marker may also provide yeast with the ability to grow in the presence of toxic compounds, such as metal.
  • the presence of CUP1 allows yeast to grow in the presence of copper ions [B utt et al. (1987) Microbiol, Rev. 57 :351 ].
  • Transformation vectors are usually comprised of a selectable marker that is either maintained in a replicon or developed into an integrating vector, as described above.
  • Expression and transformation vectors have been developed for transformation into many yeasts.
  • expression vectors have been developed for, inter alia, the following yeasts:Candida albicans [Kurtz, et al. (1986) Mol. Cell. Biol.
  • Pichia guillerimondii [Kunze et al. (1985) /. Basic Microbiol. 25: 141 ], Pichia pastoris [Cregg, et al.
  • M ethods of introducing exogenous DNA into yeast hosts are well-know n in the art, and usually include either the transformation of spheroplasts or of intact yeast cells treated with alkali cations. Transformation procedures usually vary with the yeast species to be transformed. See eg. [Kurtz et al.
  • antibody refers to a polypeptide or group of polypeptides composed of at least one antibody combining site.
  • An “antibody combining site” is the three-dimensional binding space with an internal surface shape and charge distribution complementary to the features of an epitope of an antigen, which allows a binding of the antibody with the antigen.
  • Antibody includes, for example, vertebrate antibodies, hybrid antibodies, chimeric antibodies, humanised antibodies, altered antibodies, univalent antibodies, Fab proteins, and single domain antibodies.
  • Antibodies against the proteins of the invention are useful for affinity chromatography, immunoassays, and distinguishing/identifying Neisserial proteins.
  • Antibodies to the proteins of the invention may be prepared by conventional methods.
  • the protein is first used to imm unize a suitable animal, preferably a mouse, rat, rabbit or goat. Rabbits and goats are preferred for the preparation of polyclonal sera due to the volume of serum obtainable, and the availability of labeled anti-rabbit and anti-goat antibodies.
  • Immunization is generally performed by mixing or emulsifying the protein in saline, preferably in an adjuvant such as Freund' s complete adjuvant, and injecting the mixture or emulsion parenterally (generally subcutaneously or intramuscularly). A dose of 50-200 ⁇ g/injection is typically sufficient.
  • Immunization is generally boosted 2-6 weeks later with one or more injections of the protein in saline, preferably using Freund's incomplete adjuvant.
  • Polyclonal antisera is obtained by bleeding the immunized animal into a glass or plastic container, incubating the blood at 25 °C for one hour, followed by incubating at 4°C for 2-18 hours. The serum is recovered by centrifugation (eg. l ,000g for 10 minutes). About 20-50 ml per bleed may be obtained from rabbits.
  • M onoclonal antibodies are prepared using the standard method of Kohler & M ilstein [Nature (1975) 256:495-96], or a modification thereof.
  • a mouse or rat is immunized as described above.
  • the spleen (and optionally several large lymph nodes) is removed and dissociated into single cells.
  • the spleen cells may be screened (after removal of nonspecifically adherent cells) by applying a cell suspension to a plate or well coated with the protein antigen.
  • B -cells expressing membrane-bound immunoglobulin specific for the antigen bind to the plate, and are not rinsed away with the rest of the suspension.
  • Resulting B -cells, or all dissociated spleen cells are then induced to fuse w ith myeloma cells to form hybridomas, and are cultured in a selective medium (eg. hypoxanthine, aminopterin, thymidine medium, "HAT").
  • a selective medium eg. hypoxanthine, aminopterin, thymidine medium, "HAT”
  • the resulting hybridomas are plated by limiting dilution, and are assayed for the production of antibodies which bind specifically to the immunizing antigen (and which do not bind to unrelated antigens).
  • the selected M Ab-secreting hybridomas are then cultured either in vitro (eg. in tissue culture bottles or hollow fiber reactors), or in vivo (as ascites in mice).
  • the antibodies may be labeled using conventional techniques. Suitable labels include fluorophores, chromophores, radioactive atoms (particularly P and l 25 I), electron-dense reagents, enzymes, and ligands having specific binding partners. Enzymes are typically detected by their activity. For example, horseradish peroxidase is usually detected by its ability to convert 3,3',5 ,5'-tetramethylbenzidine (TM B) to a blue pigment, quantifiable with a spectrophotometer.
  • TM B 3,3',5 ,5'-tetramethylbenzidine
  • Specific binding partner refers to a protein capable of binding a ligand molecule with high specificity, as for example in the case of an antigen and a monoclonal antibody specific therefor.
  • Other specific binding partners include biotin and avidin or streptavidin, IgG and protein A , and the numerous receptor-ligand couples known in the art. It should be understood that the above description is not meant to categorize the various labels into distinct classes, as the same label may serve in several different modes. For example, 125 I may serve as a radioactive label or as an electron-dense reagent. HRP may serve as enzyme or as antigen for a M Ab. Further, one may combine various labels for desired effect.
  • M Abs and avidin also require labels in the practice of this invention: thus, one might label a M Ab with biotin, and detect its presence with avidin labeled with l25 I, or with an anti-biotin M Ab labeled w ith HRP.
  • Other permutations and possibilities will be readily apparent to those of ordinary skill in the art, and are considered as equivalents w ithin the scope of the instant invention.
  • compositions can comprise either polypeptides, antibodies, or nucleic acid of the invention.
  • the pharmaceutical compositions will comprise a therapeutically effective amount of either polypeptides, antibodies, or polynucleotides of the claimed invention.
  • therapeutically effective amount refers to an amount of a therapeutic agent to treat, ameliorate, or prevent a desired disease or condition, or to exhibit a detectable therapeutic or preventative effect.
  • the effect can be detected by, for example, chem ical markers or antigen levels.
  • Therapeutic effects also include reduction in physical symptoms, such as decreased body temperature.
  • the precise effective amount for a subject will depend upon the subject's size and health, the nature and extent of the condition, and the therapeutics or combination of therapeutics selected for administration. Thus, it is not useful to specify an exact effective amount in advance. However, the effective amount for a given situation can be determined by routine experimentation and is within the judgement of the clinician.
  • an effective dose w ill be from about 0.01 mg/ kg to 50 mg/kg or 0.05 mg/kg to about 10 mg/kg of the DNA constructs in the individual to which it is administered.
  • a pharmaceutical composition can also contain a pharmaceutically acceptable carrier.
  • pharmaceutically acceptable carrier refers to a carrier for administration of a therapeutic agent, such as antibodies or a polypeptide, genes, and other therapeutic agents. The term refers to any pharmaceutical carrier that does not itself induce the production of antibodies harmful to the individual receiving the composition, and which may be administered without undue toxicity.
  • Suitable carriers may be large, slowly metabolized macromolecules such as proteins, polysaccharides, polylactic acids, polyglycolic acids, polymeric amino acids, amino acid copolymers, and inactive virus particles. Such carriers are well known to those of ordinary skill in the art.
  • Pharmaceutically acceptable salts can be used therein, for example, mineral acid salts such as hydrochlorides, hydrobromides, phosphates, sulfates, and the like; and the salts of organic acids such as acetates, propionates, malonates, benzoates, and the like.
  • mineral acid salts such as hydrochlorides, hydrobromides, phosphates, sulfates, and the like
  • organic acids such as acetates, propionates, malonates, benzoates, and the like.
  • Pharmaceutically acceptable carriers in therapeutic compositions may contain liquids such as water, saline, glycerol and ethanol. Additionally, auxiliary substances, such as wetting or emulsifying agents, pH buffering substances, and the like, may be present in such vehicles.
  • the therapeutic compositions are prepared as injectables, either as liquid solutions or suspensions; solid form s suitable for solution in, or suspension in, liquid vehicles prior to injection may also be prepared. Liposomes are included within the definition of a pharmaceutically acceptable carrier.
  • compositions of the invention can be administered directly to the subject.
  • the subjects to be treated can be animals; in particular, human subjects can be treated.
  • Direct delivery of the compositions will generally be accomplished by injection, either subcutaneously, intraperitoneally, intravenously or intramuscularly or delivered to the interstitial space of a tissue.
  • the compositions can also be administered into a lesion.
  • Other modes of administration include oral and pulmonary administration, suppositories, and transdermal or transcutaneous applications (eg. see W O98/20734), needles, and gene guns or hyposprays.
  • Dosage treatment may be a single dose schedule or a multiple dose schedule.
  • Vaccines comprise immunising antigen(s), immunogen(s), polypeptide(s), protein(s) or nucleic acid, usually in combination with "pharmaceutically acceptable carriers," which include any carrier that does not itself induce the production of antibodies harmful to the individual receiving the composition.
  • Suitable carriers are typically large, slowly metabolized macromolecules such as proteins, polysaccharides, polylactic acids, polyglycolic acids, polymeric amino acids, am ino acid copolymers, lipid aggregates (such as oil droplets or liposomes), and inactive virus particles.
  • Such carriers are well known to those of ordinary skill in the art. Additionally, these carriers may function as immunostimulating agents ("adjuvants").
  • the antigen or immunogen may be conjugated to a bacterial toxoid, such as a toxoid from diphtheria, tetanus, cholera, 77. pylori, etc. pathogens.
  • a bacterial toxoid such as a toxoid from diphtheria, tetanus, cholera, 77. pylori, etc. pathogens.
  • Preferred adjuvants to enhance effectiveness of the composition include, but are not limited to: (1) aluminum salts (alum), such as aluminum hydroxide, aluminum phosphate, aluminum sulfate, etc; (2) oil-in-water emulsion formulations (with or without other specific immunostimulating agents such as muramyl peptides (see below) or bacterial cell wall components), such as for example (a) M F59TM (W O 90/14837; Chapter 10 in Vaccine design: the subunit and adjuvant approach, eds.
  • aluminum salts alum
  • oil-in-water emulsion formulations with or without other specific immunostimulating agents such as muramyl peptides (see below) or bacterial cell wall components
  • M F59TM W O 90/14837
  • Chapter 10 in Vaccine design the subunit and adjuvant approach, eds.
  • M PL + CW S (Detox ); (3) saponin adjuvants, such as Stimulon (Cambridge B ioscience, W orcester, M A) may be used or particles generated therefrom such as ISCOM s (immunostimulating complexes); (4) Complete Freund' s Adjuvant (CFA) and Incomplete Freund' s Adjuvant (IFA); (5) cytokines, such as interleukins (eg. IL-1 , IL-2, IL-4, IL-5, IL-6, IL-7, IL- 12, etc.), interferons (eg.
  • interleukins eg. IL-1 , IL-2, IL-4, IL-5, IL-6, IL-7, IL- 12, etc.
  • interferons eg.
  • M -CSF macrophage colony stim ulating factor
  • TNF tumor necrosis factor
  • a lum and M F59TM are preferred.
  • muramyl peptides include, but are not limited to, N-acetyl-muramyl-L-threonyl-D- isoglutamine (thr-M DP), N-acetyl-normuramyl-L-alanyl-D-isoglutamine (nor-M DP), N-acetylmuramyl- L-alanyl-D-isoglutaminyl-L-alanine-2-(l '-2'-dipalmitoyl-in-glycero-3-hydroxyphosphoryloxy)- ethylamine (M TP-PE), etc.
  • thr-M DP N-acetyl-muramyl-L-threonyl-D- isoglutamine
  • nor-M DP N-acetyl-normuramyl-L-alanyl-D-isoglutamine
  • M TP-PE N-acetylmuramyl- L
  • the immunogenic compositions typically will contain diluents, such as water, saline, glycerol, ethanol, etc. Additionally, auxiliary substances, such as wetting or emulsifying agents, pH buffering substances, and the like, may be present in such vehicles.
  • the immunogenic compositions are prepared as injectables, either as liquid solutions or suspensions; solid forms suitable for solution in, or suspension in, liquid vehicles prior to injection may also be prepared. The preparation also may be emulsified or encapsulated in liposomes for enhanced adjuvant effect, as discussed above under pharmaceutically acceptable carriers.
  • Immunogenic compositions used as vaccines comprise an immunologically effective amount of the antigenic or immunogenic polypeptides, as well as any other of the above-mentioned components, as needed.
  • B y "immunologically effective amount" it is meant that the administration of that amount to an individual, either in a single dose or as part of a series, is effective for treatment or prevention. This amount varies depending upon the health and physical condition of the individual to be treated, the taxonomic group of individual to be treated (eg. nonhuman primate, primate, etc.), the capacity of the individual's immune system to synthesize antibodies, the degree of protection desired, the formulation of the vaccine, the treating doctor's assessment of the medical situation, and other relevant factors.
  • the immunogenic compositions are conventionally administered parenterally, eg. by injection, either subcutaneously, intramuscularly, or transdermally/transcutaneously (eg. W 098/20734). Additional formulations suitable for other modes of administration include oral and pulmonary formulations, suppositories, and transdermal applications. Dosage treatment may be a single dose schedule or a m ultiple dose schedule. The vaccine may be administered in conjunction with other immunoregulatory agents. A s an alternative to protein-based vaccines, DNA vaccination may be employed [eg. Robinson & Torres (1997) Seminars in Immunology 9:271 -283 ; Donnelly et al. (1997) Annu Rev Immunol 15 :617-648; see later herein].
  • Gene therapy vehicles for delivery of constructs including a coding sequence of a therapeutic of the invention, to be delivered to the mammal for expression in the mammal can be administered either locally or systemically.
  • constructs can utilize viral or non-viral vector approaches in in vivo or ex vivo modality. Expression of such coding sequence can be induced using endogenous mammalian or heterologous promoters. Expression of the coding sequence in vivo can be either constitutive or regulated.
  • the invention includes gene delivery vehicles capable of expressing the contemplated nucleic acid sequences.
  • the gene delivery vehicle is preferably a viral vector and, more preferably, a retroviral, adenoviral, adeno-associated viral (AAV), herpes viral, or alphavirus vector.
  • AAV adeno-associated viral
  • the viral vector can also be an astrovirus, coronavirus, orthomyxovirus, papovavirus, paramyxovirus, parvovirus, picornavirus, poxvirus, or togavirus viral vector. See generally, Jolly (1994) Cancer Gene Therapy 1 :51-64; Kimura (1994) Human Gene Therapy 5:845-852; Connelly (1995) Human Gene Therapy 6:185-193 ; and Kaplitt (1994) Nature Genetics 6:148-153.
  • Retroviral vectors are well known in the art and we contemplate that any retroviral gene therapy vector is employable in the invention, including B , C and D type retroviruses, xenotropic retroviruses (for example, NZB-X 1 , NZB -X2 and NZB 9-1 (see O'Neill (1985) J. Virol. 53 : 160) polytropic retroviruses eg. M CF and M CF-M LV (see Kelly (1983) J. Virol. 45 :291 ), spumaviruses and lentiviruses. See RNA Tumor Viruses, Second Edition, Cold Spring H arbor Laboratory, 1985.
  • xenotropic retroviruses for example, NZB-X 1 , NZB -X2 and NZB 9-1 (see O'Neill (1985) J. Virol. 53 : 160) polytropic retroviruses eg. M CF and M CF-M LV (see Kelly (1983) J. Virol. 45
  • retroviral gene therapy vector may be derived from different retroviruses.
  • retrovector LTRs may be derived from a M urine Sarcoma Virus, a tRNA binding site from a Rous Sarcoma Virus, a packaging signal from a M urine Leukemia Virus, and an origin of second strand synthesis from an Avian Leukosis Virus.
  • Retroviral vectors may be used to generate transduction competent retroviral vector particles by introducing them into appropriate packaging cell lines (see US patent 5,591 ,624).
  • Retrovirus vectors can be constructed for site-specific integration into host cell DNA by incorporation of a chimeric integrase enzyme into the retroviral particle (see W 096/37626). It is preferable that the recombinant viral vector is a replication defective recombinant virus.
  • Packaging cell lines suitable for use with the above-described retrovirus vectors are well known in the art, are readily prepared (see W O95/30763 and W O92/05266), and can be used to create producer cell lines (also termed vector cell lines or "VCLs") for the production of recombinant vector particles.
  • the packaging cell lines are made from human parent cells (eg. H T 1080 cells) or mink parent cell lines, which eliminates inactivation in human serum .
  • Preferred retroviruses for the construction of retroviral gene therapy vectors include Avian Leukosis V irus, Bovine Leukemia, V irus, M urine Leukemia Virus, M ink-Cell Focus-Inducing Virus, M urine Sarcoma Virus, Reticuloendotheliosis Virus and Rous Sarcoma V irus.
  • Particularly preferred M urine Leukemia Viruses include 4070A and 1504A (H artley and Rowe ( 1976) J Virol 19:19-25), Abelson (ATCC No. VR-999), Friend (ATCC No. VR-245), Graffi, Gross (ATCC Nol VR-590), Kirsten, Harvey Sarcoma Virus and Rauscher (ATCC No.
  • retroviruses may be obtained from depositories or collections such as the American Type Culture Collection (“ATCC”) in Rockville, M aryland or isolated from known sources using commonly available techniques.
  • ATCC American Type Culture Collection
  • Exemplary known retroviral gene therapy vectors employable in this invention include those described in patent applications GB 2200651 , EP0415731 , EP0345242, EP0334301 , W O89/02468; W O89/05349, W O89/09271 , W O90/02806, W O90/07936, W O94/03622, W 093/25698, W 093/25234, W O93/1 1230, W O93/10218, W O91/02805, W O91/02825, W O95/07994, US 5,219,740, U S 4,405,712, US 4,861 ,719, US 4,980,289, US 4,777,127, US 5,591 ,624.
  • Human adenoviral gene therapy vectors are also known in the art and employable in this invention. See, for example, Berkner (1988) Biotechniques 6:616 and Rosenfeld (1991) Science 252:431 , and W O93/07283, W O93/06223, and W O93/07282.
  • Exemplary known adenoviral gene therapy vectors employable in this invention include those described in the above referenced documents and in W 094/12649, W O93/03769, W 093/19191 , W 094/28938, W 095/1 1984, W O95/00655, W O95/27071 , W 095/29993, W 095/34671 , W O96/05320, W O94/08026, W O94/1 1506, W O93/06223, W 094/24299, W O95/14102, W 095/24297, W O95/02697, W 094/28152, W 094/24299, W O95/09241 , W O95/25807, W O95/05835, W 094/18922 and W O95/09654.
  • the gene delivery vehicles of the invention also include adenovirus associated virus (AA V ) vectors.
  • AA V adenovirus associated virus
  • Leading and preferred examples of such vectors for use in this invention are the AAV-2 based vectors disclosed in Srivastava, W O93/09239.
  • M ost preferred AAV vectors comprise the two AAV inverted terminal repeats in which the native D-sequences are modified by substitution of nucleotides, such that at least 5 native nucleotides and up to 18 native nucleotides, preferably at least 10 native nucleotides up to 18 native nucleotides, most preferably 10 native nucleotides are retained and the remaining nucleotides of the D-sequence are deleted or replaced with non-native nucleotides.
  • the native D-sequences of the AAV inverted terminal repeats are sequences of 20 consecutive nucleotides in each AAV inverted term inal repeat (ie. there is one sequence at each end) which are not involved in HP formation.
  • the non-native replacement nucleotide may be any nucleotide other than the nucleotide found in the native D-sequence in the same position.
  • Other employable exemplary AAV vectors are pW P-19, pW N-1 , both of which are disclosed in Nahreini (1993) Gene 124:257-262.
  • Another example of such an AAV vector is psub201 (see Samulski (1987) J. Virol. 61 :3096).
  • Another exemplary AAV vector is the Double-D ITR vector. Construction of the Double-D ITR vector is disclosed in US Patent 5 ,478,745.
  • Still other vectors are those disclosed in Carter US Patent 4,797,368 and M uzyczka US Patent 5,139,941 , Chartejee US Patent 5,474,935, and Kotin W 094/288157.
  • Yet a further example of an AAV vector employable in this invention is SSV9AFAB TKneo, which contains the AFP enhancer and albumin promoter and directs expression predominantly in the liver. Its structure and construction are disclosed in Su (1996) Human Gene Therapy 7:463-470. Additional AAV gene therapy vectors are described in U S 5,354,678, US 5,173,414, US 5,139,941 , and US 5,252,479.
  • the gene therapy vectors of the invention also include herpes vectors.
  • Leading and preferred examples are herpes simplex virus vectors containing a sequence encoding a thymidine kinase polypeptide such as those disclosed in US 5,288,641 and EP0176170 (Roizman).
  • herpes simplex virus vectors include HFEM/ICP6-LacZ disclosed in WO95/04139 (Wistar Institute), pHSVlac described in Geller (1988) Science 241:1667-1669 and in WO90/09441 and WO92/07945, HSV Us3::pgC-lacZ described in Fink (1992) 77 «m ⁇ n Gene Therapy 3:11-19 and HSV 7134, 2 RH 105 and GAL4 described in EP 0453242 (Breakefield), and those deposited with the ATCC as accession numbers ATCC VR-977 and ATCC VR-260.
  • alpha virus gene therapy vectors that can be employed in this invention.
  • Preferred alpha virus vectors are Sindbis viruses vectors. Togaviruses, Semliki Forest virus (ATCC VR-67; ATCC VR-1247), Middleberg virus (ATCC VR-370), Ross River virus (ATCC VR-373; ATCC VR-1246), Venezuelan equine encephalitis virus (ATCC VR923; ATCC VR-1250; ATCC VR-1249; ATCC VR-532), and those described in US patents 5,091,309, 5,217,879, and WO92/10578.
  • alpha virus vectors described in US Serial No.08/405,627, filed March 15, 1995.W094/21792, WO92/10578, WO95/07994, US 5,091,309 and US 5,217,879 are employable.
  • alpha viruses may be obtained from depositories or collections such as the ATCC in Rockville, Maryland or isolated from known sources using commonly available techniques.
  • alphavirus vectors with reduced cytotoxicity are used (see USSN 08/679640).
  • DNA vector systems such as eukaryotic layered expression systems are also useful for expressing the nucleic acids of the invention. See W 095/07994 for a detailed description of eukaryotic layered expression systems.
  • the eukaryotic layered expression systems of the invention are derived from alphavirus vectors and most preferably from Sindbis viral vectors.
  • Other viral vectors suitable for use in the present invention include those derived from poliovirus, for example ATCC VR-58 and those described in Evans, Nature 339 (1989) 385 and Sabin (1973) J. Biol.
  • compositions of this invention into cells is not limited to the above mentioned viral vectors.
  • Other delivery methods and media may be employed such as, for example, nucleic acid expression vectors, polycationic condensed DNA linked or unlinked to killed adenovirus alone, for example see US Serial No. 08/366,787, filed December 30, 1994 and Curiel (1992) Hum Gene Ther 3 :147-154 ligand linked DNA, for example see W u (1989) J Biol Chem 264: 16985-16987, eucaryotic cell delivery vehicles cells, for example see US Serial No.08/240,030, filed M ay 9, 1994, and US Serial No.
  • Particle mediated gene transfer may be employed, for example see US Serial No. 60/023,867. Briefly, the sequence can be inserted into conventional vectors that contain conventional control sequences for high level expression, and then incubated with synthetic gene transfer molecules such as polymeric DNA-binding cations like polylysine, protamine, and albumin, linked to cell targeting ligands such as asialoorosomucoid, as described in W u & W u (1987) J. Biol. Chem. 262:4429-4432, insulin as described in Hucked (1990) Biochem Pharmacol 40:253-263, galactose as described in Plank (1992) Bioconjugate Chem 3:533-539, lactose or transferrin.
  • synthetic gene transfer molecules such as polymeric DNA-binding cations like polylysine, protamine, and albumin, linked to cell targeting ligands such as asialoorosomucoid, as described in W u & W u (1987)
  • Naked DNA may also be employed.
  • Exemplary naked DNA introduction methods are described in W O 90/11092 and US 5,580,859. Uptake efficiency may be improved using biodegradable latex beads.
  • DNA coated latex beads are efficiently transported into cells after endocytosis initiation by the beads. The method may be improved further by treatment of the beads to increase hydrophobicity and thereby facilitate disruption of the endosome and release of the DNA into the cytoplasm.
  • Liposomes that can act as gene delivery vehicles are described in US 5,422,120, W 095/13796,
  • the nucleic acid sequences encoding a polypeptide can be inserted into conventional vectors that contain conventional control sequences for high level expression, and then be incubated with synthetic gene transfer molecules such as polymeric DNA -binding cations like polylysine, protamine, and album in, linked to cell targeting ligands such as asialoorosomucoid, insulin, galactose, lactose, or transferrin.
  • synthetic gene transfer molecules such as polymeric DNA -binding cations like polylysine, protamine, and album in, linked to cell targeting ligands such as asialoorosomucoid, insulin, galactose, lactose, or transferrin.
  • Other delivery systems include the use of liposomes to encapsulate DNA comprising the gene under the control of a variety of tissue-specific or ubiquitously-active promoters.
  • non-viral delivery suitable for use includes mechanical delivery systems such as the approach described in W offendin et al (1994) Proc. Natl. Acad. Sci. USA 91 (24):11581 -1 1585.
  • the coding sequence and the product of expression of such can be delivered through deposition of photopolymerized hydrogel materials.
  • Other conventional methods for gene delivery that can be used for delivery of the coding sequence include, for example, use of hand-held gene transfer particle gun, as described in US 5,149,655 ; use of ionizing radiation for activating transferred gene, as described in US 5,206,152 and W 092/1 1033
  • Exemplary liposome and polycationic gene delivery vehicles are those described in US 5,422,120 and 4,762,915 ; in W O 95/13796; W 094/23697 ; and W 091/14445 ; in EP-0524968; and in Stryer, B iochemistry, pages 236-240 (1975) W .H . Freeman, San Francisco; Szoka ( 1980) Biochem Biophys Ada 600:1 ; B ayer (1979) Biochem Biophys Ada 550:464; Rivnay (1987) Meth Enzymol 149 :1 19; W ang (1987) Proc Natl Acad Sci 84:7851 ; Plant (1989) Anal Biochem 176:420.
  • a polynucleotide composition can comprises therapeutically effective amount of a gene therapy vehicle, as the term is defined above.
  • an effective dose will be from about 0.01 mg/ kg to 50 mg/kg or 0.05 mg/kg to about 10 mg/kg of the DNA constructs in the individual to which it is administered.
  • the polynucleotide compositions of the invention can be administered (1 ) directly to the subject; (2) delivered ex vivo, to cells derived from the subject; or (3) in vitro for expression of recombinant proteins.
  • the subjects to be treated can be mammals or birds. Also, human subjects can be treated.
  • Direct delivery of the compositions will generally be accomplished by injection, either subcutaneously, intraperitoneally, intravenously or intramuscularly or delivered to the interstitial space of a tissue.
  • the compositions can also be administered into a lesion.
  • Other modes of administration include oral and pulmonary administration, suppositories, and transdermal or transcutaneous applications (eg. see W O98/20734), needles, and gene guns or hyposprays.
  • Dosage treatment may be a single dose schedule or a multiple dose schedule.
  • M ethods for the ex vivo delivery and reimplantation of transformed cells into a subject are known in the art and described in eg. W 093/14778.
  • Examples of cells useful in ex vivo applications include, for example, stem cells, particularly hematopoetic, lymph cells, macrophages, dendritic cells, or tumor cells.
  • nucleic acids for both ex vivo and in vitro applications can be accomplished by the following procedures, for example, dextran-mediated transfection, calcium phosphate precipitation, polybrene mediated transfection, protoplast fusion, electroporation, encapsulation of the polynucleotide(s) in liposomes, and direct microinjection of the DNA into nuclei, all well known in the art.
  • polypeptides which include, without lim itation: asioloorosomucoid (ASOR); transferrin; asialoglycoproteins; antibodies; antibody fragments; ferritin; interleukins; interferons, granulocyte, macrophage colony stimulating factor (GM -CSF), granulocyte colony stimulating factor (G-CSF), macrophage colony stimulating factor (M -C SF), stem cell factor and erythropoietin.
  • Viral antigens such as envelope proteins, can also be used.
  • proteins from other invasive organisms such as the 17 amino acid peptide from the circumsporozoite protein of plasmodium falciparum known as RII.
  • hormones for example: hormones, steroids, androgens, estrogens, thyroid hormone, or vitamins, folic acid.
  • polyalkylene glycol can be included with the desired polynucleotides/polypeptides.
  • the polyalkylene glycol is polyethlylene glycol.
  • mono-, di-, or polysaccharides can be included.
  • the polysaccharide is dextran or DEAE-dextran.
  • the desired polynucleotide/polypeptide can also be encapsulated in lipids or packaged in liposomes prior to delivery to the subject or to cells derived therefrom.
  • Lipid encapsulation is generally accomplished using liposomes which are able to stably bind or entrap and retain nucleic acid.
  • the ratio of condensed polynucleotide to lipid preparation can vary but will generally be around 1 :1 (mg DNA :micromoles lipid), or more of lipid.
  • liposomes as carriers for delivery of nucleic acids, see, Hug and Sleight (1991 ) Biochim. Biophys. Ada. 1097:1-17; Straubinger (1983) Meth. Enzymol. 101 :512-527.
  • Liposomal preparations for use in the present invention include cationic (positively charged), anionic (negatively charged) and neutral preparations.
  • Cationic liposomes have been shown to mediate intracellular delivery of plasmid DNA (Feigner (1987) Proc. Natl. Acad. Sci. USA 84:7413-7416); mRNA (M alone (1989) Proc. Natl. Acad. Sci. USA 86:6077-6081 ); and purified transcription factors (Debs (1990) 7. Biol. Chem. 265 :10189-10192), in functional form .
  • Cationic liposomes are readily available.
  • N[l-2,3-dioleyloxy)propyl]-N,N,N- triethylammonium (DOTM A) liposomes are available under the trademark Lipofectin, from GIB CO B RL, Grand Island, N Y . (See, also, Feigner supra).
  • Other commercially available liposomes include transfectace (DDAB/DOPE) and DOTAP/DOPE (B oerhinger).
  • Other cationic liposomes can be prepared from readily available materials using techniques well known in the art. See, eg. Szoka (1978) Proc. Natl. Acad. Sci.
  • DOTAP l ,2-bis(oleoyloxy)-3-(trimethylammonio)propane liposomes.
  • anionic and neutral liposomes are readily available, such as from Avanti Polar Lipids (B irmingham , A L), or can be easily prepared using readily available materials.
  • Such materials include phosphatidyl choline, cholesterol, phosphatidyl ethanolam ine, dioleoylphosphatidyl choline (DOPC), dioleoylphosphatidyl glycerol (DOPG), dioleoylphoshatidyl ethanolamine (DOPE), among others. These materials can also be mixed with the DOTM A and DOTAP starting materials in appropriate ratios. M ethods for making liposomes using these materials are well known in the art.
  • the liposomes can comprise multilammelar vesicles (M LVs), small unilamellar vesicles (SUVs), or large unilamellar vesicles (LUV s).
  • M LVs multilammelar vesicles
  • SUVs small unilamellar vesicles
  • LUV s large unilamellar vesicles
  • the various liposome-nucleic acid complexes are prepared using methods known in the art. See eg. Straubinger (1983) Meth. Immunol. 101 :512-527 ; Szoka (1978) Proc. Natl. Acad. Sci. USA 75 :4194-4198 ; Papahadjopoulos (1975) Biochim. Biophys. Ada 394:483 ; W ilson (1979) Cell 17:77); Deamer & B angham (1976) Biochim. Biophys.
  • lipoproteins can be included with the polynucleotide/polypeptide to be delivered.
  • lipoproteins to be utilized include: chylomicrons, HDL, ID L, LD L, and VLD L. M utants, fragments, or fusions of these proteins can also be used.
  • modifications of naturally occurring lipoproteins can be used, such as acetylated LDL.
  • These lipoproteins can target the delivery of polynucleotides to cells expressing lipoprotein receptors.
  • no other targeting ligand is included in the composition.
  • Naturally occurring lipoproteins comprise a lipid and a protein portion.
  • the protein portion are known as apoproteins.
  • apoproteins A , B , C, D , and E have been isolated and identified. At least two of these contain several proteins, designated by Roman numerals, Al, All, AIV ; CI, CII, CIII.
  • a lipoprotein can comprise more than one apoprotein.
  • naturally occurring chylomicrons comprises of A, B , C, and E, over time these lipoproteins lose A and acquire C and E apoproteins.
  • VLD L comprises A, B , C , and E apoproteins
  • LDL comprises apoprotein B
  • HD L comprises apoproteins A , C , and E.
  • Lipoproteins contain a variety of lipids including, triglycerides, cholesterol (free and esters), and phospholipids.
  • the composition of the lipids varies in naturally occurring lipoproteins.
  • chylomicrons comprise mainly triglycerides.
  • the composition of the lipids are chosen to aid in conformation of the apoprotein for receptor binding activity.
  • the composition of lipids can also be chosen to facilitate hydrophobic interaction and association with the polynucleotide binding molecule.
  • Naturally occurring lipoproteins can be isolated from serum by ultracentrifugation, for instance. Such methods are described in Meth.
  • Lipoproteins can also be produced by in vitro or recombinant methods by expression of the apoprotein genes in a desired host cell. See, for example, Atkinson (1986) Annu Rev Biophys Chem 15 :403 and Radding (1958) Biochim Biophys Ada 30: 443. Lipoproteins can also be purchased from commercial suppliers, such as B iomedical Techniologies, Inc., Stoughton, M assachusetts, USA . Further description of lipoproteins can be found in Zuckermann et al. W O98/06437.
  • Polycationic agents can be included, with or without lipoprotein, in a composition with the desired polynucleotide/polypeptide to be delivered.
  • Polycationic agents typically, exhibit a net positive charge at physiological relevant pH and are capable of neutralizing the electrical charge of nucleic acids to facilitate delivery to a desired location. These agents have both in vitro, ex vivo, and in vivo applications. Polycationic agents can be used to deliver nucleic acids to a living subject either intramuscularly, subcutaneously, etc.
  • useful polypeptides as polycationic agents: polylysine, polyarginine, polyornithine, and protamine.
  • transcriptional factors also contain domains that bind DNA and therefore may be useful as nucleic aid condensing agents. Briefly, transcriptional factors such as C/CEB P, c-jun, c-fos, AP-1 , AP-2, A P-3, CPF, Prot-1 , Sp-1 , Oct-l , Oct-2, CREP, and TFIID contain basic domains that bind DNA sequences.
  • Organic polycationic agents include: spermine, spermidine, and purtrescine.
  • polycationic agent The dimensions and of the physical properties of a polycationic agent can be extrapolated from the list above, to construct other polypeptide polycationic agents or to produce synthetic polycationic agents.
  • Synthetic polycationic agents which are useful include, for example, DEAE-dextran, polybrene.
  • LipofectinTM, and lipofectAM INETM are monomers that form polycationic complexes when combined with polynucleotides/polypeptides.
  • Immunodiasnostic Assays Neisserial antigens of the invention can be used in immunoassays to detect antibody levels (or, conversely, anti-Neisserial antibodies can be used to detect antigen levels). Immunoassays based on well defined, recombinant antigens can be developed to replace invasive diagnostics methods. Antibodies to Neisserial proteins within biological samples, including for example, blood or serum samples, can be detected.
  • Protocols for the immunoassay may be based, for example, upon competition, or direct reaction, or sandwich type assays. Protocols may also, for example, use solid supports, or may be by immunoprecipitation.
  • M ost assays involve the use of labeled antibody or polypeptide; the labels may be, for example, fluorescent, chemiluminescent, radioactive, or dye molecules.
  • Assays which amplify the signals from the probe are also known; examples of which are assays which utilize biotin and avidin, and enzyme-labeled and mediated immunoassays, such as ELISA assays.
  • Kits suitable for immunodiagnosis and containing the appropriate labeled reagents are constructed by packaging the appropriate materials, including the compositions of the invention, in suitable containers, along with the remaining reagents and materials (for example, suitable buffers, salt solutions, etc.) required for the conduct of the assay, as well as suitable set of assay instructions.
  • Hybridization refers to the association of two nucleic acid sequences to one another by hydrogen bonding. Typically, one sequence will be fixed to a solid support and the other will be free in solution. Then, the two sequences will be placed in contact with one another under conditions that favor hydrogen bonding. Factors that affect this bonding include: the type and volume of solvent; reaction temperature; time of hybridization; agitation; agents to block the non-specific attachment of the liquid phase sequence to the solid support (Denhardt's reagent or B LOTTO); concentration of the sequences; use of compounds to increase the rate of association of sequences (dextran sulfate or polyethylene glycol); and the stringency of the washing conditions following hybridization. See Sambrook et al.
  • “Stringency” refers to conditions in a hybridization reaction that favor association of very similar sequences over sequences that differ.
  • the combination of temperature and salt concentration should be chosen that is approximately 120 to 200°C below the calculated Tm of the hybrid under study.
  • the temperature and salt conditions can often be determined empirically in preliminary experiments in which samples of genomic DNA immobilized on filters are hybridized to the sequence of interest and then washed under conditions of different stringencies. See Sambrook et al. at page 9.50.
  • Variables to consider when performing, for example, a Southern blot are (1) the complexity of the DNA being blotted and (2) the homology between the probe and the sequences being detected.
  • the total amount of the fragment(s) to be studied can vary a magnitude of 10, from 0.1 to l ⁇ g for a plasmid or phage digest to 10 " to 10 "8 g for a single copy gene in a highly complex eukaryotic genome.
  • substantially shorter blotting, hybridization, and exposure times a smaller amount of starting polynucleotides, and lower specific activity of probes can be used.
  • a single-copy yeast gene can be detected with an exposure time of only 1 hour starting w ith 1 ⁇ g of yeast DNA , blotting for two hours, and hybridizing for 4-8 hours with a probe of 10 8 cpm/ ⁇ g.
  • a conservative approach would start with 10 ⁇ g of DNA , blot overnight, and hybridize overnight in the presence of 10% dextran sulfate using a probe of greater than 10 8 cpm/ ⁇ g, resulting in an exposure time of -24 hours.
  • Tm melting temperature
  • Tm 81 + 16.6(log ⁇ oCi) + 0.4[% (G + C)]-0.6(% formamide) - 600/n-1.5(% mismatch).
  • Ci is the salt concentration (monovalent ions)
  • n is the length of the hybrid in base pairs (slightly modified from M einkoth & W ahl (1984) Anal. Biochem. 138: 267-284).
  • the temperature of the hybridization and washes and the salt concentration during the washes are the simplest to adjust. As the temperature of the hybridization increases (ie. stringency), it becomes less likely for hybridization to occur between strands that are nonhomologous, and as a result, background decreases. If the radiolabeled probe is not completely homologous with the immobilized fragment (as is frequently the case in gene family and interspecies hybridization experiments), the hybridization temperature must be reduced, and background will increase. The temperature of the washes affects the intensity of the hybridizing band and the degree of background in a similar manner. The stringency of the washes is also increased with decreasing salt concentrations.
  • N. meningitidis serogroup B contained a component of approximately 80-85kDa. This protein was purified from SDS-PAGE gels and N-terminal sequenced (SEQ ID 1).
  • Antibodies raised against the SDS-PAGE purified protein cross-reacted with equivalent proteins in more than 50 N. meningitidis strains of diverse serogroups and serotypes. Cross-reactivity with N.gonorrhoeae, N.polysaccharia and N. lactamica was also observed. Post-immune sera from vaccinated patients also reacted with the protein.
  • the complete gene was cloned from serogroup B N. meningitidis (SEQ ID 2) and the encoded protein was inferred (SEQ ID 3). By comparison with the N-terminal sequencing described above, a signal peptide (SEQ ID 4) and a mature sequence (SEQ ED 5) are inferred.
  • SEQ ID 6 The complete gene from serogroup A N.meningitidis is shown in SEQ ID 6, with the encoded protein in SEQ ID 7.
  • the signal peptide and mature sequence are SEQ IDs 8 and 9.
  • SEQ ID 10 The complete gene from N.gonorrhoeae is shown in SEQ ID 10, with the encoded protein in SEQ ED 11.
  • the signal peptide and mature sequence are SEQ EDs 12 and 13.
  • the protein sequences were compared and are highly homologous.
  • the N.meningitidis serogroup B sequence and the N.gonorrhoeae sequence show 95.4% identity in 797 aa overlap:
  • pep FEGNQVYSDRKLMRQMS TEGGIWTWLTRSNQFNEQKFAQDMEKVTDFYQN GYFDFRIL orf2Ing .
  • pep FEGNQVYSDRK MRQMS TEGGI TW TRSDRFDRQKFAQDMEKVTDFYQNNGYFDFRIL 190 200 210 220 230 240
  • N.meningitidis serogroup A and B sequences show 99.9% identity in 797 aa overlap:
  • the three proteins identified above were expressed and used for immunisation. Good immune responses were observed against the proteins.
  • the proteins were each combined with antigens against other pathogenic organisms (e.g. the Chiron polysaccharide vaccine against serogroup C meningitis), and used for immunisation. Good immune responses were observed. Further NmB components
  • the Norwegian vaccine does not elicit protection against NmB strain 2996.
  • proteins from strain 2996 were added to the Norwegian vaccine, and it was shown that the efficacy of the vaccine was increased by a surprising degree.
  • the addition of a NmC polysaccharide conjugate antigen [e.g. Costantino et al. (1992) Vaccine 10:691-698] gave excellent results.
  • NmB antigens Three different NmB antigens were used:
  • This vaccine also offers protection against heterologous MenB strains.
  • strains 2996, BZ133 & 1000 OMVs prepared from homologous strain
  • strain BZ232 OMVs prepared from 2996
  • MC58 & NGH38 SEAM3
  • E.coli were transformed to express ORFl, ORF40 and ORF46.
  • OMVs prepared from the recombinant E.coli were able to induce bactericidal antibodies against N.meningitidis.
  • ORFl, ORF40 and ORF46 were expressed as His-tagged fusions in E.coli and were prepared either as pure proteins or in the form of OMVs. Bactericidal titres against both preparations were tested using strain 2996 as challenge:
  • ORF46 gives a titre against strain MC58 of 4096 in pure form, but this rises to 32000 when in the form of OMVs.
  • ORFl gives a titre against NmA strain F6124 of 128 in pure form, but this rises to 512 when in the form of OMVs.
  • ORF40 gives a titre against strain MC58 of 512 in pure form, but this doubles when in the form of OMVs.
  • NmB antigens retain immunogenicity when prepared in E.coli as OMVs and, furthermore, that immunogenicity can actually be enhanced.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Chemical & Material Sciences (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • General Health & Medical Sciences (AREA)
  • Public Health (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Organic Chemistry (AREA)
  • Immunology (AREA)
  • Virology (AREA)
  • Oncology (AREA)
  • Communicable Diseases (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Mycology (AREA)
  • Microbiology (AREA)
  • Epidemiology (AREA)
  • Molecular Biology (AREA)
  • Biotechnology (AREA)
  • Pain & Pain Management (AREA)
  • Rheumatology (AREA)
  • Biomedical Technology (AREA)
  • Neurology (AREA)
  • Neurosurgery (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)
  • Medicinal Preparation (AREA)
PCT/IB2001/000166 2000-01-17 2001-01-17 Outer membrane vesicle (omv) vaccine comprising n. meningitidis serogroup b outer membrane proteins Ceased WO2001052885A1 (en)

Priority Applications (17)

Application Number Priority Date Filing Date Title
DE60142772T DE60142772D1 (de) 2000-01-17 2001-01-17 Membranvesikel (omv) impfstoff, der n. meningitidis serogruppe b membranproteine enthält
NZ520466A NZ520466A (en) 2000-01-17 2001-01-17 Outer membrane vesicle (OMV) vaccine comprising n. meningitidis serogroup B outer membrane proteins
BRPI0107679A BRPI0107679B8 (pt) 2000-01-17 2001-01-17 composição compreendendo vesículas de membrana externa do grupo sérico b de neisseria meningitidis e um componente inorgânico e uso da mesma
MXPA02006962A MXPA02006962A (es) 2000-01-17 2001-01-17 Vacuna de vesicula de membrana exterior que comprende proteinas de membrana exterior de neisseria meningitidis serogrupo b.
AT01942562T ATE476988T1 (de) 2000-01-17 2001-01-17 Membranvesikel (omv) impfstoff, der n. meningitidis serogruppe b membranproteine enthält
CA2397508A CA2397508C (en) 2000-01-17 2001-01-17 Outer membrane vesicle (omv) vaccine comprising n. meningitidis serogroup b outer membrane proteins
JP2001552932A JP2003520248A (ja) 2000-01-17 2001-01-17 N.meningitidis血清型b外膜タンパク質を含む外膜小胞(omv)ワクチン
CN018059201A CN1416352B (zh) 2000-01-17 2001-01-17 含有脑膜炎奈瑟球菌b血清群外膜蛋白质的外膜囊(omv)疫苗
BR0107679-5A BR0107679A (pt) 2000-01-17 2001-01-17 Vacina de vesìcula de membrana externa (omv) compreendendo proteìnas de membrana externa do grupo sérico b de neisseria meningitidis
US10/181,600 US8273360B2 (en) 2000-01-17 2001-01-17 Outer membrane vesicle (OMV) vaccine comprising N. meningitidis serogroup B outer membrane proteins
AU28754/01A AU784518B2 (en) 2000-01-17 2001-01-17 Outer membrane vesicle (OMV) vaccine comprising N. meningitidis serogroup B outer membrane proteins
EP01942562A EP1248647B1 (en) 2000-01-17 2001-01-17 Outer membrane vesicle (omv) vaccine comprising n. meningitidis serogroup b outer membrane proteins
DK01942562.8T DK1248647T3 (da) 2000-01-17 2001-01-17 Ydre membranvesikel (OMV) vaccine omfattende N. meningitidis serogruppe B ydre membranproteiner
AU2009200692A AU2009200692B2 (en) 2000-01-17 2009-02-19 Outer membrane vesicle (OMV) vaccine comprising N. meningitidis serogroup B outer membrane proteins
US13/591,138 US20120328643A1 (en) 2000-01-17 2012-08-21 Outer membrane vesicle (omv) vaccine comprising n. meningitidis serogroup b outer membrane proteins
US14/882,320 US20160030546A1 (en) 2000-01-17 2015-10-13 Outer membrane vesicle (omv) vaccine comprising n. meningitidis serogroup b outer membrane proteins
US14/961,725 US20160082098A1 (en) 2000-01-17 2015-12-07 Outer membrane vesicle (omv) vaccine comprising n. meningitidis serogroup b outer membrane proteins

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
GB0001067.8 2000-01-17
GB0001067A GB0001067D0 (en) 2000-01-17 2000-01-17 Supplemented norwegian vaccine
GBGB0005699.4A GB0005699D0 (en) 2000-03-09 2000-03-09 Supplemented OMV vaccines
GB0005699.4 2000-03-09

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US10/181,600 A-371-Of-International US8273360B2 (en) 2000-01-17 2001-01-17 Outer membrane vesicle (OMV) vaccine comprising N. meningitidis serogroup B outer membrane proteins
US13/591,138 Division US20120328643A1 (en) 2000-01-17 2012-08-21 Outer membrane vesicle (omv) vaccine comprising n. meningitidis serogroup b outer membrane proteins

Publications (1)

Publication Number Publication Date
WO2001052885A1 true WO2001052885A1 (en) 2001-07-26

Family

ID=26243421

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/IB2001/000166 Ceased WO2001052885A1 (en) 2000-01-17 2001-01-17 Outer membrane vesicle (omv) vaccine comprising n. meningitidis serogroup b outer membrane proteins

Country Status (17)

Country Link
US (4) US8273360B2 (https=)
EP (6) EP1248647B1 (https=)
JP (6) JP2003520248A (https=)
CN (2) CN1416352B (https=)
AT (1) ATE476988T1 (https=)
AU (2) AU784518B2 (https=)
BR (2) BRPI0107679B8 (https=)
CA (2) CA2397508C (https=)
CY (3) CY1111056T1 (https=)
DE (1) DE60142772D1 (https=)
DK (3) DK1248647T3 (https=)
ES (2) ES2588917T3 (https=)
MX (1) MXPA02006962A (https=)
NZ (1) NZ520466A (https=)
PT (3) PT2289545T (https=)
RU (1) RU2279889C2 (https=)
WO (1) WO2001052885A1 (https=)

Cited By (106)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2002009746A3 (en) * 2000-07-31 2002-06-13 Smithkline Beecham Biolog Vaccines comprising outer membrane vesciles from gram negative bacteria
WO2003010194A3 (en) * 2001-07-27 2003-10-02 Chiron Srl Meningococcus adhesins nada, app and orf 40
WO2004014418A3 (en) * 2002-08-02 2004-07-22 Glaxosmithkline Biolog Sa Neisserial vaccine compositions comprising a combination of antigens
WO2004048404A3 (en) * 2002-11-22 2004-09-16 Chiron Srl Multiple variants of meningococcal protein nmb1870
WO2004046177A3 (en) * 2002-11-15 2004-12-29 Chiron Srl Unexpected surface proteins in neisseria meningitidis
WO2005102384A2 (en) 2004-04-22 2005-11-03 Chiron Srl Immunising against meningococcal serogroup y using proteins
US7384645B2 (en) 2001-12-17 2008-06-10 Health Protection Agency Outer membrane vesicles from gram negative bacteria and use as a vaccine
WO2009034473A2 (en) 2007-09-12 2009-03-19 Novartis Ag Gas57 mutant antigens and gas57 antibodies
EP1855715A4 (en) * 2005-01-27 2009-06-17 Childrens Hosp & Res Ct Oak VESICULAR GNA1870 VACCINES PROVIDING BROAD SPECTRUM PROTECTION AGAINST DISEASES CAUSED BY NEISSERIA MENINGITIDIS
WO2009111337A1 (en) 2008-03-03 2009-09-11 Irm Llc Compounds and compositions as tlr activity modulators
EP2168597A1 (en) 2001-07-26 2010-03-31 Novartis Vaccines and Diagnostics S.r.l. Vaccines comprising aluminium adjuvants and histidine
EP2179729A1 (en) 2003-06-02 2010-04-28 Novartis Vaccines and Diagnostics, Inc. Immunogenic compositions based on microparticles comprising adsorbed toxoid and a polysaccharide-containing antigen
WO2010049806A1 (en) 2008-10-27 2010-05-06 Novartis Ag Purification method
WO2010067202A2 (en) 2008-12-11 2010-06-17 Novartis Ag Mixing lyophilised meningococcal vaccines with non-hib vaccines
WO2010070453A2 (en) 2008-12-17 2010-06-24 Novartis Ag Meningococcal vaccines including hemoglobin receptor
WO2010078556A1 (en) 2009-01-05 2010-07-08 Epitogenesis Inc. Adjuvant compositions and methods of use
WO2010079464A1 (en) 2009-01-12 2010-07-15 Novartis Ag Cna_b domain antigens in vaccines against gram positive bacteria
US7763589B2 (en) 1996-09-17 2010-07-27 Novartis Vaccines And Diagnostics, Inc. Compositions and methods for treating intracellular diseases
EP2258390A1 (en) 2002-08-30 2010-12-08 Novartis Vaccines and Diagnostics S.r.l. Improved bacterial outer membrane vesicles
EP2258365A1 (en) 2003-03-28 2010-12-08 Novartis Vaccines and Diagnostics, Inc. Use of organic compounds for immunopotentiation
EP2263687A1 (en) 2002-12-27 2010-12-22 Novartis Vaccines&Diagnostics, Inc. Immunogenic compositions containing phospholipid
EP2263688A1 (en) 2001-06-20 2010-12-22 Novartis AG Neisseria meningitidis combination vaccines
EP2267035A2 (en) 2004-05-21 2010-12-29 Novartis Vaccines and Diagnostics S.r.l. Measuring Degree of Polymerisation for Meningococcal Capsular Saccharides that Contain Sialic Acid
EP2267036A1 (en) 2003-10-02 2010-12-29 Novartis Vaccines and Diagnostics S.r.l. Hypo- and Hyper-Acetylated Meningococcal Capsular Saccharides
EP2267005A1 (en) 2003-04-09 2010-12-29 Novartis Vaccines and Diagnostics S.r.l. ADP-ribosylating toxin from Listeria monocytogenes
US7862827B2 (en) 1999-05-19 2011-01-04 Novartis Vaccines And Diagnostics Srl Combination neisserial compositions
EP2270175A1 (en) 2001-03-27 2011-01-05 Novartis Vaccines and Diagnostics S.r.l. Streptococcus pneumoniae proteins and nucleic acids
EP2270056A2 (en) 2005-02-01 2011-01-05 Novartis Vaccines and Diagnostics S.r.l. Purification of streptococcal capsular polysaccharide
EP2277896A1 (en) 2000-10-27 2011-01-26 Novartis Vaccines and Diagnostics S.r.l. Nucleic acids and proteins from streptococcus groups A & B
EP2277595A2 (en) 2004-06-24 2011-01-26 Novartis Vaccines and Diagnostics, Inc. Compounds for immunopotentiation
EP2279747A1 (en) 2004-10-29 2011-02-02 Novartis Vaccines and Diagnostics S.r.l. Immunogenic bacterial vesicles with outer membrane proteins
US20110033491A1 (en) * 1998-11-02 2011-02-10 Andrew Robinson Multicomponent meningococcal vaccine
EP2290366A1 (en) 2004-03-17 2011-03-02 Novartis Vaccines and Diagnostics S.r.l. Analysis of saccharide vaccines without interference
EP2289546A2 (en) 2003-01-30 2011-03-02 Novartis Vaccines and Diagnostics S.r.l. Injectable vaccines against multiple meningococcal serogroups
WO2011024072A2 (en) 2009-08-27 2011-03-03 Novartis Ag Hybrid polypeptides including meningococcal fhbp sequences
WO2011024071A1 (en) 2009-08-27 2011-03-03 Novartis Ag Adjuvant comprising aluminium, oligonucleotide and polycation
US7901907B2 (en) 1996-01-04 2011-03-08 The Provost Fellows And Scholars Of The College Of The Holy And Undivided Trinity Of Queen Elizabeth Near Dublin Process for production of Helicobacter pylori bacterioferritin
WO2011027222A2 (en) 2009-09-02 2011-03-10 Novartis Ag Immunogenic compositions including tlr activity modulators
EP2298796A2 (en) 2001-03-27 2011-03-23 Novartis Vaccines and Diagnostics S.r.l. Staphylococcus aureus proteins and nucleic acids
WO2011039631A2 (en) 2009-09-30 2011-04-07 Novartis Ag Expression of meningococcal fhbp polypeptides
WO2011049677A1 (en) 2009-09-02 2011-04-28 Irm Llc Compounds and compositions as tlr activity modulators
WO2011051893A1 (en) 2009-10-27 2011-05-05 Novartis Ag Modified meningococcal fhbp polypeptides
WO2011051917A1 (en) 2009-10-30 2011-05-05 Novartis Ag Purification of staphylococcus aureus type 5 and type 8 capsular saccharides
WO2011057148A1 (en) 2009-11-05 2011-05-12 Irm Llc Compounds and compositions as tlr-7 activity modulators
EP2327719A1 (en) 2001-09-06 2011-06-01 Novartis Vaccines and Diagnostics S.r.l. Hybrid and tandem expression of neisserial proteins
EP2335724A1 (en) 2001-12-12 2011-06-22 Novartis Vaccines and Diagnostics S.r.l. Immunisation against chlamydia trachomatis
EP2343308A2 (en) 2001-10-11 2011-07-13 Wyeth Holdings Corporation Novel immunogenic compositions for the prevention and treatment of meningococcal disease
WO2011084549A1 (en) 2009-12-15 2011-07-14 Novartis Ag Homogeneous suspension of immunopotentiating compounds and uses thereof
EP2351579A1 (en) 2002-10-11 2011-08-03 Novartis Vaccines and Diagnostics S.r.l. Polypeptide vaccines for broad protection against hypervirulent meningococcal lineages
EP2357184A1 (en) 2006-03-23 2011-08-17 Novartis AG Imidazoquinoxaline compounds as immunomodulators
EP2357000A1 (en) 2005-10-18 2011-08-17 Novartis Vaccines and Diagnostics, Inc. Mucosal and systemic immunizations with alphavirus replicon particles
EP2360175A2 (en) 2005-11-22 2011-08-24 Novartis Vaccines and Diagnostics, Inc. Norovirus and Sapovirus virus-like particles (VLPs)
EP2363709A1 (en) 2006-03-22 2011-09-07 Novartis Vaccines and Diagnostics S.r.l. Separation of conjugated and unconjugated components
WO2011119759A1 (en) 2010-03-23 2011-09-29 Irm Llc Compounds (cystein based lipopeptides) and compositions as tlr2 agonists used for treating infections, inflammations, respiratory diseases etc.
EP2374473A1 (en) 2004-06-21 2011-10-12 Novartis Vaccines and Diagnostics S.r.l. Dimensional analysis of saccharide conjugates with GPC & SEC-MALS
EP2385127A1 (en) 2005-11-25 2011-11-09 Novartis Vaccines and Diagnostics S.r.l. Chimeric, hybrid and tandem polypeptides of meningococcal NMB1870
WO2011138636A1 (en) 2009-09-30 2011-11-10 Novartis Ag Conjugation of staphylococcus aureus type 5 and type 8 capsular polysaccharides
WO2011149564A1 (en) 2010-05-28 2011-12-01 Tetris Online, Inc. Interactive hybrid asynchronous computer game infrastructure
US8114960B2 (en) 2000-02-28 2012-02-14 Novartis Ag Heterologous expression of Neisserial proteins
WO2012020326A1 (en) 2010-03-18 2012-02-16 Novartis Ag Adjuvanted vaccines for serogroup b meningococcus
WO2012035519A1 (en) 2010-09-16 2012-03-22 Novartis Ag Immunogenic compositions
EP2462949A2 (en) 2007-10-19 2012-06-13 Novartis AG Meningococcal vaccine formulations
WO2012085668A2 (en) 2010-12-24 2012-06-28 Novartis Ag Compounds
US8273360B2 (en) * 2000-01-17 2012-09-25 Novartis Ag Outer membrane vesicle (OMV) vaccine comprising N. meningitidis serogroup B outer membrane proteins
US20120288517A1 (en) * 2010-03-30 2012-11-15 Beernink Peter T Factor H Binding Proteins (FHBP) with Altered Properties and Methods of Use Thereof
EP2537857A2 (en) 2007-12-21 2012-12-26 Novartis AG Mutant forms of streptolysin O
EP2548895A1 (en) 2007-01-11 2013-01-23 Novartis AG Modified saccharides
US8394390B2 (en) 1999-10-29 2013-03-12 Novartis Ag Neisserial antigenic peptides
US8409587B2 (en) 2002-11-01 2013-04-02 Glaxosmithkline Biologicals S.A. Immunogenic composition
EP2583678A2 (en) 2004-06-24 2013-04-24 Novartis Vaccines and Diagnostics, Inc. Small molecule immunopotentiators and assays for their detection
WO2013068949A1 (en) 2011-11-07 2013-05-16 Novartis Ag Carrier molecule comprising a spr0096 and a spr2021 antigen
EP2612679A1 (en) 2004-07-29 2013-07-10 Novartis Vaccines and Diagnostics, Inc. Immunogenic compositions for gram positive bacteria such as streptococcus agalactiae
US8524251B2 (en) 1998-05-01 2013-09-03 J. Craig Venter Institute, Inc. Neisseria meningitidis antigens and compositions
RU2494758C2 (ru) * 2002-08-02 2013-10-10 ГлаксоСмитКлайн Байолоджикалз с.а. Нейссериальные вакцинные композиции, содержащие комбинацию антигенов
US8574597B2 (en) 2006-12-22 2013-11-05 Wyeth Llc Immunogenic compositions for the prevention and treatment of meningococcal disease
EP2659912A2 (en) 2007-07-17 2013-11-06 Novartis AG Conjugate purification
WO2014122232A1 (en) * 2013-02-07 2014-08-14 Novartis Ag Pharmaceutical compositions comprising vesicles
US8834888B2 (en) 2009-03-24 2014-09-16 Novartis Ag Adjuvanting meningococcal factor H binding protein
US8980285B2 (en) 2000-07-27 2015-03-17 Children's Hospital & Research Center At Oakland Vaccines for broad spectrum protection against Neisseria meningitidis
US8986710B2 (en) 2012-03-09 2015-03-24 Pfizer Inc. Neisseria meningitidis compositions and methods thereof
EP2886551A2 (en) 2008-02-21 2015-06-24 Novartis AG Meningococcal fhbp polypeptides
US9169301B2 (en) 1999-04-30 2015-10-27 Glaxosmithkline Biologicals Sa Conserved Neisserial antigens
US20160303215A1 (en) * 2004-04-30 2016-10-20 Glaxosmithkline Biologicals Sa Integration of meningococcal conjugate vaccination
US9556240B2 (en) 2010-08-23 2017-01-31 Wyeth Llc Stable formulations of Neisseria meningitidis rLP2086 antigens
US9636393B2 (en) 1999-11-29 2017-05-02 Glaxosmithkline Biologicals Sa Compositions comprising Neisseria meningitidis antigens from serogroups B and C
US9757443B2 (en) 2010-09-10 2017-09-12 Wyeth Llc Non-lipidated variants of Neisseria meningitidis ORF2086 antigens
WO2017175082A1 (en) 2016-04-05 2017-10-12 Gsk Vaccines S.R.L. Immunogenic compositions
US9802987B2 (en) 2013-03-08 2017-10-31 Pfizer Inc. Immunogenic fusion polypeptides
US9822150B2 (en) 2013-09-08 2017-11-21 Pfizer Inc. Neisseria meningitidis compositions and methods thereof
US9855324B2 (en) 2012-10-03 2018-01-02 Glaxosmithkline Biologicals Sa Immunogenic compositions
US9914756B2 (en) 2013-08-02 2018-03-13 Children's Hospital & Research Center At Oakland Non-naturally occurring factor H binding proteins (fHbp) and methods of use thereof
US20180214531A1 (en) * 2014-07-17 2018-08-02 Glaxosmithkline Biologicals, Sa Meningococcus vaccines
US10179167B2 (en) 2010-09-10 2019-01-15 Glaxosmithkline Biologicals S.A. Developments in meningococcal outer membrane vesicles
US10183070B2 (en) 2017-01-31 2019-01-22 Pfizer Inc. Neisseria meningitidis compositions and methods thereof
US10196429B2 (en) 2012-03-09 2019-02-05 Pfizer Inc. Neisseria meningitidis composition and methods thereof
US10266572B2 (en) 2014-07-23 2019-04-23 Children's Hospital & Research Center At Oakland Factor H binding protein variants and methods of use thereof
EP3498302A1 (en) 2005-02-01 2019-06-19 Novartis Vaccines and Diagnostics S.r.l. Conjugation of streptococcal capsular saccharides to carrier proteins
US10376573B2 (en) 2012-06-14 2019-08-13 Glaxosmithkline Biologicals Sa Vaccines for serogroup X meningococcus
US10478483B2 (en) 2010-06-25 2019-11-19 Glaxosmithkline Biologicals Sa Combinations of meningococcal factor H binding proteins
EP3607967A1 (en) 2018-08-09 2020-02-12 GlaxoSmithKline Biologicals S.A. Modified meningococcal fhbp polypeptides
US10561720B2 (en) 2011-06-24 2020-02-18 EpitoGenesis, Inc. Pharmaceutical compositions, comprising a combination of select carriers, vitamins, tannins and flavonoids as antigen-specific immuno-modulators
US10888611B2 (en) 2015-02-19 2021-01-12 Pfizer Inc. Neisseria meningitidis compositions and methods thereof
EP3782643A1 (en) 2014-02-28 2021-02-24 GlaxoSmithKline Biologicals SA Modified meningococcal fhbp polypeptides
WO2023067086A1 (en) 2021-10-21 2023-04-27 Glaxosmithkline Biologicals Sa Methods to measure the concentration of aluminium hydroxide in menb vaccines
US11939357B2 (en) 2014-07-17 2024-03-26 Glaxosmithkline Biologicals Sa Modified meningococcal fHbp polypeptides
US12383611B2 (en) 2019-09-27 2025-08-12 Pfizer Inc. Neisseria meningitidis compositions and methods thereof

Families Citing this family (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20070026021A1 (en) * 1998-05-01 2007-02-01 Chiron S.R.I. Neisseria meningitidis antigens and compositions
GB9823978D0 (en) * 1998-11-02 1998-12-30 Microbiological Res Authority Multicomponent meningococcal vaccine
CA2371994C (en) * 1999-02-26 2010-09-28 Guido Grandi Enhancement of bactericidal activity of neisseria antigens with oligonucleotides containing cg motifs
GB0419408D0 (en) * 2004-09-01 2004-10-06 Chiron Srl 741 chimeric polypeptides
CA2695467A1 (en) * 2007-08-02 2009-03-26 Children's Hospital & Research Center At Oakland Fhbp- and lpxl1-based vesicle vaccines for broad spectrum protection against diseases caused by neisseria meningitidis
UA99659C2 (uk) * 2008-05-30 2012-09-10 Дзе Ю.Ес.Ей., Ес Репрезентед Бай Дзе Секретарі Оф Дзе Армі, Он Бехаф Оф Уолтер Рід Армі Мультивалентна вакцина з нативних везикул зовнішньої мембрани менінгококів, способи її застосування
WO2010027499A2 (en) * 2008-09-05 2010-03-11 University Of Massachusetts Medical School Methods, compositions and vaccines relating to neisseria meningitidis antibodies
WO2014016152A1 (en) 2012-07-27 2014-01-30 Institut National De La Sante Et De La Recherche Medicale Cd147 as receptor for pilus-mediated adhesion of meningococci to vascular endothelia
RU2563804C1 (ru) * 2014-05-30 2015-09-20 Общество с ограниченной ответственностью "НекстГен" Способ доставки нуклеиновых кислот в эукариотические клетки
WO2019018744A1 (en) 2017-07-21 2019-01-24 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services IMMUNOGENIC COMPOSITIONS OF NEISSERIA MENINGITIDIS
CA3083741A1 (en) * 2017-11-28 2019-06-19 The Research Foundation Of The State University Of New York Combined therapy and prophylaxis for genital tract infections
MX2023004729A (es) * 2020-10-23 2023-06-29 Omvax Inc Composiciones y metodos de vacunacion contra neisseria gonorrhoeae.
EP4735028A1 (en) 2023-06-30 2026-05-06 The United States of America, as represented by The Secretary, Department of Health and Human Services Genetically detoxified mutant of neisseria and outer membrane vesicle (omv) vaccine

Citations (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1995003413A1 (en) 1993-07-23 1995-02-02 The Rockefeller University High level expression, purification and refolding of the neisseria meningitidis outer membrane group b porin proteins
WO1996029412A1 (en) 1995-03-17 1996-09-26 Biochem Vaccines Inc. Proteinase k resistant surface protein of neisseria meningitidis
WO1999024578A2 (en) 1997-11-06 1999-05-20 Chiron S.P.A. Neisserial antigens
WO1999031132A1 (en) 1997-12-12 1999-06-24 The University Of Queensland NOVEL SURFACE PROTEIN OF $i(NEISSERIA MENINGITIDIS)
WO1999036544A2 (en) 1998-01-14 1999-07-22 Chiron S.P.A. Neisseria meningitidis antigens
WO1999055873A2 (en) 1998-04-24 1999-11-04 Smithkline Beecham Biologicals S.A. Basb006 polynucleotide(s) and polypeptides from neisseria meningitis
WO1999057280A2 (en) 1998-05-01 1999-11-11 Chiron Corporation Neisseria meningitidis antigens and compositions
WO1999061053A1 (en) * 1998-05-29 1999-12-02 Chiron Corporation Combination meningitidis b/c vaccines
WO2000066741A2 (en) 1999-04-30 2000-11-09 Chiron S.P.A. Conserved neisserial antigens

Family Cites Families (168)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US2386796A (en) 1942-08-05 1945-10-16 Bond Crown & Cork Co Extruding device
DE2848965A1 (de) 1978-11-11 1980-05-22 Behringwerke Ag Verfahren zur herstellung von membranproteinen aus neisseria meningitidis und diese enthaltende vaccine
DE2855719A1 (de) 1978-12-22 1980-07-10 Siemens Ag Zahnaerztliche handstueckanordnung
US4336336A (en) 1979-01-12 1982-06-22 President And Fellows Of Harvard College Fused gene and method of making and using same
AU545912B2 (en) 1980-03-10 1985-08-08 Cetus Corporation Cloned heterologous jive products in bacillies
ZA811368B (en) 1980-03-24 1982-04-28 Genentech Inc Bacterial polypedtide expression employing tryptophan promoter-operator
NZ199722A (en) 1981-02-25 1985-12-13 Genentech Inc Dna transfer vector for expression of exogenous polypeptide in yeast;transformed yeast strain
GR75411B (https=) 1981-04-29 1984-07-16 Biogen Nv
US4551433A (en) 1981-05-18 1985-11-05 Genentech, Inc. Microbial hybrid promoters
US4405712A (en) 1981-07-01 1983-09-20 The United States Of America As Represented By The Department Of Health And Human Services LTR-Vectors
US4769330A (en) 1981-12-24 1988-09-06 Health Research, Incorporated Modified vaccinia virus and methods for making and using the same
US4603112A (en) 1981-12-24 1986-07-29 Health Research, Incorporated Modified vaccinia virus
CA1341302C (en) 1983-02-22 2001-10-09 Rae Lyn Burke Yeast expression systems with vectors having gapdh or pyk promoters and synthesis of foreign protein
US4876197A (en) 1983-02-22 1989-10-24 Chiron Corporation Eukaryotic regulatable transcription
JPS59166086A (ja) 1983-03-09 1984-09-19 Teruhiko Beppu 新規な発現型プラスミドとそれらを用いて仔牛プロキモシン遺伝子を大腸菌内で発現させる方法
US4546083A (en) 1983-04-22 1985-10-08 Stolle Research & Development Corporation Method and device for cell culture growth
US4588684A (en) 1983-04-26 1986-05-13 Chiron Corporation a-Factor and its processing signals
JPS59205983A (ja) 1983-04-28 1984-11-21 ジエネツクス・コ−ポレイシヨン 異種遺伝子を原核微生物で発現させる方法
US4663280A (en) 1983-05-19 1987-05-05 Public Health Research Institute Of The City Of New York Expression and secretion vectors and method of constructing vectors
EP0127839B1 (en) 1983-05-27 1992-07-15 THE TEXAS A&M UNIVERSITY SYSTEM Method for producing a recombinant baculovirus expression vector
US4689406A (en) 1983-08-10 1987-08-25 Amgen Enhancement of microbial expression of polypeptides
US4870008A (en) 1983-08-12 1989-09-26 Chiron Corporation Secretory expression in eukaryotes
JPS6054685A (ja) 1983-09-02 1985-03-29 Suntory Ltd 改良発現ベクタ−およびその利用
EP0136907A3 (en) 1983-10-03 1986-12-30 Genentech, Inc. A xenogeneic expression control system, a method of using it, expression vectors containing it, cells transformed thereby and heterologous proteins produced therefrom
ZA848495B (en) 1984-01-31 1985-09-25 Idaho Res Found Production of polypeptides in insect cells
ATE102250T1 (de) 1984-05-11 1994-03-15 Chiron Corp Erhoehte hefetranskription unter verwendung einer hybridkonstruktion der promotorregion.
US4880734A (en) 1984-05-11 1989-11-14 Chiron Corporation Eukaryotic regulatable transcription
US5288641A (en) 1984-06-04 1994-02-22 Arch Development Corporation Herpes Simplex virus as a vector
CA1282721C (en) 1984-06-04 1991-04-09 Bernard Roizman Herpes simplex virus as a vector
US4738921A (en) 1984-09-27 1988-04-19 Eli Lilly And Company Derivative of the tryptophan operon for expression of fused gene products
US4745056A (en) 1984-10-23 1988-05-17 Biotechnica International, Inc. Streptomyces secretion vector
US4837148A (en) 1984-10-30 1989-06-06 Phillips Petroleum Company Autonomous replication sequences for yeast strains of the genus pichia
US4762915A (en) 1985-01-18 1988-08-09 Liposome Technology, Inc. Protein-liposome conjugates
US4797368A (en) 1985-03-15 1989-01-10 The United States Of America As Represented By The Department Of Health And Human Services Adeno-associated virus as eukaryotic expression vector
CA1260858A (en) 1985-03-28 1989-09-26 Lawrence S. Cousens Expression using fused genes providing for protein product
US4865974A (en) 1985-09-20 1989-09-12 Cetus Corporation Bacterial methionine N-terminal peptidase
US4777127A (en) 1985-09-30 1988-10-11 Labsystems Oy Human retrovirus-related products and methods of diagnosing and treating conditions associated with said retrovirus
JPS6296086A (ja) 1985-10-21 1987-05-02 Agency Of Ind Science & Technol 複合プラスミド
US5139941A (en) 1985-10-31 1992-08-18 University Of Florida Research Foundation, Inc. AAV transduction vectors
US5091309A (en) 1986-01-16 1992-02-25 Washington University Sindbis virus vectors
US4861719A (en) 1986-04-25 1989-08-29 Fred Hutchinson Cancer Research Center DNA constructs for retrovirus packaging cell lines
ES2061482T3 (es) 1986-05-02 1994-12-16 Gist Brocades Nv Metodo para la identificacion de secuencias de señal secretora para sintesis de proteina extracelular en bacillus.
ATE247708T1 (de) 1986-10-02 2003-09-15 Massachusetts Inst Technology Verfahren zur regulierung der metabolischen stabilität von proteinen
JPS63123383A (ja) 1986-11-11 1988-05-27 Mitsubishi Kasei Corp ハイブリツドプロモ−タ−、発現調節dna配列および発現ベクタ−
GB8702816D0 (en) 1987-02-07 1987-03-11 Al Sumidaie A M K Obtaining retrovirus-containing fraction
US5219740A (en) 1987-02-13 1993-06-15 Fred Hutchinson Cancer Research Center Retroviral gene transfer into diploid fibroblasts for gene therapy
CA1304020C (en) 1987-03-23 1992-06-23 Meher H. Irani High level expression in yeast
US4980289A (en) 1987-04-27 1990-12-25 Wisconsin Alumni Research Foundation Promoter deficient retroviral vector
WO1989001973A2 (en) 1987-09-02 1989-03-09 Applied Biotechnology, Inc. Recombinant pox virus for immunization against tumor-associated antigens
DK463887D0 (da) 1987-09-07 1987-09-07 Novo Industri As Gaerleader
ATE117375T1 (de) 1987-09-11 1995-02-15 Whitehead Biomedical Inst Transduktionsveränderte fibroblasten und ihre anwendung.
US4929555A (en) 1987-10-19 1990-05-29 Phillips Petroleum Company Pichia transformation
JPH02500880A (ja) 1987-11-18 1990-03-29 カイロン コーポレイション Nanbvの診断用薬およびワクチン
SE456639B (sv) 1987-11-27 1988-10-24 Golf Comback Ab C O Wiklund Golftraeningsanordning innefattande ett hus med lintrumma
WO1989005349A1 (en) 1987-12-09 1989-06-15 The Australian National University Method of combating viral infections
CA1340772C (en) 1987-12-30 1999-09-28 Patricia Tekamp-Olson Expression and secretion of heterologous protiens in yeast employing truncated alpha-factor leader sequences
US4973551A (en) 1988-01-15 1990-11-27 Merck & Co., Inc. Vector for the expression of fusion proteins and protein immunogens
US5591624A (en) 1988-03-21 1997-01-07 Chiron Viagene, Inc. Retroviral packaging cell lines
US5662896A (en) 1988-03-21 1997-09-02 Chiron Viagene, Inc. Compositions and methods for cancer immunotherapy
WO1989009271A1 (en) 1988-03-21 1989-10-05 Viagene, Inc. Recombinant retroviruses
US5206152A (en) 1988-04-08 1993-04-27 Arch Development Corporation Cloning and expression of early growth regulatory protein genes
US5422120A (en) 1988-05-30 1995-06-06 Depotech Corporation Heterovesicular liposomes
AP129A (en) 1988-06-03 1991-04-17 Smithkline Biologicals S A Expression of retrovirus gag protein eukaryotic cells
WO1990002806A1 (en) 1988-09-01 1990-03-22 Whitehead Institute For Biomedical Research Recombinant retroviruses with amphotropic and ecotropic host ranges
EP0449958B9 (en) * 1988-12-19 2003-05-28 American Cyanamid Company Meningococcal class 1 outer-membrane protein vaccine
US7118757B1 (en) * 1988-12-19 2006-10-10 Wyeth Holdings Corporation Meningococcal class 1 outer-membrane protein vaccine
US5217879A (en) 1989-01-12 1993-06-08 Washington University Infectious Sindbis virus vectors
WO1990007936A1 (en) 1989-01-23 1990-07-26 Chiron Corporation Recombinant therapies for infection and hyperproliferative disorders
JPH04503306A (ja) 1989-02-01 1992-06-18 ザ・ジェネラル・ホスピタル・コーポレーション 単純ヘルペスウイルス1型発現ベクター
JP3140757B2 (ja) 1989-02-06 2001-03-05 デイナ・フアーバー・キヤンサー・インステイテユート パッケージング欠陥hivプロウイルス、細胞系及びその使用
EP0388186A1 (en) 1989-03-17 1990-09-19 E.I. Du Pont De Nemours And Company External regulation of gene expression
CA2489769A1 (en) 1989-03-21 1990-10-04 Philip L. Felgner Expression of exogenous polynucleotide sequences in a vertebrate
US5703055A (en) 1989-03-21 1997-12-30 Wisconsin Alumni Research Foundation Generation of antibodies through lipid mediated DNA delivery
CA2017507C (en) 1989-05-25 1996-11-12 Gary Van Nest Adjuvant formulation comprising a submicron oil droplet emulsion
NL9021328A (nl) 1989-08-15 1992-06-01 Pasminco Australia Ltd Werkwijze en inrichting voor de absorptie van zinkdamp in gesmolten lood.
AU648261B2 (en) 1989-08-18 1994-04-21 Novartis Vaccines And Diagnostics, Inc. Recombinant retroviruses delivering vector constructs to target cells
US5585362A (en) 1989-08-22 1996-12-17 The Regents Of The University Of Michigan Adenovirus vectors for gene therapy
US5166057A (en) 1989-08-28 1992-11-24 The Mount Sinai School Of Medicine Of The City University Of New York Recombinant negative strand rna virus expression-systems
GB8919607D0 (en) 1989-08-30 1989-10-11 Wellcome Found Novel entities for cancer therapy
AU7007491A (en) 1990-02-02 1991-08-08 Schweiz. Serum- & Impfinstitut Bern Cdna corresponding to the genome of negative-strand rna viruses, and process for the production of infectious negative-strand rna viruses
ZA911974B (en) 1990-03-21 1994-08-22 Res Dev Foundation Heterovesicular liposomes
CA2039921A1 (en) 1990-04-16 1991-10-17 Xandra O. Breakefield Transfer and expression of gene sequences into central nervous system cells using herpes simplex virus mutants with deletions in genes for viral replication
WO1991018088A1 (en) 1990-05-23 1991-11-28 The United States Of America, Represented By The Secretary, United States Department Of Commerce Adeno-associated virus (aav)-based eucaryotic vectors
US5149655A (en) 1990-06-21 1992-09-22 Agracetus, Inc. Apparatus for genetic transformation
IE912559A1 (en) 1990-07-19 1992-01-29 Merck & Co Inc The class ii protein of the outer membrane of neisseria¹meningitidis, and vaccines containing same
EP0854193A1 (en) 1990-09-21 1998-07-22 Chiron Corporation Human retroviral packaging cell line
WO1992007945A1 (en) 1990-10-30 1992-05-14 Dana Farber Cancer Institute Cell type specific alteration of levels of gene products in neural cells
US5173414A (en) 1990-10-30 1992-12-22 Applied Immune Sciences, Inc. Production of recombinant adeno-associated virus vectors
SE9003978D0 (sv) 1990-12-13 1990-12-13 Henrik Garoff Dna expressionssystem baserade paa ett virus replikon
WO1992011033A1 (en) 1990-12-20 1992-07-09 Arch Development Corporation Control of gene expression by ionizing radiation
DE69233013T2 (de) 1991-08-20 2004-03-04 The Government Of The United States Of America As Represented By The Secretary Of National Institute Of Health, Office Of Technology Transfer Adenovirus vermittelter gentransfer in den gastrointestinaltrakt
FR2681786A1 (fr) 1991-09-27 1993-04-02 Centre Nat Rech Scient Vecteurs recombinants d'origine virale, leur procede d'obtention et leur utilisation pour l'expression de polypeptides dans des cellules musculaires.
IL103059A0 (en) 1991-09-30 1993-02-21 Boehringer Ingelheim Int Conjugates for introducing nucleic acid into higher eucaryotic cells
NZ244306A (en) 1991-09-30 1995-07-26 Boehringer Ingelheim Int Composition for introducing nucleic acid complexes into eucaryotic cells, complex containing nucleic acid and endosomolytic agent, peptide with endosomolytic domain and nucleic acid binding domain and preparation
US5252479A (en) 1991-11-08 1993-10-12 Research Corporation Technologies, Inc. Safe vector for gene therapy
WO1993010218A1 (en) 1991-11-14 1993-05-27 The United States Government As Represented By The Secretary Of The Department Of Health And Human Services Vectors including foreign genes and negative selective markers
GB9125623D0 (en) 1991-12-02 1992-01-29 Dynal As Cell modification
JPH07503372A (ja) 1992-01-23 1995-04-13 バイカル・インコーポレイテッド 生体外遺伝子導入
DE69333110T2 (de) 1992-03-02 2004-05-06 Chiron S.P.A. Mit dem cytotoxin von helicobacter pylori assoziiertes, immunodominantes antigen verwendbar in impfstoffen und zur diagnose
FR2688514A1 (fr) 1992-03-16 1993-09-17 Centre Nat Rech Scient Adenovirus recombinants defectifs exprimant des cytokines et medicaments antitumoraux les contenant.
EP0650370A4 (en) 1992-06-08 1995-11-22 Univ California METHODS AND COMPOSITIONS TARGETED ON SPECIFIC TISSUES.
CA2137361A1 (en) 1992-06-10 1993-12-23 W. French Anderson Vector particles resistant to inactivation by human serum
GB2269175A (en) 1992-07-31 1994-02-02 Imperial College Retroviral vectors
ATE404683T1 (de) 1992-09-25 2008-08-15 Aventis Pharma Sa Adenovirus vektoren für die übertragung fremder gene in zellen des zentralen nervensystems, insbesondere im gehirn
DE69333886T2 (de) 1992-11-18 2006-07-27 Arch Development Corp., Chicago Adenovirus-gelenkter Gen-Transfer zum Herz-und glattem vaskulären Muskel
WO1994012369A1 (en) 1992-12-02 1994-06-09 Corinna Morini Optical signalling device for vehicles and water-borne craft
EP1024198A3 (en) 1992-12-03 2002-05-29 Genzyme Corporation Pseudo-adenoviral vectors for the gene therapy of haemophiliae
US5478745A (en) 1992-12-04 1995-12-26 University Of Pittsburgh Recombinant viral vector system
US5348358A (en) 1993-02-22 1994-09-20 Selick David A Contact lens insertion tool
DE4311651A1 (de) 1993-04-08 1994-10-13 Boehringer Ingelheim Int Virus für den Transport von Fremd-DNA in höhere eukaryotische Zellen
PT695169E (pt) 1993-04-22 2003-04-30 Skyepharma Inc Lipossomas multivesiculares de ciclodextrina encapsulando compostos farmacologicos e metodos para a sua utilizacao
EP0624376B1 (en) * 1993-05-13 2000-03-15 American Cyanamid Company Preparation and uses of LOS-depleted outer membrane proteins of gram-negative cocci
EP0733122A4 (en) 1993-05-26 1998-06-10 Us Health FUSION PROTEINS CONTAINING REP VIRUS PROTEIN ASSOCIATED WITH ADENOVIRUS AND BACTERIAL PROTEIN
FR2705686B1 (fr) 1993-05-28 1995-08-18 Transgene Sa Nouveaux adénovirus défectifs et lignées de complémentation correspondantes.
EP0705344B8 (en) 1993-06-24 2006-05-10 Advec Inc. Adenovirus vectors for gene therapy
SK282843B6 (sk) 1993-07-13 2002-12-03 Rhone-Poulenc Rorer S. A. Defektný rekombinantný adenovírus a farmaceutický prostriedok s jeho obsahom
WO1995004139A1 (en) 1993-07-27 1995-02-09 The Wistar Institute Of Anatomy And Biology Modified dna virus vectors and uses therefor
US5631236A (en) 1993-08-26 1997-05-20 Baylor College Of Medicine Gene therapy for solid tumors, using a DNA sequence encoding HSV-Tk or VZV-Tk
US5362865A (en) 1993-09-02 1994-11-08 Monsanto Company Enhanced expression in plants using non-translated leader sequences
DK0814154T3 (da) 1993-09-15 2009-08-31 Novartis Vaccines & Diagnostic Rekombinante alfavirusvektorer
FR2710536B1 (fr) 1993-09-29 1995-12-22 Transgene Sa Usage anti-cancéreux d'un vecteur viral comportant un gène modulateur de la réponse immunitaire et/ou inflammatoire.
CA2171109A1 (en) 1993-10-01 1995-04-13 Zvi Ram Gene therapy of the nervous system
AU687117B2 (en) 1993-10-25 1998-02-19 Canji, Inc. Recombinant adenoviral vector and methods of use
AU686277B2 (en) 1993-11-16 1998-02-05 Pacira Pharmaceuticals, Inc. Vesicles with controlled release of actives
US5693506A (en) 1993-11-16 1997-12-02 The Regents Of The University Of California Process for protein production in plants
FR2712603B1 (fr) 1993-11-18 1996-02-09 Centre Nat Rech Scient Virus recombinants, préparation et utilisation en thérapie génique.
JPH07241786A (ja) 1994-03-08 1995-09-19 Fanuc Ltd 産業用ロボットの制御装置
US6780406B1 (en) 1994-03-21 2004-08-24 The Regents Of The University Of Michigan Inhibition of vascular smooth muscle cell proliferation administering a thymidine kinase gene
US7252989B1 (en) 1994-04-04 2007-08-07 Board Of Regents, The University Of Texas System Adenovirus supervector system
ATE173634T1 (de) 1994-04-20 1998-12-15 Us Army Impfstoff gegen gram-negative bakterielle infektionen
CA2189067A1 (en) 1994-04-28 1995-11-09 Gary J. Nabel Gene delivery vector using plasmid dna packaged into an adenovirus and a packaging cell line
DE69535669T2 (de) 1994-05-09 2008-12-04 Oxford Biomedica (Uk) Ltd. Retrovirale vektoren mit verminderter rekombinationsrate
ATE336587T1 (de) 1994-06-10 2006-09-15 Genvec Inc Adenoviren-vektor systeme und zelllinien
FR2723588B1 (fr) 1994-08-12 1996-09-20 Rhone Poulenc Rorer Sa Adenovirus comprenant un gene codant pour la glutathion peroxydase
US6180111B1 (en) 1995-05-18 2001-01-30 University Of Maryland Vaccine delivery system
JPH11505128A (ja) 1995-05-22 1999-05-18 カイロン コーポレイション キメラインテグラーゼタンパク質に媒介される真核生物ゲノム中へのベクター構築物の位置特異的組み込み
PL328096A1 (en) 1996-02-01 1999-01-04 North American Vaccine Expression of external membrane (mb3) protein of neisseria meningitidis of b group in yeasts and vaccines
US5753235A (en) 1996-02-15 1998-05-19 Heska Corporation Recombinant canine herpesviruses
DE19630390A1 (de) 1996-07-26 1998-01-29 Chiron Behring Gmbh & Co Proteine, insbesondere Membranproteine von Helicobacter pylori, ihre Herstellung und Verwendung
US6251433B1 (en) 1996-08-13 2001-06-26 Chiron Corporation Polycationic polymers
JP4150082B2 (ja) * 1996-08-27 2008-09-17 カイロン コーポレイション 独特の髄膜炎菌性bエピトープを規定するモノクローナル抗体およびワクチン組成物の調製におけるそれらの使用
GB9619185D0 (en) 1996-09-13 1996-10-23 Pest West Electronics Ltd Insect catching device
WO1998017805A2 (en) 1996-10-24 1998-04-30 THE GOVERNMENT OF THE UNITED STATES OF AMERICA, represented by THE SECRETARY, DEPARTMENT OF HEALTH AND HUMAN SERVICES, c/o Centers for Disease Control and Prevention, Technology Transfer Office Invasion associated genes from neisseria meningitidis serogroup b
US5980898A (en) 1996-11-14 1999-11-09 The United States Of America As Represented By The U.S. Army Medical Research & Material Command Adjuvant for transcutaneous immunization
CA2297072A1 (en) 1997-07-17 1999-01-28 Baxter Healthcare S.A. Immunogenic conjugates comprising a group b meningococcal porin and an h. influenzae polysaccharide
CA2311810A1 (en) 1997-11-28 1999-06-10 Steven Ray Molten metal filtration
GB9807721D0 (en) 1998-04-08 1998-06-10 Chiron Spa Antigen
US20070026021A1 (en) * 1998-05-01 2007-02-01 Chiron S.R.I. Neisseria meningitidis antigens and compositions
GB9810276D0 (en) 1998-05-13 1998-07-15 Smithkline Beecham Biolog Novel compounds
BR9914374A (pt) 1998-10-09 2002-09-17 Chiron Corp Sequências genÈmicas de neisseria e métodos para seu uso
GB9823978D0 (en) 1998-11-02 1998-12-30 Microbiological Res Authority Multicomponent meningococcal vaccine
ES2323845T3 (es) 1999-04-30 2009-07-27 Novartis Vaccines And Diagnostics, Inc. Secuencias genomicas de neisseria y procedimientos de uso.
JP2004508801A (ja) 1999-10-29 2004-03-25 カイロン ソチエタ ア レスポンサビリタ リミタータ ナイセリア抗原性ペプチド
AU1917501A (en) 1999-11-12 2001-06-06 University Of Iowa Research Foundation, The Control of neisserial membrane synthesis
PT2289545T (pt) * 2000-01-17 2016-09-06 Glaxosmithkline Biologicals Sa Vacina de omv suplementada contra meningococos
NZ521531A (en) 2000-02-28 2005-12-23 Chiron S Heterologous expression of neisserial proteins
ES2519440T3 (es) 2000-07-27 2014-11-07 Children's Hospital & Research Center At Oakland Vacunas para la protección de amplio espectro contra enfermedades causadas por Neisseria meningitidis
GB0121591D0 (en) 2001-09-06 2001-10-24 Chiron Spa Hybrid and tandem expression of neisserial proteins
MX339524B (es) 2001-10-11 2016-05-30 Wyeth Corp Composiciones inmunogenicas novedosas para la prevencion y tratamiento de enfermedad meningococica.
US7785608B2 (en) * 2002-08-30 2010-08-31 Wyeth Holdings Corporation Immunogenic compositions for the prevention and treatment of meningococcal disease
GB0220194D0 (en) 2002-08-30 2002-10-09 Chiron Spa Improved vesicles
HUE031886T2 (en) 2002-10-11 2017-08-28 Glaxosmithkline Biologicals Sa Polypeptide vaccines for extensive protection against hypervirulent meningococcal lines
GB0227346D0 (en) 2002-11-22 2002-12-31 Chiron Spa 741
EP2172213B1 (en) 2003-01-30 2013-04-03 Novartis AG Injectable vaccines against multiple meningococcal serogroups
GB0316560D0 (en) 2003-07-15 2003-08-20 Chiron Srl Vesicle filtration
NZ546430A (en) 2003-10-02 2009-04-30 Novartis Vaccines & Diagnostic Liquid vaccines for multiple meningococcal serogroups
GB0419408D0 (en) 2004-09-01 2004-10-06 Chiron Srl 741 chimeric polypeptides
WO2006081259A2 (en) 2005-01-27 2006-08-03 Children's Hospital & Research Center At Oakland Gna1870-based vesicle vaccines for broad spectrum protection against diseases caused by neisseria meningitidis

Patent Citations (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1995003413A1 (en) 1993-07-23 1995-02-02 The Rockefeller University High level expression, purification and refolding of the neisseria meningitidis outer membrane group b porin proteins
WO1996029412A1 (en) 1995-03-17 1996-09-26 Biochem Vaccines Inc. Proteinase k resistant surface protein of neisseria meningitidis
WO1999024578A2 (en) 1997-11-06 1999-05-20 Chiron S.P.A. Neisserial antigens
WO1999031132A1 (en) 1997-12-12 1999-06-24 The University Of Queensland NOVEL SURFACE PROTEIN OF $i(NEISSERIA MENINGITIDIS)
WO1999036544A2 (en) 1998-01-14 1999-07-22 Chiron S.P.A. Neisseria meningitidis antigens
WO1999055873A2 (en) 1998-04-24 1999-11-04 Smithkline Beecham Biologicals S.A. Basb006 polynucleotide(s) and polypeptides from neisseria meningitis
WO1999057280A2 (en) 1998-05-01 1999-11-11 Chiron Corporation Neisseria meningitidis antigens and compositions
WO1999061053A1 (en) * 1998-05-29 1999-12-02 Chiron Corporation Combination meningitidis b/c vaccines
WO2000066741A2 (en) 1999-04-30 2000-11-09 Chiron S.P.A. Conserved neisserial antigens

Non-Patent Citations (9)

* Cited by examiner, † Cited by third party
Title
BJUNE G ET AL: "EFFECT OF OUTER MEMBRANE VESICLE VACCINE AGAINST GROUP B MENINGOCOCCAL DISEASE IN NORWAY", LANCET THE,GB,LANCET LIMITED. LONDON, vol. 338, no. 8775, 2 October 1991 (1991-10-02), pages 1093 - 1096, XP000877154, ISSN: 0140-6736 *
CARTWRIGHT ET AL., VACCINE, vol. 17, 1999, pages 2612 - 2619
CLAASSEN ET AL., VACCINE, vol. 14, 1996, pages 1001 - 1008
CLAASSEN I ET AL: "Production, characterization and control of a Neisseria meningitidis hexavalent class 1 outer membrane protein containing vesicle vaccine.", VACCINE, (1996 JUL) 14 (10) 1001-8., XP004057632 *
MANNING D S ET AL: "OMP85 PROTEINS OF NEISSERIA GONORRHOEAE AND NEISSERIA MENINGITIDIS ARE SIMILAR TO HAEMOPHILUS INFLUENZAE D-15-AG AND PASTEURELLA MULTOCIDA OMA87", MICROBIAL PATHOGENESIS,US,ACADEMIC PRESS LIMITED, NEW YORK, NY, vol. 25, no. 1, 1998, pages 11 - 21, XP000857391, ISSN: 0882-4010 *
NASSIF X ET AL: "Roles of pilin and PilC in adhesion of Neisseria meningitidis to human epithelial and endothelial cells.", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA, (1994 APR 26) 91 (9) 3769-73., XP000996650 *
PEETERS C C A M ET AL: "Phase I clinical trial with a hexavalent PorA containing meningococcal outer membrane vesicle vaccine", VACCINE,GB,BUTTERWORTH SCIENTIFIC. GUILDFORD, vol. 14, no. 10, 1 July 1996 (1996-07-01), pages 1009 - 1015, XP004057633, ISSN: 0264-410X *
PEETERS ET AL., VACCINE, vol. 14, 1996, pages 1009
VAN DER LEY P ET AL: "Construction of Neisseria meningitidis strains carrying multiple chromosomal copies of the porA gene for use in the production of a multivalent outer membrane vesicle vaccine", VACCINE,BUTTERWORTH SCIENTIFIC. GUILDFORD,GB, vol. 13, no. 4, 1995, pages 401 - 407, XP004057740, ISSN: 0264-410X *

Cited By (246)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7901907B2 (en) 1996-01-04 2011-03-08 The Provost Fellows And Scholars Of The College Of The Holy And Undivided Trinity Of Queen Elizabeth Near Dublin Process for production of Helicobacter pylori bacterioferritin
US7763589B2 (en) 1996-09-17 2010-07-27 Novartis Vaccines And Diagnostics, Inc. Compositions and methods for treating intracellular diseases
US9249198B2 (en) 1998-05-01 2016-02-02 Glaxosmithkline Biologicals Sa Neisseria meningitidis antigens and compositions
US9139621B2 (en) 1998-05-01 2015-09-22 Glaxosmithkline Biologicals Sa Neisseria meningitidis antigens and compositions
US8524251B2 (en) 1998-05-01 2013-09-03 J. Craig Venter Institute, Inc. Neisseria meningitidis antigens and compositions
US9249196B2 (en) 1998-05-01 2016-02-02 Glaxosmithkline Biologicals Sa Neisseria meningitidis antigens and compositions
US9266929B2 (en) 1998-05-01 2016-02-23 Glaxosmithkline Biologicals Sa Neisseria meningitidis antigens and compositions
US10967045B2 (en) * 1998-11-02 2021-04-06 Secretary of State for Health and Social Care Multicomponent meningococcal vaccine
US20110033491A1 (en) * 1998-11-02 2011-02-10 Andrew Robinson Multicomponent meningococcal vaccine
US9169301B2 (en) 1999-04-30 2015-10-27 Glaxosmithkline Biologicals Sa Conserved Neisserial antigens
US9610342B2 (en) 1999-05-19 2017-04-04 Glaxosmithkline Biologicals Sa Combination neisserial compositions
US7862827B2 (en) 1999-05-19 2011-01-04 Novartis Vaccines And Diagnostics Srl Combination neisserial compositions
US9364528B1 (en) 1999-05-19 2016-06-14 Glaxosmithkline Biologicals Sa Combination neisserial compositions
US8734812B1 (en) 1999-10-29 2014-05-27 Novartis Ag Neisserial antigenic peptides
US9067987B2 (en) 1999-10-29 2015-06-30 Glaxosmithkline Biologicals Sa Neisserial antigenic peptides
US8394390B2 (en) 1999-10-29 2013-03-12 Novartis Ag Neisserial antigenic peptides
US9636393B2 (en) 1999-11-29 2017-05-02 Glaxosmithkline Biologicals Sa Compositions comprising Neisseria meningitidis antigens from serogroups B and C
US8273360B2 (en) * 2000-01-17 2012-09-25 Novartis Ag Outer membrane vesicle (OMV) vaccine comprising N. meningitidis serogroup B outer membrane proteins
US8114960B2 (en) 2000-02-28 2012-02-14 Novartis Ag Heterologous expression of Neisserial proteins
US8703914B2 (en) 2000-02-28 2014-04-22 Novartis Ag Heterologous expression of neisserial proteins
US9150898B2 (en) 2000-02-28 2015-10-06 Glaxosmithkline Biologicals Sa Heterologous expression of Neisserial proteins
US9267163B2 (en) 2000-02-28 2016-02-23 Glaxosmithkline Biologicals Sa Hybrid expression of neisserial proteins
US8980285B2 (en) 2000-07-27 2015-03-17 Children's Hospital & Research Center At Oakland Vaccines for broad spectrum protection against Neisseria meningitidis
WO2002009746A3 (en) * 2000-07-31 2002-06-13 Smithkline Beecham Biolog Vaccines comprising outer membrane vesciles from gram negative bacteria
EP2284181A1 (en) 2000-10-27 2011-02-16 Novartis Vaccines and Diagnostics S.r.l. Nucleic acids and proteins from streptococcus groups A and B
EP2284183A1 (en) 2000-10-27 2011-02-16 Novartis Vaccines and Diagnostics S.r.l. Nucleic acids and proteins from streptococcus groups A and B
EP2277895A1 (en) 2000-10-27 2011-01-26 Novartis Vaccines and Diagnostics S.r.l. Nucleic acids and proteins from streptococcus groups A & B
EP2284182A1 (en) 2000-10-27 2011-02-16 Novartis Vaccines and Diagnostics S.r.l. Nucleic acids and proteins from streptococcus groups A and B
EP2277896A1 (en) 2000-10-27 2011-01-26 Novartis Vaccines and Diagnostics S.r.l. Nucleic acids and proteins from streptococcus groups A & B
EP2896629A1 (en) 2000-10-27 2015-07-22 Novartis Vaccines and Diagnostics S.r.l. Nucleic acids and proteins from streptococcus group A & B
EP2277894A1 (en) 2000-10-27 2011-01-26 Novartis Vaccines and Diagnostics S.r.l. Nucleic acids and proteins from streptococcus groups A & B
EP2314697A1 (en) 2001-03-27 2011-04-27 Novartis Vaccines and Diagnostics S.r.l. Streptococcus pneumoniae proteins and nucleic acids
EP2278008A2 (en) 2001-03-27 2011-01-26 Novartis Vaccines and Diagnostics S.r.l. Streptococcus pneumoniae proteins and nucleic acids
EP2278010A1 (en) 2001-03-27 2011-01-26 Novartis Vaccines and Diagnostics S.r.l. Streptococcus pneumoniae proteins and nucleic acids
EP2270175A1 (en) 2001-03-27 2011-01-05 Novartis Vaccines and Diagnostics S.r.l. Streptococcus pneumoniae proteins and nucleic acids
EP2270177A1 (en) 2001-03-27 2011-01-05 Novartis Vaccines and Diagnostics S.r.l. Streptococcus pneumoniae proteins and nucleic acids
EP2270176A1 (en) 2001-03-27 2011-01-05 Novartis Vaccines and Diagnostics S.r.l. Streptococcus pneumoniae proteins and nucleic acids
EP2298796A2 (en) 2001-03-27 2011-03-23 Novartis Vaccines and Diagnostics S.r.l. Staphylococcus aureus proteins and nucleic acids
EP2278009A1 (en) 2001-03-27 2011-01-26 Novartis Vaccines and Diagnostics S.r.l. Streptococcus pneumoniae proteins and nucleic acids
EP2277536A2 (en) 2001-06-20 2011-01-26 Novartis AG Purification of bacterial capsular polysaccharides
EP2263688A1 (en) 2001-06-20 2010-12-22 Novartis AG Neisseria meningitidis combination vaccines
EP2277537A2 (en) 2001-06-20 2011-01-26 Novartis AG Neisseria meningitidis conjugate combination vaccine
EP2277539A2 (en) 2001-06-20 2011-01-26 Novartis AG Neisseria meningitidis conjugate combination vaccine
EP2255827A1 (en) 2001-07-26 2010-12-01 Novartis Vaccines and Diagnostics S.r.l. Vaccines comprising aluminium adjuvants and histidine
EP2168597A1 (en) 2001-07-26 2010-03-31 Novartis Vaccines and Diagnostics S.r.l. Vaccines comprising aluminium adjuvants and histidine
EP2266605A1 (en) 2001-07-26 2010-12-29 Novartis Vaccines and Diagnostics S.r.l. Vaccines comprising aluminium adjuvants and histidine
USRE45587E1 (en) 2001-07-26 2015-06-30 Glaxosmithkline Biologicals Sa Vaccines comprising aluminum adjuvants and histidine
EP2248822A2 (en) 2001-07-27 2010-11-10 Novartis Vaccines and Diagnostics S.r.l. Meningococcus adhesins
WO2003010194A3 (en) * 2001-07-27 2003-10-02 Chiron Srl Meningococcus adhesins nada, app and orf 40
US8840907B2 (en) 2001-09-06 2014-09-23 Novartis Vaccines And Diagnostics S.R.L. Isolated protein and compositions comprising the protein
US9011869B2 (en) 2001-09-06 2015-04-21 Glaxosmithkline Biologicals Sa Hybrid and tandem expression of Neisserial proteins
US8980277B2 (en) 2001-09-06 2015-03-17 Novartis Ag Hybrid and tandem expression of neisserial proteins
EP2327719A1 (en) 2001-09-06 2011-06-01 Novartis Vaccines and Diagnostics S.r.l. Hybrid and tandem expression of neisserial proteins
US9056075B2 (en) 2001-09-06 2015-06-16 Glaxosmithkline Biologicals Sa Methods of inducing an immune response with compositions comprising a Neisseria meningitidis 741 protein
EP2829549A2 (en) 2001-09-06 2015-01-28 Novartis Vaccines and Diagnostics S.r.l. Hybrid and tandem expression of neisserial derived proteins
EP2360176A2 (en) 2001-09-06 2011-08-24 Novartis Vaccines and Diagnostics S.r.l. Hybrid and tandem expression of neisserial derived proteins
US8563006B2 (en) 2001-10-11 2013-10-22 Wyeth Holdings Corporation Immunogenic compositions for the prevention and treatment of meningococcal disease
US8563007B1 (en) 2001-10-11 2013-10-22 Wyeth Holdings Corporation Immunogenic compositions for the prevention and treatment of meningococcal disease
EP2343308B1 (en) * 2001-10-11 2015-02-18 Wyeth Holdings LLC Novel immunogenic compositions for the prevention and treatment of meningococcal disease
EP2343308A2 (en) 2001-10-11 2011-07-13 Wyeth Holdings Corporation Novel immunogenic compositions for the prevention and treatment of meningococcal disease
US9107873B2 (en) 2001-10-11 2015-08-18 Wyeth Holdings Llc Immunogenic compositions for the prevention and treatment of meningococcal disease
US9757444B2 (en) 2001-10-11 2017-09-12 Wyeth Holdings Llc Immunogenic compositions for the prevention and treatment of meningococcal disease
US10300122B2 (en) 2001-10-11 2019-05-28 Wyeth Holdings Llc Immunogenic compositions for the prevention and treatment of meningococcal disease
US9132182B2 (en) 2001-10-11 2015-09-15 Wyeth Holdings Llc Immunogenic compositions for the prevention and treatment of meningococcal disease
US11116829B2 (en) 2001-10-11 2021-09-14 Wyeth Holdings Llc Immunogenic compositions for the prevention and treatment of meningococcal disease
US9168293B2 (en) 2001-10-11 2015-10-27 Wyeth Holdings Llc Immunogenic compositions for the prevention and treatment of meningococcal disease
JP2016165275A (ja) * 2001-10-11 2016-09-15 ワイス・ホールディングス・エルエルシー 髄膜炎性疾患の予防および治療のための新規免疫原性組成物
US9623101B2 (en) 2001-10-11 2017-04-18 Wyeth Holdings Llc Immunogenic compositions for the prevention and treatment of meningococcal disease
EP2335724A1 (en) 2001-12-12 2011-06-22 Novartis Vaccines and Diagnostics S.r.l. Immunisation against chlamydia trachomatis
EP2335723A1 (en) 2001-12-12 2011-06-22 Novartis Vaccines and Diagnostics S.r.l. Immunisation against chlamydia trachomatis
US7384645B2 (en) 2001-12-17 2008-06-10 Health Protection Agency Outer membrane vesicles from gram negative bacteria and use as a vaccine
EP1961427A3 (en) * 2002-08-02 2009-11-04 GlaxoSmithKline Biologicals S.A. Neisserial vaccine compositions comprising a combination of antigens
EP2258384A2 (en) 2002-08-02 2010-12-08 GlaxoSmithKline Biologicals S.A. Neisseria vaccine composition
JP2011051997A (ja) * 2002-08-02 2011-03-17 Glaxosmithkline Biologicals Sa ワクチン組成物
EP2255826A3 (en) * 2002-08-02 2012-03-28 GlaxoSmithKline Biologicals S.A. Neisserial vaccine compositions comprising a combination of antigens
DE20321889U1 (de) 2002-08-02 2012-03-12 Glaxosmithkline Biologicals S.A. Impfstoffzusammensetzung
AU2003250204B8 (en) * 2002-08-02 2008-07-10 Glaxosmithkline Biologicals S.A. Neisserial vaccine compositions comprising a combination of antigens
DE20321890U1 (de) 2002-08-02 2012-03-12 Glaxosmithkline Biologicals S.A. Impfstoffzusammensetzung
EP2255826A2 (en) 2002-08-02 2010-12-01 GlaxoSmithKline Biologicals S.A. Neisserial vaccine compositions comprising a combination of antigens
EP1524993A2 (en) 2002-08-02 2005-04-27 GlaxoSmithKline Biologicals S.A. Neisserial vaccine compositions comprising a combination of antigens
AU2003250204B2 (en) * 2002-08-02 2008-06-19 Glaxosmithkline Biologicals S.A. Neisserial vaccine compositions comprising a combination of antigens
AU2008202479B2 (en) * 2002-08-02 2011-09-22 Glaxosmithkline Biologicals S.A. Neisserial vaccine compositions comprising a combination of antigens
JP2006506467A (ja) * 2002-08-02 2006-02-23 グラクソスミスクライン バイオロジカルズ ソシエテ アノニム ワクチン組成物
JP2012107036A (ja) * 2002-08-02 2012-06-07 Glaxosmithkline Biologicals Sa ワクチン組成物
AU2008202479C1 (en) * 2002-08-02 2014-01-16 Glaxosmithkline Biologicals S.A. Neisserial vaccine compositions comprising a combination of antigens
RU2494758C2 (ru) * 2002-08-02 2013-10-10 ГлаксоСмитКлайн Байолоджикалз с.а. Нейссериальные вакцинные композиции, содержащие комбинацию антигенов
EP2258387A3 (en) * 2002-08-02 2011-10-19 GlaxoSmithKline Biologicals S.A. Neisseria vaccine composition
WO2004014418A3 (en) * 2002-08-02 2004-07-22 Glaxosmithkline Biolog Sa Neisserial vaccine compositions comprising a combination of antigens
EP2258386A3 (en) * 2002-08-02 2011-11-02 GlaxoSmithKline Biologicals S.A. Neisseria Vaccine composition
EP2258388A1 (en) 2002-08-30 2010-12-08 Novartis Vaccines and Diagnostics S.r.l. Improved bacterial outer membrane vesicles
EP2258389A1 (en) 2002-08-30 2010-12-08 Novartis Vaccines and Diagnostics S.r.l. Improved bacterial outer membrane vesicles
EP2258390A1 (en) 2002-08-30 2010-12-08 Novartis Vaccines and Diagnostics S.r.l. Improved bacterial outer membrane vesicles
EP2353608A1 (en) 2002-10-11 2011-08-10 Novartis Vaccines and Diagnostics S.r.l. Polypeptide-vaccines for broad protection against hypervirulent meningococcal lineages
EP2351579A1 (en) 2002-10-11 2011-08-03 Novartis Vaccines and Diagnostics S.r.l. Polypeptide vaccines for broad protection against hypervirulent meningococcal lineages
US8663656B2 (en) 2002-10-11 2014-03-04 Novartis Ag Polypeptide-vaccines for broad protection against hypervirulent meningococcal lineages
US8409587B2 (en) 2002-11-01 2013-04-02 Glaxosmithkline Biologicals S.A. Immunogenic composition
EP2279746A3 (en) * 2002-11-15 2011-05-25 Novartis Vaccines and Diagnostics S.r.l. Surface proteins in neisseria meningitidis
EP2279746A2 (en) 2002-11-15 2011-02-02 Novartis Vaccines and Diagnostics S.r.l. Surface proteins in neisseria meningitidis
WO2004046177A3 (en) * 2002-11-15 2004-12-29 Chiron Srl Unexpected surface proteins in neisseria meningitidis
JP2010162038A (ja) * 2002-11-22 2010-07-29 Chiron Srl 髄膜炎菌タンパク質nmb1870の複数の改変体
CN100381464C (zh) * 2002-11-22 2008-04-16 启龙有限公司 脑膜炎球菌蛋白nmb1870的多种变异体
EP2261239A2 (en) 2002-11-22 2010-12-15 Novartis Vaccines and Diagnostics S.r.l. Multiple variants of meningococcal protein NMB1870
EP2258717A2 (en) 2002-11-22 2010-12-08 Novartis Vaccines and Diagnostics S.r.l. Variant form of meningococcal NadA
AU2003288681B2 (en) * 2002-11-22 2009-06-04 Glaxosmithkline Biologicals S.A. Multiple variants of meningococcal protein NMB 1870
EP2258716A2 (en) 2002-11-22 2010-12-08 Novartis Vaccines and Diagnostics S.r.l. Multiple variants of meningococcal protein NMB1870
US8980286B2 (en) 2002-11-22 2015-03-17 Novartis Ag Multiple variants of meningococcal protein NBM1870
EP2261239A3 (en) * 2002-11-22 2011-01-19 Novartis Vaccines and Diagnostics S.r.l. Multiple variants of meningococcal protein NMB1870
JP4767540B2 (ja) * 2002-11-22 2011-09-07 ノバルティス ヴァクシンズ アンド ダイアグノスティクス エスアールエル 髄膜炎菌タンパク質nmb1870の複数の改変体
US10328142B2 (en) 2002-11-22 2019-06-25 Glaxosmithkline Biologicals Sa Multiple variants of meningococcal protein NMB1870
US9550814B2 (en) 2002-11-22 2017-01-24 Glaxosmithkline Biologicals Sa Multiple variants of meningococcal protein NMB1870
RU2336091C2 (ru) * 2002-11-22 2008-10-20 Новартис Вэксинес Энд Дайэгностикс С.Р.Л., Множественные варианты менингококкового белка nmb 1870
WO2004048404A3 (en) * 2002-11-22 2004-09-16 Chiron Srl Multiple variants of meningococcal protein nmb1870
EP2263687A1 (en) 2002-12-27 2010-12-22 Novartis Vaccines&Diagnostics, Inc. Immunogenic compositions containing phospholipid
EP2289546A2 (en) 2003-01-30 2011-03-02 Novartis Vaccines and Diagnostics S.r.l. Injectable vaccines against multiple meningococcal serogroups
EP2258365A1 (en) 2003-03-28 2010-12-08 Novartis Vaccines and Diagnostics, Inc. Use of organic compounds for immunopotentiation
EP2267005A1 (en) 2003-04-09 2010-12-29 Novartis Vaccines and Diagnostics S.r.l. ADP-ribosylating toxin from Listeria monocytogenes
EP2179729A1 (en) 2003-06-02 2010-04-28 Novartis Vaccines and Diagnostics, Inc. Immunogenic compositions based on microparticles comprising adsorbed toxoid and a polysaccharide-containing antigen
EP2267036A1 (en) 2003-10-02 2010-12-29 Novartis Vaccines and Diagnostics S.r.l. Hypo- and Hyper-Acetylated Meningococcal Capsular Saccharides
EP2290366A1 (en) 2004-03-17 2011-03-02 Novartis Vaccines and Diagnostics S.r.l. Analysis of saccharide vaccines without interference
WO2005102384A2 (en) 2004-04-22 2005-11-03 Chiron Srl Immunising against meningococcal serogroup y using proteins
US10195264B2 (en) 2004-04-22 2019-02-05 Glaxosmithkline Biologicals S.A. Immunising against meningococcal serogroup Y using proteins
US20160303215A1 (en) * 2004-04-30 2016-10-20 Glaxosmithkline Biologicals Sa Integration of meningococcal conjugate vaccination
US10064932B2 (en) * 2004-04-30 2018-09-04 Glaxosmithkline Biologicals S.A. Integration of meningococcal conjugate vaccination
EP2267035A2 (en) 2004-05-21 2010-12-29 Novartis Vaccines and Diagnostics S.r.l. Measuring Degree of Polymerisation for Meningococcal Capsular Saccharides that Contain Sialic Acid
EP2374473A1 (en) 2004-06-21 2011-10-12 Novartis Vaccines and Diagnostics S.r.l. Dimensional analysis of saccharide conjugates with GPC & SEC-MALS
EP2277595A2 (en) 2004-06-24 2011-01-26 Novartis Vaccines and Diagnostics, Inc. Compounds for immunopotentiation
EP2583678A2 (en) 2004-06-24 2013-04-24 Novartis Vaccines and Diagnostics, Inc. Small molecule immunopotentiators and assays for their detection
EP2612679A1 (en) 2004-07-29 2013-07-10 Novartis Vaccines and Diagnostics, Inc. Immunogenic compositions for gram positive bacteria such as streptococcus agalactiae
EP2279747A1 (en) 2004-10-29 2011-02-02 Novartis Vaccines and Diagnostics S.r.l. Immunogenic bacterial vesicles with outer membrane proteins
US10046043B2 (en) 2005-01-27 2018-08-14 Children's Hospital & Research Center At Oakland GNA1870-based vesicle vaccines for broad spectrum protection against diseases caused by Neisseria meningitidis
EP2682126A1 (en) * 2005-01-27 2014-01-08 Children's Hospital & Research Center at Oakland GNA1870-based vesicle vaccines for broad spectrum protection against diseases caused by Neisseria meningitidis
EP1855715A4 (en) * 2005-01-27 2009-06-17 Childrens Hosp & Res Ct Oak VESICULAR GNA1870 VACCINES PROVIDING BROAD SPECTRUM PROTECTION AGAINST DISEASES CAUSED BY NEISSERIA MENINGITIDIS
US11801293B2 (en) 2005-01-27 2023-10-31 Children's Hospital & Research Center At Oakland GNA1870-based vesicle vaccines for broad spectrum protection against diseases caused by Neisseria meningitidis
EP2433647A3 (en) * 2005-01-27 2012-06-06 Children's Hospital & Research Center at Oakland GNA1870-based vesicle vaccines for broad spectrum protection against diseases caused by Neisseria meningitidis
RU2432962C2 (ru) * 2005-01-27 2011-11-10 Чилдрен'З Хоспитал Энд Рисерч Сентер Эт Окленд Вакцины с использованием везикул на основе gna 1870 широкого спектра действия для профилактики заболеваний, вызываемых neisseria meningitidis
US10857221B2 (en) 2005-01-27 2020-12-08 Children's Hospital & Research Center At Oakland GNA1870-based vesicle vaccines for broad spectrum protection against diseases caused by Neisseria meningitidis
US9034345B2 (en) 2005-01-27 2015-05-19 Children's Hospital & Research Center Oakland GNA1870-based vesicle vaccines for broad spectrum protection against diseases caused by Neisseria meningitidis
US10478484B2 (en) 2005-01-27 2019-11-19 Children's Hospital & Research Center At Oakland GNA1870-based vesicle vaccines for broad spectrum protection against diseases caused by Neisseria meningitidis
US9452208B2 (en) 2005-01-27 2016-09-27 Children's Hospital & Research Center Oakland GNA1870-based vesicle vaccines for broad spectrum protection against diseases caused by Neisseria meningitidis
US8968748B2 (en) 2005-01-27 2015-03-03 Children's Hospital & Research Center Oakland GNA1870-based vesicle vaccines for broad spectrum protection against diseases caused by Neisseria meningitidis
EP3498302A1 (en) 2005-02-01 2019-06-19 Novartis Vaccines and Diagnostics S.r.l. Conjugation of streptococcal capsular saccharides to carrier proteins
EP2270056A2 (en) 2005-02-01 2011-01-05 Novartis Vaccines and Diagnostics S.r.l. Purification of streptococcal capsular polysaccharide
EP2357000A1 (en) 2005-10-18 2011-08-17 Novartis Vaccines and Diagnostics, Inc. Mucosal and systemic immunizations with alphavirus replicon particles
EP2360175A2 (en) 2005-11-22 2011-08-24 Novartis Vaccines and Diagnostics, Inc. Norovirus and Sapovirus virus-like particles (VLPs)
EP2385127A1 (en) 2005-11-25 2011-11-09 Novartis Vaccines and Diagnostics S.r.l. Chimeric, hybrid and tandem polypeptides of meningococcal NMB1870
EP2385126A1 (en) 2005-11-25 2011-11-09 Novartis Vaccines and Diagnostics S.r.l. Chimeric, hybrid and tandem polypeptides of meningococcal NMB1870
US9156894B2 (en) 2005-11-25 2015-10-13 Glaxosmithkline Biologicals Sa Chimeric, hybrid and tandem polypeptides of meningococcal NMB1870
EP2363709A1 (en) 2006-03-22 2011-09-07 Novartis Vaccines and Diagnostics S.r.l. Separation of conjugated and unconjugated components
EP2357184A1 (en) 2006-03-23 2011-08-17 Novartis AG Imidazoquinoxaline compounds as immunomodulators
US8574597B2 (en) 2006-12-22 2013-11-05 Wyeth Llc Immunogenic compositions for the prevention and treatment of meningococcal disease
EP2548895A1 (en) 2007-01-11 2013-01-23 Novartis AG Modified saccharides
US9463250B2 (en) 2007-07-17 2016-10-11 Glaxosmithkline Biologicals Sa Conjugate purification
EP2659912A2 (en) 2007-07-17 2013-11-06 Novartis AG Conjugate purification
WO2009034473A2 (en) 2007-09-12 2009-03-19 Novartis Ag Gas57 mutant antigens and gas57 antibodies
EP2462949A2 (en) 2007-10-19 2012-06-13 Novartis AG Meningococcal vaccine formulations
EP2537857A2 (en) 2007-12-21 2012-12-26 Novartis AG Mutant forms of streptolysin O
US9468673B2 (en) 2008-02-21 2016-10-18 Glaxosmithkline Biologicals Sa Meningococcal fHBP polypeptides
US9579372B2 (en) 2008-02-21 2017-02-28 Glaxosmithkline Biologicals Sa Meningococcal fHBP polypeptides
EP3263591A1 (en) 2008-02-21 2018-01-03 GlaxoSmithKline Biologicals S.A. Meningococcal fhbp polypeptides
EP2886551A2 (en) 2008-02-21 2015-06-24 Novartis AG Meningococcal fhbp polypeptides
WO2009111337A1 (en) 2008-03-03 2009-09-11 Irm Llc Compounds and compositions as tlr activity modulators
WO2010049806A1 (en) 2008-10-27 2010-05-06 Novartis Ag Purification method
WO2010067202A2 (en) 2008-12-11 2010-06-17 Novartis Ag Mixing lyophilised meningococcal vaccines with non-hib vaccines
WO2010070453A3 (en) * 2008-12-17 2010-08-19 Novartis Ag Meningococcal vaccines including hemoglobin receptor
WO2010070453A2 (en) 2008-12-17 2010-06-24 Novartis Ag Meningococcal vaccines including hemoglobin receptor
US8425922B2 (en) 2009-01-05 2013-04-23 EpitoGenesis, Inc. Adjuvant compositions and methods of use
WO2010078556A1 (en) 2009-01-05 2010-07-08 Epitogenesis Inc. Adjuvant compositions and methods of use
US9180184B2 (en) 2009-01-05 2015-11-10 EpitoGenesis, Inc. Adjuvant compositions and methods of use
WO2010079464A1 (en) 2009-01-12 2010-07-15 Novartis Ag Cna_b domain antigens in vaccines against gram positive bacteria
US9572884B2 (en) 2009-03-24 2017-02-21 Glaxosmithkline Biologicals Sa Adjuvanting meningococcal factor H binding protein
US10245311B2 (en) 2009-03-24 2019-04-02 Glaxosmithkline Biologicals Sa Adjuvanting meningococcal factor H binding protein
US8834888B2 (en) 2009-03-24 2014-09-16 Novartis Ag Adjuvanting meningococcal factor H binding protein
US10568953B2 (en) 2009-03-24 2020-02-25 Glaxosmithkline Biologicals Sa Adjuvanting meningococcal factor H binding protein
WO2011024072A2 (en) 2009-08-27 2011-03-03 Novartis Ag Hybrid polypeptides including meningococcal fhbp sequences
EP3017828A1 (en) 2009-08-27 2016-05-11 GlaxoSmithKline Biologicals SA Hybrid polypeptides including meningococcal fhbp sequences
WO2011024071A1 (en) 2009-08-27 2011-03-03 Novartis Ag Adjuvant comprising aluminium, oligonucleotide and polycation
WO2011027222A2 (en) 2009-09-02 2011-03-10 Novartis Ag Immunogenic compositions including tlr activity modulators
WO2011049677A1 (en) 2009-09-02 2011-04-28 Irm Llc Compounds and compositions as tlr activity modulators
WO2011039631A2 (en) 2009-09-30 2011-04-07 Novartis Ag Expression of meningococcal fhbp polypeptides
WO2011138636A1 (en) 2009-09-30 2011-11-10 Novartis Ag Conjugation of staphylococcus aureus type 5 and type 8 capsular polysaccharides
WO2011051893A1 (en) 2009-10-27 2011-05-05 Novartis Ag Modified meningococcal fhbp polypeptides
EP3199177A1 (en) 2009-10-30 2017-08-02 GlaxoSmithKline Biologicals S.A. Purification of staphylococcus aureus type 5 and type 8 capsular saccharides
WO2011051917A1 (en) 2009-10-30 2011-05-05 Novartis Ag Purification of staphylococcus aureus type 5 and type 8 capsular saccharides
WO2011057148A1 (en) 2009-11-05 2011-05-12 Irm Llc Compounds and compositions as tlr-7 activity modulators
US9408907B2 (en) 2009-12-15 2016-08-09 Glaxosmithkline Biologicals Sa Homogenous suspension of immunopotentiating compounds and uses thereof
US10046048B2 (en) 2009-12-15 2018-08-14 Glaxosmithkline Biologicals S.A. Homogenous suspension of immunopotentiating compounds and uses thereof
WO2011084549A1 (en) 2009-12-15 2011-07-14 Novartis Ag Homogeneous suspension of immunopotentiating compounds and uses thereof
WO2012020326A1 (en) 2010-03-18 2012-02-16 Novartis Ag Adjuvanted vaccines for serogroup b meningococcus
WO2011119759A1 (en) 2010-03-23 2011-09-29 Irm Llc Compounds (cystein based lipopeptides) and compositions as tlr2 agonists used for treating infections, inflammations, respiratory diseases etc.
US10905754B2 (en) 2010-03-30 2021-02-02 Children's Hospital & Research Center At Oakland Factor H binding proteins (fHbp) with altered properties and methods of use thereof
US10342860B2 (en) 2010-03-30 2019-07-09 Children's Hospital & Research Center At Oakland Factor H binding proteins (FHBP) with altered properties and methods of use thereof
US9439957B2 (en) * 2010-03-30 2016-09-13 Children's Hospital & Research Center Oakland Factor H binding proteins (FHBP) with altered properties and methods of use thereof
US20120288517A1 (en) * 2010-03-30 2012-11-15 Beernink Peter T Factor H Binding Proteins (FHBP) with Altered Properties and Methods of Use Thereof
US9827300B2 (en) 2010-03-30 2017-11-28 Children's Hospital & Research Center Oakland Factor H binding proteins (FHBP) with altered properties and methods of use thereof
WO2011149564A1 (en) 2010-05-28 2011-12-01 Tetris Online, Inc. Interactive hybrid asynchronous computer game infrastructure
US10478483B2 (en) 2010-06-25 2019-11-19 Glaxosmithkline Biologicals Sa Combinations of meningococcal factor H binding proteins
US9556240B2 (en) 2010-08-23 2017-01-31 Wyeth Llc Stable formulations of Neisseria meningitidis rLP2086 antigens
US9757443B2 (en) 2010-09-10 2017-09-12 Wyeth Llc Non-lipidated variants of Neisseria meningitidis ORF2086 antigens
US10179167B2 (en) 2010-09-10 2019-01-15 Glaxosmithkline Biologicals S.A. Developments in meningococcal outer membrane vesicles
US10512681B2 (en) 2010-09-10 2019-12-24 Wyeth Llc Non-lipidated variants of Neisseria meningitidis ORF2086 antigens
US11077180B2 (en) 2010-09-10 2021-08-03 Wyeth Llc Non-lipidated variants of Neisseria meningitidis ORF2086 antigens
WO2012035519A1 (en) 2010-09-16 2012-03-22 Novartis Ag Immunogenic compositions
WO2012085668A2 (en) 2010-12-24 2012-06-28 Novartis Ag Compounds
US10561720B2 (en) 2011-06-24 2020-02-18 EpitoGenesis, Inc. Pharmaceutical compositions, comprising a combination of select carriers, vitamins, tannins and flavonoids as antigen-specific immuno-modulators
WO2013068949A1 (en) 2011-11-07 2013-05-16 Novartis Ag Carrier molecule comprising a spr0096 and a spr2021 antigen
US11472850B2 (en) 2012-03-09 2022-10-18 Pfizer Inc. Neisseria meningitidis composition and methods thereof
US9561269B2 (en) 2012-03-09 2017-02-07 Pfizer Inc. Neisseria meningitidis compositions and methods thereof
US10196429B2 (en) 2012-03-09 2019-02-05 Pfizer Inc. Neisseria meningitidis composition and methods thereof
US8986710B2 (en) 2012-03-09 2015-03-24 Pfizer Inc. Neisseria meningitidis compositions and methods thereof
US10550159B2 (en) 2012-03-09 2020-02-04 Pfizer Inc. Neisseria meningitidis composition and methods thereof
US9724402B2 (en) 2012-03-09 2017-08-08 Pfizer Inc. Neisseria meningitidis composition and methods thereof
US10829521B2 (en) 2012-03-09 2020-11-10 Pfizer Inc. Neisseria meningitidis composition and methods thereof
US10376573B2 (en) 2012-06-14 2019-08-13 Glaxosmithkline Biologicals Sa Vaccines for serogroup X meningococcus
US9855324B2 (en) 2012-10-03 2018-01-02 Glaxosmithkline Biologicals Sa Immunogenic compositions
CN105163724A (zh) * 2013-02-07 2015-12-16 葛兰素史密丝克莱恩生物有限公司 包含囊泡的药物组合物
WO2014122232A1 (en) * 2013-02-07 2014-08-14 Novartis Ag Pharmaceutical compositions comprising vesicles
US9802987B2 (en) 2013-03-08 2017-10-31 Pfizer Inc. Immunogenic fusion polypeptides
US9914756B2 (en) 2013-08-02 2018-03-13 Children's Hospital & Research Center At Oakland Non-naturally occurring factor H binding proteins (fHbp) and methods of use thereof
US10899802B2 (en) 2013-09-08 2021-01-26 Pfizer Inc. Neisseria meningitidis compositions and methods thereof
US9822150B2 (en) 2013-09-08 2017-11-21 Pfizer Inc. Neisseria meningitidis compositions and methods thereof
US11680087B2 (en) 2013-09-08 2023-06-20 Pfizer Inc. Neisseria meningitidis compositions and methods thereof
US12415838B2 (en) 2014-02-28 2025-09-16 Glaxosmithkline Biologicals Sa Modified meningococcal fHbp polypeptides
EP3782643A1 (en) 2014-02-28 2021-02-24 GlaxoSmithKline Biologicals SA Modified meningococcal fhbp polypeptides
US11932671B2 (en) 2014-02-28 2024-03-19 Glaxosmithkline Biologicals Sa Modified meningococcal fHbp polypeptides
US20180214531A1 (en) * 2014-07-17 2018-08-02 Glaxosmithkline Biologicals, Sa Meningococcus vaccines
US11707513B2 (en) * 2014-07-17 2023-07-25 Glaxosmithkline Biologicals Sa Meningococcus vaccines
US12485164B2 (en) 2014-07-17 2025-12-02 Glaxosmithkline Biologicals Sa Meningococcus vaccines
US11939357B2 (en) 2014-07-17 2024-03-26 Glaxosmithkline Biologicals Sa Modified meningococcal fHbp polypeptides
US11834476B2 (en) 2014-07-23 2023-12-05 Children's Hospital & Research Center At Oakland Factor H binding protein variants and methods of use thereof
US10995122B2 (en) 2014-07-23 2021-05-04 Children's Hospital & Research Center At Oakland Factor H binding protein variants and methods of use thereof
US10487122B2 (en) 2014-07-23 2019-11-26 Children's Hospital & Research Center At Oakland Factor H binding protein variants and methods of use thereof
US12269849B2 (en) 2014-07-23 2025-04-08 Children's Hospital & Research Center At Oakland Factor H binding protein variants and methods of use thereof
US12129282B2 (en) 2014-07-23 2024-10-29 Children's Hospital & Research Center At Oakland Factor H binding protein variants and methods of use thereof
US11673920B2 (en) 2014-07-23 2023-06-13 Children's Hospital & Research Center At Oakland Factor H binding protein variants and methods of use thereof
US10266572B2 (en) 2014-07-23 2019-04-23 Children's Hospital & Research Center At Oakland Factor H binding protein variants and methods of use thereof
US10836799B2 (en) 2014-07-23 2020-11-17 Children's Hospital & Research Center At Oakland Factor H binding protein variants and methods of use thereof
US10888611B2 (en) 2015-02-19 2021-01-12 Pfizer Inc. Neisseria meningitidis compositions and methods thereof
WO2017175082A1 (en) 2016-04-05 2017-10-12 Gsk Vaccines S.R.L. Immunogenic compositions
US10183070B2 (en) 2017-01-31 2019-01-22 Pfizer Inc. Neisseria meningitidis compositions and methods thereof
US10813989B2 (en) 2017-01-31 2020-10-27 Pfizer Inc. Neisseria meningitidis compositions and methods thereof
US11730800B2 (en) 2017-01-31 2023-08-22 Pfizer Inc. Neisseria meningitidis compositions and methods thereof
US10543267B2 (en) 2017-01-31 2020-01-28 Pfizer Inc. Neisseria meningitidis compositions and methods thereof
EP3607967A1 (en) 2018-08-09 2020-02-12 GlaxoSmithKline Biologicals S.A. Modified meningococcal fhbp polypeptides
WO2020030782A1 (en) 2018-08-09 2020-02-13 Glaxosmithkline Biologicals Sa Modified meningococcal fhbp polypeptides
US12383611B2 (en) 2019-09-27 2025-08-12 Pfizer Inc. Neisseria meningitidis compositions and methods thereof
WO2023067086A1 (en) 2021-10-21 2023-04-27 Glaxosmithkline Biologicals Sa Methods to measure the concentration of aluminium hydroxide in menb vaccines

Also Published As

Publication number Publication date
EP1897555A2 (en) 2008-03-12
CN1416352A (zh) 2003-05-07
AU2875401A (en) 2001-07-31
PT1897555E (pt) 2014-10-10
DK2289545T3 (en) 2016-09-05
EP2281570A3 (en) 2012-05-09
RU2279889C2 (ru) 2006-07-20
AU2009200692A1 (en) 2009-03-19
EP2289545A2 (en) 2011-03-02
JP2013181036A (ja) 2013-09-12
BRPI0107679B1 (pt) 2018-03-13
CY1111056T1 (el) 2015-06-11
JP2013181035A (ja) 2013-09-12
AU784518B2 (en) 2006-04-27
DK1897555T3 (da) 2014-10-13
BRPI0107679B8 (pt) 2021-05-25
JP2015193652A (ja) 2015-11-05
CA2871789C (en) 2017-04-04
EP2275129A3 (en) 2013-11-06
JP2013181037A (ja) 2013-09-12
PT2289545T (pt) 2016-09-06
AU2009200692B2 (en) 2011-04-14
US20160030546A1 (en) 2016-02-04
DE60142772D1 (de) 2010-09-23
CY1117957T1 (el) 2017-05-17
CY1115842T1 (el) 2017-01-25
EP2289545A3 (en) 2012-05-09
EP2289545B1 (en) 2016-06-08
CA2397508C (en) 2015-11-24
EP1248647B1 (en) 2010-08-11
CN1416352B (zh) 2011-05-25
BR0107679A (pt) 2004-07-06
CA2871789A1 (en) 2001-07-26
EP2275129A2 (en) 2011-01-19
EP1897555A3 (en) 2010-03-10
EP1248647A1 (en) 2002-10-16
ATE476988T1 (de) 2010-08-15
US8273360B2 (en) 2012-09-25
EP1897555B1 (en) 2014-07-16
JP2011116793A (ja) 2011-06-16
JP5823446B2 (ja) 2015-11-25
US20160082098A1 (en) 2016-03-24
JP2003520248A (ja) 2003-07-02
US20040249125A1 (en) 2004-12-09
EP2281570A2 (en) 2011-02-09
NZ520466A (en) 2003-09-26
EP2281571A3 (en) 2012-04-25
ES2588917T3 (es) 2016-11-07
RU2002122111A (ru) 2004-03-10
CA2397508A1 (en) 2001-07-26
PT1248647E (pt) 2010-11-18
DK1248647T3 (da) 2010-09-27
MXPA02006962A (es) 2002-12-13
ES2507100T3 (es) 2014-10-14
EP2281571A2 (en) 2011-02-09
CN102172398A (zh) 2011-09-07
US20120328643A1 (en) 2012-12-27

Similar Documents

Publication Publication Date Title
EP1248647B1 (en) Outer membrane vesicle (omv) vaccine comprising n. meningitidis serogroup b outer membrane proteins
US9169301B2 (en) Conserved Neisserial antigens
AU2006200732B2 (en) Outer membrane vesicle (OMV) vaccine comprising N. meningitidis serogroup B outer membrane proteins
ES2348657T3 (es) Vacuna de vesicula de membrana externa (omv) que comprende proteinas de membrana externa del serogrupo b de n. meningitidis.

Legal Events

Date Code Title Description
AK Designated states

Kind code of ref document: A1

Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BY BZ CA CH CN CR CU CZ DE DK DM DZ EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT TZ UA UG US UZ VN YU ZA ZW

AL Designated countries for regional patents

Kind code of ref document: A1

Designated state(s): GH GM KE LS MW MZ SD SL SZ TZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE TR BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG

121 Ep: the epo has been informed by wipo that ep was designated in this application
DFPE Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101)
WWE Wipo information: entry into national phase

Ref document number: 2001942562

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2397508

Country of ref document: CA

ENP Entry into the national phase

Ref country code: JP

Ref document number: 2001 552932

Kind code of ref document: A

Format of ref document f/p: F

WWE Wipo information: entry into national phase

Ref document number: PA/a/2002/006962

Country of ref document: MX

WWE Wipo information: entry into national phase

Ref document number: 10181600

Country of ref document: US

WWE Wipo information: entry into national phase

Ref document number: 28754/01

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 520466

Country of ref document: NZ

ENP Entry into the national phase

Ref country code: RU

Ref document number: 2002 2002122111

Kind code of ref document: A

Format of ref document f/p: F

WWE Wipo information: entry into national phase

Ref document number: 018059201

Country of ref document: CN

WWP Wipo information: published in national office

Ref document number: 2001942562

Country of ref document: EP

REG Reference to national code

Ref country code: DE

Ref legal event code: 8642

WWP Wipo information: published in national office

Ref document number: 520466

Country of ref document: NZ

WWG Wipo information: grant in national office

Ref document number: 520466

Country of ref document: NZ