US20070154992A1 - Compositions and methods for the preparation of protease resistant human growth hormone glycosylation mutants - Google Patents
Compositions and methods for the preparation of protease resistant human growth hormone glycosylation mutants Download PDFInfo
- Publication number
- US20070154992A1 US20070154992A1 US11/402,105 US40210506A US2007154992A1 US 20070154992 A1 US20070154992 A1 US 20070154992A1 US 40210506 A US40210506 A US 40210506A US 2007154992 A1 US2007154992 A1 US 2007154992A1
- Authority
- US
- United States
- Prior art keywords
- growth hormone
- human growth
- amino acid
- mutant
- seq
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 108010000521 Human Growth Hormone Proteins 0.000 title claims abstract description 392
- 102000002265 Human Growth Hormone Human genes 0.000 title claims abstract description 371
- 239000000854 Human Growth Hormone Substances 0.000 title claims abstract description 362
- 238000000034 method Methods 0.000 title claims abstract description 209
- 230000013595 glycosylation Effects 0.000 title claims abstract description 58
- 238000006206 glycosylation reaction Methods 0.000 title claims abstract description 56
- 108091005804 Peptidases Proteins 0.000 title claims abstract description 48
- 239000004365 Protease Substances 0.000 title claims abstract description 47
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 title claims abstract 8
- 239000000203 mixture Substances 0.000 title description 30
- 238000002360 preparation method Methods 0.000 title description 8
- 230000035772 mutation Effects 0.000 claims abstract description 82
- 230000004989 O-glycosylation Effects 0.000 claims abstract description 55
- 230000017854 proteolysis Effects 0.000 claims abstract description 46
- 230000004988 N-glycosylation Effects 0.000 claims abstract description 45
- 230000014509 gene expression Effects 0.000 claims abstract description 29
- 102000040430 polynucleotide Human genes 0.000 claims abstract description 21
- 108091033319 polynucleotide Proteins 0.000 claims abstract description 21
- 239000002157 polynucleotide Substances 0.000 claims abstract description 21
- 239000008194 pharmaceutical composition Substances 0.000 claims abstract description 4
- -1 poly(ethylene glycol) Polymers 0.000 claims description 256
- 235000000346 sugar Nutrition 0.000 claims description 192
- 229920001223 polyethylene glycol Polymers 0.000 claims description 169
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 107
- 150000001413 amino acids Chemical class 0.000 claims description 73
- 102000004190 Enzymes Human genes 0.000 claims description 72
- 108090000790 Enzymes Proteins 0.000 claims description 72
- 150000007523 nucleic acids Chemical class 0.000 claims description 50
- 229920003169 water-soluble polymer Polymers 0.000 claims description 46
- 102000039446 nucleic acids Human genes 0.000 claims description 45
- 108020004707 nucleic acids Proteins 0.000 claims description 45
- 125000002519 galactosyl group Chemical group C1([C@H](O)[C@@H](O)[C@@H](O)[C@H](O1)CO)* 0.000 claims description 31
- 125000000539 amino acid group Chemical group 0.000 claims description 29
- 239000000758 substrate Substances 0.000 claims description 22
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 claims description 18
- 238000012546 transfer Methods 0.000 claims description 18
- 125000005629 sialic acid group Chemical group 0.000 claims description 17
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 claims description 16
- 125000001500 prolyl group Chemical group [H]N1C([H])(C(=O)[*])C([H])([H])C([H])([H])C1([H])[H] 0.000 claims description 13
- 239000004473 Threonine Substances 0.000 claims description 10
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 claims description 9
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 claims description 9
- 239000003937 drug carrier Substances 0.000 claims description 4
- 230000009469 supplementation Effects 0.000 claims 1
- 108090000765 processed proteins & peptides Proteins 0.000 abstract description 272
- 102000004196 processed proteins & peptides Human genes 0.000 abstract description 101
- 229920001184 polypeptide Polymers 0.000 abstract description 40
- 125000005647 linker group Chemical group 0.000 description 135
- 125000003147 glycosyl group Chemical group 0.000 description 131
- 239000002202 Polyethylene glycol Substances 0.000 description 116
- 239000000562 conjugate Substances 0.000 description 102
- 108090000623 proteins and genes Proteins 0.000 description 97
- 102000004169 proteins and genes Human genes 0.000 description 79
- 235000018102 proteins Nutrition 0.000 description 76
- 108700023372 Glycosyltransferases Proteins 0.000 description 73
- 235000001014 amino acid Nutrition 0.000 description 72
- 229940088598 enzyme Drugs 0.000 description 72
- 229940024606 amino acid Drugs 0.000 description 71
- 229920000642 polymer Polymers 0.000 description 61
- 210000004027 cell Anatomy 0.000 description 55
- 241000894007 species Species 0.000 description 46
- 230000001225 therapeutic effect Effects 0.000 description 43
- 239000000370 acceptor Substances 0.000 description 42
- 102000035195 Peptidases Human genes 0.000 description 40
- 239000000126 substance Substances 0.000 description 40
- 108010015899 Glycopeptides Proteins 0.000 description 39
- 102000002068 Glycopeptides Human genes 0.000 description 39
- 125000000217 alkyl group Chemical group 0.000 description 39
- 239000002773 nucleotide Substances 0.000 description 39
- 150000008163 sugars Chemical class 0.000 description 39
- SQVRNKJHWKZAKO-OQPLDHBCSA-N sialic acid Chemical compound CC(=O)N[C@@H]1[C@@H](O)C[C@@](O)(C(O)=O)OC1[C@H](O)[C@H](O)CO SQVRNKJHWKZAKO-OQPLDHBCSA-N 0.000 description 37
- 108700014210 glycosyltransferase activity proteins Proteins 0.000 description 36
- 238000006243 chemical reaction Methods 0.000 description 35
- 235000019419 proteases Nutrition 0.000 description 34
- SQVRNKJHWKZAKO-UHFFFAOYSA-N beta-N-Acetyl-D-neuraminic acid Natural products CC(=O)NC1C(O)CC(O)(C(O)=O)OC1C(O)C(O)CO SQVRNKJHWKZAKO-UHFFFAOYSA-N 0.000 description 33
- 102000045442 glycosyltransferase activity proteins Human genes 0.000 description 33
- 102000003838 Sialyltransferases Human genes 0.000 description 32
- 108090000141 Sialyltransferases Proteins 0.000 description 32
- 125000003729 nucleotide group Chemical group 0.000 description 31
- 102000051366 Glycosyltransferases Human genes 0.000 description 30
- 150000001720 carbohydrates Chemical class 0.000 description 30
- 125000003118 aryl group Chemical group 0.000 description 26
- 230000002255 enzymatic effect Effects 0.000 description 26
- 125000004404 heteroalkyl group Chemical group 0.000 description 26
- 238000007792 addition Methods 0.000 description 25
- 125000000837 carbohydrate group Chemical group 0.000 description 25
- 150000001875 compounds Chemical class 0.000 description 23
- 230000006320 pegylation Effects 0.000 description 23
- DQJCDTNMLBYVAY-ZXXIYAEKSA-N (2S,5R,10R,13R)-16-{[(2R,3S,4R,5R)-3-{[(2S,3R,4R,5S,6R)-3-acetamido-4,5-dihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy}-5-(ethylamino)-6-hydroxy-2-(hydroxymethyl)oxan-4-yl]oxy}-5-(4-aminobutyl)-10-carbamoyl-2,13-dimethyl-4,7,12,15-tetraoxo-3,6,11,14-tetraazaheptadecan-1-oic acid Chemical compound NCCCC[C@H](C(=O)N[C@@H](C)C(O)=O)NC(=O)CC[C@H](C(N)=O)NC(=O)[C@@H](C)NC(=O)C(C)O[C@@H]1[C@@H](NCC)C(O)O[C@H](CO)[C@H]1O[C@H]1[C@H](NC(C)=O)[C@@H](O)[C@H](O)[C@@H](CO)O1 DQJCDTNMLBYVAY-ZXXIYAEKSA-N 0.000 description 22
- 239000003814 drug Substances 0.000 description 22
- 125000000524 functional group Chemical group 0.000 description 22
- 238000000746 purification Methods 0.000 description 22
- 125000001424 substituent group Chemical group 0.000 description 22
- 108020004414 DNA Proteins 0.000 description 21
- 102000053602 DNA Human genes 0.000 description 21
- 239000000863 peptide conjugate Substances 0.000 description 20
- 230000015572 biosynthetic process Effects 0.000 description 19
- 239000003795 chemical substances by application Substances 0.000 description 19
- 230000021615 conjugation Effects 0.000 description 19
- 230000002401 inhibitory effect Effects 0.000 description 19
- 229920001577 copolymer Polymers 0.000 description 18
- 230000004048 modification Effects 0.000 description 18
- 238000012986 modification Methods 0.000 description 18
- 210000001519 tissue Anatomy 0.000 description 18
- 239000000386 donor Substances 0.000 description 17
- 150000002482 oligosaccharides Chemical class 0.000 description 17
- 238000003786 synthesis reaction Methods 0.000 description 17
- 239000002253 acid Substances 0.000 description 16
- 239000000122 growth hormone Substances 0.000 description 16
- 239000002243 precursor Substances 0.000 description 16
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 16
- 241000700159 Rattus Species 0.000 description 15
- 150000001412 amines Chemical class 0.000 description 15
- 210000004369 blood Anatomy 0.000 description 15
- 239000008280 blood Substances 0.000 description 15
- 201000010099 disease Diseases 0.000 description 15
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 15
- 239000012634 fragment Substances 0.000 description 15
- 239000012528 membrane Substances 0.000 description 15
- 235000004400 serine Nutrition 0.000 description 15
- 230000008685 targeting Effects 0.000 description 15
- 108010019236 Fucosyltransferases Proteins 0.000 description 14
- 102000006471 Fucosyltransferases Human genes 0.000 description 14
- 150000004676 glycans Chemical class 0.000 description 14
- 125000001072 heteroaryl group Chemical group 0.000 description 14
- 229910001868 water Inorganic materials 0.000 description 14
- 108060003306 Galactosyltransferase Proteins 0.000 description 13
- 102000030902 Galactosyltransferase Human genes 0.000 description 13
- WQZGKKKJIJFFOK-PHYPRBDBSA-N alpha-D-galactose Chemical group OC[C@H]1O[C@H](O)[C@H](O)[C@@H](O)[C@H]1O WQZGKKKJIJFFOK-PHYPRBDBSA-N 0.000 description 13
- 125000001360 methionine group Chemical group N[C@@H](CCSC)C(=O)* 0.000 description 13
- 238000006467 substitution reaction Methods 0.000 description 13
- 235000014633 carbohydrates Nutrition 0.000 description 12
- 238000004587 chromatography analysis Methods 0.000 description 12
- 150000002148 esters Chemical group 0.000 description 12
- 239000000047 product Substances 0.000 description 12
- 150000003254 radicals Chemical class 0.000 description 12
- 235000002639 sodium chloride Nutrition 0.000 description 12
- 108020004705 Codon Proteins 0.000 description 11
- 108010031186 Glycoside Hydrolases Proteins 0.000 description 11
- 102000005744 Glycoside Hydrolases Human genes 0.000 description 11
- 102000018997 Growth Hormone Human genes 0.000 description 11
- 108010051696 Growth Hormone Proteins 0.000 description 11
- 102000004357 Transferases Human genes 0.000 description 11
- 108090000992 Transferases Proteins 0.000 description 11
- 229940079593 drug Drugs 0.000 description 11
- 125000005842 heteroatom Chemical group 0.000 description 11
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 11
- 238000004519 manufacturing process Methods 0.000 description 11
- 125000001570 methylene group Chemical group [H]C([H])([*:1])[*:2] 0.000 description 11
- 229920001542 oligosaccharide Polymers 0.000 description 11
- 229910052760 oxygen Inorganic materials 0.000 description 11
- 229920001451 polypropylene glycol Polymers 0.000 description 11
- 229910052717 sulfur Inorganic materials 0.000 description 11
- 241000588724 Escherichia coli Species 0.000 description 10
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 10
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 10
- 229910052799 carbon Inorganic materials 0.000 description 10
- 230000000694 effects Effects 0.000 description 10
- 238000001727 in vivo Methods 0.000 description 10
- 229930182817 methionine Chemical group 0.000 description 10
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 10
- 238000002703 mutagenesis Methods 0.000 description 10
- 231100000350 mutagenesis Toxicity 0.000 description 10
- 239000011541 reaction mixture Substances 0.000 description 10
- 150000003839 salts Chemical class 0.000 description 10
- 229920003176 water-insoluble polymer Polymers 0.000 description 10
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical group OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 description 9
- 102000003886 Glycoproteins Human genes 0.000 description 9
- 108090000288 Glycoproteins Proteins 0.000 description 9
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 9
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical group CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 9
- 108010057005 beta-galactoside alpha-2,3-sialyltransferase Proteins 0.000 description 9
- 239000000872 buffer Substances 0.000 description 9
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 9
- 238000003776 cleavage reaction Methods 0.000 description 9
- 239000002299 complementary DNA Substances 0.000 description 9
- 235000018417 cysteine Nutrition 0.000 description 9
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 9
- 239000000017 hydrogel Substances 0.000 description 9
- 230000001976 improved effect Effects 0.000 description 9
- 210000003000 inclusion body Anatomy 0.000 description 9
- 229910052757 nitrogen Inorganic materials 0.000 description 9
- 230000008569 process Effects 0.000 description 9
- 230000007017 scission Effects 0.000 description 9
- 238000007920 subcutaneous administration Methods 0.000 description 9
- TXCIAUNLDRJGJZ-UHFFFAOYSA-N CMP-N-acetyl neuraminic acid Natural products O1C(C(O)C(O)CO)C(NC(=O)C)C(O)CC1(C(O)=O)OP(O)(=O)OCC1C(O)C(O)C(N2C(N=C(N)C=C2)=O)O1 TXCIAUNLDRJGJZ-UHFFFAOYSA-N 0.000 description 8
- 102100029962 CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase Human genes 0.000 description 8
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 8
- 241000238631 Hexapoda Species 0.000 description 8
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 8
- WBSCNDJQPKSPII-KKUMJFAQSA-N Lys-Lys-Lys Chemical compound NCCCC[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(O)=O WBSCNDJQPKSPII-KKUMJFAQSA-N 0.000 description 8
- 239000004472 Lysine Substances 0.000 description 8
- 108010087568 Mannosyltransferases Proteins 0.000 description 8
- 102000006722 Mannosyltransferases Human genes 0.000 description 8
- 229920002684 Sepharose Polymers 0.000 description 8
- 150000001408 amides Chemical class 0.000 description 8
- 230000001580 bacterial effect Effects 0.000 description 8
- 125000004432 carbon atom Chemical group C* 0.000 description 8
- 102000037865 fusion proteins Human genes 0.000 description 8
- 108020001507 fusion proteins Proteins 0.000 description 8
- 239000000499 gel Substances 0.000 description 8
- 125000000592 heterocycloalkyl group Chemical group 0.000 description 8
- 235000018977 lysine Nutrition 0.000 description 8
- 125000000311 mannosyl group Chemical group C1([C@@H](O)[C@@H](O)[C@H](O)[C@H](O1)CO)* 0.000 description 8
- 239000000463 material Substances 0.000 description 8
- 230000003647 oxidation Effects 0.000 description 8
- 238000007254 oxidation reaction Methods 0.000 description 8
- 229920001282 polysaccharide Polymers 0.000 description 8
- 230000002829 reductive effect Effects 0.000 description 8
- 238000010561 standard procedure Methods 0.000 description 8
- 238000011282 treatment Methods 0.000 description 8
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 7
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 7
- 241000894006 Bacteria Species 0.000 description 7
- TXCIAUNLDRJGJZ-BILDWYJOSA-N CMP-N-acetyl-beta-neuraminic acid Chemical compound O1[C@@H]([C@H](O)[C@H](O)CO)[C@H](NC(=O)C)[C@@H](O)C[C@]1(C(O)=O)OP(O)(=O)OC[C@@H]1[C@@H](O)[C@@H](O)[C@H](N2C(N=C(N)C=C2)=O)O1 TXCIAUNLDRJGJZ-BILDWYJOSA-N 0.000 description 7
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical group OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 7
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 7
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 7
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 7
- HSCJRCZFDFQWRP-UHFFFAOYSA-N Uridindiphosphoglukose Natural products OC1C(O)C(O)C(CO)OC1OP(O)(=O)OP(O)(=O)OCC1C(O)C(O)C(N2C(NC(=O)C=C2)=O)O1 HSCJRCZFDFQWRP-UHFFFAOYSA-N 0.000 description 7
- 125000003277 amino group Chemical group 0.000 description 7
- 235000009582 asparagine Nutrition 0.000 description 7
- 229960001230 asparagine Drugs 0.000 description 7
- 230000008859 change Effects 0.000 description 7
- 125000000753 cycloalkyl group Chemical group 0.000 description 7
- 229930182830 galactose Natural products 0.000 description 7
- 229910052736 halogen Inorganic materials 0.000 description 7
- 150000002632 lipids Chemical class 0.000 description 7
- 239000005017 polysaccharide Substances 0.000 description 7
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 7
- 108020003175 receptors Proteins 0.000 description 7
- 102000005962 receptors Human genes 0.000 description 7
- 238000004007 reversed phase HPLC Methods 0.000 description 7
- 210000002966 serum Anatomy 0.000 description 7
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 6
- 108091026890 Coding region Proteins 0.000 description 6
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 6
- 108010046220 N-Acetylgalactosaminyltransferases Proteins 0.000 description 6
- 102000007524 N-Acetylgalactosaminyltransferases Human genes 0.000 description 6
- 206010028980 Neoplasm Diseases 0.000 description 6
- 108091028043 Nucleic acid sequence Proteins 0.000 description 6
- 229920000954 Polyglycolide Polymers 0.000 description 6
- 102000004338 Transferrin Human genes 0.000 description 6
- 108090000901 Transferrin Proteins 0.000 description 6
- 125000002947 alkylene group Chemical group 0.000 description 6
- BFNBIHQBYMNNAN-UHFFFAOYSA-N ammonium sulfate Chemical group N.N.OS(O)(=O)=O BFNBIHQBYMNNAN-UHFFFAOYSA-N 0.000 description 6
- 239000000427 antigen Substances 0.000 description 6
- 108091007433 antigens Proteins 0.000 description 6
- 102000036639 antigens Human genes 0.000 description 6
- 239000002585 base Substances 0.000 description 6
- 230000001588 bifunctional effect Effects 0.000 description 6
- 230000027455 binding Effects 0.000 description 6
- 210000004556 brain Anatomy 0.000 description 6
- 230000006870 function Effects 0.000 description 6
- 230000002209 hydrophobic effect Effects 0.000 description 6
- 230000005847 immunogenicity Effects 0.000 description 6
- 238000010324 immunological assay Methods 0.000 description 6
- 238000007634 remodeling Methods 0.000 description 6
- 238000012552 review Methods 0.000 description 6
- 230000009450 sialylation Effects 0.000 description 6
- 239000002904 solvent Substances 0.000 description 6
- 229920001059 synthetic polymer Polymers 0.000 description 6
- 239000012581 transferrin Substances 0.000 description 6
- 239000013598 vector Substances 0.000 description 6
- 125000004169 (C1-C6) alkyl group Chemical group 0.000 description 5
- 108010088751 Albumins Proteins 0.000 description 5
- 102000009027 Albumins Human genes 0.000 description 5
- BVKZGUZCCUSVTD-UHFFFAOYSA-L Carbonate Chemical class [O-]C([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-L 0.000 description 5
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 5
- 101000599951 Homo sapiens Insulin-like growth factor I Proteins 0.000 description 5
- 102100037852 Insulin-like growth factor I Human genes 0.000 description 5
- SHZGCJCMOBCMKK-DHVFOXMCSA-N L-fucopyranose Chemical group C[C@@H]1OC(O)[C@@H](O)[C@H](O)[C@@H]1O SHZGCJCMOBCMKK-DHVFOXMCSA-N 0.000 description 5
- NVGBPTNZLWRQSY-UWVGGRQHSA-N Lys-Lys Chemical compound NCCCC[C@H](N)C(=O)N[C@H](C(O)=O)CCCCN NVGBPTNZLWRQSY-UWVGGRQHSA-N 0.000 description 5
- OVRNDRQMDRJTHS-CBQIKETKSA-N N-Acetyl-D-Galactosamine Chemical group CC(=O)N[C@H]1[C@@H](O)O[C@H](CO)[C@H](O)[C@@H]1O OVRNDRQMDRJTHS-CBQIKETKSA-N 0.000 description 5
- OVRNDRQMDRJTHS-UHFFFAOYSA-N N-acelyl-D-glucosamine Chemical group CC(=O)NC1C(O)OC(CO)C(O)C1O OVRNDRQMDRJTHS-UHFFFAOYSA-N 0.000 description 5
- MBLBDJOUHNCFQT-UHFFFAOYSA-N N-acetyl-D-galactosamine Chemical group CC(=O)NC(C=O)C(O)C(O)C(O)CO MBLBDJOUHNCFQT-UHFFFAOYSA-N 0.000 description 5
- OVRNDRQMDRJTHS-FMDGEEDCSA-N N-acetyl-beta-D-glucosamine Chemical group CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O OVRNDRQMDRJTHS-FMDGEEDCSA-N 0.000 description 5
- MBLBDJOUHNCFQT-LXGUWJNJSA-N N-acetylglucosamine Chemical group CC(=O)N[C@@H](C=O)[C@@H](O)[C@H](O)[C@H](O)CO MBLBDJOUHNCFQT-LXGUWJNJSA-N 0.000 description 5
- 241000588650 Neisseria meningitidis Species 0.000 description 5
- HSCJRCZFDFQWRP-ABVWGUQPSA-N UDP-alpha-D-galactose Chemical group O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@@H]1OP(O)(=O)OP(O)(=O)OC[C@@H]1[C@@H](O)[C@@H](O)[C@H](N2C(NC(=O)C=C2)=O)O1 HSCJRCZFDFQWRP-ABVWGUQPSA-N 0.000 description 5
- 150000007513 acids Chemical class 0.000 description 5
- 230000009471 action Effects 0.000 description 5
- 229910052921 ammonium sulfate Inorganic materials 0.000 description 5
- 235000011130 ammonium sulphate Nutrition 0.000 description 5
- 238000003556 assay Methods 0.000 description 5
- WQZGKKKJIJFFOK-FPRJBGLDSA-N beta-D-galactose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@H]1O WQZGKKKJIJFFOK-FPRJBGLDSA-N 0.000 description 5
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 5
- 230000004071 biological effect Effects 0.000 description 5
- 229920001400 block copolymer Polymers 0.000 description 5
- 150000001732 carboxylic acid derivatives Chemical group 0.000 description 5
- 230000015556 catabolic process Effects 0.000 description 5
- 230000003197 catalytic effect Effects 0.000 description 5
- 230000000295 complement effect Effects 0.000 description 5
- 238000006731 degradation reaction Methods 0.000 description 5
- 239000013604 expression vector Substances 0.000 description 5
- 239000008103 glucose Substances 0.000 description 5
- 229930182470 glycoside Natural products 0.000 description 5
- 150000002367 halogens Chemical class 0.000 description 5
- 125000004474 heteroalkylene group Chemical group 0.000 description 5
- 229910052739 hydrogen Inorganic materials 0.000 description 5
- 239000001257 hydrogen Substances 0.000 description 5
- 108010054155 lysyllysine Proteins 0.000 description 5
- 210000004962 mammalian cell Anatomy 0.000 description 5
- 108020004999 messenger RNA Proteins 0.000 description 5
- 210000000865 mononuclear phagocyte system Anatomy 0.000 description 5
- 229950006780 n-acetylglucosamine Drugs 0.000 description 5
- 239000008188 pellet Substances 0.000 description 5
- 210000001322 periplasm Anatomy 0.000 description 5
- 229920000570 polyether Polymers 0.000 description 5
- 238000003752 polymerase chain reaction Methods 0.000 description 5
- 239000002244 precipitate Substances 0.000 description 5
- 230000002285 radioactive effect Effects 0.000 description 5
- 229920002477 rna polymer Polymers 0.000 description 5
- 239000000523 sample Substances 0.000 description 5
- 238000000926 separation method Methods 0.000 description 5
- 125000005630 sialyl group Chemical group 0.000 description 5
- 238000001542 size-exclusion chromatography Methods 0.000 description 5
- 208000024891 symptom Diseases 0.000 description 5
- 125000000341 threoninyl group Chemical group [H]OC([H])(C([H])([H])[H])C([H])(N([H])[H])C(*)=O 0.000 description 5
- 102100029945 Beta-galactoside alpha-2,6-sialyltransferase 1 Human genes 0.000 description 4
- SHZGCJCMOBCMKK-UHFFFAOYSA-N D-mannomethylose Chemical group CC1OC(O)C(O)C(O)C1O SHZGCJCMOBCMKK-UHFFFAOYSA-N 0.000 description 4
- 241000196324 Embryophyta Species 0.000 description 4
- 102000003951 Erythropoietin Human genes 0.000 description 4
- 108090000394 Erythropoietin Proteins 0.000 description 4
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 4
- JOYRKODLDBILNP-UHFFFAOYSA-N Ethyl urethane Chemical compound CCOC(N)=O JOYRKODLDBILNP-UHFFFAOYSA-N 0.000 description 4
- LQEBEXMHBLQMDB-UHFFFAOYSA-N GDP-L-fucose Natural products OC1C(O)C(O)C(C)OC1OP(O)(=O)OP(O)(=O)OCC1C(O)C(O)C(N2C3=C(C(N=C(N)N3)=O)N=C2)O1 LQEBEXMHBLQMDB-UHFFFAOYSA-N 0.000 description 4
- LQEBEXMHBLQMDB-JGQUBWHWSA-N GDP-beta-L-fucose Chemical compound O[C@H]1[C@H](O)[C@H](O)[C@H](C)O[C@@H]1OP(O)(=O)OP(O)(=O)OC[C@@H]1[C@@H](O)[C@@H](O)[C@H](N2C3=C(C(NC(N)=N3)=O)N=C2)O1 LQEBEXMHBLQMDB-JGQUBWHWSA-N 0.000 description 4
- 239000004471 Glycine Substances 0.000 description 4
- 102000004457 Granulocyte-Macrophage Colony-Stimulating Factor Human genes 0.000 description 4
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 4
- 206010056438 Growth hormone deficiency Diseases 0.000 description 4
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 4
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 4
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 4
- 241001465754 Metazoa Species 0.000 description 4
- 241001529936 Murinae Species 0.000 description 4
- 241000588652 Neisseria gonorrhoeae Species 0.000 description 4
- 108091005461 Nucleic proteins Proteins 0.000 description 4
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 4
- 241000293869 Salmonella enterica subsp. enterica serovar Typhimurium Species 0.000 description 4
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 4
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 4
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 4
- 230000004913 activation Effects 0.000 description 4
- 235000004279 alanine Nutrition 0.000 description 4
- 238000013459 approach Methods 0.000 description 4
- 125000004429 atom Chemical group 0.000 description 4
- 230000008901 benefit Effects 0.000 description 4
- MSWZFWKMSRAUBD-UHFFFAOYSA-N beta-D-galactosamine Natural products NC1C(O)OC(CO)C(O)C1O MSWZFWKMSRAUBD-UHFFFAOYSA-N 0.000 description 4
- 108010064886 beta-D-galactoside alpha 2-6-sialyltransferase Proteins 0.000 description 4
- 201000011510 cancer Diseases 0.000 description 4
- 239000000969 carrier Substances 0.000 description 4
- 230000001268 conjugating effect Effects 0.000 description 4
- 230000008878 coupling Effects 0.000 description 4
- 238000010168 coupling process Methods 0.000 description 4
- 238000005859 coupling reaction Methods 0.000 description 4
- 230000022811 deglycosylation Effects 0.000 description 4
- 238000011161 development Methods 0.000 description 4
- 230000018109 developmental process Effects 0.000 description 4
- 238000012377 drug delivery Methods 0.000 description 4
- 238000006911 enzymatic reaction Methods 0.000 description 4
- 229940105423 erythropoietin Drugs 0.000 description 4
- 230000004927 fusion Effects 0.000 description 4
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 4
- 235000004554 glutamine Nutrition 0.000 description 4
- 230000012010 growth Effects 0.000 description 4
- 238000003018 immunoassay Methods 0.000 description 4
- 238000000338 in vitro Methods 0.000 description 4
- 239000003446 ligand Substances 0.000 description 4
- 239000002502 liposome Substances 0.000 description 4
- 239000011159 matrix material Substances 0.000 description 4
- 230000001404 mediated effect Effects 0.000 description 4
- 239000011859 microparticle Substances 0.000 description 4
- 108091005601 modified peptides Proteins 0.000 description 4
- 239000000178 monomer Substances 0.000 description 4
- 229920005615 natural polymer Polymers 0.000 description 4
- 230000001817 pituitary effect Effects 0.000 description 4
- 229920000747 poly(lactic acid) Polymers 0.000 description 4
- 229920002451 polyvinyl alcohol Polymers 0.000 description 4
- OXCMYAYHXIHQOA-UHFFFAOYSA-N potassium;[2-butyl-5-chloro-3-[[4-[2-(1,2,4-triaza-3-azanidacyclopenta-1,4-dien-5-yl)phenyl]phenyl]methyl]imidazol-4-yl]methanol Chemical compound [K+].CCCCC1=NC(Cl)=C(CO)N1CC1=CC=C(C=2C(=CC=CC=2)C2=N[N-]N=N2)C=C1 OXCMYAYHXIHQOA-UHFFFAOYSA-N 0.000 description 4
- 238000001742 protein purification Methods 0.000 description 4
- 230000009257 reactivity Effects 0.000 description 4
- 238000012216 screening Methods 0.000 description 4
- 238000002741 site-directed mutagenesis Methods 0.000 description 4
- JQWHASGSAFIOCM-UHFFFAOYSA-M sodium periodate Chemical compound [Na+].[O-]I(=O)(=O)=O JQWHASGSAFIOCM-UHFFFAOYSA-M 0.000 description 4
- 239000007858 starting material Substances 0.000 description 4
- 239000006228 supernatant Substances 0.000 description 4
- 229940124597 therapeutic agent Drugs 0.000 description 4
- 125000003396 thiol group Chemical group [H]S* 0.000 description 4
- 238000013518 transcription Methods 0.000 description 4
- 230000035897 transcription Effects 0.000 description 4
- 238000009966 trimming Methods 0.000 description 4
- 238000000108 ultra-filtration Methods 0.000 description 4
- MSWZFWKMSRAUBD-GASJEMHNSA-N 2-amino-2-deoxy-D-galactopyranose Chemical compound N[C@H]1C(O)O[C@H](CO)[C@H](O)[C@@H]1O MSWZFWKMSRAUBD-GASJEMHNSA-N 0.000 description 3
- MSWZFWKMSRAUBD-IVMDWMLBSA-N 2-amino-2-deoxy-D-glucopyranose Chemical compound N[C@H]1C(O)O[C@H](CO)[C@@H](O)[C@@H]1O MSWZFWKMSRAUBD-IVMDWMLBSA-N 0.000 description 3
- 101710098620 Alpha-1,2-fucosyltransferase Proteins 0.000 description 3
- 239000004475 Arginine Substances 0.000 description 3
- 101710136188 Beta-galactoside alpha-2,6-sialyltransferase 2 Proteins 0.000 description 3
- 102100029963 Beta-galactoside alpha-2,6-sialyltransferase 2 Human genes 0.000 description 3
- 102000004506 Blood Proteins Human genes 0.000 description 3
- 108010017384 Blood Proteins Proteins 0.000 description 3
- 241000283690 Bos taurus Species 0.000 description 3
- 102100031974 CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 Human genes 0.000 description 3
- 108090000204 Dipeptidase 1 Proteins 0.000 description 3
- PNNNRSAQSRJVSB-SLPGGIOYSA-N Fucose Chemical group C[C@H](O)[C@@H](O)[C@H](O)[C@H](O)C=O PNNNRSAQSRJVSB-SLPGGIOYSA-N 0.000 description 3
- MVMSCBBUIHUTGJ-GDJBGNAASA-N GDP-alpha-D-mannose Chemical compound C([C@H]1O[C@H]([C@@H]([C@@H]1O)O)N1C=2N=C(NC(=O)C=2N=C1)N)OP(O)(=O)OP(O)(=O)O[C@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@@H]1O MVMSCBBUIHUTGJ-GDJBGNAASA-N 0.000 description 3
- 108010010803 Gelatin Proteins 0.000 description 3
- 108010055629 Glucosyltransferases Proteins 0.000 description 3
- 102000000340 Glucosyltransferases Human genes 0.000 description 3
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 3
- PMMYEEVYMWASQN-DMTCNVIQSA-N Hydroxyproline Chemical compound O[C@H]1CN[C@H](C(O)=O)C1 PMMYEEVYMWASQN-DMTCNVIQSA-N 0.000 description 3
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 3
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 3
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 3
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 3
- 102000002493 N-Acetylglucosaminyltransferases Human genes 0.000 description 3
- 108010093077 N-Acetylglucosaminyltransferases Proteins 0.000 description 3
- 229910019142 PO4 Inorganic materials 0.000 description 3
- 241000276498 Pollachius virens Species 0.000 description 3
- 108010066816 Polypeptide N-acetylgalactosaminyltransferase Proteins 0.000 description 3
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 3
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 3
- 108010076504 Protein Sorting Signals Proteins 0.000 description 3
- NINIDFKCEFEMDL-UHFFFAOYSA-N Sulfur Chemical compound [S] NINIDFKCEFEMDL-UHFFFAOYSA-N 0.000 description 3
- MZVQCMJNVPIDEA-UHFFFAOYSA-N [CH2]CN(CC)CC Chemical group [CH2]CN(CC)CC MZVQCMJNVPIDEA-UHFFFAOYSA-N 0.000 description 3
- 125000002777 acetyl group Chemical group [H]C([H])([H])C(*)=O 0.000 description 3
- 230000003213 activating effect Effects 0.000 description 3
- 239000013543 active substance Substances 0.000 description 3
- 125000002252 acyl group Chemical group 0.000 description 3
- 125000003545 alkoxy group Chemical group 0.000 description 3
- 238000004458 analytical method Methods 0.000 description 3
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 3
- 229960003121 arginine Drugs 0.000 description 3
- 125000003710 aryl alkyl group Chemical group 0.000 description 3
- KFEUJDWYNGMDBV-RPHKZZMBSA-N beta-D-Galp-(1->4)-D-GlcpNAc Chemical compound O[C@@H]1[C@@H](NC(=O)C)C(O)O[C@H](CO)[C@H]1O[C@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 KFEUJDWYNGMDBV-RPHKZZMBSA-N 0.000 description 3
- 102000006635 beta-lactamase Human genes 0.000 description 3
- 230000000903 blocking effect Effects 0.000 description 3
- 210000000988 bone and bone Anatomy 0.000 description 3
- 239000004202 carbamide Substances 0.000 description 3
- 238000001516 cell proliferation assay Methods 0.000 description 3
- 239000006285 cell suspension Substances 0.000 description 3
- 229920002678 cellulose Polymers 0.000 description 3
- 239000003153 chemical reaction reagent Substances 0.000 description 3
- 230000007812 deficiency Effects 0.000 description 3
- 238000012217 deletion Methods 0.000 description 3
- 230000037430 deletion Effects 0.000 description 3
- 238000001212 derivatisation Methods 0.000 description 3
- 239000003599 detergent Substances 0.000 description 3
- 238000000502 dialysis Methods 0.000 description 3
- 238000009826 distribution Methods 0.000 description 3
- PMMYEEVYMWASQN-UHFFFAOYSA-N dl-hydroxyproline Natural products OC1C[NH2+]C(C([O-])=O)C1 PMMYEEVYMWASQN-UHFFFAOYSA-N 0.000 description 3
- 238000005516 engineering process Methods 0.000 description 3
- RTZKZFJDLAIYFH-UHFFFAOYSA-N ether Chemical group CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 3
- 210000003527 eukaryotic cell Anatomy 0.000 description 3
- 238000005194 fractionation Methods 0.000 description 3
- 125000002446 fucosyl group Chemical group C1([C@@H](O)[C@H](O)[C@H](O)[C@@H](O1)C)* 0.000 description 3
- 238000007306 functionalization reaction Methods 0.000 description 3
- 239000008273 gelatin Substances 0.000 description 3
- 229920000159 gelatin Polymers 0.000 description 3
- 235000019322 gelatine Nutrition 0.000 description 3
- 235000011852 gelatine desserts Nutrition 0.000 description 3
- 230000002068 genetic effect Effects 0.000 description 3
- 125000002791 glucosyl group Chemical group C1([C@H](O)[C@@H](O)[C@H](O)[C@H](O1)CO)* 0.000 description 3
- 150000002338 glycosides Chemical class 0.000 description 3
- 125000005843 halogen group Chemical group 0.000 description 3
- 238000004128 high performance liquid chromatography Methods 0.000 description 3
- 229940088597 hormone Drugs 0.000 description 3
- 239000005556 hormone Substances 0.000 description 3
- 150000002431 hydrogen Chemical group 0.000 description 3
- 229960002591 hydroxyproline Drugs 0.000 description 3
- 230000002163 immunogen Effects 0.000 description 3
- 238000010348 incorporation Methods 0.000 description 3
- 238000002347 injection Methods 0.000 description 3
- 239000007924 injection Substances 0.000 description 3
- 230000003993 interaction Effects 0.000 description 3
- 239000000543 intermediate Substances 0.000 description 3
- 238000001990 intravenous administration Methods 0.000 description 3
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 3
- 230000007246 mechanism Effects 0.000 description 3
- 238000005374 membrane filtration Methods 0.000 description 3
- 125000000956 methoxy group Chemical group [H]C([H])([H])O* 0.000 description 3
- RBMYDHMFFAVMMM-PLQWBNBWSA-N neolactotetraose Chemical compound O([C@H]1[C@H](O)[C@H]([C@@H](O[C@@H]1CO)O[C@@H]1[C@H]([C@H](O[C@H]([C@H](O)CO)[C@H](O)[C@@H](O)C=O)O[C@H](CO)[C@@H]1O)O)NC(=O)C)[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O RBMYDHMFFAVMMM-PLQWBNBWSA-N 0.000 description 3
- 125000004433 nitrogen atom Chemical group N* 0.000 description 3
- 125000004430 oxygen atom Chemical group O* 0.000 description 3
- 230000003285 pharmacodynamic effect Effects 0.000 description 3
- 230000000144 pharmacologic effect Effects 0.000 description 3
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 3
- 230000004962 physiological condition Effects 0.000 description 3
- 210000002826 placenta Anatomy 0.000 description 3
- 229920001983 poloxamer Polymers 0.000 description 3
- 229920000233 poly(alkylene oxides) Polymers 0.000 description 3
- 229920001308 poly(aminoacid) Polymers 0.000 description 3
- 210000001236 prokaryotic cell Anatomy 0.000 description 3
- 238000011084 recovery Methods 0.000 description 3
- 230000002441 reversible effect Effects 0.000 description 3
- 230000028327 secretion Effects 0.000 description 3
- 229910052710 silicon Inorganic materials 0.000 description 3
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 3
- 239000007787 solid Substances 0.000 description 3
- 239000011593 sulfur Substances 0.000 description 3
- 125000004434 sulfur atom Chemical group 0.000 description 3
- FGMPLJWBKKVCDB-UHFFFAOYSA-N trans-L-hydroxy-proline Natural products ON1CCCC1C(O)=O FGMPLJWBKKVCDB-UHFFFAOYSA-N 0.000 description 3
- 125000002023 trifluoromethyl group Chemical group FC(F)(F)* 0.000 description 3
- 239000001226 triphosphate Substances 0.000 description 3
- 235000011178 triphosphate Nutrition 0.000 description 3
- 125000002264 triphosphate group Chemical group [H]OP(=O)(O[H])OP(=O)(O[H])OP(=O)(O[H])O* 0.000 description 3
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 3
- 125000000969 xylosyl group Chemical group C1([C@H](O)[C@@H](O)[C@H](O)CO1)* 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- 125000004178 (C1-C4) alkyl group Chemical group 0.000 description 2
- MVMSCBBUIHUTGJ-UHFFFAOYSA-N 10108-97-1 Natural products C1=2NC(N)=NC(=O)C=2N=CN1C(C(C1O)O)OC1COP(O)(=O)OP(O)(=O)OC1OC(CO)C(O)C(O)C1O MVMSCBBUIHUTGJ-UHFFFAOYSA-N 0.000 description 2
- MSWZFWKMSRAUBD-CBPJZXOFSA-N 2-amino-2-deoxy-D-mannopyranose Chemical compound N[C@@H]1C(O)O[C@H](CO)[C@@H](O)[C@@H]1O MSWZFWKMSRAUBD-CBPJZXOFSA-N 0.000 description 2
- JOOXCMJARBKPKM-UHFFFAOYSA-N 4-oxopentanoic acid Chemical compound CC(=O)CCC(O)=O JOOXCMJARBKPKM-UHFFFAOYSA-N 0.000 description 2
- 108700028369 Alleles Proteins 0.000 description 2
- 108010039209 Blood Coagulation Factors Proteins 0.000 description 2
- 102000015081 Blood Coagulation Factors Human genes 0.000 description 2
- 241000589875 Campylobacter jejuni Species 0.000 description 2
- 108010001857 Cell Surface Receptors Proteins 0.000 description 2
- 102000000844 Cell Surface Receptors Human genes 0.000 description 2
- 102000011022 Chorionic Gonadotropin Human genes 0.000 description 2
- 108010062540 Chorionic Gonadotropin Proteins 0.000 description 2
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 2
- 102000008186 Collagen Human genes 0.000 description 2
- 108010035532 Collagen Proteins 0.000 description 2
- 108091035707 Consensus sequence Proteins 0.000 description 2
- SRBFZHDQGSBBOR-IOVATXLUSA-N D-xylopyranose Chemical compound O[C@@H]1COC(O)[C@H](O)[C@H]1O SRBFZHDQGSBBOR-IOVATXLUSA-N 0.000 description 2
- 229920002307 Dextran Polymers 0.000 description 2
- 108010089072 Dolichyl-diphosphooligosaccharide-protein glycotransferase Proteins 0.000 description 2
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 2
- 241000206602 Eukaryota Species 0.000 description 2
- 102000012673 Follicle Stimulating Hormone Human genes 0.000 description 2
- 108010079345 Follicle Stimulating Hormone Proteins 0.000 description 2
- ZHNUHDYFZUAESO-UHFFFAOYSA-N Formamide Chemical compound NC=O ZHNUHDYFZUAESO-UHFFFAOYSA-N 0.000 description 2
- IAJILQKETJEXLJ-UHFFFAOYSA-N Galacturonsaeure Natural products O=CC(O)C(O)C(O)C(O)C(O)=O IAJILQKETJEXLJ-UHFFFAOYSA-N 0.000 description 2
- AEMRFAOFKBGASW-UHFFFAOYSA-N Glycolic acid Chemical class OCC(O)=O AEMRFAOFKBGASW-UHFFFAOYSA-N 0.000 description 2
- 229920002683 Glycosaminoglycan Polymers 0.000 description 2
- 102000004269 Granulocyte Colony-Stimulating Factor Human genes 0.000 description 2
- 108010017080 Granulocyte Colony-Stimulating Factor Proteins 0.000 description 2
- 229920002971 Heparan sulfate Polymers 0.000 description 2
- UFHFLCQGNIYNRP-UHFFFAOYSA-N Hydrogen Chemical compound [H][H] UFHFLCQGNIYNRP-UHFFFAOYSA-N 0.000 description 2
- 108091092195 Intron Proteins 0.000 description 2
- CLRLHXKNIYJWAW-UHFFFAOYSA-N KDN Natural products OCC(O)C(O)C1OC(O)(C(O)=O)CC(O)C1O CLRLHXKNIYJWAW-UHFFFAOYSA-N 0.000 description 2
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 2
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 2
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 2
- LRQKBLKVPFOOQJ-YFKPBYRVSA-N L-norleucine Chemical group CCCC[C@H]([NH3+])C([O-])=O LRQKBLKVPFOOQJ-YFKPBYRVSA-N 0.000 description 2
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 2
- 108010070158 Lactose synthase Proteins 0.000 description 2
- 102100030928 Lactosylceramide alpha-2,3-sialyltransferase Human genes 0.000 description 2
- 108090001090 Lectins Proteins 0.000 description 2
- 102000004856 Lectins Human genes 0.000 description 2
- 102000007651 Macrophage Colony-Stimulating Factor Human genes 0.000 description 2
- 108010046938 Macrophage Colony-Stimulating Factor Proteins 0.000 description 2
- CSNNHWWHGAXBCP-UHFFFAOYSA-L Magnesium sulfate Chemical compound [Mg+2].[O-][S+2]([O-])([O-])[O-] CSNNHWWHGAXBCP-UHFFFAOYSA-L 0.000 description 2
- NQTADLQHYWFPDB-UHFFFAOYSA-N N-Hydroxysuccinimide Chemical compound ON1C(=O)CCC1=O NQTADLQHYWFPDB-UHFFFAOYSA-N 0.000 description 2
- 125000003047 N-acetyl group Chemical group 0.000 description 2
- SQVRNKJHWKZAKO-PFQGKNLYSA-N N-acetyl-beta-neuraminic acid Chemical group CC(=O)N[C@@H]1[C@@H](O)C[C@@](O)(C(O)=O)O[C@H]1[C@H](O)[C@H](O)CO SQVRNKJHWKZAKO-PFQGKNLYSA-N 0.000 description 2
- 108010015197 N-acetyllactosaminide alpha-2,3-sialyltransferase Proteins 0.000 description 2
- FDJKUWYYUZCUJX-UHFFFAOYSA-N N-glycolyl-beta-neuraminic acid Natural products OCC(O)C(O)C1OC(O)(C(O)=O)CC(O)C1NC(=O)CO FDJKUWYYUZCUJX-UHFFFAOYSA-N 0.000 description 2
- FDJKUWYYUZCUJX-KVNVFURPSA-N N-glycolylneuraminic acid Chemical group OC[C@H](O)[C@H](O)[C@@H]1O[C@](O)(C(O)=O)C[C@H](O)[C@H]1NC(=O)CO FDJKUWYYUZCUJX-KVNVFURPSA-N 0.000 description 2
- 241000588653 Neisseria Species 0.000 description 2
- 108010006232 Neuraminidase Proteins 0.000 description 2
- 102000005348 Neuraminidase Human genes 0.000 description 2
- 101710116435 Outer membrane protein Proteins 0.000 description 2
- 102000004316 Oxidoreductases Human genes 0.000 description 2
- 108090000854 Oxidoreductases Proteins 0.000 description 2
- 239000004952 Polyamide Substances 0.000 description 2
- 229920002732 Polyanhydride Polymers 0.000 description 2
- 229920001710 Polyorthoester Polymers 0.000 description 2
- 229940124158 Protease/peptidase inhibitor Drugs 0.000 description 2
- 101000652822 Rattus norvegicus CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase Proteins 0.000 description 2
- 239000002262 Schiff base Substances 0.000 description 2
- BQCADISMDOOEFD-UHFFFAOYSA-N Silver Chemical compound [Ag] BQCADISMDOOEFD-UHFFFAOYSA-N 0.000 description 2
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 2
- 229920002125 Sokalan® Polymers 0.000 description 2
- 102000004896 Sulfotransferases Human genes 0.000 description 2
- 108090001033 Sulfotransferases Proteins 0.000 description 2
- 108060008683 Tumor Necrosis Factor Receptor Proteins 0.000 description 2
- CYKLRRKFBPBYEI-KBQKSTHMSA-N UDP-alpha-D-galactosamine Chemical compound O1[C@H](CO)[C@H](O)[C@H](O)[C@@H](N)[C@H]1OP(O)(=O)OP(O)(=O)OC[C@@H]1[C@@H](O)[C@@H](O)[C@H](N2C(NC(=O)C=C2)=O)O1 CYKLRRKFBPBYEI-KBQKSTHMSA-N 0.000 description 2
- CYKLRRKFBPBYEI-NQQHDEILSA-N UDP-alpha-D-glucosamine Chemical compound O1[C@H](CO)[C@@H](O)[C@H](O)[C@@H](N)[C@H]1OP(O)(=O)OP(O)(=O)OC[C@@H]1[C@@H](O)[C@@H](O)[C@H](N2C(NC(=O)C=C2)=O)O1 CYKLRRKFBPBYEI-NQQHDEILSA-N 0.000 description 2
- HSCJRCZFDFQWRP-JZMIEXBBSA-N UDP-alpha-D-glucose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1OP(O)(=O)OP(O)(=O)OC[C@@H]1[C@@H](O)[C@@H](O)[C@H](N2C(NC(=O)C=C2)=O)O1 HSCJRCZFDFQWRP-JZMIEXBBSA-N 0.000 description 2
- ISAKRJDGNUQOIC-UHFFFAOYSA-N Uracil Chemical compound O=C1C=CNC(=O)N1 ISAKRJDGNUQOIC-UHFFFAOYSA-N 0.000 description 2
- 102000010199 Xylosyltransferases Human genes 0.000 description 2
- 238000001042 affinity chromatography Methods 0.000 description 2
- 125000001931 aliphatic group Chemical group 0.000 description 2
- 125000003368 amide group Chemical group 0.000 description 2
- 239000003242 anti bacterial agent Substances 0.000 description 2
- 229940088710 antibiotic agent Drugs 0.000 description 2
- 230000000890 antigenic effect Effects 0.000 description 2
- 239000007864 aqueous solution Substances 0.000 description 2
- 125000000089 arabinosyl group Chemical group C1([C@@H](O)[C@H](O)[C@H](O)CO1)* 0.000 description 2
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 2
- UCMIRNVEIXFBKS-UHFFFAOYSA-N beta-alanine Chemical compound NCCC(O)=O UCMIRNVEIXFBKS-UHFFFAOYSA-N 0.000 description 2
- 239000012867 bioactive agent Substances 0.000 description 2
- 239000003114 blood coagulation factor Substances 0.000 description 2
- GDTBXPJZTBHREO-UHFFFAOYSA-N bromine Chemical compound BrBr GDTBXPJZTBHREO-UHFFFAOYSA-N 0.000 description 2
- 239000001768 carboxy methyl cellulose Substances 0.000 description 2
- 125000002057 carboxymethyl group Chemical group [H]OC(=O)C([H])([H])[*] 0.000 description 2
- 238000004113 cell culture Methods 0.000 description 2
- 230000010261 cell growth Effects 0.000 description 2
- 239000013592 cell lysate Substances 0.000 description 2
- 230000001413 cellular effect Effects 0.000 description 2
- 239000001913 cellulose Substances 0.000 description 2
- 235000010980 cellulose Nutrition 0.000 description 2
- 239000002738 chelating agent Substances 0.000 description 2
- 238000012412 chemical coupling Methods 0.000 description 2
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 2
- 238000000576 coating method Methods 0.000 description 2
- 229920001436 collagen Polymers 0.000 description 2
- 238000004440 column chromatography Methods 0.000 description 2
- 238000007796 conventional method Methods 0.000 description 2
- 238000004132 cross linking Methods 0.000 description 2
- 239000003431 cross linking reagent Substances 0.000 description 2
- 150000003983 crown ethers Chemical class 0.000 description 2
- 125000000113 cyclohexyl group Chemical group [H]C1([H])C([H])([H])C([H])([H])C([H])(*)C([H])([H])C1([H])[H] 0.000 description 2
- 239000003398 denaturant Substances 0.000 description 2
- 238000004925 denaturation Methods 0.000 description 2
- 230000036425 denaturation Effects 0.000 description 2
- 238000001514 detection method Methods 0.000 description 2
- 239000000032 diagnostic agent Substances 0.000 description 2
- 229940039227 diagnostic agent Drugs 0.000 description 2
- 238000010790 dilution Methods 0.000 description 2
- 239000012895 dilution Substances 0.000 description 2
- 150000002016 disaccharides Chemical class 0.000 description 2
- 150000002019 disulfides Chemical class 0.000 description 2
- 239000000839 emulsion Substances 0.000 description 2
- 238000012869 ethanol precipitation Methods 0.000 description 2
- 238000011156 evaluation Methods 0.000 description 2
- 238000000605 extraction Methods 0.000 description 2
- 239000000706 filtrate Substances 0.000 description 2
- 238000001914 filtration Methods 0.000 description 2
- 125000001153 fluoro group Chemical group F* 0.000 description 2
- 229940028334 follicle stimulating hormone Drugs 0.000 description 2
- 238000009472 formulation Methods 0.000 description 2
- 230000033581 fucosylation Effects 0.000 description 2
- 238000002825 functional assay Methods 0.000 description 2
- 230000002538 fungal effect Effects 0.000 description 2
- 238000007429 general method Methods 0.000 description 2
- 238000010353 genetic engineering Methods 0.000 description 2
- 229960002442 glucosamine Drugs 0.000 description 2
- 235000013922 glutamic acid Nutrition 0.000 description 2
- 239000004220 glutamic acid Substances 0.000 description 2
- 239000000348 glycosyl donor Substances 0.000 description 2
- 230000001279 glycosylating effect Effects 0.000 description 2
- 229960000789 guanidine hydrochloride Drugs 0.000 description 2
- PJJJBBJSCAKJQF-UHFFFAOYSA-N guanidinium chloride Chemical compound [Cl-].NC(N)=[NH2+] PJJJBBJSCAKJQF-UHFFFAOYSA-N 0.000 description 2
- 108010076477 haematoside synthetase Proteins 0.000 description 2
- 125000001188 haloalkyl group Chemical group 0.000 description 2
- 229920000669 heparin Polymers 0.000 description 2
- 229960002897 heparin Drugs 0.000 description 2
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 2
- 229960002885 histidine Drugs 0.000 description 2
- 125000000487 histidyl group Chemical group [H]N([H])C(C(=O)O*)C([H])([H])C1=C([H])N([H])C([H])=N1 0.000 description 2
- 229940084986 human chorionic gonadotropin Drugs 0.000 description 2
- 238000009396 hybridization Methods 0.000 description 2
- 230000007062 hydrolysis Effects 0.000 description 2
- 238000006460 hydrolysis reaction Methods 0.000 description 2
- 210000000987 immune system Anatomy 0.000 description 2
- 238000003780 insertion Methods 0.000 description 2
- 230000037431 insertion Effects 0.000 description 2
- 239000002198 insoluble material Substances 0.000 description 2
- 238000007918 intramuscular administration Methods 0.000 description 2
- 238000007912 intraperitoneal administration Methods 0.000 description 2
- 229910052740 iodine Inorganic materials 0.000 description 2
- 238000004255 ion exchange chromatography Methods 0.000 description 2
- 230000002427 irreversible effect Effects 0.000 description 2
- 229960000310 isoleucine Drugs 0.000 description 2
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 2
- 238000005304 joining Methods 0.000 description 2
- 125000000468 ketone group Chemical group 0.000 description 2
- 239000008101 lactose Substances 0.000 description 2
- 239000002523 lectin Substances 0.000 description 2
- 101150018810 lgtB gene Proteins 0.000 description 2
- 210000004185 liver Anatomy 0.000 description 2
- 210000002540 macrophage Anatomy 0.000 description 2
- 239000003550 marker Substances 0.000 description 2
- 230000004060 metabolic process Effects 0.000 description 2
- MYWUZJCMWCOHBA-VIFPVBQESA-N methamphetamine Chemical compound CN[C@@H](C)CC1=CC=CC=C1 MYWUZJCMWCOHBA-VIFPVBQESA-N 0.000 description 2
- BDAGIHXWWSANSR-UHFFFAOYSA-N methanoic acid Natural products OC=O BDAGIHXWWSANSR-UHFFFAOYSA-N 0.000 description 2
- 238000010369 molecular cloning Methods 0.000 description 2
- 150000002772 monosaccharides Chemical class 0.000 description 2
- 125000004573 morpholin-4-yl group Chemical group N1(CCOCC1)* 0.000 description 2
- 229940060155 neuac Drugs 0.000 description 2
- QJGQUHMNIGDVPM-UHFFFAOYSA-N nitrogen group Chemical group [N] QJGQUHMNIGDVPM-UHFFFAOYSA-N 0.000 description 2
- 239000003921 oil Substances 0.000 description 2
- 230000003204 osmotic effect Effects 0.000 description 2
- 239000001301 oxygen Substances 0.000 description 2
- WXZMFSXDPGVJKK-UHFFFAOYSA-N pentaerythritol Chemical compound OCC(CO)(CO)CO WXZMFSXDPGVJKK-UHFFFAOYSA-N 0.000 description 2
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 2
- 238000012510 peptide mapping method Methods 0.000 description 2
- 239000000546 pharmaceutical excipient Substances 0.000 description 2
- 125000001997 phenyl group Chemical group [H]C1=C([H])C([H])=C(*)C([H])=C1[H] 0.000 description 2
- NMHMNPHRMNGLLB-UHFFFAOYSA-N phloretic acid Chemical compound OC(=O)CCC1=CC=C(O)C=C1 NMHMNPHRMNGLLB-UHFFFAOYSA-N 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 2
- 239000010452 phosphate Substances 0.000 description 2
- 230000001766 physiological effect Effects 0.000 description 2
- 229920001484 poly(alkylene) Polymers 0.000 description 2
- 229920000111 poly(butyric acid) Polymers 0.000 description 2
- 229920001583 poly(oxyethylated polyols) Polymers 0.000 description 2
- 229920002627 poly(phosphazenes) Polymers 0.000 description 2
- 238000002264 polyacrylamide gel electrophoresis Methods 0.000 description 2
- 229920001515 polyalkylene glycol Polymers 0.000 description 2
- 229920002647 polyamide Polymers 0.000 description 2
- 229920000728 polyester Polymers 0.000 description 2
- 229920000139 polyethylene terephthalate Polymers 0.000 description 2
- 239000005020 polyethylene terephthalate Substances 0.000 description 2
- 239000004633 polyglycolic acid Substances 0.000 description 2
- 239000004626 polylactic acid Substances 0.000 description 2
- 229920005862 polyol Polymers 0.000 description 2
- 150000003077 polyols Chemical class 0.000 description 2
- 229920001155 polypropylene Polymers 0.000 description 2
- 229920002635 polyurethane Polymers 0.000 description 2
- 239000004814 polyurethane Substances 0.000 description 2
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 2
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 2
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 2
- 239000011148 porous material Substances 0.000 description 2
- 125000006239 protecting group Chemical group 0.000 description 2
- 230000004044 response Effects 0.000 description 2
- 238000001223 reverse osmosis Methods 0.000 description 2
- 238000012163 sequencing technique Methods 0.000 description 2
- 150000003354 serine derivatives Chemical class 0.000 description 2
- 239000000741 silica gel Substances 0.000 description 2
- 229910002027 silica gel Inorganic materials 0.000 description 2
- 229910052709 silver Inorganic materials 0.000 description 2
- 239000004332 silver Substances 0.000 description 2
- 239000011780 sodium chloride Substances 0.000 description 2
- 239000001488 sodium phosphate Substances 0.000 description 2
- 229910000162 sodium phosphate Inorganic materials 0.000 description 2
- 238000005063 solubilization Methods 0.000 description 2
- 230000007928 solubilization Effects 0.000 description 2
- 238000010254 subcutaneous injection Methods 0.000 description 2
- 239000007929 subcutaneous injection Substances 0.000 description 2
- 238000012360 testing method Methods 0.000 description 2
- 238000002560 therapeutic procedure Methods 0.000 description 2
- 125000005309 thioalkoxy group Chemical group 0.000 description 2
- 150000003568 thioethers Chemical group 0.000 description 2
- JOXIMZWYDAKGHI-UHFFFAOYSA-N toluene-4-sulfonic acid Chemical compound CC1=CC=C(S(O)(=O)=O)C=C1 JOXIMZWYDAKGHI-UHFFFAOYSA-N 0.000 description 2
- 230000009261 transgenic effect Effects 0.000 description 2
- 238000013519 translation Methods 0.000 description 2
- ITMCEJHCFYSIIV-UHFFFAOYSA-N triflic acid Chemical compound OS(=O)(=O)C(F)(F)F ITMCEJHCFYSIIV-UHFFFAOYSA-N 0.000 description 2
- RYFMWSXOAZQYPI-UHFFFAOYSA-K trisodium phosphate Chemical compound [Na+].[Na+].[Na+].[O-]P([O-])([O-])=O RYFMWSXOAZQYPI-UHFFFAOYSA-K 0.000 description 2
- 102000003298 tumor necrosis factor receptor Human genes 0.000 description 2
- 125000004417 unsaturated alkyl group Chemical group 0.000 description 2
- 238000005406 washing Methods 0.000 description 2
- 230000004584 weight gain Effects 0.000 description 2
- 235000019786 weight gain Nutrition 0.000 description 2
- LNAZSHAWQACDHT-XIYTZBAFSA-N (2r,3r,4s,5r,6s)-4,5-dimethoxy-2-(methoxymethyl)-3-[(2s,3r,4s,5r,6r)-3,4,5-trimethoxy-6-(methoxymethyl)oxan-2-yl]oxy-6-[(2r,3r,4s,5r,6r)-4,5,6-trimethoxy-2-(methoxymethyl)oxan-3-yl]oxyoxane Chemical compound CO[C@@H]1[C@@H](OC)[C@H](OC)[C@@H](COC)O[C@H]1O[C@H]1[C@H](OC)[C@@H](OC)[C@H](O[C@H]2[C@@H]([C@@H](OC)[C@H](OC)O[C@@H]2COC)OC)O[C@@H]1COC LNAZSHAWQACDHT-XIYTZBAFSA-N 0.000 description 1
- KYBXNPIASYUWLN-WUCPZUCCSA-N (2s)-5-hydroxypyrrolidine-2-carboxylic acid Chemical compound OC1CC[C@@H](C(O)=O)N1 KYBXNPIASYUWLN-WUCPZUCCSA-N 0.000 description 1
- 125000000229 (C1-C4)alkoxy group Chemical group 0.000 description 1
- VMSLCPKYRPDHLN-UHFFFAOYSA-N (R)-Humulone Chemical compound CC(C)CC(=O)C1=C(O)C(CC=C(C)C)=C(O)C(O)(CC=C(C)C)C1=O VMSLCPKYRPDHLN-UHFFFAOYSA-N 0.000 description 1
- ODIGIKRIUKFKHP-UHFFFAOYSA-N (n-propan-2-yloxycarbonylanilino) acetate Chemical compound CC(C)OC(=O)N(OC(C)=O)C1=CC=CC=C1 ODIGIKRIUKFKHP-UHFFFAOYSA-N 0.000 description 1
- UKAUYVFTDYCKQA-UHFFFAOYSA-N -2-Amino-4-hydroxybutanoic acid Natural products OC(=O)C(N)CCO UKAUYVFTDYCKQA-UHFFFAOYSA-N 0.000 description 1
- RKDVKSZUMVYZHH-UHFFFAOYSA-N 1,4-dioxane-2,5-dione Chemical compound O=C1COC(=O)CO1 RKDVKSZUMVYZHH-UHFFFAOYSA-N 0.000 description 1
- 125000001637 1-naphthyl group Chemical group [H]C1=C([H])C([H])=C2C(*)=C([H])C([H])=C([H])C2=C1[H] 0.000 description 1
- 125000004214 1-pyrrolidinyl group Chemical group [H]C1([H])N(*)C([H])([H])C([H])([H])C1([H])[H] 0.000 description 1
- 125000001462 1-pyrrolyl group Chemical group [*]N1C([H])=C([H])C([H])=C1[H] 0.000 description 1
- NBSLIHUMUUEJER-UHFFFAOYSA-N 1h-imidazol-2-yl formate Chemical class O=COC1=NC=CN1 NBSLIHUMUUEJER-UHFFFAOYSA-N 0.000 description 1
- VGONTNSXDCQUGY-RRKCRQDMSA-N 2'-deoxyinosine Chemical group C1[C@H](O)[C@@H](CO)O[C@H]1N1C(N=CNC2=O)=C2N=C1 VGONTNSXDCQUGY-RRKCRQDMSA-N 0.000 description 1
- 125000004206 2,2,2-trifluoroethyl group Chemical group [H]C([H])(*)C(F)(F)F 0.000 description 1
- RPZANUYHRMRTTE-UHFFFAOYSA-N 2,3,4-trimethoxy-6-(methoxymethyl)-5-[3,4,5-trimethoxy-6-(methoxymethyl)oxan-2-yl]oxyoxane;1-[[3,4,5-tris(2-hydroxybutoxy)-6-[4,5,6-tris(2-hydroxybutoxy)-2-(2-hydroxybutoxymethyl)oxan-3-yl]oxyoxan-2-yl]methoxy]butan-2-ol Chemical compound COC1C(OC)C(OC)C(COC)OC1OC1C(OC)C(OC)C(OC)OC1COC.CCC(O)COC1C(OCC(O)CC)C(OCC(O)CC)C(COCC(O)CC)OC1OC1C(OCC(O)CC)C(OCC(O)CC)C(OCC(O)CC)OC1COCC(O)CC RPZANUYHRMRTTE-UHFFFAOYSA-N 0.000 description 1
- BHNQPLPANNDEGL-UHFFFAOYSA-N 2-(4-octylphenoxy)ethanol Chemical compound CCCCCCCCC1=CC=C(OCCO)C=C1 BHNQPLPANNDEGL-UHFFFAOYSA-N 0.000 description 1
- YGDVXSDNEFDTGV-UHFFFAOYSA-N 2-[6-[bis(carboxymethyl)amino]hexyl-(carboxymethyl)amino]acetic acid Chemical compound OC(=O)CN(CC(O)=O)CCCCCCN(CC(O)=O)CC(O)=O YGDVXSDNEFDTGV-UHFFFAOYSA-N 0.000 description 1
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 1
- 125000000979 2-amino-2-oxoethyl group Chemical group [H]C([*])([H])C(=O)N([H])[H] 0.000 description 1
- 125000004174 2-benzimidazolyl group Chemical group [H]N1C(*)=NC2=C([H])C([H])=C([H])C([H])=C12 0.000 description 1
- 125000002941 2-furyl group Chemical group O1C([*])=C([H])C([H])=C1[H] 0.000 description 1
- 125000001622 2-naphthyl group Chemical group [H]C1=C([H])C([H])=C2C([H])=C(*)C([H])=C([H])C2=C1[H] 0.000 description 1
- KIHAGWUUUHJRMS-JOCHJYFZSA-N 2-octadecanoyl-sn-glycero-3-phosphoethanolamine zwitterion Chemical compound CCCCCCCCCCCCCCCCCC(=O)O[C@H](CO)COP(O)(=O)OCCN KIHAGWUUUHJRMS-JOCHJYFZSA-N 0.000 description 1
- 125000000094 2-phenylethyl group Chemical group [H]C1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])C([H])([H])* 0.000 description 1
- 125000003903 2-propenyl group Chemical group [H]C([*])([H])C([H])=C([H])[H] 0.000 description 1
- 125000004105 2-pyridyl group Chemical group N1=C([*])C([H])=C([H])C([H])=C1[H] 0.000 description 1
- 125000000389 2-pyrrolyl group Chemical group [H]N1C([*])=C([H])C([H])=C1[H] 0.000 description 1
- 125000000175 2-thienyl group Chemical group S1C([*])=C([H])C([H])=C1[H] 0.000 description 1
- ZSLUVFAKFWKJRC-IGMARMGPSA-N 232Th Chemical compound [232Th] ZSLUVFAKFWKJRC-IGMARMGPSA-N 0.000 description 1
- HVCOBJNICQPDBP-UHFFFAOYSA-N 3-[3-[3,5-dihydroxy-6-methyl-4-(3,4,5-trihydroxy-6-methyloxan-2-yl)oxyoxan-2-yl]oxydecanoyloxy]decanoic acid;hydrate Chemical compound O.OC1C(OC(CC(=O)OC(CCCCCCC)CC(O)=O)CCCCCCC)OC(C)C(O)C1OC1C(O)C(O)C(O)C(C)O1 HVCOBJNICQPDBP-UHFFFAOYSA-N 0.000 description 1
- 125000000474 3-butynyl group Chemical group [H]C#CC([H])([H])C([H])([H])* 0.000 description 1
- 125000003682 3-furyl group Chemical group O1C([H])=C([*])C([H])=C1[H] 0.000 description 1
- 125000003349 3-pyridyl group Chemical group N1=C([H])C([*])=C([H])C([H])=C1[H] 0.000 description 1
- 125000001397 3-pyrrolyl group Chemical group [H]N1C([H])=C([*])C([H])=C1[H] 0.000 description 1
- 125000001541 3-thienyl group Chemical group S1C([H])=C([*])C([H])=C1[H] 0.000 description 1
- WEQPBCSPRXFQQS-UHFFFAOYSA-N 4,5-dihydro-1,2-oxazole Chemical group C1CC=NO1 WEQPBCSPRXFQQS-UHFFFAOYSA-N 0.000 description 1
- OSWFIVFLDKOXQC-UHFFFAOYSA-N 4-(3-methoxyphenyl)aniline Chemical compound COC1=CC=CC(C=2C=CC(N)=CC=2)=C1 OSWFIVFLDKOXQC-UHFFFAOYSA-N 0.000 description 1
- JLJZRAUDCHWQPS-NYONGVCJSA-N 4-oxo-n-[(3s,4r,5s,6r)-2,4,5-trihydroxy-6-(hydroxymethyl)oxan-3-yl]pentanamide Chemical compound CC(=O)CCC(=O)N[C@@H]1C(O)O[C@H](CO)[C@@H](O)[C@@H]1O JLJZRAUDCHWQPS-NYONGVCJSA-N 0.000 description 1
- 125000000339 4-pyridyl group Chemical group N1=C([H])C([H])=C([*])C([H])=C1[H] 0.000 description 1
- KDDQRKBRJSGMQE-UHFFFAOYSA-N 4-thiazolyl Chemical group [C]1=CSC=N1 KDDQRKBRJSGMQE-UHFFFAOYSA-N 0.000 description 1
- 229940117976 5-hydroxylysine Drugs 0.000 description 1
- CWDWFSXUQODZGW-UHFFFAOYSA-N 5-thiazolyl Chemical group [C]1=CN=CS1 CWDWFSXUQODZGW-UHFFFAOYSA-N 0.000 description 1
- HOSGXJWQVBHGLT-UHFFFAOYSA-N 6-hydroxy-3,4-dihydro-1h-quinolin-2-one Chemical group N1C(=O)CCC2=CC(O)=CC=C21 HOSGXJWQVBHGLT-UHFFFAOYSA-N 0.000 description 1
- ZCYVEMRRCGMTRW-UHFFFAOYSA-N 7553-56-2 Chemical group [I] ZCYVEMRRCGMTRW-UHFFFAOYSA-N 0.000 description 1
- HRPVXLWXLXDGHG-UHFFFAOYSA-N Acrylamide Chemical compound NC(=O)C=C HRPVXLWXLXDGHG-UHFFFAOYSA-N 0.000 description 1
- 229920000936 Agarose Polymers 0.000 description 1
- 101710180924 Alpha-1,2-galactosyltransferase Proteins 0.000 description 1
- 102100022622 Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase Human genes 0.000 description 1
- 101710183133 Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1 Proteins 0.000 description 1
- 102100031969 Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1 Human genes 0.000 description 1
- 102100031970 Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 2 Human genes 0.000 description 1
- 102100031971 Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 Human genes 0.000 description 1
- 229920000856 Amylose Polymers 0.000 description 1
- 201000001320 Atherosclerosis Diseases 0.000 description 1
- 108090001008 Avidin Proteins 0.000 description 1
- 241000194110 Bacillus sp. (in: Bacteria) Species 0.000 description 1
- 108010077805 Bacterial Proteins Proteins 0.000 description 1
- LSNNMFCWUKXFEE-UHFFFAOYSA-M Bisulfite Chemical compound OS([O-])=O LSNNMFCWUKXFEE-UHFFFAOYSA-M 0.000 description 1
- 101710136075 CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase Proteins 0.000 description 1
- 102100027098 CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 Human genes 0.000 description 1
- 108010033531 CMP-N-acetylneuraminate-poly-alpha-2,8-sialosyl sialyltransferase Proteins 0.000 description 1
- 102100021786 CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase Human genes 0.000 description 1
- 101100408676 Caenorhabditis elegans pmt-1 gene Proteins 0.000 description 1
- 229920002134 Carboxymethyl cellulose Polymers 0.000 description 1
- 241000863012 Caulobacter Species 0.000 description 1
- 229920000623 Cellulose acetate phthalate Polymers 0.000 description 1
- DQEFEBPAPFSJLV-UHFFFAOYSA-N Cellulose propionate Chemical compound CCC(=O)OCC1OC(OC(=O)CC)C(OC(=O)CC)C(OC(=O)CC)C1OC1C(OC(=O)CC)C(OC(=O)CC)C(OC(=O)CC)C(COC(=O)CC)O1 DQEFEBPAPFSJLV-UHFFFAOYSA-N 0.000 description 1
- 229920002284 Cellulose triacetate Polymers 0.000 description 1
- KZBUYRJDOAKODT-UHFFFAOYSA-N Chlorine Chemical compound ClCl KZBUYRJDOAKODT-UHFFFAOYSA-N 0.000 description 1
- GUTLYIVDDKVIGB-OUBTZVSYSA-N Cobalt-60 Chemical compound [60Co] GUTLYIVDDKVIGB-OUBTZVSYSA-N 0.000 description 1
- 101100007328 Cocos nucifera COS-1 gene Proteins 0.000 description 1
- 108700010070 Codon Usage Proteins 0.000 description 1
- 241000699802 Cricetulus griseus Species 0.000 description 1
- 229920000858 Cyclodextrin Polymers 0.000 description 1
- WXOFKRKAHJQKLT-BQBZGAKWSA-N Cys-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H](N)CS WXOFKRKAHJQKLT-BQBZGAKWSA-N 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- 230000009946 DNA mutation Effects 0.000 description 1
- 239000003155 DNA primer Substances 0.000 description 1
- QOSSAOTZNIDXMA-UHFFFAOYSA-N Dicylcohexylcarbodiimide Chemical compound C1CCCCC1N=C=NC1CCCCC1 QOSSAOTZNIDXMA-UHFFFAOYSA-N 0.000 description 1
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 1
- 206010013883 Dwarfism Diseases 0.000 description 1
- 108700035678 EC 2.4.1.45 Proteins 0.000 description 1
- 101100540702 Escherichia coli (strain K12) waaU gene Proteins 0.000 description 1
- 108090000371 Esterases Proteins 0.000 description 1
- 239000001856 Ethyl cellulose Substances 0.000 description 1
- ZZSNKZQZMQGXPY-UHFFFAOYSA-N Ethyl cellulose Chemical compound CCOCC1OC(OC)C(OCC)C(OCC)C1OC1C(O)C(O)C(OC)C(CO)O1 ZZSNKZQZMQGXPY-UHFFFAOYSA-N 0.000 description 1
- IAYPIBMASNFSPL-UHFFFAOYSA-N Ethylene oxide Chemical compound C1CO1 IAYPIBMASNFSPL-UHFFFAOYSA-N 0.000 description 1
- 108700024394 Exon Proteins 0.000 description 1
- 102000001690 Factor VIII Human genes 0.000 description 1
- 108010054218 Factor VIII Proteins 0.000 description 1
- KRHYYFGTRYWZRS-UHFFFAOYSA-M Fluoride anion Chemical compound [F-] KRHYYFGTRYWZRS-UHFFFAOYSA-M 0.000 description 1
- PXGOKWXKJXAPGV-UHFFFAOYSA-N Fluorine Chemical compound FF PXGOKWXKJXAPGV-UHFFFAOYSA-N 0.000 description 1
- WSFSSNUMVMOOMR-UHFFFAOYSA-N Formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 1
- 108030004655 Fucosylgalactoside 3-alpha-galactosyltransferases Proteins 0.000 description 1
- 241000287828 Gallus gallus Species 0.000 description 1
- 108010092364 Glucuronosyltransferase Proteins 0.000 description 1
- 102000016354 Glucuronosyltransferase Human genes 0.000 description 1
- 229930186217 Glycolipid Natural products 0.000 description 1
- 102100021700 Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 Human genes 0.000 description 1
- 241000590002 Helicobacter pylori Species 0.000 description 1
- 102000001554 Hemoglobins Human genes 0.000 description 1
- 108010054147 Hemoglobins Proteins 0.000 description 1
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 description 1
- 229920000209 Hexadimethrine bromide Polymers 0.000 description 1
- 101000972916 Homo sapiens Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase Proteins 0.000 description 1
- 101000863898 Homo sapiens CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase Proteins 0.000 description 1
- 101000616698 Homo sapiens CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase Proteins 0.000 description 1
- 101000896564 Homo sapiens Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 Proteins 0.000 description 1
- 101001002657 Homo sapiens Interleukin-2 Proteins 0.000 description 1
- 102000003918 Hyaluronan Synthases Human genes 0.000 description 1
- 108090000320 Hyaluronan Synthases Proteins 0.000 description 1
- AVXURJPOCDRRFD-UHFFFAOYSA-N Hydroxylamine Chemical compound ON AVXURJPOCDRRFD-UHFFFAOYSA-N 0.000 description 1
- 229920002153 Hydroxypropyl cellulose Polymers 0.000 description 1
- 108010093096 Immobilized Enzymes Proteins 0.000 description 1
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 1
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 1
- 102000006992 Interferon-alpha Human genes 0.000 description 1
- 108010047761 Interferon-alpha Proteins 0.000 description 1
- 102000014150 Interferons Human genes 0.000 description 1
- 108010050904 Interferons Proteins 0.000 description 1
- 108010002350 Interleukin-2 Proteins 0.000 description 1
- 102000000588 Interleukin-2 Human genes 0.000 description 1
- 108010063738 Interleukins Proteins 0.000 description 1
- 102000015696 Interleukins Human genes 0.000 description 1
- 206010065973 Iron Overload Diseases 0.000 description 1
- 241000588747 Klebsiella pneumoniae Species 0.000 description 1
- SHZGCJCMOBCMKK-PQMKYFCFSA-N L-Fucose Natural products C[C@H]1O[C@H](O)[C@@H](O)[C@@H](O)[C@@H]1O SHZGCJCMOBCMKK-PQMKYFCFSA-N 0.000 description 1
- QUOGESRFPZDMMT-UHFFFAOYSA-N L-Homoarginine Natural products OC(=O)C(N)CCCCNC(N)=N QUOGESRFPZDMMT-UHFFFAOYSA-N 0.000 description 1
- ZGUNAGUHMKGQNY-ZETCQYMHSA-N L-alpha-phenylglycine zwitterion Chemical compound OC(=O)[C@@H](N)C1=CC=CC=C1 ZGUNAGUHMKGQNY-ZETCQYMHSA-N 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- QUOGESRFPZDMMT-YFKPBYRVSA-N L-homoarginine Chemical compound OC(=O)[C@@H](N)CCCCNC(N)=N QUOGESRFPZDMMT-YFKPBYRVSA-N 0.000 description 1
- UKAUYVFTDYCKQA-VKHMYHEASA-N L-homoserine Chemical group OC(=O)[C@@H](N)CCO UKAUYVFTDYCKQA-VKHMYHEASA-N 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- QEFRNWWLZKMPFJ-ZXPFJRLXSA-N L-methionine (R)-S-oxide Chemical group C[S@@](=O)CC[C@H]([NH3+])C([O-])=O QEFRNWWLZKMPFJ-ZXPFJRLXSA-N 0.000 description 1
- QEFRNWWLZKMPFJ-UHFFFAOYSA-N L-methionine sulphoxide Chemical group CS(=O)CCC(N)C(O)=O QEFRNWWLZKMPFJ-UHFFFAOYSA-N 0.000 description 1
- PNNNRSAQSRJVSB-UHFFFAOYSA-N L-rhamnose Natural products CC(O)C(O)C(O)C(O)C=O PNNNRSAQSRJVSB-UHFFFAOYSA-N 0.000 description 1
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 1
- 235000014647 Lens culinaris subsp culinaris Nutrition 0.000 description 1
- 244000043158 Lens esculenta Species 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 102000003960 Ligases Human genes 0.000 description 1
- 108090000364 Ligases Proteins 0.000 description 1
- 101710105045 Lipoprotein E Proteins 0.000 description 1
- FYYHWMGAXLPEAU-UHFFFAOYSA-N Magnesium Chemical compound [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 description 1
- 201000009906 Meningitis Diseases 0.000 description 1
- AFVFQIVMOAPDHO-UHFFFAOYSA-N Methanesulfonic acid Chemical compound CS(O)(=O)=O AFVFQIVMOAPDHO-UHFFFAOYSA-N 0.000 description 1
- DBTDEFJAFBUGPP-UHFFFAOYSA-N Methanethial Chemical compound S=C DBTDEFJAFBUGPP-UHFFFAOYSA-N 0.000 description 1
- 108010014251 Muramidase Proteins 0.000 description 1
- 102000016943 Muramidase Human genes 0.000 description 1
- 101100170937 Mus musculus Dnmt1 gene Proteins 0.000 description 1
- 241000186359 Mycobacterium Species 0.000 description 1
- QPCDCPDFJACHGM-UHFFFAOYSA-N N,N-bis{2-[bis(carboxymethyl)amino]ethyl}glycine Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(=O)O)CCN(CC(O)=O)CC(O)=O QPCDCPDFJACHGM-UHFFFAOYSA-N 0.000 description 1
- 108010046068 N-Acetyllactosamine Synthase Proteins 0.000 description 1
- 108010062010 N-Acetylmuramoyl-L-alanine Amidase Proteins 0.000 description 1
- HESSGHHCXGBPAJ-UHFFFAOYSA-N N-acetyllactosamine Natural products CC(=O)NC(C=O)C(O)C(C(O)CO)OC1OC(CO)C(O)C(O)C1O HESSGHHCXGBPAJ-UHFFFAOYSA-N 0.000 description 1
- 102100023315 N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase Human genes 0.000 description 1
- 108010056664 N-acetyllactosaminide beta-1,6-N-acetylglucosaminyltransferase Proteins 0.000 description 1
- SQVRNKJHWKZAKO-LUWBGTNYSA-N N-acetylneuraminic acid Chemical compound CC(=O)N[C@@H]1[C@@H](O)CC(O)(C(O)=O)O[C@H]1[C@H](O)[C@H](O)CO SQVRNKJHWKZAKO-LUWBGTNYSA-N 0.000 description 1
- 230000006181 N-acylation Effects 0.000 description 1
- 108010033644 N-acylsphingosine galactosyltransferase Proteins 0.000 description 1
- FDJKUWYYUZCUJX-AJKRCSPLSA-N N-glycoloyl-beta-neuraminic acid Chemical compound OC[C@@H](O)[C@@H](O)[C@@H]1O[C@](O)(C(O)=O)C[C@H](O)[C@H]1NC(=O)CO FDJKUWYYUZCUJX-AJKRCSPLSA-N 0.000 description 1
- SUHQNCLNRUAGOO-UHFFFAOYSA-N N-glycoloyl-neuraminic acid Natural products OCC(O)C(O)C(O)C(NC(=O)CO)C(O)CC(=O)C(O)=O SUHQNCLNRUAGOO-UHFFFAOYSA-N 0.000 description 1
- 108010052465 Neu5Ac N-acetylgalactosamine 2,6-sialyltransferase Proteins 0.000 description 1
- 101100108611 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) alg-8 gene Proteins 0.000 description 1
- 238000000636 Northern blotting Methods 0.000 description 1
- 229910003849 O-Si Inorganic materials 0.000 description 1
- 108091034117 Oligonucleotide Proteins 0.000 description 1
- 108020005187 Oligonucleotide Probes Proteins 0.000 description 1
- 108010038807 Oligopeptides Proteins 0.000 description 1
- 102000015636 Oligopeptides Human genes 0.000 description 1
- 108700026244 Open Reading Frames Proteins 0.000 description 1
- 229910003872 O—Si Inorganic materials 0.000 description 1
- 101710195435 Periplasmic oligopeptide-binding protein Proteins 0.000 description 1
- ABLZXFCXXLZCGV-UHFFFAOYSA-N Phosphorous acid Chemical class OP(O)=O ABLZXFCXXLZCGV-UHFFFAOYSA-N 0.000 description 1
- 241000607568 Photobacterium Species 0.000 description 1
- 229920003171 Poly (ethylene oxide) Polymers 0.000 description 1
- 229920001305 Poly(isodecyl(meth)acrylate) Polymers 0.000 description 1
- 229920002319 Poly(methyl acrylate) Polymers 0.000 description 1
- 229920001665 Poly-4-vinylphenol Polymers 0.000 description 1
- 229920001283 Polyalkylene terephthalate Polymers 0.000 description 1
- 229920000805 Polyaspartic acid Polymers 0.000 description 1
- 239000004698 Polyethylene Substances 0.000 description 1
- 229920002873 Polyethylenimine Polymers 0.000 description 1
- 239000004743 Polypropylene Substances 0.000 description 1
- 239000004793 Polystyrene Substances 0.000 description 1
- 239000004372 Polyvinyl alcohol Substances 0.000 description 1
- 241001415846 Procellariidae Species 0.000 description 1
- 241000589517 Pseudomonas aeruginosa Species 0.000 description 1
- 108010083644 Ribonucleases Proteins 0.000 description 1
- 102000006382 Ribonucleases Human genes 0.000 description 1
- 241000235070 Saccharomyces Species 0.000 description 1
- 241000607142 Salmonella Species 0.000 description 1
- 241001138501 Salmonella enterica Species 0.000 description 1
- 101100540701 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) waaK gene Proteins 0.000 description 1
- 150000004753 Schiff bases Chemical class 0.000 description 1
- 241000235347 Schizosaccharomyces pombe Species 0.000 description 1
- 229920005654 Sephadex Polymers 0.000 description 1
- 239000012507 Sephadex™ Substances 0.000 description 1
- SBMNPABNWKXNBJ-BQBZGAKWSA-N Ser-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H](N)CO SBMNPABNWKXNBJ-BQBZGAKWSA-N 0.000 description 1
- 229910007161 Si(CH3)3 Inorganic materials 0.000 description 1
- XUIMIQQOPSSXEZ-UHFFFAOYSA-N Silicon Chemical compound [Si] XUIMIQQOPSSXEZ-UHFFFAOYSA-N 0.000 description 1
- PMZURENOXWZQFD-UHFFFAOYSA-L Sodium Sulfate Chemical compound [Na+].[Na+].[O-]S([O-])(=O)=O PMZURENOXWZQFD-UHFFFAOYSA-L 0.000 description 1
- 238000002105 Southern blotting Methods 0.000 description 1
- 241001284373 Spinus Species 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 235000021355 Stearic acid Nutrition 0.000 description 1
- 108010090804 Streptavidin Proteins 0.000 description 1
- 101000874347 Streptococcus agalactiae IgA FC receptor Proteins 0.000 description 1
- 101000895926 Streptomyces plicatus Endo-beta-N-acetylglucosaminidase H Proteins 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- 102000019197 Superoxide Dismutase Human genes 0.000 description 1
- 108010012715 Superoxide dismutase Proteins 0.000 description 1
- NSOXQYCFHDMMGV-UHFFFAOYSA-N Tetrakis(2-hydroxypropyl)ethylenediamine Chemical compound CC(O)CN(CC(C)O)CCN(CC(C)O)CC(C)O NSOXQYCFHDMMGV-UHFFFAOYSA-N 0.000 description 1
- WDLRUFUQRNWCPK-UHFFFAOYSA-N Tetraxetan Chemical compound OC(=O)CN1CCN(CC(O)=O)CCN(CC(O)=O)CCN(CC(O)=O)CC1 WDLRUFUQRNWCPK-UHFFFAOYSA-N 0.000 description 1
- 229910052776 Thorium Inorganic materials 0.000 description 1
- 108010065282 UDP xylose-protein xylosyltransferase Proteins 0.000 description 1
- 102100038413 UDP-N-acetylglucosamine-dolichyl-phosphate N-acetylglucosaminephosphotransferase Human genes 0.000 description 1
- 108010024501 UDPacetylglucosamine-dolichyl-phosphate acetylglucosamine-1-phosphate transferase Proteins 0.000 description 1
- AXQLFFDZXPOFPO-UHFFFAOYSA-N UNPD216 Natural products O1C(CO)C(O)C(OC2C(C(O)C(O)C(CO)O2)O)C(NC(=O)C)C1OC(C1O)C(O)C(CO)OC1OC1C(O)C(O)C(O)OC1CO AXQLFFDZXPOFPO-UHFFFAOYSA-N 0.000 description 1
- 229910052770 Uranium Inorganic materials 0.000 description 1
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 1
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 1
- 108050001741 Xylosyltransferases Proteins 0.000 description 1
- 241000607447 Yersinia enterocolitica Species 0.000 description 1
- NNLVGZFZQQXQNW-ADJNRHBOSA-N [(2r,3r,4s,5r,6s)-4,5-diacetyloxy-3-[(2s,3r,4s,5r,6r)-3,4,5-triacetyloxy-6-(acetyloxymethyl)oxan-2-yl]oxy-6-[(2r,3r,4s,5r,6s)-4,5,6-triacetyloxy-2-(acetyloxymethyl)oxan-3-yl]oxyoxan-2-yl]methyl acetate Chemical compound O([C@@H]1O[C@@H]([C@H]([C@H](OC(C)=O)[C@H]1OC(C)=O)O[C@H]1[C@@H]([C@@H](OC(C)=O)[C@H](OC(C)=O)[C@@H](COC(C)=O)O1)OC(C)=O)COC(=O)C)[C@@H]1[C@@H](COC(C)=O)O[C@@H](OC(C)=O)[C@H](OC(C)=O)[C@H]1OC(C)=O NNLVGZFZQQXQNW-ADJNRHBOSA-N 0.000 description 1
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 1
- XAKBSHICSHRJCL-UHFFFAOYSA-N [CH2]C(=O)C1=CC=CC=C1 Chemical group [CH2]C(=O)C1=CC=CC=C1 XAKBSHICSHRJCL-UHFFFAOYSA-N 0.000 description 1
- 239000008351 acetate buffer Substances 0.000 description 1
- DPXJVFZANSGRMM-UHFFFAOYSA-N acetic acid;2,3,4,5,6-pentahydroxyhexanal;sodium Chemical compound [Na].CC(O)=O.OCC(O)C(O)C(O)C(O)C=O DPXJVFZANSGRMM-UHFFFAOYSA-N 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- NIXOWILDQLNWCW-UHFFFAOYSA-M acrylate group Chemical group C(C=C)(=O)[O-] NIXOWILDQLNWCW-UHFFFAOYSA-M 0.000 description 1
- NIXOWILDQLNWCW-UHFFFAOYSA-N acrylic acid group Chemical group C(C=C)(=O)O NIXOWILDQLNWCW-UHFFFAOYSA-N 0.000 description 1
- 239000000654 additive Substances 0.000 description 1
- 239000000556 agonist Substances 0.000 description 1
- 150000001298 alcohols Chemical class 0.000 description 1
- 150000001299 aldehydes Chemical class 0.000 description 1
- 235000010443 alginic acid Nutrition 0.000 description 1
- 239000000783 alginic acid Substances 0.000 description 1
- 229920000615 alginic acid Polymers 0.000 description 1
- 229960001126 alginic acid Drugs 0.000 description 1
- 150000004781 alginic acids Chemical class 0.000 description 1
- 150000001335 aliphatic alkanes Chemical class 0.000 description 1
- 125000003342 alkenyl group Chemical group 0.000 description 1
- 125000003282 alkyl amino group Chemical group 0.000 description 1
- 229920013820 alkyl cellulose Polymers 0.000 description 1
- 125000004414 alkyl thio group Chemical group 0.000 description 1
- 230000002152 alkylating effect Effects 0.000 description 1
- 125000005237 alkyleneamino group Chemical group 0.000 description 1
- 125000005238 alkylenediamino group Chemical group 0.000 description 1
- 125000005530 alkylenedioxy group Chemical group 0.000 description 1
- 125000005529 alkyleneoxy group Chemical group 0.000 description 1
- 125000000304 alkynyl group Chemical group 0.000 description 1
- 208000026935 allergic disease Diseases 0.000 description 1
- 108010070113 alpha-1,3-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase I Proteins 0.000 description 1
- GZCGUPFRVQAUEE-UHFFFAOYSA-N alpha-D-galactose Natural products OCC(O)C(O)C(O)C(O)C=O GZCGUPFRVQAUEE-UHFFFAOYSA-N 0.000 description 1
- WQZGKKKJIJFFOK-UHFFFAOYSA-N alpha-D-glucopyranose Natural products OCC1OC(O)C(O)C(O)C1O WQZGKKKJIJFFOK-UHFFFAOYSA-N 0.000 description 1
- HSFWRNGVRCDJHI-UHFFFAOYSA-N alpha-acetylene Natural products C#C HSFWRNGVRCDJHI-UHFFFAOYSA-N 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- 150000003862 amino acid derivatives Chemical class 0.000 description 1
- MDFFNEOEWAXZRQ-UHFFFAOYSA-N aminyl Chemical compound [NH2] MDFFNEOEWAXZRQ-UHFFFAOYSA-N 0.000 description 1
- 238000012870 ammonium sulfate precipitation Methods 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 238000004873 anchoring Methods 0.000 description 1
- 239000003957 anion exchange resin Substances 0.000 description 1
- 229940121363 anti-inflammatory agent Drugs 0.000 description 1
- 239000002260 anti-inflammatory agent Substances 0.000 description 1
- 239000002246 antineoplastic agent Substances 0.000 description 1
- 229940041181 antineoplastic drug Drugs 0.000 description 1
- PYMYPHUHKUWMLA-UHFFFAOYSA-N arabinose Natural products OCC(O)C(O)C(O)C=O PYMYPHUHKUWMLA-UHFFFAOYSA-N 0.000 description 1
- 125000005165 aryl thioxy group Chemical group 0.000 description 1
- 125000004104 aryloxy group Chemical group 0.000 description 1
- 125000000613 asparagine group Chemical group N[C@@H](CC(N)=O)C(=O)* 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- ISAOCJYIOMOJEB-UHFFFAOYSA-N benzoin Chemical group C=1C=CC=CC=1C(O)C(=O)C1=CC=CC=C1 ISAOCJYIOMOJEB-UHFFFAOYSA-N 0.000 description 1
- 125000001797 benzyl group Chemical group [H]C1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])* 0.000 description 1
- AXQLFFDZXPOFPO-UNTPKZLMSA-N beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-Glcp Chemical compound O([C@@H]1O[C@H](CO)[C@H](O)[C@@H]([C@H]1O)O[C@H]1[C@@H]([C@H]([C@H](O)[C@@H](CO)O1)O[C@H]1[C@@H]([C@@H](O)[C@@H](O)[C@@H](CO)O1)O)NC(=O)C)[C@H]1[C@H](O)[C@@H](O)[C@H](O)O[C@@H]1CO AXQLFFDZXPOFPO-UNTPKZLMSA-N 0.000 description 1
- SRBFZHDQGSBBOR-UHFFFAOYSA-N beta-D-Pyranose-Lyxose Natural products OC1COC(O)C(O)C1O SRBFZHDQGSBBOR-UHFFFAOYSA-N 0.000 description 1
- 229940000635 beta-alanine Drugs 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 229920002988 biodegradable polymer Polymers 0.000 description 1
- 239000004621 biodegradable polymer Substances 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- 125000000319 biphenyl-4-yl group Chemical group [H]C1=C([H])C([H])=C([H])C([H])=C1C1=C([H])C([H])=C([*])C([H])=C1[H] 0.000 description 1
- ACBQROXDOHKANW-UHFFFAOYSA-N bis(4-nitrophenyl) carbonate Chemical compound C1=CC([N+](=O)[O-])=CC=C1OC(=O)OC1=CC=C([N+]([O-])=O)C=C1 ACBQROXDOHKANW-UHFFFAOYSA-N 0.000 description 1
- 230000017531 blood circulation Effects 0.000 description 1
- 229910052794 bromium Inorganic materials 0.000 description 1
- 125000000484 butyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 239000006227 byproduct Substances 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- CJZGTCYPCWQAJB-UHFFFAOYSA-L calcium stearate Chemical compound [Ca+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O CJZGTCYPCWQAJB-UHFFFAOYSA-L 0.000 description 1
- 239000008116 calcium stearate Substances 0.000 description 1
- 235000013539 calcium stearate Nutrition 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 238000005251 capillar electrophoresis Methods 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- 150000001721 carbon Chemical group 0.000 description 1
- 150000004649 carbonic acid derivatives Chemical class 0.000 description 1
- PFKFTWBEEFSNDU-UHFFFAOYSA-N carbonyldiimidazole Chemical compound C1=CN=CN1C(=O)N1C=CN=C1 PFKFTWBEEFSNDU-UHFFFAOYSA-N 0.000 description 1
- 235000010948 carboxy methyl cellulose Nutrition 0.000 description 1
- UHBYWPGGCSDKFX-UHFFFAOYSA-N carboxyglutamic acid Chemical compound OC(=O)C(N)CC(C(O)=O)C(O)=O UHBYWPGGCSDKFX-UHFFFAOYSA-N 0.000 description 1
- 150000007942 carboxylates Chemical class 0.000 description 1
- 239000008112 carboxymethyl-cellulose Substances 0.000 description 1
- 235000010418 carrageenan Nutrition 0.000 description 1
- 229920001525 carrageenan Polymers 0.000 description 1
- 239000000679 carrageenan Substances 0.000 description 1
- 229940113118 carrageenan Drugs 0.000 description 1
- 238000005341 cation exchange Methods 0.000 description 1
- 150000001768 cations Chemical class 0.000 description 1
- 239000006143 cell culture medium Substances 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 229920002301 cellulose acetate Polymers 0.000 description 1
- 229920006217 cellulose acetate butyrate Polymers 0.000 description 1
- 229940081734 cellulose acetate phthalate Drugs 0.000 description 1
- 229920003086 cellulose ether Polymers 0.000 description 1
- 229920006218 cellulose propionate Polymers 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 239000013522 chelant Substances 0.000 description 1
- 238000009614 chemical analysis method Methods 0.000 description 1
- 239000007795 chemical reaction product Substances 0.000 description 1
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 1
- 229910052801 chlorine Inorganic materials 0.000 description 1
- 239000000460 chlorine Substances 0.000 description 1
- 235000012000 cholesterol Nutrition 0.000 description 1
- 238000011098 chromatofocusing Methods 0.000 description 1
- 230000004087 circulation Effects 0.000 description 1
- 239000007979 citrate buffer Substances 0.000 description 1
- 239000004927 clay Substances 0.000 description 1
- 230000010405 clearance mechanism Effects 0.000 description 1
- 229940105778 coagulation factor viii Drugs 0.000 description 1
- 238000013329 compounding Methods 0.000 description 1
- 239000012141 concentrate Substances 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 239000000356 contaminant Substances 0.000 description 1
- 238000012937 correction Methods 0.000 description 1
- 239000002739 cryptand Substances 0.000 description 1
- 125000004122 cyclic group Chemical group 0.000 description 1
- 125000000392 cycloalkenyl group Chemical group 0.000 description 1
- 229940097362 cyclodextrins Drugs 0.000 description 1
- 125000000582 cycloheptyl group Chemical group [H]C1([H])C([H])([H])C([H])([H])C([H])([H])C([H])(*)C([H])([H])C1([H])[H] 0.000 description 1
- 125000001511 cyclopentyl group Chemical group [H]C1([H])C([H])([H])C([H])([H])C([H])(*)C1([H])[H] 0.000 description 1
- 125000004186 cyclopropylmethyl group Chemical group [H]C([H])(*)C1([H])C([H])([H])C1([H])[H] 0.000 description 1
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 1
- 210000000805 cytoplasm Anatomy 0.000 description 1
- 231100000599 cytotoxic agent Toxicity 0.000 description 1
- 239000002619 cytotoxin Substances 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- 239000012024 dehydrating agents Substances 0.000 description 1
- YSMODUONRAFBET-UHFFFAOYSA-N delta-DL-hydroxylysine Natural products NCC(O)CCC(N)C(O)=O YSMODUONRAFBET-UHFFFAOYSA-N 0.000 description 1
- 108010005905 delta-hGHR Proteins 0.000 description 1
- 239000000412 dendrimer Substances 0.000 description 1
- 229920000736 dendritic polymer Polymers 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 238000003795 desorption Methods 0.000 description 1
- 230000001904 diabetogenic effect Effects 0.000 description 1
- 238000011026 diafiltration Methods 0.000 description 1
- 125000004427 diamine group Chemical group 0.000 description 1
- MROCJMGDEKINLD-UHFFFAOYSA-N dichlorosilane Chemical compound Cl[SiH2]Cl MROCJMGDEKINLD-UHFFFAOYSA-N 0.000 description 1
- 125000005442 diisocyanate group Chemical group 0.000 description 1
- 239000000539 dimer Substances 0.000 description 1
- 230000003292 diminished effect Effects 0.000 description 1
- 230000003467 diminishing effect Effects 0.000 description 1
- 150000002009 diols Chemical class 0.000 description 1
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 1
- 108010088016 dolichyl-phosphate beta-D-mannosyltransferase Proteins 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 230000012361 double-strand break repair Effects 0.000 description 1
- 230000009977 dual effect Effects 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 239000003480 eluent Substances 0.000 description 1
- 230000001159 endocytotic effect Effects 0.000 description 1
- 210000002889 endothelial cell Anatomy 0.000 description 1
- 230000002708 enhancing effect Effects 0.000 description 1
- 230000009144 enzymatic modification Effects 0.000 description 1
- 210000002919 epithelial cell Anatomy 0.000 description 1
- YSMODUONRAFBET-UHNVWZDZSA-N erythro-5-hydroxy-L-lysine Chemical compound NC[C@H](O)CC[C@H](N)C(O)=O YSMODUONRAFBET-UHNVWZDZSA-N 0.000 description 1
- 210000003743 erythrocyte Anatomy 0.000 description 1
- 150000002170 ethers Chemical group 0.000 description 1
- 235000019325 ethyl cellulose Nutrition 0.000 description 1
- 229920001249 ethyl cellulose Polymers 0.000 description 1
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 description 1
- 229940093476 ethylene glycol Drugs 0.000 description 1
- 125000002534 ethynyl group Chemical group [H]C#C* 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 238000000855 fermentation Methods 0.000 description 1
- 230000004151 fermentation Effects 0.000 description 1
- 102000013361 fetuin Human genes 0.000 description 1
- 108060002885 fetuin Proteins 0.000 description 1
- 108010069898 fibrinogen fragment X Proteins 0.000 description 1
- 239000012467 final product Substances 0.000 description 1
- 239000000796 flavoring agent Substances 0.000 description 1
- 235000019634 flavors Nutrition 0.000 description 1
- 229910052731 fluorine Inorganic materials 0.000 description 1
- 239000011737 fluorine Substances 0.000 description 1
- 235000013305 food Nutrition 0.000 description 1
- 235000019253 formic acid Nutrition 0.000 description 1
- 238000013467 fragmentation Methods 0.000 description 1
- 238000006062 fragmentation reaction Methods 0.000 description 1
- 230000008014 freezing Effects 0.000 description 1
- 238000007710 freezing Methods 0.000 description 1
- 150000002242 furanose derivatives Chemical class 0.000 description 1
- 150000002243 furanoses Chemical group 0.000 description 1
- 108010001671 galactoside 3-fucosyltransferase Proteins 0.000 description 1
- 108010082530 galactosyl-1-3-N-acetylgalactosaminyl-specific 2,6-sialyltransferase Proteins 0.000 description 1
- 238000002523 gelfiltration Methods 0.000 description 1
- 230000024924 glomerular filtration Effects 0.000 description 1
- 229940097043 glucuronic acid Drugs 0.000 description 1
- 108010026195 glycanase Proteins 0.000 description 1
- 150000002334 glycols Chemical class 0.000 description 1
- 150000002337 glycosamines Chemical class 0.000 description 1
- 229930004094 glycosylphosphatidylinositol Natural products 0.000 description 1
- 125000003630 glycyl group Chemical group [H]N([H])C([H])([H])C(*)=O 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 210000004349 growth plate Anatomy 0.000 description 1
- 229940037467 helicobacter pylori Drugs 0.000 description 1
- 125000000623 heterocyclic group Chemical group 0.000 description 1
- 125000004366 heterocycloalkenyl group Chemical group 0.000 description 1
- 230000005745 host immune response Effects 0.000 description 1
- 235000020256 human milk Nutrition 0.000 description 1
- 210000004251 human milk Anatomy 0.000 description 1
- 125000001183 hydrocarbyl group Chemical group 0.000 description 1
- 125000004435 hydrogen atom Chemical group [H]* 0.000 description 1
- 239000000852 hydrogen donor Substances 0.000 description 1
- 238000004191 hydrophobic interaction chromatography Methods 0.000 description 1
- 229920013821 hydroxy alkyl cellulose Polymers 0.000 description 1
- WGCNASOHLSPBMP-UHFFFAOYSA-N hydroxyacetaldehyde Natural products OCC=O WGCNASOHLSPBMP-UHFFFAOYSA-N 0.000 description 1
- 125000002349 hydroxyamino group Chemical group [H]ON([H])[*] 0.000 description 1
- 229910052588 hydroxylapatite Inorganic materials 0.000 description 1
- 235000010977 hydroxypropyl cellulose Nutrition 0.000 description 1
- 239000001863 hydroxypropyl cellulose Substances 0.000 description 1
- 235000010979 hydroxypropyl methyl cellulose Nutrition 0.000 description 1
- 229920003088 hydroxypropyl methyl cellulose Polymers 0.000 description 1
- 239000001866 hydroxypropyl methyl cellulose Substances 0.000 description 1
- UFVKGYZPFZQRLF-UHFFFAOYSA-N hydroxypropyl methyl cellulose Chemical compound OC1C(O)C(OC)OC(CO)C1OC1C(O)C(O)C(OC2C(C(O)C(OC3C(C(O)C(O)C(CO)O3)O)C(CO)O2)O)C(CO)O1 UFVKGYZPFZQRLF-UHFFFAOYSA-N 0.000 description 1
- 239000000960 hypophysis hormone Substances 0.000 description 1
- 150000003949 imides Chemical class 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 230000002998 immunogenetic effect Effects 0.000 description 1
- 230000009851 immunogenic response Effects 0.000 description 1
- 238000002513 implantation Methods 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 239000012535 impurity Substances 0.000 description 1
- 238000011065 in-situ storage Methods 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 229940055742 indium-111 Drugs 0.000 description 1
- APFVFJFRJDLVQX-AHCXROLUSA-N indium-111 Chemical compound [111In] APFVFJFRJDLVQX-AHCXROLUSA-N 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 239000004615 ingredient Substances 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 229910001867 inorganic solvent Inorganic materials 0.000 description 1
- 239000003049 inorganic solvent Substances 0.000 description 1
- 230000002608 insulinlike Effects 0.000 description 1
- 229940079322 interferon Drugs 0.000 description 1
- 210000000936 intestine Anatomy 0.000 description 1
- 238000007917 intracranial administration Methods 0.000 description 1
- 238000007914 intraventricular administration Methods 0.000 description 1
- 238000011835 investigation Methods 0.000 description 1
- 238000005342 ion exchange Methods 0.000 description 1
- 125000000959 isobutyl group Chemical group [H]C([H])([H])C([H])(C([H])([H])[H])C([H])([H])* 0.000 description 1
- 239000012948 isocyanate Substances 0.000 description 1
- 150000002513 isocyanates Chemical class 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- 125000001449 isopropyl group Chemical group [H]C([H])([H])C([H])(*)C([H])([H])[H] 0.000 description 1
- 150000002540 isothiocyanates Chemical class 0.000 description 1
- 150000002576 ketones Chemical group 0.000 description 1
- 210000003127 knee Anatomy 0.000 description 1
- 230000006651 lactation Effects 0.000 description 1
- JJTUDXZGHPGLLC-UHFFFAOYSA-N lactide Chemical compound CC1OC(=O)C(C)OC1=O JJTUDXZGHPGLLC-UHFFFAOYSA-N 0.000 description 1
- IEQCXFNWPAHHQR-UHFFFAOYSA-N lacto-N-neotetraose Natural products OCC1OC(OC2C(C(OC3C(OC(O)C(O)C3O)CO)OC(CO)C2O)O)C(NC(=O)C)C(O)C1OC1OC(CO)C(O)C(O)C1O IEQCXFNWPAHHQR-UHFFFAOYSA-N 0.000 description 1
- USIPEGYTBGEPJN-UHFFFAOYSA-N lacto-N-tetraose Natural products O1C(CO)C(O)C(OC2C(C(O)C(O)C(CO)O2)O)C(NC(=O)C)C1OC1C(O)C(CO)OC(OC(C(O)CO)C(O)C(O)C=O)C1O USIPEGYTBGEPJN-UHFFFAOYSA-N 0.000 description 1
- 229940062780 lacto-n-neotetraose Drugs 0.000 description 1
- 238000011031 large-scale manufacturing process Methods 0.000 description 1
- 229940040102 levulinic acid Drugs 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 238000004895 liquid chromatography mass spectrometry Methods 0.000 description 1
- 230000004807 localization Effects 0.000 description 1
- 210000004324 lymphatic system Anatomy 0.000 description 1
- 230000002934 lysing effect Effects 0.000 description 1
- 239000004325 lysozyme Substances 0.000 description 1
- 229960000274 lysozyme Drugs 0.000 description 1
- 235000010335 lysozyme Nutrition 0.000 description 1
- 229920002521 macromolecule Polymers 0.000 description 1
- 229910052749 magnesium Inorganic materials 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Substances [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 1
- 229910052943 magnesium sulfate Inorganic materials 0.000 description 1
- 230000014759 maintenance of location Effects 0.000 description 1
- 230000000873 masking effect Effects 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 230000010534 mechanism of action Effects 0.000 description 1
- 230000003340 mental effect Effects 0.000 description 1
- 239000002207 metabolite Substances 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 229910021645 metal ion Inorganic materials 0.000 description 1
- 125000005395 methacrylic acid group Chemical group 0.000 description 1
- KNWQLFOXPQZGPX-UHFFFAOYSA-N methanesulfonyl fluoride Chemical compound CS(F)(=O)=O KNWQLFOXPQZGPX-UHFFFAOYSA-N 0.000 description 1
- HRDXJKGNWSUIBT-UHFFFAOYSA-N methoxybenzene Chemical group [CH2]OC1=CC=CC=C1 HRDXJKGNWSUIBT-UHFFFAOYSA-N 0.000 description 1
- 229920000609 methyl cellulose Polymers 0.000 description 1
- 235000010981 methylcellulose Nutrition 0.000 description 1
- 239000001923 methylcellulose Substances 0.000 description 1
- LSDPWZHWYPCBBB-UHFFFAOYSA-O methylsulfide anion Chemical compound [SH2+]C LSDPWZHWYPCBBB-UHFFFAOYSA-O 0.000 description 1
- 238000000520 microinjection Methods 0.000 description 1
- 235000013336 milk Nutrition 0.000 description 1
- 239000008267 milk Substances 0.000 description 1
- 210000004080 milk Anatomy 0.000 description 1
- 230000003278 mimic effect Effects 0.000 description 1
- 230000033607 mismatch repair Effects 0.000 description 1
- 239000002808 molecular sieve Substances 0.000 description 1
- HPEUEJRPDGMIMY-IFQPEPLCSA-N molybdopterin Chemical compound O([C@H]1N2)[C@H](COP(O)(O)=O)C(S)=C(S)[C@@H]1NC1=C2N=C(N)NC1=O HPEUEJRPDGMIMY-IFQPEPLCSA-N 0.000 description 1
- 125000006682 monohaloalkyl group Chemical group 0.000 description 1
- 125000004572 morpholin-3-yl group Chemical group N1C(COCC1)* 0.000 description 1
- 230000000869 mutational effect Effects 0.000 description 1
- 125000004108 n-butyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])C([H])([H])* 0.000 description 1
- 125000003136 n-heptyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])* 0.000 description 1
- 125000001280 n-hexyl group Chemical group C(CCCCC)* 0.000 description 1
- 125000000740 n-pentyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])* 0.000 description 1
- 125000004123 n-propyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])* 0.000 description 1
- 238000001728 nano-filtration Methods 0.000 description 1
- 239000006225 natural substrate Substances 0.000 description 1
- 230000004112 neuroprotection Effects 0.000 description 1
- 125000006502 nitrobenzyl group Chemical group 0.000 description 1
- 229920001220 nitrocellulos Polymers 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 238000007899 nucleic acid hybridization Methods 0.000 description 1
- 238000001668 nucleic acid synthesis Methods 0.000 description 1
- 239000002777 nucleoside Substances 0.000 description 1
- 125000003835 nucleoside group Chemical group 0.000 description 1
- 235000016709 nutrition Nutrition 0.000 description 1
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical compound CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 1
- OQCDKBAXFALNLD-UHFFFAOYSA-N octadecanoic acid Natural products CCCCCCCC(C)CCCCCCCCC(O)=O OQCDKBAXFALNLD-UHFFFAOYSA-N 0.000 description 1
- 229920002113 octoxynol Polymers 0.000 description 1
- 235000019198 oils Nutrition 0.000 description 1
- 239000002751 oligonucleotide probe Substances 0.000 description 1
- 239000003960 organic solvent Substances 0.000 description 1
- 210000001672 ovary Anatomy 0.000 description 1
- 238000012261 overproduction Methods 0.000 description 1
- 238000010525 oxidative degradation reaction Methods 0.000 description 1
- 230000001590 oxidative effect Effects 0.000 description 1
- 150000002924 oxiranes Chemical class 0.000 description 1
- 125000005702 oxyalkylene group Chemical group 0.000 description 1
- 238000002638 palliative care Methods 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 244000052769 pathogen Species 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- XYJRXVWERLGGKC-UHFFFAOYSA-D pentacalcium;hydroxide;triphosphate Chemical compound [OH-].[Ca+2].[Ca+2].[Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O XYJRXVWERLGGKC-UHFFFAOYSA-D 0.000 description 1
- 239000000813 peptide hormone Substances 0.000 description 1
- 238000010647 peptide synthesis reaction Methods 0.000 description 1
- 239000000816 peptidomimetic Substances 0.000 description 1
- KHIWWQKSHDUIBK-UHFFFAOYSA-M periodate Chemical compound [O-]I(=O)(=O)=O KHIWWQKSHDUIBK-UHFFFAOYSA-M 0.000 description 1
- KHIWWQKSHDUIBK-UHFFFAOYSA-N periodic acid Chemical compound OI(=O)(=O)=O KHIWWQKSHDUIBK-UHFFFAOYSA-N 0.000 description 1
- 239000002953 phosphate buffered saline Substances 0.000 description 1
- WTJKGGKOPKCXLL-RRHRGVEJSA-N phosphatidylcholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCCC=CCCCCCCCC WTJKGGKOPKCXLL-RRHRGVEJSA-N 0.000 description 1
- 150000003013 phosphoric acid derivatives Chemical class 0.000 description 1
- BZQFBWGGLXLEPQ-REOHCLBHSA-N phosphoserine Chemical compound OC(=O)[C@@H](N)COP(O)(O)=O BZQFBWGGLXLEPQ-REOHCLBHSA-N 0.000 description 1
- 230000006461 physiological response Effects 0.000 description 1
- 125000000587 piperidin-1-yl group Chemical group [H]C1([H])N(*)C([H])([H])C([H])([H])C([H])([H])C1([H])[H] 0.000 description 1
- 125000004483 piperidin-3-yl group Chemical group N1CC(CCC1)* 0.000 description 1
- 230000036470 plasma concentration Effects 0.000 description 1
- 229920000765 poly(2-oxazolines) Polymers 0.000 description 1
- 229920001584 poly(acrylomorpholines) Polymers 0.000 description 1
- 229920001490 poly(butyl methacrylate) polymer Polymers 0.000 description 1
- 229920001279 poly(ester amides) Polymers 0.000 description 1
- 229920001483 poly(ethyl methacrylate) polymer Polymers 0.000 description 1
- 229920000212 poly(isobutyl acrylate) Polymers 0.000 description 1
- 229920000205 poly(isobutyl methacrylate) Polymers 0.000 description 1
- 229920001606 poly(lactic acid-co-glycolic acid) Polymers 0.000 description 1
- 229920001306 poly(lactide-co-caprolactone) Polymers 0.000 description 1
- 229920000196 poly(lauryl methacrylate) Polymers 0.000 description 1
- 229920003229 poly(methyl methacrylate) Polymers 0.000 description 1
- 229920000184 poly(octadecyl acrylate) Polymers 0.000 description 1
- 229920002401 polyacrylamide Polymers 0.000 description 1
- 229920001281 polyalkylene Polymers 0.000 description 1
- 229920000768 polyamine Polymers 0.000 description 1
- 229920000515 polycarbonate Polymers 0.000 description 1
- 239000004417 polycarbonate Substances 0.000 description 1
- 229920000573 polyethylene Polymers 0.000 description 1
- 229920002643 polyglutamic acid Polymers 0.000 description 1
- 125000006684 polyhaloalkyl group Polymers 0.000 description 1
- 229920000129 polyhexylmethacrylate Polymers 0.000 description 1
- 229920000197 polyisopropyl acrylate Polymers 0.000 description 1
- 229920000656 polylysine Polymers 0.000 description 1
- 239000004926 polymethyl methacrylate Substances 0.000 description 1
- 229920000182 polyphenyl methacrylate Polymers 0.000 description 1
- 229920001296 polysiloxane Polymers 0.000 description 1
- 229920002223 polystyrene Polymers 0.000 description 1
- 229920003226 polyurethane urea Polymers 0.000 description 1
- 239000011118 polyvinyl acetate Substances 0.000 description 1
- 229920002689 polyvinyl acetate Polymers 0.000 description 1
- 229920000915 polyvinyl chloride Polymers 0.000 description 1
- 239000004800 polyvinyl chloride Substances 0.000 description 1
- 229920001290 polyvinyl ester Polymers 0.000 description 1
- 229920001289 polyvinyl ether Polymers 0.000 description 1
- 229920001291 polyvinyl halide Polymers 0.000 description 1
- 229920006316 polyvinylpyrrolidine Polymers 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 238000002953 preparative HPLC Methods 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 239000013615 primer Substances 0.000 description 1
- 229940002612 prodrug Drugs 0.000 description 1
- 239000000651 prodrug Substances 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 230000001737 promoting effect Effects 0.000 description 1
- 238000011321 prophylaxis Methods 0.000 description 1
- 229960004063 propylene glycol Drugs 0.000 description 1
- 235000013772 propylene glycol Nutrition 0.000 description 1
- 102000008467 protein O-GlcNAc transferase activity proteins Human genes 0.000 description 1
- 108040002385 protein O-GlcNAc transferase activity proteins Proteins 0.000 description 1
- 238000000159 protein binding assay Methods 0.000 description 1
- 239000012460 protein solution Substances 0.000 description 1
- 230000002797 proteolythic effect Effects 0.000 description 1
- 230000006337 proteolytic cleavage Effects 0.000 description 1
- 229940024999 proteolytic enzymes for treatment of wounds and ulcers Drugs 0.000 description 1
- 210000001938 protoplast Anatomy 0.000 description 1
- 125000000561 purinyl group Chemical group N1=C(N=C2N=CNC2=C1)* 0.000 description 1
- 150000003214 pyranose derivatives Chemical class 0.000 description 1
- 150000003215 pyranoses Chemical class 0.000 description 1
- 125000003373 pyrazinyl group Chemical group 0.000 description 1
- 125000005344 pyridylmethyl group Chemical group [H]C1=C([H])C([H])=C([H])C(=N1)C([H])([H])* 0.000 description 1
- 229910052705 radium Inorganic materials 0.000 description 1
- HCWPIIXVSYCSAN-UHFFFAOYSA-N radium atom Chemical compound [Ra] HCWPIIXVSYCSAN-UHFFFAOYSA-N 0.000 description 1
- 239000000376 reactant Substances 0.000 description 1
- 239000012429 reaction media Substances 0.000 description 1
- 238000003259 recombinant expression Methods 0.000 description 1
- 239000002684 recombinant hormone Substances 0.000 description 1
- 238000010188 recombinant method Methods 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 238000004153 renaturation Methods 0.000 description 1
- 230000008439 repair process Effects 0.000 description 1
- 230000010076 replication Effects 0.000 description 1
- 230000000717 retained effect Effects 0.000 description 1
- 239000012465 retentate Substances 0.000 description 1
- 238000003757 reverse transcription PCR Methods 0.000 description 1
- 101150030372 rfaB gene Proteins 0.000 description 1
- 101150052269 rfaJ gene Proteins 0.000 description 1
- 210000003705 ribosome Anatomy 0.000 description 1
- 238000007151 ring opening polymerisation reaction Methods 0.000 description 1
- 238000005185 salting out Methods 0.000 description 1
- 229920006395 saturated elastomer Polymers 0.000 description 1
- 229930195734 saturated hydrocarbon Natural products 0.000 description 1
- 125000002914 sec-butyl group Chemical group [H]C([H])([H])C([H])([H])C([H])(*)C([H])([H])[H] 0.000 description 1
- 238000012764 semi-quantitative analysis Methods 0.000 description 1
- 125000003607 serino group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(O[H])([H])[H] 0.000 description 1
- 230000035939 shock Effects 0.000 description 1
- 239000010703 silicon Substances 0.000 description 1
- 239000000377 silicon dioxide Substances 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- URGAHOPLAPQHLN-UHFFFAOYSA-N sodium aluminosilicate Chemical compound [Na+].[Al+3].[O-][Si]([O-])=O.[O-][Si]([O-])=O URGAHOPLAPQHLN-UHFFFAOYSA-N 0.000 description 1
- 235000019812 sodium carboxymethyl cellulose Nutrition 0.000 description 1
- 229920001027 sodium carboxymethylcellulose Polymers 0.000 description 1
- 230000003381 solubilizing effect Effects 0.000 description 1
- 239000000243 solution Substances 0.000 description 1
- 238000000527 sonication Methods 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 230000009870 specific binding Effects 0.000 description 1
- 238000004611 spectroscopical analysis Methods 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 239000008117 stearic acid Substances 0.000 description 1
- 239000008174 sterile solution Substances 0.000 description 1
- 230000000638 stimulation Effects 0.000 description 1
- 210000002784 stomach Anatomy 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 239000000829 suppository Substances 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 230000002194 synthesizing effect Effects 0.000 description 1
- 238000010189 synthetic method Methods 0.000 description 1
- 230000001839 systemic circulation Effects 0.000 description 1
- 239000000454 talc Substances 0.000 description 1
- 235000012222 talc Nutrition 0.000 description 1
- 229910052623 talc Inorganic materials 0.000 description 1
- 229920001897 terpolymer Polymers 0.000 description 1
- 125000000999 tert-butyl group Chemical group [H]C([H])([H])C(*)(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- 125000004192 tetrahydrofuran-2-yl group Chemical group [H]C1([H])OC([H])(*)C([H])([H])C1([H])[H] 0.000 description 1
- 125000003831 tetrazolyl group Chemical group 0.000 description 1
- 229940126585 therapeutic drug Drugs 0.000 description 1
- 239000010409 thin film Substances 0.000 description 1
- 150000003573 thiols Chemical class 0.000 description 1
- 210000002303 tibia Anatomy 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 239000003053 toxin Substances 0.000 description 1
- 231100000765 toxin Toxicity 0.000 description 1
- 230000002103 transcriptional effect Effects 0.000 description 1
- 238000005809 transesterification reaction Methods 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 238000003151 transfection method Methods 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 238000011426 transformation method Methods 0.000 description 1
- 230000014621 translational initiation Effects 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- ITMCEJHCFYSIIV-UHFFFAOYSA-M triflate Chemical compound [O-]S(=O)(=O)C(F)(F)F ITMCEJHCFYSIIV-UHFFFAOYSA-M 0.000 description 1
- 150000004043 trisaccharides Chemical group 0.000 description 1
- 108010087967 type I signal peptidase Proteins 0.000 description 1
- 241000701447 unidentified baculovirus Species 0.000 description 1
- 210000001364 upper extremity Anatomy 0.000 description 1
- 229940035893 uracil Drugs 0.000 description 1
- DNYWZCXLKNTFFI-UHFFFAOYSA-N uranium Chemical compound [U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U][U] DNYWZCXLKNTFFI-UHFFFAOYSA-N 0.000 description 1
- 210000003934 vacuole Anatomy 0.000 description 1
- 239000004474 valine Substances 0.000 description 1
- 235000015112 vegetable and seed oil Nutrition 0.000 description 1
- 235000019871 vegetable fat Nutrition 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- 238000012795 verification Methods 0.000 description 1
- 125000000391 vinyl group Chemical group [H]C([*])=C([H])[H] 0.000 description 1
- 229920002554 vinyl polymer Polymers 0.000 description 1
- 239000013603 viral vector Substances 0.000 description 1
- 230000036642 wellbeing Effects 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
- 238000010626 work up procedure Methods 0.000 description 1
- 210000005253 yeast cell Anatomy 0.000 description 1
- 229940098232 yersinia enterocolitica Drugs 0.000 description 1
- UHVMMEOXYDMDKI-JKYCWFKZSA-L zinc;1-(5-cyanopyridin-2-yl)-3-[(1s,2s)-2-(6-fluoro-2-hydroxy-3-propanoylphenyl)cyclopropyl]urea;diacetate Chemical compound [Zn+2].CC([O-])=O.CC([O-])=O.CCC(=O)C1=CC=C(F)C([C@H]2[C@H](C2)NC(=O)NC=2N=CC(=CC=2)C#N)=C1O UHVMMEOXYDMDKI-JKYCWFKZSA-L 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
- C07K14/61—Growth hormone [GH], i.e. somatotropin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/22—Hormones
- A61K38/27—Growth hormone [GH], i.e. somatotropin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P5/00—Drugs for disorders of the endocrine system
- A61P5/06—Drugs for disorders of the endocrine system of the anterior pituitary hormones, e.g. TSH, ACTH, FSH, LH, PRL, GH
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Definitions
- Human growth hormone (hGH) and agonist variants thereof are members of a family of recombinant proteins, described in U.S. Pat. No. 4,658,021 and U.S. Pat. No. 5,633,352. Their recombinant production and methods of use are detailed in U.S. Pat. Nos. 4,342,832, 4,601,980; U.S. Pat. No. 4,898,830; U.S. Pat. No. 5,424,199; and U.S. Pat. No. 5,795,745. Human growth hormone participates in various aspects of the regulation of normal human growth and development.
- this 22 kDa pituitary hormone modulates a multitude of biological effects, such as linear growth (somatogenesis), lactation, activation of macrophages, and insulin-like and diabetogenic effects.
- somatogenesis linear growth
- lactation lactation
- activation of macrophages and insulin-like and diabetogenic effects.
- Chawla Annu. Rev. Med., 34: 519 (1983); Edwards et al., Science, 239: 769 (1988); Isaksson et al., Annu. Rev. Physiol., 47: 483 (1985); Thomer and Vance, J. Clin. Invest., 82: 745 (1988); Hughes and Friesen, Annu. Rev. Physiol., 47: 469 (1985).
- glycosylated and non-glycosylated peptides for engendering a particular physiological response is well known in the medicinal arts. Both purified and recombinant hGH have been used for treating conditions and diseases due to hGH deficiency, e.g., dwarfism in children.
- a principal factor that has limited the use of therapeutic peptides is the immunogenic nature of most peptides. In a patient, an immunogenic response to an administered peptide can neutralize the peptide and/or lead to the development of an allergic response in the patient.
- Other deficiencies of therapeutic glycopeptides include suboptimal potency and rapid clearance rates.
- the problems inherent in peptide therapeutics are recognized in the art, and various methods of eliminating the problems have been investigated. For example, to provide soluble peptide therapeutics, synthetic polymers have been attached to the peptide backbone.
- PEG poly(ethylene glycol)
- the use of PEG to derivatize peptide therapeutics has been demonstrated to reduce the immunogenicity of the peptides.
- U.S. Pat. No. 4,179,337 discloses non-immunogenic polypeptides such as enzymes and peptide hormones coupled to polyethylene glycol (PEG) or polypropylene glycol. Between 10 and 100 moles of polymer are used per mole of polypeptide and at least 15% of the physiological activity is maintained. In addition to reduced immunogenicity, the clearance time in circulation is prolonged due to the increased size of the PEG-conjugate of the polypeptides in question.
- the principal mode of attachment of PEG, and its derivatives, to peptides is a non-specific bonding through a peptide amino acid residue (see e.g., U.S. Pat. No. 4,088,538 U.S. Pat. No. 4,496,689, U.S. Pat. No. 4,414,147, U.S. Pat. No. 4,055,635, and PCT WO 87/00056).
- Another mode of PEG-to-peptide attachment is through the non-specific oxidation of glycosyl residues on a glycopeptide (see e.g., WO 94/05332).
- poly(ethyleneglycol) is added in a random, non-specific manner to reactive residues on a peptide backbone.
- the random addition of PEG molecules has its inherent disadvantages, including, e.g. the lack of homogeneity in the final product and potential for reduction in the biological or enzymatic activity of the peptide. Therefore, a derivitization strategy that results in the formation of a specifically labeled, readily characterizable, essentially homogeneous product is far superior in the context of therapeutic peptide production. Such methods have been developed.
- homogeneous peptide therapeutics can be produced in vitro through the action of enzymes.
- enzyme-based syntheses have the advantages of regioselectivity and stereoselectivity.
- Two principal classes of enzymes that can be employed in the synthesis of labeled peptides are glycosyltransferases (e.g., sialyltransferases, oligosaccharyltransferases, N-acetylglucosaminyltransferases) and glycosidases. These enzymes can be used for the specific attachment of sugars which can be subsequently modified to comprise a therapeutic moiety.
- glycosyltransferases and modified glycosidases can be used to directly transfer modified sugars to a peptide backbone (see e.g., U.S. Pat. No. 6,399,336, and U.S. Patent Application Publications 20030040037, 20040132640, 20040137557, 20040126838, and 20040142856). Methods combining both chemical and enzymatic synthetic elements are also known (see e.g., Yamamoto et al. Carbohydr. Res. 305: 415-422 (1998) and U.S. Patent Application Publication 20040137557).
- the present invention provides a glycopegylated hGH that is therapeutically active and which has pharmacokinetic parameters and properties that are improved relative to an identical, or closely analogous, hGH peptide that is not glycopegylated. Furthermore, the present invention provides cost-effective methods by which improved hGH peptides can be produced on an industrial scale.
- Glycosyl residues have also been modified to bear ketone groups.
- Mahal and co-workers Science 276: 1125 (1997) have prepared N-levulinoyl mannosamine (“ManLev”), which has a ketone functionality at the position normally occupied by the acetyl group in the natural substrate. Cells were treated with the ManLev, thereby incorporating a ketone group onto the cell surface. See, also Saxon et al., Science 287: 2007 (2000); Hang et al., J. Am. Chem. Soc. 123: 1242 (2001); Yarema et al., J. Biol. Chem. 273: 31168 (1998); and Charter et al., Glycobiology 10: 1049 (2000).
- Carbohydrates are attached to glycopeptides in several ways of which N-linked to asparagine and mucin-type O-linked to serine and threonine are the most relevant for recombinant glycoprotein therapeutics.
- a determining factor for initiation of glycosylation of a protein is the primary sequence context, although clearly other factors including protein region and conformation have their roles.
- N-linked glycosylation occurs at the consensus sequence NXS/T, where X can be any amino acid but proline.
- polypeptides such as human growth hormone are readily proteolyzed by numerous proteases in the blood and lymphatic system. These proteases cleave the human growth hormone in both the amino internal and carboxy terminal regions, thereby fragmenting the protein and reducing the growth effects of hGH. The proteolysis also facilitates clearance of the degraded protein, dramatically reducing the residence time in the body after injection.
- proteases with protease resistance and method of producing such polypeptides.
- the present invention answers these needs by providing hGH mutants that contain newly introduced O-linked glycosylation sites, providing flexibility in glycosylation and/or glycoconjugation, e.g., glycoPEGylation of these recombinant hGH mutants.
- the O-glycosylation mutants optionally further include one or more proteolysis resistant mutation or sites for chemical PEGylation of region(s) most susceptible to proteases.
- the invention provides an industrially practical method for the modification of N- or O-linked mutant hGH peptides with modifying groups such as water-soluble polymers, therapeutic moieties, biomolecules, and the like. Of particular interest are methods in which the modified mutant hGH has improved properties, which enhance its use as a therapeutic or diagnostic agent.
- the present invention provides for hGH mutants with N-linked or O-linked glycosylation sites not found in wild-type hGH.
- Exemplary embodiments of the invention include N- or O-linked glycosylated hGH mutants having one or more characteristics selected from the following: glycoPEGylation, protease resistance, and chemically PEGylation.
- the present invention yields novel hGH derivatives with pharmacokinetic properties that are improved relative to the corresponding native hGH.
- the present invention provides an isolated nucleic acid comprising a polynucleotide sequence encoding a mutant human growth hormone.
- the mutant human growth hormone comprises an N-linked or O-linked glycosylation site and/or proteolysis resistant mutation(s) that are not present in wild-type human growth hormone.
- the wild-type human growth hormones have the amino acid sequence of pituitary-derived GH-N (SEQ ID NO:1) or placenta-derived GH-V (SEQ ID NO:2).
- the mutant human growth hormone includes the amino acid sequence of SEQ ID NO:3, 4, 5, 6, 7, 8, 9, 80, 81, 82, 83, 84, 85, 86, 87, and 88.
- the present invention provides an expression cassette or a cell that comprises a nucleic acid, e.g., an isolated nucleic acid, including a polynucleotide sequence encoding a mutant human growth hormone.
- the mutant human growth hormone includes an N-linked or O-linked glycosylation site and/or proteolysis inhibiting mutation(s) that are not present in the wild-type human growth hormone.
- the present invention provides a mutant glycoPEGylated human growth hormone that includes one or more N-linked or O-linked glycosylation site not present in the wild-type human growth hormone.
- the wild-type human growth hormone has the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:2.
- the mutant human growth hormone comprises the amino acid sequence of SEQ ID NO:3, 4, 5, 6, 7, 8, 9, 80, 81, 82, 83, 84, 85, 86, 87, and 88.
- the present invention provides a mutant human growth hormone that includes one or more N-linked or O-linked glycosylation site not present in the wild-type human growth hormone and one or more proteolysis resistant mutations(s) not present in the wild-type human growth hormone.
- the wild-type human growth hormone has the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:2.
- the mutant human growth hormone comprises the amino acid sequence of SEQ ID NO:3, 4, 5, 6, 7, 8, 9, 80, 81, 82, 83, 84, 85, 86, 87, and 88.
- the present invention provides a chemically PEGylated mutant human growth hormone that includes one or more N-linked or O-linked glycosylation site not present in the wild-type human growth hormone.
- the wild-type human growth hormone has the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:2.
- the mutant human growth hormone comprises the amino acid sequence of SEQ ID NO:3, 4, 5, 6, 7, 8, 9, 80, 81, 82, 83, 84, 85, 86, 87, and 88.
- the present invention provides a glycoPEGylated mutant human growth hormone that includes one or more N-linked or O-linked glycosylation site not present in the wild-type human growth hormone and one or more proteolysis resistant mutations(s) not present in the wild-type human growth hormone.
- the wild-type human growth hormone has the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:2.
- the mutant human growth hormone comprises the amino acid sequence of SEQ ID NO:3, 4, 5, 6, 7, 8, 9, 80, 81, 82, 83, 84, 85, 86, 87, and 88.
- the present invention provides a chemically PEGylated mutant human growth hormone that includes one or more N-linked or O-linked glycosylation site not present in the wild-type human growth hormone and one or more proteolysis resistant mutations(s) not present in the wild-type human growth hormone.
- the wild-type human growth hormone has the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:2.
- the mutant human growth hormone comprises the amino acid sequence of SEQ ID NO:3, 4, 5, 6, 7, 8, 9, 80, 81, 82, 83, 84, 85, 86, 87, and 88.
- the present invention provides a glycoPEGylated and chemically PEGylated mutant human growth hormone that includes one or more N-linked or O-linked glycosylation site not present in the wild-type human growth hormone.
- the wild-type human growth hormone has the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:2.
- the mutant human growth hormone comprises the amino acid sequence of SEQ ID NO:3, 4, 5, 6, 7, 8, 9, 80, 81, 82, 83, 84, 85, 86, 87, and 88.
- the present invention provides a glycoPEGylated and chemically PEGylated mutant human growth hormone that includes one or more N-linked or O-linked glycosylation site not present in the wild-type human growth hormone and one or more proteolysis resistant mutations(s) not present in the wild-type human growth hormone.
- the wild-type human growth hormone has the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:2.
- the mutant human growth hormone comprises the amino acid sequence of SEQ ID NO:3, 4, 5, 6, 7, 8, 9, 80, 81, 82, 83, 84, 85, 86, 87, and 88.
- the present invention provides a method for making a mutant human growth hormone that includes an N-linked or O-linked glycosylation site and/or proteolysis inhibiting mutation(s) that are not present in the wild-type human growth hormone.
- This method includes the steps of recombinantly producing the mutant human growth hormone, and glycosylating the mutant human growth hormone at the new glycosylation site.
- the wild-type human growth hormone has the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:2.
- the mutant human growth hormone comprises the amino acid sequence of SEQ ID NO:3, 4, 5, 6, 7, 8, 9, 80, 81, 82, 83, 84, 85, 86, 87, and 88.
- the present invention provides a pharmaceutical composition having a therapeutically effective amount of a mutant human growth hormone that includes an N-linked or O-linked glycosylation site and/or proteolysis inhibiting mutation(s) not present in the wild-type human growth hormone.
- the wild-type human growth hormone has the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:2.
- the mutant human growth hormone comprises the amino acid sequence of SEQ ID NO:3, 4, 5, 6, 7, 8, 9, 80, 81, 82, 83, 84, 85, 86, 87, and 88.
- the present invention provides a method for treating human growth hormone deficiency in a subject.
- the method includes administering to the subject an amount of a mutant human growth hormone effective to treat or ameliorate the growth hormone deficiency.
- the mutant human growth hormone used in this method comprises an N-linked or O-linked glycosylation site and/or proteolysis inhibiting mutation(s) that do not exist in the corresponding wild-type human growth hormone.
- the corresponding wild-type human growth hormone has the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:2.
- the mutant human growth hormone comprises the amino acid sequence of SEQ ID NO:3, 4, 5, 6, 7, 8, 9, 80, 81, 82, 83, 84, 85, 86, 87, and 88.
- the mutant human growth hormone is optionally conjugated to one or more modifying groups, preferably via glycoconjugation, giving rise to a glycosyl linking group between the glycosylation site and the modifying group.
- modifying groups preferably via glycoconjugation, giving rise to a glycosyl linking group between the glycosylation site and the modifying group.
- An exemplary modifying group is poly(ethylene glycol), otherwise known as PEG.
- “glycopegylated” hGH molecules are produced by the enzyme-mediated formation of a conjugate between a glycosylated or non-glycosylated hGH peptide and an enzymatically transferable saccharyl moiety that includes one or more poly(ethylene glycol) moieties within its structure
- the PEG moiety is attached to the saccharyl moiety directly (i.e., through a single group formed by the reaction of two reactive groups) or through a linker moiety, e.g., substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, etc.
- FIG. 1 are glycoPEGylation schemes for insect cell and mammalian cell produced hGH N-linked glycan mutants.
- FIG. 2 shows a pituitary derived hGH (GH-N) sequence into which six (6) different exemplary O-linked glycosylation sites have been introduced (SEQ ID NO:90).
- the wild-type amino acid sequence for GH-N (SEQ ID NO:1) is also shown for comparison.
- the arrows indicate the threonine residue of the GH-N glycan mutant on which O-linked glycosylation will occur.
- FIG. 3 includes the alignment of amino acid sequences for hGH O-linked GH-N mutant 134(rtg) ⁇ ttt (SEQ ID NO:91) and hGH O-linked 5′ GH-N mutant (SEQ ID NO:92) in which amino acids ⁇ 3 to ⁇ 1 (ptt) are inserted at the amino terminus, resulting in a 194 amino acid hGH polypeptide, with the native amino acid sequence of mature hGH-N1 (SEQ ID NO: 1).
- FIG. 4 includes the amino acid sequences of hGH O-linked GH-N mutant 134(rtg) ⁇ ttg (SEQ ID NO:93) and hGH O-linked 5′ GH-N mutant (SEQ ID NO:94) in which amino acids ⁇ 3 to ⁇ 1 (mvt) are inserted at the amino terminus, resulting in a 194 amino acid hGH polypeptide, with the native amino acid sequence of mature hGH-N1 (SEQ ID NO:1).
- FIG. 5A depicts the amino acid sequence of mature pituitary-derived human growth hormone (GH-N) (SEQ ID NO:1).
- FIG. 5B depicts the amino acid sequence of mature placenta-derived human growth hormone (GH-V) (SEQ ID NO:2).
- FIG. 5C depicts the amino acid sequence of human growth hormone mutant 1 (SEQ ID NO:3).
- FIG. 5D depicts the amino acid sequence of human growth hormone mutant 2 (SEQ ID NO:4).
- FIG. 5E depicts the amino acid sequence of human growth hormone mutant 3 (SEQ ID NO:5).
- FIG. 5F depicts the amino acid sequence of human growth hormone mutant 4 (SEQ ID NO:6).
- FIG. 5G depicts the amino acid sequence of human growth hormone mutant 5 (SEQ ID NO:7).
- FIG. 5H depicts the amino acid sequence of human growth hormone mutant 6 (SEQ ID NO:8).
- FIG. 5I depicts the amino acid sequence of human growth hormone mutant 7 (SEQ ID NO:9).
- FIG. 6A depicts the amino acid sequence of human growth hormone mutant 8 (SEQ ID NO:80).
- FIG. 6B depicts the amino acid sequence of human growth hormone mutant 9 (SEQ ID NO:81).
- FIG. 6C depicts the amino acid sequence of human growth hormone mutant 10 (SEQ ID NO:82).
- FIG. 6D depicts the amino acid sequence of human growth hormone mutant 11 (SEQ ID NO:83).
- FIG. 6E depicts the amino acid sequence of human growth hormone mutant 12 (SEQ ID NO:84).
- FIG. 6F depicts the amino acid sequence of human growth hormone mutant 13 (SEQ ID NO:85).
- FIG. 6G depicts the amino acid sequence of human growth hormone mutant 14 (SEQ ID NO:86).
- FIG. 6H depicts the amino acid sequence of human growth hormone mutant 15 (SEQ ID NO:87).
- FIG. 6I depicts the amino acid sequence of human growth hormone mutant 16 (SEQ ID NO:88).
- FIG. 6J depicts the amino acid sequence of human growth hormone mutant 17 (SEQ ID NO:83).
- FIG. 6K depicts the amino acid sequence of mature human growth hormone (GH-N) with the various proteolysis inhibiting mutation sites in bold (SEQ ID NO:95).
- FIG. 7 shows data for various hGH mutants with proteolysis inhibiting mutations from an Nb2-11 cell proliferation assay.
- FIG. 8 depicts exemplary reactions through which glycoPEGylation of mutant hGH can be achieved.
- FIG. 9 shows the gel runs for the starting material and product in the glycoPEGylation of hGH mutants ID# AI and AG (P 134 TQGAM and P 140 TQA).
- FIG. 10 shows the gel runs for the starting material and product in the glycoPEGylation of hGH mutant ID# AO (P 134 TINTIAN).
- FIG. 11 shows the results of an SDS PAGE silver stain to demonstrate the purity of four exemplary hGH-PEG conjugates.
- FIG. 12 shows the results of an Nb2-11 cell proliferation assay for seven hGH-PEG mutants relative to wild-type hGH.
- FIG. 13 shows the respective pharmacokinetic data in rats given subcutaneous administration of five hGH-PEG mutants (P 134 TINT).
- FIG. 14 shows the respective pharmacokinetic data in rats given subcutaneous administration of three hGH-PEG mutants (P 140 TQA).
- FIG. 15 shows the respective amount of weight gained by hypophysectomized rats given subcutaneous administration of five hGH-PEG mutants (P 134 TINT).
- FIG. 16 shows the respective amount of weight gained by hypophysectomized rats given subcutaneous administration of three hGH-PEG mutants with the P 140 TQA mutation motif and 1 hGH-PEG mutant with a P 3 TEIP mutation motif.
- FIG. 17 shows the respective serum IGF-1 levels in hypophysectomized rats given subcutaneous administration of two hGH-PEG mutants (P 134 TINT).
- FIG. 18 shows the respective serum IGF-1 levels in hypophysectomized rats given subcutaneous administration of three hGH-PEG mutants (P 134 TINT).
- FIG. 19 shows the respective serum IGF-1 levels in hypophysectomized rats given subcutaneous administration of three hGH-PEG mutants with the P 140 TQA mutation motif and 1 hGH-PEG mutant with a P 3 TEIP mutation motif.
- FIG. 20 shows the respective weight gain and respective serum IGF-1 levels over time in hypophysectomized rats that were administered a recombinant wild-type hGH and an exemplary hGH mutant at varying dosages.
- FIG. 21 shows the respective weight gain and respective serum IGF-1 levels over time in hypophysectomized rats that were administered a recombinant wild-type hGH and various exemplary hGH mutants.
- FIG. 22 shows the respective mean hGH concentration levels over time in rats that were administered single subcutaneous injections of a recombinant wild-type hGH and various exemplary hGH mutants.
- FIG. 23 shows an exemplary hGH mutant construct with protease recognition sites indicated in block shading and exemplary mutations indicated in bold lettering in the upper panel.
- mutations in an exemplary hGH mutant construct are indicated in bold underlined lettering and exemplary sites for chemical PEGylation are indicated in bold, encircled lettering.
- FIG. 24 are SDS-PAGE analysis results for two exemplary glycoPEGylated hGH, illustrating the extent to which two exemplary glycoPEGylated hGH mutants are chemically PEGylated over 18 hours.
- FIG. 25 shows the results of an Nb2-11 cell proliferation assay for seven hGH-PEG mutants relative to wild-type hGH.
- PEG poly(ethylene glycol), e.g. monomethoxy poly(ethyleneglycol) (m-PEG); PPG, poly(propyleneglycol); Ara, arabinosyl; Fru, fiuctosyl; Fuc, fucosyl; Gal, galactosyl; GalNAc, N-acetylgalactosaminyl; Glc, glucosyl; GlcNAc, N-acetylglucosaminyl; Man, mannosyl; ManAc, N-acetylmannosaminyl; Xyl, xylosyl; NeuAc, sialyl or N-acetylneuraminyl; Sia, sialyl or N-acetylneuraminyl, and derivatives and analogues thereof.
- nucleic acid refers to deoxyribonucleic acids (DNA) or ribonucleic acids (RNA) and polymers thereof in either single- or double-stranded form. Unless specifically limited, the term encompasses nucleic acids containing known analogues of natural nucleotides that have similar binding properties as the reference nucleic acid and are metabolized in a manner similar to naturally occurring nucleotides. Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g., degenerate codon substitutions), alleles, orthologs, SNPs, and complementary sequences as well as the sequence explicitly indicated.
- DNA deoxyribonucleic acids
- RNA ribonucleic acids
- degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues (Batzer et al., Nucleic Acid Res. 19:5081 (1991); Ohtsuka et al., J. Biol. Chem. 260:2605-2608 (1985); and Rossolini et al., Mol. Cell. Probes 8:91-98 (1994)).
- the term nucleic acid is used interchangeably with gene, cDNA, and mRNA encoded by a gene.
- gene means the segment of DNA involved in producing a polypeptide chain. It may include regions preceding and following the coding region (leader and trailer) as well as intervening sequences (introns) between individual coding segments (exons).
- nucleic acid or protein when applied to a nucleic acid or protein, denotes that the nucleic acid or protein is essentially free of other cellular components with which it is associated in the natural state. It is preferably in a homogeneous state although it can be in either a dry or aqueous solution. Purity and homogeneity are typically determined using analytical chemistry techniques such as polyacrylamide gel electrophoresis or high performance liquid chromatography. A protein that is the predominant species present in a preparation is substantially purified. In particular, an isolated gene is separated from open reading frames that flank the gene and encode a protein other than the gene of interest. The term “purified” denotes that a nucleic acid or protein gives rise to essentially one band in an electrophoretic gel. Particularly, it means that the nucleic acid or protein is at least 85% pure, more preferably at least 95% pure, and most preferably at least 99% pure.
- proximate when not used in reference to a proline residue, describes an amino acid having five or few amino acids removed from the C terminal end or N terminal end of the protease recognition site.
- amino acid refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids.
- Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, ⁇ -carboxyglutamate, and O-phosphoserine.
- Amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, i.e., an ⁇ carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid.
- Amino acid mimetics refers to chemical compounds having a structure that is different from the general chemical structure of an amino acid, but that functions in a manner similar to a naturally occurring amino acid.
- amino acid whether it is in a linker or a component of a peptide sequence refers to both the D- and L-isomer of the amino acid as well as mixtures of these two isomers.
- “Conservatively modified variants” applies to both amino acid and nucleic acid sequences. With respect to particular nucleic acid sequences, “conservatively modified variants” refers to those nucleic acids that encode identical or essentially identical amino acid sequences, or where the nucleic acid does not encode an amino acid sequence, to essentially identical sequences. Because of the degeneracy of the genetic code, a large number of functionally identical nucleic acids encode any given protein. For instance, the codons GCA, GCC, GCG and GCU all encode the amino acid alanine. Thus, at every position where an alanine is specified by a codon, the codon can be altered to any of the corresponding codons described without altering the encoded polypeptide.
- nucleic acid variations are “silent variations,” which are one species of conservatively modified variations. Every nucleic acid sequence herein that encodes a polypeptide also describes every possible silent variation of the nucleic acid.
- each codon in a nucleic acid except AUG, which is ordinarily the only codon for methionine, and TGG, which is ordinarily the only codon for tryptophan
- TGG which is ordinarily the only codon for tryptophan
- amino acid sequences one of skill will recognize that individual substitutions, deletions or additions to a nucleic acid, peptide, polypeptide, or protein sequence which alters, adds or deletes a single amino acid or a small percentage of amino acids in the encoded sequence is a “conservatively modified variant” where the alteration results in the substitution of an amino acid with a chemically similar amino acid. Conservative substitution tables providing functionally similar amino acids are well known in the art. Such conservatively modified variants are in addition to and do not exclude polymorphic variants, interspecies homologs, and alleles of the invention.
- I Isoleucine
- L Leucine
- M Methionine
- V Valine
- Amino acids may be referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Nucleotides, likewise, may be referred to by their commonly accepted single-letter codes.
- amino acid residues are numbered according to their relative positions from the left most residue, which is numbered 1, in an unmodified wild-type polypeptide sequence.
- Proximate a proline residue refers to an amino acid that is less than about 10 amino acids removed from a proline residue, preferably, less than about 9, 8, 7, 6 or 5 amino acids removed from a proline residue, more preferably, less than about 4, 3, 2 or 1 residues removed from a proline residue.
- the amino acid “proximate a proline residue” may be on the C- or N-terminal side of the proline residue.
- sialic acid refers to any member of a family of nine-carbon carboxylated sugars.
- the most common member of the sialic acid family is N-acetyl-neuraminic acid (2-keto-5-acetamido-3,5-dideoxy-D-glycero-D-galactononulopyranos-1-onic acid (often abbreviated as Neu5Ac, NeuAc, or NANA).
- a second member of the family is N-glycolyl-neuraminic acid (Neu5Gc or NeuGc), in which the N-acetyl group of NeuAc is hydroxylated.
- a third sialic acid family member is 2-keto-3-deoxy-nonulosonic acid (KDN) (Nadano et al. (1986) J. Biol. Chem. 261: 11550-11557; Kanamori et al., J. Biol. Chem. 265: 21811-21819 (1990)). Also included are 9-substituted sialic acids such as a 9-O—C 1 -C 6 acyl-Neu5Ac like 9-O-lactyl-Neu5Ac or 9-O-acetyl-Neu5Ac, 9-deoxy-9-fluoro-Neu5Ac and 9-azido-9-deoxy-Neu5Ac.
- KDN 2-keto-3-deoxy-nonulosonic acid
- 9-substituted sialic acids such as a 9-O—C 1 -C 6 acyl-Neu5Ac like 9-O-lactyl-Neu5Ac or 9-O-
- sialic acid family see, e.g., Varki, Glycobiology 2: 25-40 (1992); Sialic Acids: Chemistry, Metabolism and Function , R. Schauer, Ed. (Springer-Verlag, New York (1992)).
- the synthesis and use of sialic acid compounds in a sialylation procedure is disclosed in international application WO 92/16640, published Oct. 1, 1992.
- “Peptide” refers to a polymer in which the monomers are amino acids and are joined together through amide bonds, alternatively referred to as a polypeptide or a protein. Additionally, unnatural amino acids, for example, ⁇ -alanine, phenylglycine and homoarginine are also included. Amino acids that are not gene-encoded may also be used in the present invention. Furthermore, amino acids that have been modified to include reactive groups, glycosylation sites, polymers, therapeutic moieties, biomolecules and the like may also be used in the invention. All of the amino acids used in the present invention may be either the d- or 1-isomer. The 1-isomer is generally preferred. In addition, other peptidomimetics are also useful in the present invention.
- peptide refers to both glycosylated and unglycosylated peptides. Also included are peptides that are incompletely glycosylated by a system that expresses the peptide. For a general review, see, Spatola, A. F., in Chemistry and Biochemistry of Amino Acids, Peptides and Proteins, B. Weinstein, eds., Marcel Dekker, New York, p. 267 (1983). The numbering of the amino acid residues in the peptides of the invention is based on the initial unmodified sequence in which the left most residue, methionine, is numbered as position 1.
- peptide conjugate refers to species of the invention in which a peptide is conjugated with a modified sugar as set forth herein.
- hGH peptides of the invention comprise sequences with additional amino acids. These amino acids can be inserted into the middle of the sequence, as shown in “O-linked Glycosylation of Peptides”, filed Jan. 10, 2005, Atty. Docket No. 040853-01-5138-US. Additional amino acids, both natural and unnatural, can also be attached at the beginning or end of the amino acid sequence.
- proteolysis resistant mutant or “protease resistant mutant” refers to a hGH mutant that is proteolyzed more slowly than the corresponding wild-type hGH.
- the protease resistant mutant of the invention is proteolyzed at a rate of 90% or less relative to the corresponding wild-type hGH. More preferably, the protease resistant mutant of the invention is proteolyzed at a rate of 70% or less relative to the corresponding wild-type hGH. Even more preferably, the protease resistant mutant of the invention is proteolyzed at a rate of 50% or less relative to the corresponding wild-type hGH.
- mutating refers to the deletion, insertion, or substitution of any nucleotide or amino acid residue, by chemical, enzymatic, or any other means, in a polynucleotide sequence encoding a wild-type human growth hormone or the amino acid sequence of a wild-type human growth hormone, respectively, such that the amino acid sequence of the resulting human growth hormone comprises at least one N- or O-linked glycosylation site that does not exist in the corresponding wild-type human growth hormone.
- amino acid substitution both conservative and non-conservative substitutions may be used to create a hGH mutant that contains a new N- or O-linked glycosylation site.
- the site for a mutation introducing a new N- or O-linked glycosylation site may be located anywhere in the polypeptide.
- Exemplary amino acid sequences for human growth hormone mutants are depicted in SEQ ID NOs:3-9, and 80-89.
- a “mutant human growth hormone” of this invention thus comprises at least one mutated amino acid residue.
- the wild-type human growth hormone whose coding sequence is modified to generate a mutant human growth hormone is referred to in this application as “the corresponding wild-type human growth hormone.”
- SEQ ID NO:1 is the amino acid sequence of the corresponding wild-type human growth hormone for mutant human growth hormones having the amino acid sequences of SEQ ID NOs:3-9, and 80-89.
- modified sugar refers to a naturally- or non-naturally-occurring carbohydrate that is enzymatically added onto an amino acid or a glycosyl residue of a peptide in a process of the invention.
- the modified sugar is selected from a number of enzyme substrates including, but not limited to sugar nucleotides (mono-, di-, and tri-phosphates), activated sugars (e.g., glycosyl halides, glycosyl mesylates) and sugars that are neither activated nor nucleotides.
- the “modified sugar” can be covalently functionalized with a “modifying group.”
- modifying group refers to a component of the hGH conjugate that is covalently attached to a glycosyl linking group.
- a modifying group can be a component of the modified sugar that is subsequently attached to the hGH peptide.
- a modifying group can also be attached directly to a sugar moiety that is already attached to the hGH peptide.
- Useful modifying groups include, but are not limited to, water-soluble polymer moieties such as PEG, water-insoluble polymer moieties, therapeutic moieties, diagnostic moieties, biomolecules, and the like.
- the modifying group also includes reactive functional groups, such as levulinic acid.
- reactive functional groups can serve as the locus of attachment for water-soluble polymers such as PEG moieties, therapeutic moieties, diagnostic moieties, biomolecules, and the like.
- These reactive functional groups can also comprise protecting groups which can be removed at appropriate times to facilitate proper functionalization. Reactive functional groups with protecting groups are alternatively known as masked reactive functional groups.
- the modifying group is preferably not a naturally occurring, or an unmodified carbohydrate. The locus of functionalization with the modifying group is selected such that it does not prevent the “modified sugar” from being added enzymatically to a peptide.
- water-soluble refers to moieties that have some detectable degree of solubility in water. Methods to detect and/or quantify water solubility are well known in the art.
- Exemplary water-soluble polymers include peptides, saccharides, poly(ethers), poly(amines), poly(carboxylic acids) and the like. Peptides can have mixed sequences or be composed of a single amino acid, e.g., poly(lysine).
- An exemplary polysaccharide is poly(sialic acid).
- An exemplary poly(ether) is poly(ethylene glycol).
- Poly(ethylene imine) is an exemplary polyamine
- poly(acrylic) acid is a representative poly(carboxylic acid).
- the polymer backbone of the water-soluble polymer can be poly(ethylene glycol) (i.e. PEG).
- PEG poly(ethylene glycol)
- other related polymers are also suitable for use in the practice of this invention and that the use of the term PEG or poly(ethylene glycol) is intended to be inclusive and not exclusive in this respect.
- PEG includes poly(ethylene glycol) in any of its forms, including alkoxy PEG, difunctional PEG, multiarmed PEG, forked PEG, branched PEG, pendent PEG (i.e. PEG or related polymers having one or more functional groups pendent to the polymer backbone), or PEG with degradable linkages therein.
- the polymer backbone can be linear or branched.
- Branched polymer backbones are generally known in the art.
- a branched polymer has a central branch core moiety and a plurality of linear polymer chains linked to the central branch core.
- PEG is commonly used in branched forms that can be prepared by addition of ethylene oxide to various polyols, such as glycerol, pentaerythritol and sorbitol.
- the central branch moiety can also be derived from several amino acids, such as lysine.
- the branched poly(ethylene glycol) can be represented in general form as R(-PEG-OH) m in which R represents the core moiety, such as glycerol or pentaerythritol, and m represents the number of arms.
- R represents the core moiety, such as glycerol or pentaerythritol
- m represents the number of arms.
- Multi-armed PEG molecules such as those described in U.S. Pat. No. 5,932,462, which is incorporated by reference herein in its entirety, can also be used as the polymer backbone.
- polymers are also suitable for the invention.
- suitable polymers include, but are not limited to, other poly(alkylene glycols), such as poly(propylene glycol) (“PPG”), copolymers of ethylene glycol and propylene glycol and the like, poly(oxyethylated polyol), poly(olefinic alcohol), poly(vinylpyrrolidone), poly(hydroxypropylmethacrylamide), poly( ⁇ -hydroxy acid), poly(vinyl alcohol), polyphosphazene, polyoxazoline, poly(N-acryloylmorpholine), such as described in U.S. Pat.
- PPG poly(propylene glycol)
- PPG poly(propylene glycol)
- copolymers of ethylene glycol and propylene glycol and the like poly(oxyethylated polyol), poly(olefinic alcohol),
- AUC area under the curve
- half-life or “t1 ⁇ 2”, as used herein in the context of administering a peptide drug to a patient, is defined as the time required for plasma concentration of a drug in a patient to be reduced by one half. There may be more than one half-life associated with the peptide drug depending on multiple clearance mechanisms, redistribution, and other mechanisms well known in the art. Usually, alpha and beta half-lives are defined such that the alpha phase is associated with redistribution, and the beta phase is associated with clearance. However, with protein drugs that are, for the most part, confined to the bloodstream, there can be at least two clearance half-lives.
- rapid beta phase clearance may be mediated via receptors on macrophages, or endothelial cells that recognize terminal galactose, N-acetylgalactosamine, N-acetylglucosamine, mannose, or fucose.
- Slower beta phase clearance may occur via renal glomerular filtration for molecules with an effective radius ⁇ 2 nm (approximately 68 kD) and/or specific or non-specific uptake and metabolism in tissues.
- GlycoPEGylation may cap terminal sugars (e.g., galactose or N-acetylgalactosamine) and thereby block rapid alpha phase clearance via receptors that recognize these sugars.
- glycoconjugation refers to the enzymatically mediated conjugation of a modified sugar species to an amino acid or glycosyl residue of a polypeptide, e.g., a mutant human growth hormone of the present invention.
- a subgenus of “glycoconjugation” is “glycoPEGylation,” in which the modifying group of the modified sugar is poly(ethylene glycol), and alkyl derivative (e.g., m-PEG) or reactive derivative (e.g., H2N-PEG, HOOC-PEG) thereof.
- alkyl derivative e.g., m-PEG
- reactive derivative e.g., H2N-PEG, HOOC-PEG
- large-scale and “industrial-scale” are used interchangeably and refer to a reaction cycle that produces at least about 250 mg, preferably at least about 500 mg, and more preferably at least about 1 gram of glycoconjugate at the completion of a single reaction cycle.
- glycosyl linking group refers to a glycosyl residue to which a modifying group (e.g., PEG moiety, therapeutic moiety, biomolecule) is covalently attached; the glycosyl linking group joins the modifying group to the remainder of the conjugate.
- the “glycosyl linking group” becomes covalently attached to a glycosylated or unglycosylated peptide, thereby linking the agent to an amino acid and/or glycosyl residue on the peptide.
- a “glycosyl linking group” is generally derived from a “modified sugar” by the enzymatic attachment of the “modified sugar” to an amino acid and/or glycosyl residue of the peptide.
- the glycosyl linking group can be a saccharide-derived structure that is degraded during formation of modifying group-modified sugar cassette (e.g., oxidation-Schiff base formation-reduction), or the glycosyl linking group may be intact.
- An “intact glycosyl linking group” refers to a linking group that is derived from a glycosyl moiety in which the saccharide monomer that links the modifying group to the remainder of the conjugate is not degraded, e.g., oxidized by sodium metaperiodate.
- “Intact glycosyl linking groups” of the invention may be derived from a naturally occurring oligosaccharide by addition of glycosyl unit(s) or removal of one or more glycosyl unit from a parent sac
- targeting moiety refers to species that will selectively localize in a particular tissue or region of the body. The localization is mediated by specific recognition of molecular determinants, molecular size of the targeting agent or conjugate, ionic interactions, hydrophobic interactions and the like. Other mechanisms of targeting an agent to a particular tissue or region are known to those of skill in the art.
- exemplary targeting moieties include antibodies, antibody fragments, transferrin, HS-glycoprotein, coagulation factors, serum proteins, ⁇ -glycoprotein, hGH, GM-CSF, M-CSF, EPO and the like.
- therapeutic moiety means any agent useful for therapy including, but not limited to, antibiotics, anti-inflammatory agents, anti-tumor drugs, cytotoxins, and radioactive agents.
- therapeutic moiety includes prodrugs of bioactive agents, constructs in which more than one therapeutic moiety is bound to a carrier, e.g., multivalent agents.
- Therapeutic moiety also includes proteins and constructs that include proteins.
- Exemplary proteins include, but are not limited to, Erythropoietin (EPO), Granulocyte Colony Stimulating Factor (G-CSF), Granulocyte Macrophage Colony Stimulating Factor (GMCSF), Interferon (e.g., Interferon- ⁇ , - ⁇ , - ⁇ ), Interleukin (e.g., Interleukin II), serum proteins (e.g., Factors VII, VIIa, VIII, IX, and X), Human Chorionic Gonadotropin (HCG), Follicle Stimulating Hormone (FSH) and Lutenizing Hormone (LH) and antibody fusion proteins (e.g. Tumor Necrosis Factor Receptor ((TNFR)/Fc domain fusion protein)).
- EPO Erythropoietin
- G-CSF Granulocyte Colony Stimulating Factor
- GMCSF Granulocyte Macrophage Colony Stimulating Factor
- a radioactive agent includes any radioisotope that is effective in diagnosing or destroying a tumor. Examples include, but are not limited to, indium-111, cobalt-60. Additionally, naturally occurring radioactive elements such as uranium, radium, and thorium, which typically represent mixtures of radioisotopes, are suitable examples of a radioactive agent. The metal ions are typically chelated with an organic chelating moiety.
- “pharmaceutically acceptable carrier” includes any material, which when combined with the conjugate retains the conjugate's activity and is non-reactive with the subject's immune systems. Examples include, but are not limited to, any of the standard pharmaceutical carriers such as a phosphate buffered saline solution, water, emulsions such as oil/water emulsion, and various types of wetting agents. Other carriers may also include sterile solutions, tablets including coated tablets and capsules. Typically such carriers contain excipients such as starch, milk, sugar, certain types of clay, gelatin, stearic acid or salts thereof, magnesium or calcium stearate, talc, vegetable fats or oils, gums, glycols, or other known excipients. Such carriers may also include flavor and color additives or other ingredients. Compositions comprising such carriers are formulated by well known conventional methods.
- administering means oral administration, inhalation, administration as a suppository, topical contact, intravenous, intraperitoneal, intramuscular, intralesional, intranasal or subcutaneous administration, or the implantation of a slow-release device e.g., a mini-osmotic pump, to the subject.
- Administration is by any route including parenteral, and transmucosal (e.g., oral, nasal, vaginal, rectal, or transdermal).
- Parenteral administration includes, e.g., intravenous, intramuscular, intra-arteriole, intradermal, subcutaneous, intraperitoneal, intraventricular, and intracranial.
- Other modes of delivery include, but are not limited to, the use of liposomal formulations, intravenous infusion, transdermal patches, etc.
- Ameliorating refers to any indicia of success in the treatment of a pathology or condition, including any objective or subjective parameter such as abatement, remission or diminishing of symptoms or an improvement in a patient's physical or mental well-being. Amelioration of symptoms can be based on objective or subjective parameters, including the results of a physical examination and/or a psychiatric evaluation.
- therapy refers to “treating” or “treatment” of a disease or condition including preventing the disease or condition from occurring in an animal that may be predisposed to the disease but does not yet experience or exhibit symptoms of the disease (prophylactic treatment), inhibiting the disease (slowing or arresting its development), providing relief from the symptoms or side-effects of the disease (including palliative treatment), and relieving the disease (causing regression of the disease).
- the term “effective amount,” as used herein, refers to an amount that produces therapeutic effects for which a substance is administered.
- the effects include the prevention, correction, or inhibition of progression of the symptoms of a disease/condition and related complications to any detectable extent.
- the exact amount will depend on the purpose of the treatment, and will be ascertainable by one skilled in the art using known techniques (see, e.g., Lieberman, Pharmaceutical Dosage Forms (vols. 1-3, 1992); Lloyd, The Art, Science and Technology of Pharmaceutical Compounding (1999); and Pickar, Dosage Calculations (1999)).
- isolated refers to a material that is substantially or essentially free from components, which are used to produce the material.
- isolated refers to material that is substantially or essentially free from components, which normally accompany the material in the mixture used to prepare the peptide conjugate.
- isolated and pure are used interchangeably.
- isolated peptide conjugates of the invention have a level of purity preferably expressed as a range. The lower end of the range of purity for the peptide conjugates is about 60%, about 70% or about 80% and the upper end of the range of purity is about 70%, about 80%, about 90% or more than about 90%.
- the peptide conjugates are more than about 90% pure, their purities are also preferably expressed as a range.
- the lower end of the range of purity is about 90%, about 92%, about 94%, about 96% or about 98%.
- the upper end of the range of purity is about 92%, about 94%, about 96%, about 98% or about 100% purity.
- Purity is determined by any art-recognized method of analysis (e.g., band intensity on a silver stained gel, polyacrylamide gel electrophoresis, HPLC, or a similar means).
- Essentially each member of the population describes a characteristic of a population of peptide conjugates of the invention in which a selected percentage of the modified sugars added to a peptide are added to multiple, identical acceptor sites on the peptide. “Essentially each member of the population” speaks to the “homogeneity” of the sites on the peptide conjugated to a modified sugar and refers to conjugates of the invention, which are at least about 80%, preferably at least about 90% and more preferably at least about 95% homogenous.
- “Homogeneity,” refers to the structural consistency across a population of acceptor moieties to which the modified sugars are conjugated. Thus, in a peptide conjugate of the invention in which each modified sugar moiety is conjugated to an acceptor site having the same structure as the acceptor site to which every other modified sugar is conjugated, the peptide conjugate is said to be about 100% homogeneous. Homogeneity is typically expressed as a range. The lower end of the range of homogeneity for the peptide conjugates is about 60%, about 70% or about 80% and the upper end of the range of purity is about 70%, about 80%, about 90% or more than about 90%.
- the peptide conjugates are more than or equal to about 90% homogeneous, their homogeneity is also preferably expressed as a range.
- the lower end of the range of homogeneity is about 90%, about 92%, about 94%, about 96% or about 98%.
- the upper end of the range of purity is about 92%, about 94%, about 96%, about 98% or about 100% homogeneity.
- the purity of the peptide conjugates is typically determined by one or more methods known to those of skill in the art, e.g., liquid chromatography-mass spectrometry (LC-MS), matrix assisted laser desorption mass time of flight spectrometry (MALDITOF), capillary electrophoresis, and the like.
- substantially uniform glycoform or a “substantially uniform glycosylation pattern,” when referring to a glycopeptide species, refers to the percentage of acceptor moieties that are glycosylated by the glycosyltransferase of interest (e.g., fucosyltransferase). For example, in the case of a ⁇ 1,2 fucosyltransferase, a substantially uniform fucosylation pattern exists if substantially all of the Gal ⁇ 1,4-GlcNAc-R and sialylated analogues thereof are fucosylated in a peptide conjugate of the invention.
- the Fuc-GlcNAc linkage is generally ⁇ 6 or ⁇ 3, with ⁇ 6 generallypreferred.
- the starting material may contain glycosylated acceptor moieties (e.g., fucosylated Gal ⁇ 1,4-GlcNAc-R moieties).
- the calculated percent glycosylation will include acceptor moieties that are glycosylated by the methods of the invention, as well as those acceptor moieties already glycosylated in the starting material.
- substantially in the above definitions of “substantially uniform” generally means at least about 40%, at least about 70%, at least about 80%, or more preferably at least about 90%, and still more preferably at least about 95% of the acceptor moieties for a particular glycosyltransferase are glycosylated.
- substituent groups are specified by their conventional chemical formulae, written from left to right, they equally encompass the chemically identical substituents, which would result from writing the structure from right to left, e.g., —CH 2 O— is intended to also recite —OCH 2 —.
- alkyl by itself or as part of another substituent means, unless otherwise stated, a straight or branched chain, or cyclic hydrocarbon radical, or combination thereof, which may be fully saturated, mono- or polyunsaturated and can include di- and multivalent radicals, having the number of carbon atoms designated (i.e. C 1 -C 10 means one to ten carbons).
- saturated hydrocarbon radicals include, but are not limited to, groups such as methyl, ethyl, n-propyl, isopropyl, n-butyl, t-butyl, isobutyl, sec-butyl, cyclohexyl, (cyclohexyl)methyl, cyclopropylmethyl, homologs and isomers of, for example, n-pentyl, n-hexyl, n-heptyl, n-octyl, and the like.
- An unsaturated alkyl group is one having one or more double bonds or triple bonds.
- alkyl groups examples include, but are not limited to, vinyl, 2-propenyl, crotyl, 2-isopentenyl, 2-(butadienyl), 2,4-pentadienyl, 3-(1,4-pentadienyl), ethynyl, 1- and 3-propynyl, 3-butynyl, and the higher homologs and isomers.
- alkyl unless otherwise noted, is also meant to include those derivatives of alkyl defined in more detail below, such as “heteroalkyl.” Alkyl groups that are limited to hydrocarbon groups are termed “homoalkyl”.
- alkylene by itself or as part of another substituent means a divalent radical derived from an alkane, as exemplified, but not limited, by —CH 2 CH 2 CH 2 CH 2 —, and further includes those groups described below as “heteroalkylene.”
- an alkyl (or alkylene) group will have from 1 to 24 carbon atoms, with those groups having 10 or fewer carbon atoms being preferred in the present invention.
- a “lower alkyl” or “lower alkylene” is a shorter chain alkyl or alkylene group, generally having eight or fewer carbon atoms.
- alkoxy alkylamino and “alkylthio” (or thioalkoxy) are used in their conventional sense, and refer to those alkyl groups attached to the remainder of the molecule via an oxygen atom, an amino group, or a sulfur atom, respectively.
- heteroalkyl by itself or in combination with another term, means, unless otherwise stated, a stable straight or branched chain, or cyclic hydrocarbon radical, or combinations thereof, consisting of the stated number of carbon atoms and at least one heteroatom selected from the group consisting of O, N, Si and S, and wherein the nitrogen and sulfur atoms may optionally be oxidized and the nitrogen heteroatom may optionally be quaternized.
- the heteroatom(s) O, N and S and Si may be placed at any interior position of the heteroalkyl group or at the position at which the alkyl group is attached to the remainder of the molecule.
- Examples include, but are not limited to, —CH 2 —CH 2 —O—CH 3 , —CH 2 —CH 2 —NH—CH 3 , —CH 2 —CH 2 —N(CH 3 )—CH 3 , —CH 2 —S—CH 2 —CH 3 , —CH 2 —CH 2 , —S(O)—CH 3 , —CH 2 —CH 2 —S(O) 2 —CH 3 , —CH ⁇ CH—O—CH 3 , —Si(CH3) 3 , —CH 2 —CH ⁇ N—OCH 3 , and —CH ⁇ CH—N(CH 3 )—CH 3 .
- heteroalkylene by itself or as part of another substituent means a divalent radical derived from heteroalkyl, as exemplified, but not limited by, —CH 2 —CH 2 —S—CH 2 —CH 2 — and —CH 2 —S—CH 2 —CH 2 —NH—CH 2 —.
- heteroatoms can also occupy either or both of the chain termini (e.g., alkyleneoxy, alkylenedioxy, alkyleneamino, alkylenediamino, and the like). Still further, for alkylene and heteroalkylene linking groups, no orientation of the linking group is implied by the direction in which the formula of the linking group is written. For example, the formula —C(O) 2 R′— represents both —C(O) 2 R′— and —R′C(O) 2 —.
- cycloalkyl and “heterocycloalkyl”, by themselves or in combination with other terms, represent, unless otherwise stated, cyclic versions of “alkyl” and “heteroalkyl”, respectively. Additionally, for heterocycloalkyl, a heteroatom can occupy the position at which the heterocycle is attached to the remainder of the molecule. Examples of cycloalkyl include, but are not limited to, cyclopentyl, cyclohexyl, 1-cyclohexenyl, 3-cyclohexenyl, cycloheptyl, and the like.
- heterocycloalkyl examples include, but are not limited to, 1-(1,2,5,6-tetrahydropyridyl), 1-piperidinyl, 2-piperidinyl, 3-piperidinyl, 4-morpholinyl, 3-morpholinyl, tetrahydrofuran-2-yl, tetrahydrofuran-3-yl, tetrahydrothien-2-yl, tetrahydrothien-3-yl, 1-piperazinyl, 2-piperazinyl, and the like.
- halo or “halogen,” by themselves or as part of another substituent, mean, unless otherwise stated, a fluorine, chlorine, bromine, or iodine atom. Additionally, terms such as “haloalkyl,” are meant to include monohaloalkyl and polyhaloalkyl.
- halo(C 1 -C 4 )alkyl is mean to include, but not be limited to, trifluoromethyl, 2,2,2-trifluoroethyl, 4-chlorobutyl, 3-bromopropyl, and the like.
- aryl means, unless otherwise stated, a polyunsaturated, aromatic, substituent that can be a single ring or multiple rings (preferably from 1 to 3 rings), which are fused together or linked covalently.
- heteroaryl refers to aryl groups (or rings) that contain from one to four heteroatoms selected from N, O, and S, wherein the nitrogen and sulfur atoms are optionally oxidized, and the nitrogen atom(s) are optionally quaternized.
- a heteroaryl group can be attached to the remainder of the molecule through a heteroatom.
- Non-limiting examples of aryl and heteroaryl groups include phenyl, 1-naphthyl, 2-naphthyl, 4-biphenyl, 1-pyrrolyl, 2-pyrrolyl, 3-pyrrolyl, 3-pyrazolyl, 2-imidazolyl, 4-imidazolyl, pyrazinyl, 2-oxazolyl, 4-oxazolyl, 2-phenyl-4-oxazolyl, 5-oxazolyl, 3-isoxazolyl, 4-isoxazolyl, 5-isoxazolyl, 2-thiazolyl, 4-thiazolyl, 5-thiazolyl, 2-furyl, 3-furyl, 2-thienyl, 3-thienyl, 2-pyridyl, 3-pyridyl, 4-pyridyl, 2-pyrimidyl, 4-pyrimidyl, 5-benzothiazolyl, purinyl, 2-benzimidazolyl, 5-indolyl, 1-isoquinoly
- aryl when used in combination with other terms (e.g., aryloxy, arylthioxy, arylalkyl) includes both aryl and heteroaryl rings as defined above.
- arylalkyl is meant to include those radicals in which an aryl group is attached to an alkyl group (e.g., benzyl, phenethyl, pyridylmethyl and the like) including those alkyl groups in which a carbon atom (e.g., a methylene group) has been replaced by, for example, an oxygen atom (e.g., phenoxymethyl, 2-pyridyloxymethyl, 3-(1-naphthyloxy)propyl, and the like).
- alkyl group e.g., benzyl, phenethyl, pyridylmethyl and the like
- an oxygen atom e.g., phenoxymethyl, 2-pyridyloxymethyl, 3-(1-naph
- alkyl e.g., “alkyl,” “heteroalkyl,” “aryl” and “heteroaryl” is meant to include both substituted and unsubstituted forms of the indicated radical.
- Preferred substituents for each type of radical are provided below.
- R′, R′′, R′′′ and R′′′′ each preferably independently refer to hydrogen, substituted or unsubstituted heteroalkyl, substituted or unsubstituted aryl, e.g., aryl substituted with 1-3 halogens, substituted or unsubstituted alkyl, alkoxy or thioalkoxy groups, or arylalkyl groups.
- each of the R groups is independently selected as are each R′, R′′, R′′′ and R′′′′ groups when more than one of these groups is present.
- R′ and R′′ are attached to the same nitrogen atom, they can be combined with the nitrogen atom to form a 5-, 6-, or 7-membered ring.
- —NR′R′′ is meant to include, but not be limited to, 1-pyrrolidinyl and 4-morpholinyl.
- substituents for the aryl and heteroaryl groups are generically referred to as “aryl group substituents.”
- the substituents are selected from, for example: halogen, —OR′, ⁇ O, ⁇ NR′, ⁇ N—OR′, —NR′R′′, —SR′, -halogen, —SiR′R′′R′′′, —OC(O)R′, —C(O)R′, —CO 2 R′, —CONR′R′′, —OC(O)NR′R′′, —NR′′C(O)R′, —NR′—C(O)NR′′R′′′, —NR′′C(O) 2 R′, —NR—C(NR′R′′R′′′) ⁇ NR′′′′, —NR—C(NR′R′′) ⁇ NR′′′, —S(O)R′, —S(O) 2 R′, —S(O) 2 NR′R′′
- each of the R groups is independently selected as are each R′, R′′, R′′′ and R′′′′ groups when more than one of these groups is present.
- the symbol X represents “R” as described above.
- Two of the substituents on adjacent atoms of the aryl or heteroaryl ring may optionally be replaced with a substituent of the formula -T-C(O)—(CRR′)q-U-, wherein T and U are independently —NR—, —O—, —CRR′— or a single bond, and q is an integer of from 0 to 3.
- two of the substituents on adjacent atoms of the aryl or heteroaryl ring may optionally be replaced with a substituent of the formula -A-(CH 2 )r-B—, wherein A and B are independently —CRR′—, —O—, —NR—, —S—, —S(O)—, —S(O) 2 —, —S(O) 2 NR′— or a single bond, and r is an integer of from 1 to 4.
- One of the single bonds of the new ring so formed may optionally be replaced with a double bond.
- two of the substituents on adjacent atoms of the aryl or heteroaryl ring may optionally be replaced with a substituent of the formula —(CRR′)s-X—(CR′′R′′′)d-, where s and d are independently integers of from 0 to 3, and X is —O—, —NR′—, —S—, —S(O)—, —S(O) 2 —, or —S(O) 2 NR′—.
- the substituents R, R′, R′′ and R′′′ are preferably independently selected from hydrogen or substituted or unsubstituted (C1-C6)alkyl.
- heteroatom is meant to include oxygen (O), nitrogen (N), sulfur (S) and silicon (Si).
- the present invention provides genetically engineered mutants of human growth hormone that contain N-linked and/or O-linked glycosylation sites not present in naturally occurring human growth hormone.
- some of the mutants contain a proteolysis resistant mutation(s) and/or potential sites for chemical PEGylation in regions susceptible to proteases.
- FIGS. 6A-6K illustrate exemplary proteolysis resistant mutation sites.
- hGH mutants of the invention also substantially retain the biological activity of the wild-type hormone
- the newly introduced glycosylation sites allow the recombinantly produced hGH mutants to be selectively glycosylated in a large variety of patterns.
- the non-natural glycosylation sites provide loci for selective glycoconjugation of modifying groups to the peptide at one or more sites.
- An exemplary modifying group is a water-soluble polymer, such as poly(ethylene glycol), e.g., PEG (e.g., m-PEG), PPG (e.g., m-PPG). Modification of the hGH mutants improve the stability and in vivo retention time of the recombinant hGH, reduces the peptides' antigenicity, and enhances the peptides' ability to target a specific tissue in need of treatment.
- the present invention provides mutants of hGH that include one or more O- or N-linked glycosylation sites that are not found in the wild type peptide. In all cases, the N-terminal Met may be present or absent on any hGH mutant.
- the mutants are substrates for enzymatic glycosylation and/or glycoPEGylation at one or more sites that would not normally be glycosylated, or would be poorly glycosylated, in the wild type peptide. These mutants allow the position of a glycosyl residue or a glycosyl linking group to be engineered to obtain a peptide having selected desirable properties.
- P134TTAQIF Mutant BE: MFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQ KSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPTTAQIF KQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
- the present invention provides glycoPEGylated mutants of hGH that include one or more O- or N-linked glycosylation sites that are not found in the wild type peptide. In all cases, the N-terminal Met may be present or absent on any hGH mutant.
- other properties that can be varied using the mutants and methods of the invention include pharmacokinetics, pharmacodynamics, resistance to proteolysis, immunogenicity, recognition by the reticuloendothelial system, tissue distribution and the like.
- the present invention also provides mutants of hGH with mutations that impart resistance towards degradation of the peptide by proteolytic enzymes.
- the N-terminal Met may be present or absent on any hGH mutant.
- Protease resistance is achieved by modifying, substituting, inserting or deleting one or more amino acids within the protease recognition or cleavage sites in rhGH.
- Exemplary mutant motifs include, but is not limited to the following: wherein horizontal lines on both sides of the various motifs represent amino acid sequences which precede and follow it in the corresponding native hGH amino acid sequence.
- examples of the P 134 TINT motif have been provided in FIGS. 6D, 6E , 6 F, 6 G, and 6 J. In each of these five mutants, the native R 135 TGQ sequence has been replaced by TINT.
- Examples of the P 140 TQA motif are provided in FIGS. 6C and 6H , and examples of the P 134 TTVS motif in FIGS. 6B and 6I .
- the native FKQT motif has been replaced by PTQA.
- the native R 135 TGQ sequence has been replaced by T 135 TVS.
- An exemplary insertion mutant can be found in FIG. 6A , where a glutamic acid has been inserted between the threonine at the 4th position and isoleucine at the 5th position of the native hGH sequence.
- FIG. 6K shows other possible sites for the proteolysis resistant mutations, as indicated on the native hGH amino acid sequence.
- Protease resistant mutations can be the sole mutation type or the mutant peptide can also include one or more glycosylation mutation to form a protease resistant conjugate that can also serve as substrates for enzymatic glycosylation and/or glycoPEGylation.
- the present invention further provides wild-type hGH peptides and hGH mutants that are substrates for chemical PEGylation.
- Protease resistance can also be achieved through a mechanism other than the proteolysis resistant mutations described above. Since many of the lysine residues in hGH are present in regions most susceptible to proteases, chemical PEGylation of one or more of these lysines has the effect of blocking the proteolytic cleavage or binding site, which thereby reduces in vivo degradation of the polypeptide.
- the amino terminus and histidine residues in hGH are other useful sites for chemical PEGylation. Exemplary chemical PEGylation sites of the invention are indicated by larger, highlighted, bold font in FIG. 6I and FIG. 6J .
- the present invention also provides for chemically PEGylated hGH mutants containing protease resistant mutations.
- the combined use of chemical PEGylation of residues near or in the protease cleavage/recognition site and protease resistant mutations provides a two-pronged method of blocking proteolytic activity.
- proteolysis inhibiting mutations can be selectively introduced so as to provide amino-containing side chains, which can be used as additional substrates for chemical PEGylation. exemplary sites for chemical PEGylation.
- FIGS. 6A-6K chemical PEGylation, glycoPEGylation, and proteolysis inhibiting mutations can all be used in conjunction, as exemplified by FIGS. 6A-6K .
- Each of these amino acid sequences contains proteolysis inhibiting mutations and glycosylation sites according to the present invention.
- glycosylation site mutations and proteolysis inhibiting mutations are introduced in such a manner as to retain at least one lysine or histidine residue within the mutant amino acid sequence.
- the present invention provides for hGH mutants with N-linked or O-linked glycosylation sites not found in wild-type hGH.
- Exemplary embodiments of the invention include N- or O-linked glycosylated hGH mutants having one or more characteristics selected from the following: glycoPEGylation, protease resistance, and chemically PEGylation.
- the present invention yields novel hGH derivatives with pharmacokinetic properties that are improved relative to the corresponding native hGH.
- the present invention provides an isolated nucleic acid comprising a polynucleotide sequence encoding a mutant human growth hormone.
- the mutant human growth hormone comprises an N-linked or O-linked glycosylation site and/or proteolysis resistant mutation(s) that are not present in wild-type human growth hormone.
- the wild-type human growth hormones have the amino acid sequence of pituitary-derived GH-N (SEQ ID NO:1) or placenta-derived GH-V (SEQ ID NO:2).
- the mutant human growth hormone includes the amino acid sequence of SEQ ID NO:3, 4, 5, 6, 7, 8, 9, 80, 81, 82, 83, 84, 85, 86, 87, and 88.
- the present invention provides an expression cassette or a cell that comprises a nucleic acid, e.g., an isolated nucleic acid, including a polynucleotide sequence encoding a mutant human growth hormone.
- the mutant human growth hormone includes an N-linked or O-linked glycosylation site and/or proteolysis inhibiting mutation(s) that are not present in the wild-type human growth hormone.
- the present invention provides a mutant glycoPEGylated human growth hormone that includes one or more N-linked or O-linked glycosylation site not present in the wild-type human growth hormone.
- the wild-type human growth hormone has the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:2.
- the mutant human growth hormone comprises the amino acid sequence of SEQ ID NO:3, 4, 5, 6, 7, 8, 9, 80, 81, 82, 83, 84, 85, 86, 87, and 88.
- the present invention provides a mutant human growth hormone that includes one or more N-linked or O-linked glycosylation site not present in the wild-type human growth hormone and one or more proteolysis resistant mutations(s) not present in the wild-type human growth hormone.
- the wild-type human growth hormone has the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:2.
- the mutant human growth hormone comprises the amino acid sequence of SEQ ID NO:3, 4, 5, 6, 7, 8, 9, 80, 81, 82, 83, 84, 85, 86, 87, and 88.
- the present invention provides a chemically PEGylated mutant human growth hormone that includes one or more N-linked or O-linked glycosylation site not present in the wild-type human growth hormone.
- the wild-type human growth hormone has the amino acid sequence of SEQ ID NO:1 or SEQ BD NO:2.
- the mutant human growth hormone comprises the amino acid sequence of SEQ ID NO:3, 4, 5, 6, 7, 8, 9, 80, 81, 82, 83, 84, 85, 86, 87, and 88.
- the present invention provides a glycoPEGylated mutant human growth hormone that includes one or more N-linked or O-linked glycosylation site not present in the wild-type human growth hormone and one or more proteolysis resistant mutations(s) not present in the wild-type human growth hormone.
- the wild-type human growth hormone has the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:2.
- the mutant human growth hormone comprises the amino acid sequence of SEQ ID NO:3, 4, 5, 6, 7, 8, 9, 80, 81, 82, 83, 84, 85, 86, 87, and 88.
- the present invention provides a chemically PEGylated mutant human growth hormone that includes one or more N-linked or O-linked glycosylation site not present in the wild-type human growth hormone and one or more proteolysis resistant mutations(s) not present in the wild-type human growth hormone.
- the wild-type human growth hormone has the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:2.
- the mutant human growth hormone comprises the amino acid sequence of SEQ ID NO:3, 4, 5, 6, 7, 8, 9, 80, 81, 82, 83, 84, 85, 86, 87, and 88.
- the present invention provides a glycoPEGylated and chemically PEGylated mutant human growth hormone that includes one or more N-linked or O-linked glycosylation site not present in the wild-type human growth hormone.
- the wild-type human growth hormone has the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:2.
- the mutant human growth hormone comprises the amino acid sequence of SEQ ID NO:3, 4, 5, 6, 7, 8, 9, 80, 81, 82, 83, 84, 85, 86, 87, and 88.
- the present invention provides a glycoPEGylated and chemically PEGylated mutant human growth hormone that includes one or more N-linked or O-linked glycosylation site not present in the wild-type human growth hormone and one or more proteolysis resistant mutations(s) not present in the wild-type human growth hormone.
- the wild-type human growth hormone has the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:2.
- the mutant human growth hormone comprises the amino acid sequence of SEQ ID NO:3, 4, 5, 6, 7, 8, 9, 80, 81, 82, 83, 84, 85, 86, 87, and 88.
- the present invention provides a method for making a mutant human growth hormone that includes an N-linked or O-linked glycosylation site and/or proteolysis inhibiting mutation(s) that are not present in the wild-type human growth hormone.
- This method includes the steps of recombinantly producing the mutant human growth hormone, and glycosylating the mutant human growth hormone at the new glycosylation site.
- the wild-type human growth hormone has the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:2.
- the mutant human growth hormone comprises the amino acid sequence of SEQ ID NO:3, 4, 5, 6, 7, 8, 9, 80, 81, 82, 83, 84, 85, 86, 87, and 88.
- the present invention provides a pharmaceutical composition having a therapeutically effective amount of a mutant human growth hormone that includes an N-linked or O-linked glycosylation site and/or proteolysis inhibiting mutation(s) not present in the wild-type human growth hormone.
- the wild-type human growth hormone has the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:2.
- the mutant human growth hormone comprises the amino acid sequence of SEQ ID NO:3, 4, 5, 6, 7, 8, 9, 80, 81, 82, 83, 84, 85, 86, 87, and 88.
- the present invention provides a method for treating human growth hormone deficiency in a subject.
- the method includes administering to the subject an amount of a mutant human growth hormone effective to treat or ameliorate the growth hormone deficiency.
- the mutant human growth hormone used in this method comprises an N-linked or O-linked glycosylation site and/or proteolysis inhibiting mutation(s) that do not exist in the corresponding wild-type human growth hormone.
- the corresponding wild-type human growth hormone has the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:2.
- the mutant human growth hormone comprises the amino acid sequence of SEQ ID NO:3, 4, 5, 6, 7, 8, 9, 80, 81, 82, 83, 84, 85, 86, 87, and 88.
- a number of polynucleotide sequences encoding a wild-type human growth hormone e.g., GenBank Accession Nos. NM 000515, NM 002059, NM 022556, NM 022557, NM 022558, NM 022559, NM 022560, NM 022561, and NM 022562, have been determined and can be obtained from a commercial supplier.
- amino acid sequence of a wild-type human growth hormone e.g., SEQ ID NO:1 or SEQ ID NO:2
- this amino acid sequence may be modified to introduce proteolysis inhibiting mutations and/or alter the protein's glycosylation pattern, by introducing additional glycosylation site(s) at various locations in the amino acid sequence.
- N-linked glycosylation occurs on the asparagine of the consensus sequence Asn-X aa -Ser/Thr, in which X aa is any amino acid except proline (Kornfeld et al., Ann Rev Biochem 54:631-664 (1985); Kukuruzinska et al., Proc. Natl. Acad. Sci. USA 84:2145-2149 (1987); Herscovics et al., FASEB J 7:540-550 (1993); and Orlean, Saccharomyces Vol. 3 (1996)).
- O-linked glycosylation takes place at serine or threonine residues (Tanner et al., Biochim. Biophys. Acta. 906:81-91 (1987); and Hounsell et al., Glycoconj. J. 13:19-26 (1996)).
- Other glycosylation patterns are formed by linking glycosylphosphatidylinositol to the carboxyl-terminal carboxyl group of the protein (Takeda et al., Trends Biochem. Sci. 20:367-371 (1995); and Udenfriend et al., Ann. Rev. Biochem. 64:593-591 (1995). Based on this knowledge, suitable mutations can thus be introduced into a wild-type human growth hormone sequence to form new glycosylation sites.
- Mutational methods of generating diversity include, for example, site-directed mutagenesis (Botstein and Shortle, Science, 229: 1193-1201 (1985)), mutagenesis using uracil-containing templates (Kunkel, Proc. Natl. Acad. Sci. USA, 82: 488-492 (1985)), oligonucleotide-directed mutagenesis (Zoller and Smith, Nucl. Acids Res., 10: 6487-6500 (1982)), phosphorothioate-modified DNA mutagenesis (Taylor et al., Nucl.
- mutant human growth hormone of the present invention can be produced using routine techniques in the field of recombinant genetics, relying on the polynucleotide sequences encoding the polypeptide disclosed herein.
- a strong promoter to direct transcription e.g., in Sambrook and Russell, supra, and Ausubel et al., supra.
- Bacterial expression systems for expressing the wild-type or mutant human growth hormone are available in, e.g., E. coli, Bacillus sp., Salmonella , and Caulobacter . Kits for such expression systems are commercially available.
- Eukaryotic expression systems for mammalian cells, yeast, and insect cells are well known in the art and are also commercially available.
- the expression vector further comprises a sequence encoding a secretion signal, such as the E. coli OppA (Periplasmic Oligopeptide Binding Protein) secretion signal or a modified version thereof, which is directly connected to 5′ of the coding sequence of the protein to be expressed.
- a secretion signal such as the E. coli OppA (Periplasmic Oligopeptide Binding Protein) secretion signal or a modified version thereof, which is directly connected to 5′ of the coding sequence of the protein to be expressed.
- This signal sequence directs the recombinant protein produced in cytoplasm through the cell membrane into the periplasmic space.
- the expression vector may further comprise a coding sequence for signal peptidase 1, which is capable of enzymatically cleaving the signal sequence when the recombinant protein is entering the periplasmic space.
- Standard transfection methods are used to produce bacterial, mammalian, yeast, insect, or plant cell lines that express large quantities of the mutant human growth hormone, which are then purified using standard techniques (see, e.g., Colley et al., J. Biol. Chem. 264: 17619-17622 (1989); Guide to Protein Purification, in Methods in Enzymology , vol. 182 (Deutscher, ed., 1990)). Transformation of eukaryotic and prokaryotic cells are performed according to standard techniques (see, e.g., Morrison, J. Bact. 132: 349-351 (1977); Clark-Curtiss & Curtiss, Methods in Enzymology 101: 347-362 (Wu et al., eds, 1983).
- Any of the well known procedures for introducing foreign nucleotide sequences into host cells may be used. These include the use of calcium phosphate transfection, polybrene, protoplast fusion, electroporation, liposomes, microinjection, plasma vectors, viral vectors and any of the other well known methods for introducing cloned genomic DNA, cDNA, synthetic DNA, or other foreign genetic material into a host cell (see, e.g., Sambrook and Russell, supra). It is only necessary that the particular genetic engineering procedure used be capable of successfully introducing at least one gene into the host cell capable of expressing the mutant human growth hormone.
- the transfected cells are cultured under conditions favoring expression of the mutant human growth hormone.
- the cells are then screened for the expression of the recombinant polypeptide, which is subsequently recovered from the culture using standard techniques (see, e.g., Scopes, Protein Purification: Principles and Practice (1982); U.S. Pat. No. 4,673,641; Ausubel et al., supra; and Sambrook and Russell, supra).
- gene expression can be detected at the nucleic acid level.
- a variety of methods of specific DNA and RNA measurement using nucleic acid hybridization techniques are commonly used (e.g., Sambrook and Russell, supra). Some methods involve an electrophoretic separation (e.g., Southern blot for detecting DNA and Northern blot for detecting RNA), but detection of DNA or RNA can be carried out without electrophoresis as well (such as by dot blot).
- the presence of nucleic acid encoding a mutant human growth hormone in transfected cells can also be detected by PCR or RT-PCR using sequence-specific primers.
- gene expression can be detected at the polypeptide level.
- Various immunological assays are routinely used by those skilled in the art to measure the level of a gene product, particularly using polyclonal or monoclonal antibodies that react specifically with a mutant human growth hormone of the present invention, such as a polypeptide having the amino acid sequence of SEQ ID NO:3, 4, or 5, (e.g., Harlow and Lane, Antibodies, A Laboratory Manual, Chapter 14, Cold Spring Harbor, 1988; Kohler and Milstein, Nature, 256: 495-497 (1975)).
- Such techniques require antibody preparation by selecting antibodies with high specificity against the mutant human growth hormone or an antigenic portion thereof.
- art-recognized methods for purifying bacterially-expressed peptides are utilized.
- the mutant human growth hormones of the present invention are produced recombinantly by transformed bacteria in large amounts, typically after promoter induction, although expression can be constitutive, the proteins may form insoluble aggregates.
- Purification of protein inclusion bodies typically involves the extraction, separation and/or purification of inclusion bodies by disruption of bacterial cells, e.g., by incubation in a buffer of about 100-150 ⁇ g/ml lysozyme and 0.1% Nonidet P40, a non-ionic detergent.
- the cell suspension can be ground using a Polytron grinder (Brinkman Instruments, Westbury, N.Y.). Alternatively, the cells can be sonicated on ice. Alternate methods of lysing bacteria are described in Ausubel et al. and Sambrook and Russell, both supra, and will be apparent to those of skill in the art.
- the cell suspension is generally centrifuged and the pellet containing the inclusion bodies resuspended in buffer which does not dissolve but washes the inclusion bodies, e.g., 20 mM Tris-HCl (pH 7.2), 1 mM EDTA, 150 mM NaCl and 2% Triton-X 100, a non-ionic detergent. It may be necessary to repeat the wash step to remove as much cellular debris as possible.
- the remaining pellet of inclusion bodies may be resuspended in an appropriate buffer (e.g., 20 mM sodium phosphate, pH 6.8, 150 mM NaCl).
- an appropriate buffer e.g., 20 mM sodium phosphate, pH 6.8, 150 mM NaCl.
- Other appropriate buffers will be apparent to those of skill in the art.
- the inclusion bodies are solubilized by the addition of a solvent that is both a strong hydrogen acceptor and a strong hydrogen donor (or a combination of solvents each having one of these properties).
- a solvent that is both a strong hydrogen acceptor and a strong hydrogen donor or a combination of solvents each having one of these properties.
- the proteins that formed the inclusion bodies may then be renatured by dilution or dialysis with a compatible buffer.
- Suitable solvents include, but are not limited to, urea (from about 4 M to about 8 M), formamide (at least about 80%, volume/volume basis), and guanidine hydrochloride (from about 4 M to about 8 M).
- Some solvents that are capable of solubilizing aggregate-forming proteins may be inappropriate for use in this procedure due to the possibility of irreversible denaturation of the proteins, accompanied by a lack of immunogenicity and/or activity.
- SDS sodium dodecyl sulfate
- 70% formic acid may be inappropriate for use in this procedure due to the possibility of irreversible denaturation of the proteins, accompanied by a lack of immunogenicity and/or activity.
- guanidine hydrochloride and similar agents are denaturants, this denaturation is not irreversible and renaturation may occur upon removal (by dialysis, for example) or dilution of the denaturant, allowing re-formation of the immunologically and/or biologically active protein of interest.
- the protein can be separated from other bacterial proteins by standard separation techniques.
- purifying recombinant human growth hormone from bacterial inclusion body see, e.g., Patra et al., Protein Expression and Purification 18: 182-190 (2000).
- recombinant polypeptides e.g., a mutant human growth hormone
- the periplasmic fraction of the bacteria can be isolated by cold osmotic shock in addition to other methods known to those of skill in the art (see e.g., Ausubel et al., supra).
- the bacterial cells are centrifuged to form a pellet. The pellet is resuspended in a buffer containing 20% sucrose.
- the bacteria are centrifuged and the pellet is resuspended in ice-cold 5 mM MgSO 4 and kept in an ice bath for approximately 10 minutes.
- the cell suspension is centrifuged and the supernatant decanted and saved.
- the recombinant proteins present in the supernatant can be separated from the host proteins by standard separation techniques well known to those of skill in the art.
- a recombinant polypeptide e.g., the mutant human growth hormone of the present invention
- its purification can follow the standard protein purification procedure described below.
- an initial salt fractionation can separate many of the unwanted host cell proteins (or proteins derived from the cell culture media) from the recombinant protein of interest, e.g., a mutant human growth hormone of the present invention.
- the preferred salt is ammonium sulfate. Ammonium sulfate precipitates proteins by effectively reducing the amount of water in the protein mixture. Proteins then precipitate on the basis of their solubility. The more hydrophobic a protein is, the more likely it is to precipitate at lower ammonium sulfate concentrations. A typical protocol is to add saturated ammonium sulfate to a protein solution so that the resultant ammonium sulfate concentration is between 20-30%.
- a protein of greater and lesser size can be isolated using ultrafiltration through membranes of different pore sizes (for example, Amicon or Millipore membranes).
- the protein mixture is ultrafiltered through a membrane with a pore size that has a lower molecular weight cut-off than the molecular weight of a protein of interest, e.g., a mutant human growth hormone.
- the retentate of the ultrafiltration is then ultrafiltered against a membrane with a molecular cut off greater than the molecular weight of the protein of interest.
- the recombinant protein will pass through the membrane into the filtrate.
- the filtrate can then be chromatographed as described below.
- proteins of interest can also be separated from other proteins on the basis of their size, net surface charge, hydrophobicity, or affinity for ligands.
- antibodies raised against human growth hormone can be conjugated to column matrices and the human growth hormone immunopurified. All of these methods are well known in the art.
- immunological assays may be useful to detect in a sample the expression of the polypeptide. Immunological assays are also useful for quantifying the expression level of the recombinant hormone. Antibodies against a mutant human growth hormone are necessary for carrying out these immunological assays.
- Such techniques include antibody preparation by selection of antibodies from libraries of recombinant antibodies in phage or similar vectors (see, Huse et al., Science 246: 1275-1281, 1989; and Ward et al., Nature 341: 544-546, 1989).
- the amount of the polypeptide in a sample can be measured by a variety of immunoassay methods providing qualitative and quantitative results to a skilled artisan.
- immunoassay methods providing qualitative and quantitative results to a skilled artisan.
- Post-expression in vitro modification of peptides is an attractive strategy to remedy the deficiencies of methods that rely on controlling glycosylation by engineering expression systems, including both modification of glycan structures or introduction of glycans at novel sites.
- a comprehensive arsenal of enzymes that transfer saccharide donor moieties is becoming available, making in vitro enzymatic synthesis of glycoconjugates with custom designed glycosylation patterns and glycosyl structures possible. See, for example, U.S. Pat. Nos.
- the invention provides methods for preparing conjugates of glycosylated and unglycosylated mutant human growth hormones, which have new glycosylation sites that do not exist in the corresponding wild-type hGH. Such conjugation may take place directly on the appropriate sugar units of a glycosylated mutant hGH, or following the removal (i.e., “trimming back”) of any undesired sugar units.
- the conjugates are formed between peptides and diverse species such as water-soluble polymers, therapeutic moieties, diagnostic moieties, targeting moieties and the like.
- conjugates that include two or more peptides linked together through a linker arm i.e., multifunctional conjugates.
- the multi-functional conjugates of the invention can include two or more copies of the same peptide or a collection of diverse peptides with different structures, and/or properties.
- the conjugates of the invention are formed by the enzymatic attachment of a modified sugar to the glycosylated or unglycosylated peptide.
- the modified sugar when interposed between the peptide and the modifying group on the sugar becomes what is referred to herein as “a glycosyl linking group,” e.g., an intact glycosyl linking group.
- a glycosyl linking group e.g., an intact glycosyl linking group.
- the present method provides peptides that bear a desired group at one or more specific locations.
- a modified sugar is attached directly to a selected locus on the peptide chain or, alternatively, the modified sugar is appended onto a carbohydrate moiety of a glycopeptide.
- Peptides in which modified sugars are bound to both a glycopeptide carbohydrate and directly to an amino acid residue of the peptide backbone are also within the scope of the present invention.
- the methods of the invention make it possible to assemble peptides and glycopeptides that have a substantially homogeneous derivatization pattern; the enzymes used in the invention are generally selective for a particular amino acid residue or combination of amino acid residues of the peptide.
- the methods are also practical for large-scale production of modified peptides and glycopeptides.
- the methods of the invention provide a practical means for large-scale preparation of glycopeptides having preselected uniform derivatization patterns.
- the methods are particularly well suited for modification of therapeutic peptides, including but not limited to, glycopeptides that are incompletely glycosylated during production in cell culture cells (e.g., mammalian cells, insect cells, plant cells, fungal cells, yeast cells, or prokaryotic cells) or transgenic plants or animals.
- cell culture cells e.g., mammalian cells, insect cells, plant cells, fungal cells, yeast cells, or prokaryotic cells
- transgenic plants or animals e.g., transgenic plants or animals.
- the present invention also provides conjugates of glycosylated and unglycosylated peptides with increased therapeutic half-life due to, for example, resistance to proteolysis, reduced clearance rate, or reduced rate of uptake by the immune or reticuloendothelial system (RES), etc.
- the methods of the invention provide a means for masking antigenic determinants on peptides, thus reducing or eliminating a host immune response against the peptide.
- Selective attachment of targeting agents can also be used to target a peptide to a particular tissue or cell surface receptor that is specific for the particular targeting agent.
- the present invention provides a conjugate between one or more selected modifying groups, e.g. PEG, and a peptide that has an in vivo activity similar or otherwise analogous to art-recognized hGH.
- the modifying group(s) may be attached at a mutant glycosylation site or at a site that is present in the wild type peptide.
- the selected modifying moiety is essentially any species that can be attached to a saccharide unit, resulting in a modified sugar that is recognized by an appropriate transferase enzyme, which appends the modified sugar onto the peptide, or a glycosyl residue attached thereto.
- the saccharide component of the modified sugar when interposed between the peptide and a selected moiety, becomes a “glycosyl linking group,” e.g., an “intact glycosyl linking group.”
- the glycosyl linking group is formed from any mono-or oligo-saccharide that, after modification with the modifying group, is a substrate for an enzyme that adds the modified sugar to an amino acid or glycosyl residue of a peptide.
- the hGH peptide is conjugated to one or more polymeric modifying moieties through a glycosyl linking group.
- the polymeric modifying moiety can be attached at any position of a glycosyl moiety of hGH.
- the polymeric modifying moiety can be bound to a glycosyl residue at any position of a wild type or mutant hGH amino acid sequence.
- an hGH peptide can be conjugated to a plurality of the same or different polymeric modifying moieties via a single glycosyl linking group or via multiple glycosyl linking groups.
- Exemplary hGH peptide conjugates include a glycosyl linking group having a formula selected from:
- R 2 is H, CH 2 OR 7 , COOR 7 , COO ⁇ M + or OR 7 , in which R 7 represents H, substituted or unsubstituted alkyl or substituted or unsubstituted heteroalkyl.
- R 7 represents H, substituted or unsubstituted alkyl or substituted or unsubstituted heteroalkyl.
- COOR 7 is a carboxylic acid or carboxylate
- R 3 , R 4 , R 5 , R 6 and R 6′ independently represent H, substituted or unsubstituted alkyl, OR 8 , NHC(O)R 9 .
- M + is a metal.
- the index d is 0 or 1.
- R 8 and R 9 are independently selected from H, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, sialic acid or polysialic acid.
- At least one of R 3 , R 4 , R 5 , R 6 or R 6′ includes a polymeric modifying moiety e.g., PEG.
- R 6 and R 6′ together with the carbon to which they are attached are components of the pyruvyl side chain of sialic acid. In a further exemplary embodiment, this side chain is functionalized with the polymeric modifying moiety.
- R 6 and R 6′ together with the carbon to which they are attached are components of the side chain of sialic acid and the polymeric modifying moiety is a component of R 5 .
- the polymeric modifying moiety is bound to the glycosyl linking group, generally through a heteroatom on the glycosyl core (e.g., N, O), through a linker, L, as shown below:
- R 1 is the polymeric modifying group and L is selected from a bond and a linking group.
- the index w represents an integer selected from 1-6, preferably 1-3 and more preferably 1-2.
- Exemplary linking groups include substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl moieties and sialic acid.
- An exemplary component of the linker is an acyl moiety.
- linking group is an amino acid residue (e.g., cysteine, serine, lysine, and short oligopeptides, e.g., Lys-Lys, Lys-Lys-Lys, Cys-Lys, Ser-Lys, etc.)
- amino acid residue e.g., cysteine, serine, lysine, and short oligopeptides, e.g., Lys-Lys, Lys-Lys-Lys, Cys-Lys, Ser-Lys, etc.
- L When L is a bond, it is formed by reaction of a reactive functional group on a precursor of R 1 and a reactive functional group of complementary reactivity on a precursor of the glycosyl linking group.
- L When L is a non-zero order linking group, L can be in place on the glycosyl moiety prior to reaction with the R 1 precursor.
- the precursors of R 1 and L can be incorporated into a preformed cassette that is subsequently attached to the glycosyl moiety.
- An exemplary compound according to the invention has a structure according to Formulae A or B, in which at least one of R 2 , R 3 , R 4 , R 5 , R 6 or R 6′ has the formula:
- At least one of R 2 , R 3 , R 4 , R 5 , R 6 or R 6′ has the formula: in which s is an integer from 0 to 20 and R 1 is a linear polymeric modifying moiety.
- the polymeric modifying moiety-linker construct is a branched structure that includes two or more polymeric chains attached to central moiety.
- the construct has a structure according to Formula I.
- L When L is a bond it is formed between a reactive functional group on a precursor of R 1 and a reactive functional group of complementary reactivity on the saccharyl core.
- a precursor of L can be in place on the glycosyl moiety prior to reaction with the R 1 precursor.
- the precursors of R 1 and L can be incorporated into a preformed cassette that is subsequently attached to the glycosyl moiety.
- the selection and preparation of precursors with appropriate reactive functional groups is within the ability of those skilled in the art.
- coupling the precursors proceeds by chemistry that is well understood in the art.
- L is a linking group that is formed from an amino acid, or small peptide (e.g., 1-4 amino acid residues) providing a modified sugar in which the polymeric modifying moiety is attached through a substituted alkyl linker.
- exemplary linkers include glycine, lysine, serine and cysteine.
- the PEG moiety can be attached to the amine moiety of the linker through an amide or urethane bond.
- the PEG is linked to the sulfur or oxygen atoms of cysteine and serine through thioether or ether bonds, respectively.
- R 5 includes the polymeric modifying moiety.
- R 5 includes both the polymeric modifying moiety and a linker, L, joining the modifying moiety to the remainder of the molecule.
- L can be a linear or branched structure.
- the polymeric modifying moiety can be branched or linear.
- Formula I has a structure according to the following formula: in which the moiety: is the linker arm, L, and R 16 and R 17 are R 1 .
- R 16 and R 17 are independently selected polymeric modifying moieties.
- C is carbon.
- X 5 is preferably a non-reactive group (e.g., H, unsubstituted alkyl, unsubstituted heteroalkyl), and can be a polymeric arm.
- X 2 and X 4 are linkage fragments that are preferably essentially non-reactive under physiological conditions, which may be the same or different.
- An exemplary linker includes neither aromatic nor ester moieties.
- linkages can include one or more moiety that is designed to degrade under physiologically relevant conditions, e.g., esters, disulfides, etc.
- X 2 and X 4 join polymeric arms R 16 and R 17 to C.
- Exemplary linkage fragments for X 2 , X 3 and X 4 are independently selected and include S, SC(O)NH, HNC(O)S, SC(O)O, O, NH, NHC(O), (O)CNH and NHC(O)O, and OC(O)NH, CH 2 S, CH 2 O, CH 2 CH 2 O, CH 2 CH 2 S, (CH 2 ) o O, (CH 2 ) o S or (CH 2 ) o Y′-PEG wherein, Y′ is S, NH, NHC(O), C(O)NH, NHC(O)O, OC(O)NH, or O and o is an integer from 1 to 50.
- the linkage fragments X 2 and X 4 join polymeric
- Formula I has a structure according to the following formula: the indices m and n are integers independently selected from 0 to 5000.
- a 1 , A 2 , A 3 , A 4 , A 5 , A 6 , A 7 , A 8 , A 9 , A 10 and A 11 are members independently selected from H, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl, —NA 12 A 13 , —OA 12 and —SiA 12 A 13 .
- the indices j and k are integers independently selected from 0 to 20.
- a 12 and A 13 are members independently selected from substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl.
- Formula IV has a structure according to the following formula:
- a 1 and A 2 are each —OCH 3 or H.
- the present invention provides an hGH peptide comprising the moiety: wherein D is a member selected from —OH and R 1 -L-HN—; G is a member selected from H and R 1 -L- and —C(O)(C 1 -C 6 )alkyl; R 1 is a moiety comprising a straight-chain or branched poly(ethylene glycol) residue; and L is a linker, e.g., a bond (“zero order”), substituted or unsubstituted alkyl and substituted or unsubstituted heteroalkyl.
- D is a member selected from —OH and R 1 -L-HN—
- G is a member selected from H and R 1 -L- and —C(O)(C 1 -C 6 )alkyl
- R 1 is a moiety comprising a straight-chain or branched poly(ethylene glycol) residue
- L is a linker, e.g., a bond
- the selected modifying moiety is a water-soluble polymer, e.g., m-PEG.
- the PEG moiety is attached directly to a glycosyl linker, preferably an intact glycosyl linker, or via a non-glycosyl linker, e.g., substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl.
- the glycosyl linker is covalently attached to an amino acid residue or a glycosyl residue of the peptide.
- the invention also provides conjugates in which an amino acid residue and a glycosyl residue are modified with a glycosyl linker.
- An exemplary water-soluble polymer is poly(ethylene glycol), e.g., methoxy-poly(ethylene glycol).
- the poly(ethylene glycol) used in the present invention is not restricted to any particular form or molecular weight range.
- the PEG of use in the conjugates of the invention can be linear or branched.
- the molecular weight preferably ranges from about 500 to 100,000.
- a molecular weight of 2000-60,000 is preferably used and preferably of from 5,000 to about 30,000. More preferably, the molecular weight is from about 5,000 to about 30,000.
- the poly(ethylene glycol) is a branched PEG having more than one PEG moiety attached.
- branched PEGs are described in U.S. Pat. No. 5,932,462; U.S. Pat. No. 5,342,940; U.S. Pat. No. 5,643,575; U.S. Pat. No. 5,919,455; U.S. Pat. No. 6,113,906; U.S. Pat. No. 5,183,660; WO 02/09766; Kodera Y., Bioconjugate Chemistry 5: 283-288 (1994); and Yamasaki et al., Agric. Biol. Chem., 52: 2125-2127, 1998.
- the molecular weight of each poly(ethylene glycol) of the branched PEG is less than or equal to 40,000 daltons.
- branched polymer species according to this formula are essentially pure water-soluble polymers.
- X 3′ is a moiety that includes an ionizable (e.g., OH, COOH, H 2 PO 4 , HSO 3 , NH 2 , and salts thereof, etc.) or other reactive functional group, e.g., infra.
- C is carbon.
- X 5 , R 16 and R 17 are independently selected from non-reactive groups (e.g., H, unsubstituted alkyl, unsubstituted heteroalkyl) and polymeric arms (e.g., PEG).
- X 2 and X 4 are linkage fragments that are preferably essentially non-reactive under physiological conditions, which may be the same or different.
- An exemplary linker includes neither aromatic nor ester moieties. Alternatively, these linkages can include one or more moieties that are designed to degrade under physiologically relevant conditions, e.g., esters, disulfides, etc.
- X 2 and X 4 join polymeric arms R 16 and R 17 to C. When X 3′ is reacted with a reactive functional group of complementary reactivity on a linker, sugar or linker-sugar cassette, X 3′ is converted to a component of linkage fragment X 3 .
- the glycosyl linking group can be, or can include, a saccharide moiety that is degradatively modified before or during the addition of the modifying group.
- the glycosyl linking group can be derived from a saccharide residue that is produced by oxidative degradation of an intact saccharide to the corresponding aldehyde, e.g., via the action of metaperiodate, and subsequently converted to a Schiff base with an appropriate amine, which is then reduced to the corresponding amine.
- Exemplary intact glycosyl linking groups include sialic acid moieties that are derivatized with PEG.
- Exemplary conjugates of the present invention can be characterized by the general structure: in which the symbols a, b, c, and d represent a positive, non-zero integer and s and t are either 0 or a positive integer.
- the “agent” is a therapeutic agent, a bioactive agent, a detectable label, water-soluble moiety (e.g., PEG, m-PEG, PPG, and m-PPG) or the like.
- the “agent” can be a peptide, e.g., enzyme, antibody, antigen, etc.
- the linker can be any of a wide array of linking groups, infra. Alternatively, the linker may be a single bond or a “zero order linker.”
- the present invention provides conjugates that are highly homogenous in their substitution patterns. Using the methods of the invention, it is possible to form peptide conjugates in which essentially all of the modified sugar moieties across a population of conjugates of the invention are attached to multiple copies of a structurally identical amino acid or glycosyl residue.
- the invention provides a peptide conjugate having a population of water-soluble polymer moieties, which are covalently bound to the peptide through a glycosyl linking group, e.g. an intact glycosyl linking group.
- each member of the population is bound via the glycosyl linking group to a glycosyl residue of the peptide, and each glycosyl residue of the peptide to which the glycosyl linking group is attached has the same structure.
- a peptide conjugate having a population of water-soluble polymer moieties covalently bound thereto through a glycosyl linking group.
- a glycosyl linking group essentially every member of the population of water soluble polymer moieties is bound to an amino acid residue of the peptide via a glycosyl linking group, and each amino acid residue having a glycosyl linking group attached thereto has the same structure.
- the present invention also provides conjugates analogous to those described above in which the peptide is conjugated to a therapeutic moiety, diagnostic moiety, targeting moiety, toxin moiety or the like via an intact glycosyl linking group.
- a therapeutic moiety e.g., diagnostic moiety, targeting moiety, toxin moiety or the like via an intact glycosyl linking group.
- moieties can be a small molecule, natural polymer (e.g., polypeptide) or synthetic polymer.
- the peptides of the invention include at least one N-, or O-linked glycosylation site, which is glycosylated with a glycosyl residue that includes a polymeric modifying moiety, e.g. a PEG moiety.
- the PEG is covalently attached to the peptide via an intact glycosyl linking group.
- the glycosyl linking group is covalently attached to either an amino acid residue or a glycosyl residue of the peptide.
- the glycosyl linking group is attached to one or more glycosyl units of a glycopeptide.
- the invention also provides conjugates in which a glycosyl linking group is attached to both an amino acid residue and a glycosyl residue.
- mutant human growth hormone is conjugated to transferrin via a bifunctional linker that includes an intact glycosyl linking group at each terminus of the PEG moiety.
- a bifunctional linker that includes an intact glycosyl linking group at each terminus of the PEG moiety.
- one terminus of the PEG linker is functionalized with an intact sialic acid linker that is attached to transferrin and the other is functionalized with an intact GalNAc linker that is attached to the mutant hGH.
- conjugates of the invention can include intact glycosyl linking groups that are mono- or multi-valent (e.g., antennary structures).
- conjugates of the invention include both species in which a selected moiety is attached to a peptide via a monovalent glycosyl linking group.
- conjugates in which more than one selected moiety is attached to a peptide via a multivalent linking group are also included within the invention.
- the invention provides conjugates that localize selectively in a particular tissue due to the presence of a targeting agent as a component of the conjugate.
- the targeting agent is a protein.
- Exemplary proteins include transferrin (brain, blood pool), HS-glycoprotein (bone, brain, blood pool), antibodies (brain, tissue with antibody-specific antigen, blood pool), coagulation factors V-XII (damaged tissue, clots, cancer, blood pool), serum proteins, e.g., ⁇ -acid glycoprotein, fetuin, ⁇ -fetal protein (brain, blood pool), ⁇ 2-glycoprotein (liver, atherosclerosis plaques, brain, blood pool), hGH, GM-CSF, M-CSF, and EPO (immune stimulation, cancers, blood pool, red blood cell overproduction, neuroprotection), albumin (increase in half-life), and lipoprotein E.
- the present invention provides methods for preparing these and other conjugates.
- the invention provides a method of forming a covalent conjugate between a selected moiety and a peptide.
- the invention provides methods for targeting conjugates of the invention to a particular tissue or region of the body.
- the present invention provides a method for preventing, curing, or ameliorating a disease state by administering a conjugate of the invention to a subject at risk of developing the disease or a subject that has the disease.
- the conjugate is formed between a polymeric modifying moiety, a therapeutic moiety, targeting moiety or a biomolecule, and a glycosylated or non-glycosylated peptide.
- the polymer, therapeutic moiety or biomolecule is conjugated to the peptide via a glycosyl linking group (or glycosyl residue), which is interposed between, and covalently linked to both the peptide and the modifying group (e.g., water-soluble polymer).
- the method includes contacting the peptide with a mixture containing a modified sugar and an enzyme, e.g. glycosyltransferase, that conjugates the modified sugar to the substrate.
- the reaction is conducted under conditions sufficient to form a covalent bond between the modified sugar and the peptide.
- the sugar moiety of the modified sugar is preferably selected from nucleotide sugars, activated sugars, and sugars that are neither nucleotides nor activated.
- the acceptor hGH peptide (glycosylated or non-glycosylated) is typically synthesized de novo, or recombinantly expressed in a prokaryotic cell (e.g., bacterial cell, such as E. coli ) or in a eukaryotic cell such as a mammalian, yeast, insect, fungal or plant cell.
- a prokaryotic cell e.g., bacterial cell, such as E. coli
- a eukaryotic cell such as a mammalian, yeast, insect, fungal or plant cell.
- the peptide can be either a full-length protein or a fragment.
- the peptide can be a wild type or mutated peptide.
- the peptide includes a mutation that adds one or more O- or N-linked glycosylation sites to the hGH peptide sequence.
- the method of the invention also provides for modification of incompletely glycosylated peptides that are produced recombinantly.
- Many recombinantly produced glycoproteins are incompletely glycosylated, exposing carbohydrate residues that may have undesirable properties, e.g., immunogenicity, recognition by the RES.
- the peptide can be simultaneously further glycosylated and derivatized with, e.g., a water-soluble polymer, therapeutic agent, or the like.
- the sugar moiety of the modified sugar can be the residue that would properly be conjugated to the acceptor in a fully glycosylated peptide, or another sugar moiety with desirable properties.
- Peptides modified by the methods of the invention can be synthetic or wild-type peptides or they can be mutated peptides, produced by methods known in the art, such as site-directed mutagenesis. Glycosylation of peptides is typically either N-linked or O-linked. An exemplary N-linkage is the attachment of the modified sugar to the side chain of an asparagine residue.
- the tripeptide sequences asparagine-X-serine and asparagine-X-threonine, where X is any amino acid except proline, are the recognition sequences for enzymatic attachment of a carbohydrate moiety to the asparagine side chain.
- O-linked glycosylation refers to the attachment of one sugar (e.g., N-aceylgalactosamine, galactose, mannose, GlcNAc, glucose, fucose or xylose) to the hydroxy side chain of a hydroxyamino acid, preferably serine or threonine, although 5-hydroxyproline or 5-hydroxylysine may also be used.
- one sugar e.g., N-aceylgalactosamine, galactose, mannose, GlcNAc, glucose, fucose or xylose
- Addition of glycosylation sites to a peptide or other structure is conveniently accomplished by altering the amino acid sequence such that it contains one or more glycosylation sites.
- the addition may also be made by the incorporation of one or more species presenting an —OH group, preferably serine or threonine residues, within the sequence of the peptide (for O-linked glycosylation sites).
- the addition may be made by mutation or by full chemical synthesis of the peptide.
- the peptide amino acid sequence is preferably altered through changes at the DNA level, particularly by mutating the DNA encoding the peptide at preselected bases such that codons are generated that will translate into the desired amino acids.
- the DNA mutation(s) are preferably made using methods known in the art.
- the glycosylation site is added by shuffling polynucleotides.
- Polynucleotides encoding a candidate peptide can be modulated with DNA shuffling protocols.
- DNA shuffling is a process of recursive recombination and mutation, performed by random fragmentation of a pool of related genes, followed by reassembly of the fragments by a polymerase chain reaction-like process. See, e.g., Stemmer, Proc. Natl. Acad. Sci. USA 91:10747-10751 (1994); Stemmer, Nature 370:389-391 (1994); and U.S. Pat. Nos. 5,605,793, 5,837,458, 5,830,721 and 5,811,238.
- the present invention also provides means of adding (or removing) one or more selected glycosyl residues to a peptide, after which a modified sugar is conjugated to at least one of the selected glycosyl residues of the peptide.
- the present embodiment is useful, for example, when it is desired to conjugate the modified sugar to a selected glycosyl residue that is either not present on a peptide or is not present in a desired amount.
- the selected glycosyl residue prior to coupling a modified sugar to a peptide, the selected glycosyl residue is conjugated to the peptide by enzymatic or chemical coupling.
- the glycosylation pattern of a glycopeptide is altered prior to the conjugation of the modified sugar by the removal of a carbohydrate residue from the glycopeptide. See, for example WO 98/31826.
- Enzymatic cleavage of carbohydrate moieties on polypeptide variants can be achieved by the use of a variety of endo- and exo-glycosidases as described by Thotakura et al., Meth. Enzymol. 138: 350 (1987).
- glycosyl moieties Chemical addition of glycosyl moieties is carried out by any art-recognized method. Enzymatic addition of sugar moieties is preferably achieved using a modification of the methods set forth herein, substituting native glycosyl units for the modified sugars used in the invention. Other methods of adding sugar moieties are disclosed in U.S. Pat. Nos. 5,876,980, 6,030,815, 5,728,554, and 5,922,577.
- Exemplary attachment points for selected glycosyl residue include, but are not limited to: (a) consensus sites for N-linked glycosylation and O-linked glycosylation; (b) terminal glycosyl moieties that are acceptors for a glycosyltransferase; (c) arginine, asparagine and histidine; (d) free carboxyl groups; (e) free sulfhydryl groups such as those of cysteine; (f) free hydroxyl groups such as those of serine, threonine, or hydroxyproline; (g) aromatic residues such as those of phenylalanine, tyrosine, or tryptophan; or (h) the amide group of glutamine.
- the modified sugar such as those set forth above, is activated as the corresponding nucleotide sugars.
- Exemplary sugar nucleotides that are used in the present invention in their modified form include nucleotide mono-, di- or triphosphates or analogs thereof.
- the modified sugar nucleotide is selected from a UDP-glycoside, CMP-glycoside, or a GDP-glycoside.
- the sugar nucleotide portion of the modified sugar nucleotide is selected from UDP-galactose, UDP-galactosamine, UDP-glucose, UDP-glucosamine, GDP-mannose, GDP-fucose, CMP-sialic acid, or CMP-NeuAc.
- the nucleotide phosphate is attached to C-1.
- the present invention uses modified sugars, such as modified sugar nucleotides, as reactants in the production of hGH conjugates.
- the sugar moiety is preferably a saccharide, a deoxy-saccharide, an amino-saccharide, or an N-acyl saccharide.
- saccharide a saccharide
- deoxy-saccharide an amino-saccharide
- N-acyl saccharide an N-acyl saccharide.
- the modifying group is conjugated to the sugar moiety, typically, through conjugation with an amine, sulfhydryl or hydroxyl, e.g., primary hydroxyl, moiety on the sugar.
- the modifying group is attached through an amine moiety on the sugar, e.g., through an amide, a urethane or a urea that is formed through the reaction of the amine with a reactive derivative of the modifying group.
- any sugar can be utilized in the hGH conjugates of the invention.
- Exemplary sugars that are useful in the conjugates of the invention include, but are not limited to, glucose, galactose, mannose, fucose, and sialic acid.
- Other useful sugars include amino sugars such as glucosamine, galactosamine, mannosamine, the 5-amine analogue of sialic acid and the like.
- the sugar can be a structure found in nature or it can be modified to provide a site for conjugating the modifying group.
- the invention provides a sialic acid derivative in which the 9-hydroxy moiety is replaced with an amine.
- the amine is readily derivatized with an activated analogue of a modifying group.
- the invention utilizes a modified sugar amine that has the formula: in which J is a glycosyl moiety (e.g. a nucleotide sugar), and L is a bond or a linker and R 1 is the modifying group, e.g. a polymeric modifying moiety.
- exemplary bonds are those that are formed between an NH 2 moiety on the glycosyl moiety and a group of complementary reactivity on the modifying group.
- R 1 includes a carboxylic acid moiety, such moiety may be activated and coupled with the NH 2 moiety on the glycosyl residue, thereby affording a bond having the structure NHC(O)R 1 .
- J is preferably a glycosyl moiety that is “intact,” i.e. not having been degraded by exposure to conditions that cleave the pyranose or furanose structure, e.g. oxidative conditions, sodium periodate.
- Exemplary linkers include alkyl and heteroalkyl moieties.
- the linkers include linking groups, such as acyl-based linking groups, e.g., —C(O)NH—, —OC(O)NH—, and the like.
- the linking groups are bonds formed between components of the species of the invention, e.g. between the glycosyl moiety and the linker (L), or between the linker and the modifying group (R 1 ).
- Other exemplary linking groups are ethers, thioethers and amines.
- the linker is an amino acid residue, such as a glycine residue.
- the carboxylic acid moiety of the glycine is converted to the corresponding amide by reaction with an amine on the glycosyl residue, and the amine of the glycine is converted to the corresponding amide or urethane by reaction with an activated carboxylic acid or carbonate on the rest of the modifying group.
- Another exemplary linker is a PEG moiety, e.g. a PEG moiety that is functionalized with an amino acid residue.
- the PEG linker is conjugated to the glycosyl group through the amino acid residue at one PEG terminus and bound to R 1 through the other PEG terminus.
- the amino acid residue is bound to R 1 and the PEG terminus, which is not bound to the amino acid, is bound to the glycosyl group.
- An exemplary species of NH— L-R 1 has the formula: —NH ⁇ C(O)(CH 2 ) a NH ⁇ s ⁇ C(O)(CH 2 ) b (OCH 2 CH 2 ) c O(CH 2 ) d NH ⁇ t R 1 , in which the indices s and t are independently 0 or 1.
- the indices a, b and d are independently integers from 0 to 20, and c is an integer from 1 to 2500.
- Other similar linkers are based on species in which an —NH moiety is replaced by another group, for example, —S, —O or —CH 2 .
- one or more of the bracketed moieties corresponding to indices s and t can be replaced with a substituted or unsubstituted alkyl or heteroalkyl moiety.
- the invention utilizes compounds in which NH-L 5 -R 1 is:
- the indices a, b and d are independently selected from the integers from 0 to 20, preferably from 1 to 5.
- the index c is an integer from 1 to 2500.
- c is selected such that the PEG moiety is approximately 1 kDa, 2 kDa, 5 kDa, 10 kDa, 15 kDa, 20 kDa, 25 kDa, 30 kDa, 35 kDa, 40 kDa, 45 kDa, 50 kDa, 55 kDa, 60 kDa, 65 kDa, 70 kDa, 75 kDa or 80 kDa.
- J is sialic acid and selected compounds of use in the invention have the formulae:
- sialic acid moiety in the exemplary compounds above can be replaced with any other amino-saccharide including, but not limited to, glucosamine, galactosamine, mannosamine, their N-acetyl derivatives, and the like.
- a primary hydroxyl moiety of the sugar is functionalized with a modifying group.
- the 9-hydroxyl of sialic acid can be converted to the corresponding amine and functionalized to provide a modified sugar according to the invention.
- Formulae according to this embodiment include:
- the method of the invention utilizes compounds having the formulae: in which L-R 1 is as discussed above, and L 1 -R 1 represents a linker bound to the modifying group.
- L-R 1 is as discussed above
- L 1 -R 1 represents a linker bound to the modifying group.
- exemplary linker species according to L 1 include a bond, alkyl or heteroalkyl moieties.
- the present invention provides for the use of nucleotide sugars that are modified with a water-soluble polymer, which is either straight-chain or branched.
- a water-soluble polymer which is either straight-chain or branched.
- compounds having the formula shown below are of use to prepare conjugates within the scope of the present invention: in which X 4 is O or a bond.
- Selected conjugates according to this motif are based on mannose, galactose or glucose, or on species having the stereochemistry of mannose, galactose or glucose.
- the general formulae of these conjugates are:
- the invention provides saccharides bearing a modifying group, activated analogues of these species and conjugates formed between species such as peptides and lipids and a modified saccharide of the invention.
- the invention utilizes modified sugars as set forth above that are activated as the corresponding nucleotide sugars.
- exemplary sugar nucleotides that are used in the present invention in their modified form include nucleotide mono-, di- or triphosphates or analogs thereof.
- the modified sugar nucleotide is selected from a UDP-glycoside, CMP-glycoside, or a GDP-glycoside.
- the sugar nucleotide portion of the modified sugar nucleotide is selected from UDP-galactose, UDP-galactosamine, UDP-glucose, UDP-glucosamine, GDP-mannose, GDP-fucose, CMP-sialic acid, or CMP-NeuAc.
- the nucleotide phosphate is attached to C-1.
- the invention also provides for the use of sugar nucleotides modified with L-R 1 at the 6-carbon position.
- exemplary species according to this embodiment include: in which the R groups, and L, represent moieties as discussed above.
- the index “y” is 0, 1 or 2.
- L is a bond between NH and R 1 .
- the base is a nucleic acid base.
- nucleotide sugars of use in the invention in which the carbon at the 6-position is modified include species having the stereochemistry of GDP mannose, e.g.: in which X 5 is a bond or O.
- the index i represents 0 or 1.
- the index a represents an integer from 1 to 20.
- the indices e and f independently represent integers from 1 to 2500.
- Q is H or substituted or unsubstituted C 1 -C 6 alkyl.
- the serine derivative, in which S is replaced with O also falls within this general motif.
- the invention provides a conjugate in which the modified sugar is based on the stereochemistry of UDP galactose.
- An exemplary nucleotide sugar of use in this invention has the structure:
- nucleotide sugar is based on the stereochemistry of glucose.
- exemplary species according to this embodiment have the formulae:
- the invention provides a method for linking hGH and one or more peptide through a linking group.
- the linking group is of any useful structure and may be selected from straight-chain and branched chain structures.
- each terminus of the linker, which is attached to a peptide includes a modified sugar (i.e., a nascent intact glycosyl linking group).
- two peptides are linked together via a linker moiety that includes a PEG linker.
- a PEG moiety is functionalized at a first terminus with a first glycosyl unit and at a second terminus with a second glycosyl unit.
- the first and second glycosyl units are preferably substrates for different transferases, allowing orthogonal attachment of the first and second peptides to the first and second glycosyl units, respectively.
- the (glycosyl) 1 -PEG-(glycosyl) 2 linker is contacted with the first peptide and a first transferase for which the first glycosyl unit is a substrate, thereby forming (peptide) 1 -(glycosyl) 1 -PEG-(glycosyl) 2 .
- Glycosyltransferase and/or unreacted peptide is then optionally removed from the reaction mixture.
- the second peptide and a second transferase for which the second glycosyl unit is a substrate are added to the (peptide) 1 -(glycosyl) 1 -PEG-(glycosyl) 2 conjugate, forming (peptide) 1 -(glycosyl) 1 -PEG-(glycosyl) 2 -(peptide) 2 .
- Those of skill in the art will appreciate that the method outlined above is also applicable to forming conjugates between more than two peptides by, for example, the use of a branched PEG, dendrimer, poly(amino acid), polysaccharide or the like.
- human growth hormone is conjugated to transferrin via a bifunctional linker that includes an intact glycosyl linking group at each terminus of the PEG moiety (Scheme 1).
- the hGH conjugate has an in vivo half-life that is increased over that of hGH alone by virtue of the greater molecular sized of the conjugate.
- the conjugation of hGH to transferrin serves to selectively target the conjugate to the brain.
- one terminus of the PEG linker is functionalized with a CMP sialic acid and the other is functionalized with an UDP GalNAc.
- the linker is combined with hGH in the presence of a GalNAc transferase, resulting in the attachment of the GalNAc of the linker arm to a serine and/or threonine residue on the hGH.
- the processes described above can be carried through as many cycles as desired, and is not limited to forming a conjugate between two peptides with a single linker.
- the reactions functionalizing the intact glycosyl linking groups at the termini of the PEG (or other) linker with the peptide can occur simultaneously in the same reaction vessel, or they can be carried out in a step-wise fashion.
- the conjugate produced at each step is optionally purified from one or more reaction components (e.g., enzymes, peptides).
- Scheme 2 shows a method of preparing a conjugate that targets a selected protein, e.g., human growth hormone, to bone and increases the circulatory half-life of the selected protein.
- G is a glycosyl residue on an activated sugar moiety (e.g., sugar nucleotide), which is converted to an intact glycosyl linker group in the conjugate.
- L is a saccharyl linking group such as GalNAc, or GalNAc-Gal.
- reactive derivatives of PEG or other linkers
- the use of reactive derivatives of PEG (or other linkers) to attach one or more peptide moieties to the linker is within the scope of the present invention.
- the invention is not limited by the identity of the reactive PEG analogue.
- Many activated derivatives of poly(ethylene glycol) are available commercially and in the literature. It is well within the abilities of one of skill to choose, and synthesize if necessary, an appropriate activated PEG derivative with which to prepare a substrate useful in the present invention. See, Abuchowski et al. Cancer Biochem. Biophys., 7: 175-186 (1984); Abuchowski et al., J. Biol. Chem., 252: 3582-3586 (1977); Jackson et al., Anal.
- linking groups include the urethane linkage between amino groups and activated PEG. See, Veronese, et al., Appl. Biochem. Biotechnol., 11: 141-152 (1985).
- the invention provides a method for extending the blood-circulation half-life of a selected peptide, in essence targeting the peptide to the blood pool, by conjugating the peptide to a synthetic or natural polymer of a size sufficient to retard the filtration of the protein by the glomerulus (e.g., albumin).
- a synthetic or natural polymer of a size sufficient to retard the filtration of the protein by the glomerulus e.g., albumin.
- This embodiment of the invention is illustrated in Scheme 3 in which hGH is conjugated to albumin via a PEG linker using a combination of chemical and enzymatic modification.
- a residue (e.g., amino acid side chain) of albumin is modified with a reactive PEG derivative, such as X-PEG-(CMP-sialic acid), in which X is an activating group (e.g., active ester, isothiocyanate, etc).
- X is an activating group (e.g., active ester, isothiocyanate, etc).
- the PEG derivative and hGH are combined and contacted with a transferase for which CMP-sialic acid is a substrate.
- an 1-amine of lysine is reacted with the N-hydroxysuccinimide ester of the PEG-linker to form the albumin conjugate.
- the CMP-sialic acid of the linker is enzymatically conjugated to an appropriate residue on hGH, e.g., Gal or GalNAc, thereby forming the conjugate.
- hGH e.g., Gal or GalNAc
- the invention utilizes modified sugars in which the 6-hydroxyl position is converted to the corresponding amine moiety, which bears a modifying group such as those set forth above.
- exemplary saccharyl groups that can be used as the core of these modified sugars include Gal, GalNAc, Glc, GlcNAc, Fuc, Xyl, Man, and the like.
- a representative modified sugar according to this embodiment has the formula: in which R 3 -R 6 are members independently selected from H, OH, C(O)CH 3 , NH, and NH C(O)CH 3 .
- R 7 is a link to another glycosyl residue (—O-glycosyl) or to an amino acid of the hGH peptide.
- R 6 is OR 1 , NHR 1 or NH-L-R 1 , which is as described above.
- the modified sugar is based upon a 6-amino-N-acetyl-glycosyl moiety. As shown below for N-acetylgalactosamine, the 6-amino-sugar moiety is readily prepared by standard methods.
- the index n represents an integer from 1 to 2500, preferably from 10 to 1500, and more preferably from 10 to 1200.
- the symbol “A” represents an activating group, e.g., a halo, a component of an activated ester (e.g., a N-hydroxysuccinimide ester), a component of a carbonate (e.g., p-nitrophenyl carbonate) and the like.
- Preferred activated leaving groups, for use in the present invention are those that do not significantly sterically encumber the enzymatic transfer of the glyco side to the acceptor. Those of skill in the art will appreciate that other PEG-amide nucleotide sugars are readily prepared by this and analogous methods.
- the amide moiety is replaced by a group such as a urethane or a urea.
- the glycosyl structures on the peptide conjugates of the invention have substantially any structure.
- the glycans can be O-linked or N-linked.
- each of the pyranose and furanose derivatives discussed above can be a component of a glycosyl moiety of a peptide.
- the group has the formula: in which the index t is 0 or 1.
- the group has a structure which is a member selected from the following formulae: in which the index t is 0 or 1.
- the group has the formula: in which the index p represents and integer from 1 to 10; and a is either 0 or 1.
- R 1 is a branched PEG, for example, one of those species set forth above.
- Illustrative compounds according to this embodiment include: in which X 4 is a bond or O.
- the invention provides hGH peptide conjugates that includes a glycosyl linking group, such as those set forth above, that is covalently attached to an amino acid residue of the peptide.
- the glycosyl linking moiety is linked to a galactose residue through a Sia residue:
- An exemplary species according to this motif is prepared by conjugating Sia-L-R 1 to a terminal sialic acid of a glycan using an enzyme that forms Sia-Sia bonds, e.g., CST-II, ST8Sia-II, ST8Sia-II1 and ST8Sia-IV.
- the sugar moiety is a sialic acid moiety that has been oxidized and conjugated to a polymeric modifying moiety, such as is described in commonly assigned U.S. Provisional Patent Application No. 60/641,956 (Attorney Docket No. 040853-01-5150), filed Jan. 6, 2005.
- an exemplary linker is derived from a natural or unnatural amino acid, amino acid analogue or amino acid mimetic, or a small peptide formed from one or more such species.
- certain branched polymers found in the compounds of the invention have the formula:
- X a is a linkage fragment that is formed by the reaction of a reactive functional group, e.g. X 3′ , on a precursor of the branched polymeric modifying moiety and a reactive functional group on the sugar moiety, or a precursor to a linker.
- a reactive functional group e.g. X 3′
- X 3′ when X 3′ is a carboxylic acid, it can be activated and bound directly to an amine group pendent from an amino-saccharide (e.g., Sia, GalNH 2 , GlcNH 2 , ManNH 2 , etc.), forming an X a that is an amide.
- an amino-saccharide e.g., Sia, GalNH 2 , GlcNH 2 , ManNH 2 , etc.
- Additional exemplary reactive functional groups and activated precursors are described hereinbelow.
- the index c represents an integer from 1 to 10. The other symbols have the same identity as those discussed above.
- X a is a linking moiety formed with another linker: in which X b is a second linkage fragment and is independently selected from those groups set forth for X a , and similar to L, L 1 is a bond, substituted or unsubstituted alkyl or substituted or unsubstituted heteroalkyl.
- Exemplary species for X a and X b include S, SC(O)NH, HNC(O)S, SC(O)O, O, NH, NHC(O), C(O)NH and NHC(O)O, and OC(O)NH.
- X 4 is a peptide bond to R 17 , which is an amino acid, di-peptide, e.g. Lys-Lys, or tri-peptide (e.g. Lys-Lys-Lys) in which the alpha-amine moiety(ies) and/or side chain heteroatom are modified with a polymeric modifying moiety.
- R 17 is an amino acid, di-peptide, e.g. Lys-Lys, or tri-peptide (e.g. Lys-Lys-Lys) in which the alpha-amine moiety(ies) and/or side chain heteroatom are modified with a polymeric modifying moiety.
- the conjugates of the invention include a moiety, e.g. an R 15 moiety that has a formula that is selected from: in which the identity of the radicals represented by the various symbols is the same as that discussed hereinabove.
- L a is a bond or a linker as discussed above for L and L 1 , e.g. substituted or unsubstituted alkyl or substituted or unsubstituted heteroalkyl moiety.
- L a is a moiety of the side chain of sialic acid that is functionalized with the polymeric modifying moiety as shown.
- Exemplary L a moieties include substituted or unsubstituted alkyl chains that include one or more OH or NH 2 .
- the invention provides conjugates having a moiety, e.g. an R 15 moiety with formula:
- the hGH peptide includes an R 15 moiety with the formula: in which the identities of the radicals are as discussed above.
- An exemplary species for L a is —(CH 2 ) j C(O)NH(CH 2 ) h C(O)NH—, in which the indices h and j are independently selected integers from 0 to 10.
- a further exemplary species is —C(O)NH—.
- the indices j and k are integers independently selected from 0 to 20.
- the indices m and n are integers independently selected from 0 to 5000.
- a 1 , A 2 , A 3 , A 4 , A 5 , A 6 , A 7 , A 8 , A 9 , A 10 and A 11 are members independently selected from H, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl, —NA 12 A 13 , —OA 12 and —SiA 12 A 13 .
- a 12 and A 13 are members independently selected from substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl.
- the modified sugar is an oligosaccharide having an antennary structure.
- one or more of the termini of the antennae bear the modifying moiety.
- the oligosaccharide is useful to “amplify” the modifying moiety; each oligosaccharide unit conjugated to the peptide attaches multiple copies of the modifying group to the peptide.
- the general structure of a typical chelate of the invention as set forth in the drawing above, encompasses multivalent species resulting from preparing a conjugate of the invention utilizing an antennary structure. Many antennary saccharide structures are known in the art, and the present method can be practiced with them without limitation.
- poly(ethylene glycol) e.g., methoxy-poly(ethylene glycol).
- PEG poly(ethylene glycol)
- Those of skill will appreciate that the focus in the sections that follow is for clarity of illustration and the various motifs set forth using PEG as an exemplary polymer are equally applicable to species in which a polymer other than PEG is utilized.
- PEG of any molecular weight e.g., 1 kDa, 2 kDa, 5 kDa, 10 kDa, 15 kDa, 20 kDa, 25 kDa, 30 kDa, 35 kDa, 40 kDa, 45 kDa, 50 kDa, 55 kDa, 60 kDa, 65 kDa, 70 kDa, 75 kDa or 80 kDa can be used in the present invention.
- 1 kDa, 2 kDa, 5 kDa, 10 kDa, 15 kDa, 20 kDa, 25 kDa, 30 kDa, 35 kDa, 40 kDa, 45 kDa, 50 kDa, 55 kDa, 60 kDa, 65 kDa, 70 kDa, 75 kDa or 80 kDa can be used in the present invention.
- the R 15 moiety has a formula that is a member selected from the group:
- linker fragment —NH(CH 2 ) a — can be present or absent.
- the conjugate includes an R 15 moiety selected from the group:
- the indices e and f are independently selected from the integers from 1 to 2500. In further exemplary embodiments, e and f are selected to provide a PEG moiety that is about 1 kDa, 2 kDa, 5 kDa, 10 kDa, 15 kDa, 20 kDa, 25 kDa, 30 kDa, 35 kDa, 40 kDa, 45 kDa, 50 kDa, 55 kDa, 60 kDa, 65 kDa, 70 kDa, 75 kDa or 80 kDa.
- the symbol Q represents substituted or unsubstituted alkyl (e.g., C 1 -C 6 alkyl, e.g., methyl), substituted or unsubstituted heteroalkyl or H.
- branched polymers have structures based on di-lysine (Lys-Lys) peptides, and tri-lysine peptides (Lys-Lys-Lys), e.g.:
- e, f, f′, and f′′ represent integers independently selected from 1 to 2500.
- the indices q, q′ and q′′ represent integers independently selected from 1 to 20.
- modifying groups are discussed below.
- the modifying groups can be selected for their ability to impart to a polypeptide one or more desirable properties.
- Exemplary properties include, but are not limited to, enhaced pharmacokinetics, enhanced pharmacodynamics, improved biodistribution, providing a polyvalent species, improved water solubility, enhanced or diminished lipophilicity, and tissue targeting.
- modified sugars are modified with water-soluble or water-insoluble polymers.
- useful polymer are further exemplified below.
- water-soluble polymers are known to those of skill in the art and are useful in practicing the present invention.
- the term water-soluble polymer encompasses species such as saccharides (e.g., dextran, amylose, hyalouronic acid, poly(sialic acid), heparans, heparins, etc.); poly(amino acids), e.g., poly(aspartic acid) and poly(glutamic acid); nucleic acids; synthetic polymers (e.g., poly(acrylic acid), poly(ethers), e.g., poly(ethylene glycol); peptides, proteins, and the like.
- the present invention may be practiced with any water-soluble polymer with the sole limitation that the polymer must include a point at which the remainder of the conjugate can be attached.
- Preferred water-soluble polymers are those in which a substantial proportion of the polymer molecules in a sample of the polymer are of approximately the same molecular weight; such polymers are “homodisperse.”
- the present invention is further illustrated by reference to a poly(ethylene glycol) conjugate.
- a poly(ethylene glycol) conjugate Several reviews and monographs on the functionalization and conjugation of PEG are available. See, for example, Harris, Cellol. Chem. Phys. C 25: 325-373 (1985); Scouten, Methods in Enzymology 135: 30-65 (1987); Wong et al., Enzyme Microb. Technol. 14: 866-874 (1992); Delgado et al., Critical Reviews in Therapeutic Drug Carrier Systems 9: 249-304 (1992); Zalipsky, Bioconjugate Chem. 6: 150-165 (1995); and Bhadra, et al., Pharmazie, 57:5-29 (2002).
- U.S. Pat. No. 5,672,662 discloses a water soluble and isolatable conjugate of an active ester of a polymer acid selected from linear or branched poly(alkylene oxides), poly(oxyethylated polyols), poly(olefinic alcohols), and poly(acrylomorpholine).
- U.S. Pat. No. 6,376,604 sets forth a method for preparing a water-soluble 1-benzotriazolylcarbonate ester of a water-soluble and non-peptidic polymer by reacting a terminal hydroxyl of the polymer with di(1-benzotriazoyl)carbonate in an organic solvent.
- the active ester is used to form conjugates with a biologically active agent such as a protein or peptide.
- WO 99/45964 describes a conjugate comprising a biologically active agent and an activated water soluble polymer comprising a polymer backbone having at least one terminus linked to the polymer backbone through a stable linkage, wherein at least one terminus comprises a branching moiety having proximal reactive groups linked to the branching moiety, in which the biologically active agent is linked to at least one of the proximal reactive groups.
- Other branched poly(ethylene glycols) are described in WO 96/21469, U.S. Pat. No. 5,932,462 describes a conjugate formed with a branched PEG molecule that includes a branched terminus that includes reactive functional groups.
- the free reactive groups are available to react with a biologically active species, such as a protein or peptide, forming conjugates between the poly(ethylene glycol) and the biologically active species.
- a biologically active species such as a protein or peptide
- U.S. Pat. No. 5,446,090 describes a bifunctional PEG linker and its use in forming conjugates having a peptide at each of the PEG linker termini.
- Conjugates that include degradable PEG linkages are described in WO 99/34833; and WO 99/14259, as well as in U.S. Pat. No. 6,348,558. Such degradable linkages are applicable in the present invention.
- the branched PEG is based upon a cysteine, serine or di-lysine core.
- further exemplary branched PEGs include:
- the modified sugars are prepared by reacting the glycosyl core (or a linker on the core) with a polymeric modifying moiety (or a linker on the polymeric modifying moiety).
- a polymeric modifying moiety or a linker on the polymeric modifying moiety.
- Representative polymeric modifying moieties include structures that are based on side chain-containing amino acids, e.g., serine, cysteine, lysine, and small peptides, e.g., lys-lys.
- the free amine in the di-lysine structures can also be pegylated through an amide or urethane bond with a PEG moiety.
- the branched PEG moiety is based upon a tri-lysine peptide.
- the tri-lysine can be mono-, di-, tri-, or tetra-PEGylated.
- Exemplary species according to this embodiment have the formulae: in which e, f and f′ are independently selected integers from 1 to 2500; and q, q′ and q′′ are independently selected integers from 1 to 20.
- the PEG is m-PEG (5 kD, 10 kD, 15 kD, 20 kD or 30 kD).
- An exemplary branched PEG species is a serine- or cysteine-(m-PEG) 2 in which the m-PEG is a 20 kD m-PEG.
- the branched PEG is the cysteine residue shown above with a 20 kD m-PEG attached to the sulfur and another attached to the nitrogen.
- the branched polymers of use in the invention include variations on the themes set forth above.
- the di-lysine-PEG conjugate shown above can include three polymeric subunits, the third bonded to the ⁇ -amine shown as unmodified in the structure above.
- the use of a tri-lysine functionalized with three or four polymeric subunits labeled with the polymeric modifying moiety in a desired manner is within the scope of the invention.
- Exemplary PEG molecules that are activated with these and other activating group species and methods of making the activated PEGs are set forth in WO 04/083259.
- m-PEG arms of the branched polymers shown above can be replaced by a PEG moiety with a different terminus, e.g., OH, COOH, NH 2 , C 2 -C 10 -alkyl, etc.
- the structures above are readily modified by inserting alkyl linkers (or removing carbon atoms) between the ⁇ -carbon atom and the functional group of the amino acid side chain.
- alkyl linkers or removing carbon atoms
- branched PEG species set forth herein are readily prepared by methods such as that set forth in the scheme below: in which X a is O or S and r is an integer from 1 to 5.
- the indices e and f are independently selected integers from 1 to 2500. In an exemplary embodiment, one or both of these indices are selected such that the polymer is about 10 kD, 15 kD, or 20 kD in molecular weight.
- a natural or unnatural amino acid is contacted with an activated m-PEG derivative, in this case the tosylate, forming 1 by alkylating the side-chain heteroatom X a .
- the mono-functionalized m-PEG amino acid is submitted to N-acylation conditions with a reactive m-PEG derivative, thereby assembling branched m-PEG 2.
- the tosylate leaving group can be replaced with any suitable leaving group, e.g., halogen, mesylate, triflate, etc.
- the reactive carbonate utilized to acylate the amine can be replaced with an active ester, e.g., N-hydroxysuccinimide, etc., or the acid can be activated in situ using a dehydrating agent such as dicyclohexylcarbodiimide, carbonyldiimidazole, etc.
- the urea moiety is replaced by a group such as a amide.
- the modified sugars comprise a water-insoluble polymer, rather than a water-soluble polymer.
- the conjugates of the invention may also include one or more water-insoluble polymers. This embodiment of the invention is illustrated by the use of the conjugate as a vehicle with which to deliver a therapeutic peptide in a controlled manner.
- Polymeric drug delivery systems are known in the art. See, for example, Dunn et al., Eds. P OLYMERIC D RUGS A ND D RUG D ELIVERY S YSTEMS , ACS Symposium Series Vol. 469, American Chemical Society, Washington, D.C. 1991.
- substantially any known drug delivery system is applicable to the conjugates of the present invention.
- Representative water-insoluble polymers include, but are not limited to, polyphosphazines, poly(vinyl alcohols), polyamides, polycarbonates, polyalkylenes, polyacrylamides, polyalkylene glycols, polyalkylene oxides, polyalkylene terephthalates, polyvinyl ethers, polyvinyl esters, polyvinyl halides, polyvinylpyrrolidone, polyglycolides, polysiloxanes, polyurethanes, poly(methyl methacrylate), poly(ethyl methacrylate), poly(butyl methacrylate), poly(isobutyl methacrylate), poly(hexyl methacrylate), poly(isodecyl methacrylate), poly(lauryl methacrylate), poly(phenyl methacrylate), poly(methyl acrylate), poly(isopropyl acrylate), poly(isobutyl acrylate), poly(octadecyl acrylate)
- Synthetically modified natural polymers of use in hGH conjugates of the invention include, but are not limited to, alkyl celluloses, hydroxyalkyl celluloses, cellulose ethers, cellulose esters, and nitrocelluloses.
- Particularly preferred members of the broad classes of synthetically modified natural polymers include, but are not limited to, methyl cellulose, ethyl cellulose, hydroxypropyl cellulose, hydroxypropyl methyl cellulose, hydroxybutyl methyl cellulose, cellulose acetate, cellulose propionate, cellulose acetate butyrate, cellulose acetate phthalate, carboxymethyl cellulose, cellulose triacetate, cellulose sulfate sodium salt, and polymers of acrylic and methacrylic esters and alginic acid.
- biodegradable polymers of use in the hGH conjugates of the invention include, but are not limited to, polylactides, polyglycolides and copolymers thereof, poly(ethylene terephthalate), poly(butyric acid), poly(valeric acid), poly(lactide-co-caprolactone), poly(lactide-co-glycolide), polyanhydrides, polyorthoesters, blends and copolymers thereof.
- compositions that form gels such as those including collagen, pluronics and the like.
- the polymers of use in the invention include “hybrid” polymers that include water-insoluble materials having within at least a portion of their structure, a bioresorbable molecule.
- An example of such a polymer is one that includes a water-insoluble copolymer, which has a bioresorbable region, a hydrophilic region and a plurality of crosslinkable functional groups per polymer chain.
- water-insoluble materials includes materials that are substantially insoluble in water or water-containing environments. Thus, although certain regions or segments of the copolymer may be hydrophilic or even water-soluble, the polymer molecule, as a whole, does not to any substantial measure dissolve in water.
- bioresorbable molecule includes a region that is capable of being metabolized or broken down and resorbed and/or eliminated through normal excretory routes by the body. Such metabolites or break down products are preferably substantially non-toxic to the body.
- the bioresorbable region may be either hydrophobic or hydrophilic, so long as the copolymer composition as a whole is not rendered water-soluble.
- the bioresorbable region is selected based on the preference that the polymer, as a whole, remains water-insoluble. Accordingly, the relative properties, i.e., the kinds of functional groups contained by, and the relative proportions of the bioresorbable region, and the hydrophilic region are selected to ensure that useful bioresorbable compositions remain water-insoluble.
- Exemplary resorbable polymers include, for example, synthetically produced resorbable block copolymers of poly( ⁇ -hydroxy-carboxylic acid)/poly(oxyalkylene, (see, Cohn et al., U.S. Pat. No. 4,826,945). These copolymers are not crosslinked and are water-soluble so that the body can excrete the degraded block copolymer compositions. See, Younes et al., J. Biomed. Mater. Res. 21: 1301-1316 (1987); and Cohn et al., J. Biomed. Mater. Res. 22: 993-1009 (1988).
- bioresorbable polymers include one or more components selected from poly(esters), poly(hydroxy acids), poly(lactones), poly(amides), poly(ester-amides), poly(amino acids), poly(anhydrides), poly(orthoesters), poly(carbonates), poly(phosphazines), poly(phosphoesters), poly(thioesters), polysaccharides and mixtures thereof. More preferably still, the bioresorbable polymer includes a poly(hydroxy) acid component. Of the poly(hydroxy) acids, polylactic acid, polyglycolic acid, polycaproic acid, polybutyric acid, polyvaleric acid and copolymers and mixtures thereof are preferred.
- preferred polymeric coatings for use in the methods of the invention can also form an excretable and/or metabolizable fragment.
- Bioresorbable regions of coatings useful in the present invention can be designed to be hydrolytically and/or enzymatically cleavable.
- hydrolytically cleavable refers to the susceptibility of the copolymer, especially the bioresorbable region, to hydrolysis in water or a water-containing environment.
- enzymatically cleavable refers to the susceptibility of the copolymer, especially the bioresorbable region, to cleavage by endogenous or exogenous enzymes.
- the hydrophilic region When placed within the body, the hydrophilic region can be processed into excretable and/or metabolizable fragments.
- the hydrophilic region can include, for example, polyethers, polyalkylene oxides, polyols, poly(vinyl pyrrolidine), poly(vinyl alcohol), poly(alkyl oxazolines), polysaccharides, carbohydrates, peptides, proteins and copolymers and mixtures thereof.
- the hydrophilic region can also be, for example, a poly(alkylene)oxide.
- Such poly(alkylene)oxides can include, for example, poly(ethylene)oxide, poly(propylene)oxide and mixtures and copolymers thereof.
- Hydrogels are polymeric materials that are capable of absorbing relatively large quantities of water.
- hydrogel forming compounds include, but are not limited to, polyacrylic acids, sodium carboxymethylcellulose, polyvinyl alcohol, polyvinyl pyrrolidine, gelatin, carrageenan and other polysaccharides, hydroxyethylenemethacrylic acid (HEMA), as well as derivatives thereof, and the like.
- Hydrogels can be produced that are stable, biodegradable and bioresorbable.
- hydrogel compositions can include subunits that exhibit one or more of these properties.
- Bio-compatible hydrogel compositions whose integrity can be controlled through crosslinking are known and are presently preferred for use in the methods of the invention.
- Hubbell et al. U.S. Pat. No. 5,410,016, which issued on Apr. 25, 1995 and U.S. Pat. No. 5,529,914, which issued on Jun. 25, 1996, disclose water-soluble systems, which are crosslinked block copolymers having a water-soluble central block segment sandwiched between two hydrolytically labile extensions. Such copolymers are further end-capped with photopolymerizable acrylate functionalities. When crosslinked, these systems become hydrogels.
- the water soluble central block of such copolymers can include poly(ethylene glycol); whereas, the hydrolytically labile extensions can be a poly( ⁇ -hydroxy acid), such as polyglycolic acid or polylactic acid. See, Sawhney et al., Macromolecules 26: 581-587 (1993).
- the gel is a thermoreversible gel.
- Thermoreversible gels including components, such as pluronics, collagen, gelatin, hyalouronic acid, polysaccharides, polyurethane hydrogel, polyurethane-urea hydrogel and combinations thereof are presently preferred.
- the hGH conjugates of the invention include a component of a liposome.
- Liposomes can be prepared according to methods known to those skilled in the art, for example, as described in Eppstein et al., U.S. Pat. No. 4,522,811, which issued on Jun. 11, 1985.
- liposome formulations may be prepared by dissolving appropriate lipid(s) (such as stearoyl phosphatidyl ethanolamine, stearoyl phosphatidyl choline, arachadoyl phosphatidyl choline, and cholesterol) in an inorganic solvent that is then evaporated, leaving behind a thin film of dried lipid on the surface of the container.
- aqueous solution of the active compound or its pharmaceutically acceptable salt is then introduced into the container.
- the container is then swirled by hand to free lipid material from the sides of the container and to disperse lipid aggregates, thereby forming the liposomal suspension.
- microparticles and methods of preparing the microparticles are offered by way of example and they are not intended to define the scope of microparticles of use in the present invention. It will be apparent to those of skill in the art that an array of microparticles, fabricated by different methods, are of use in the present invention.
- the degree of PEG substitution of the modified sugars and hGH conjugates can be controlled by choice of stoichiometry, number of available glycosylation sites, selection of an enzyme that is selective for a particular site, and the like, see U.S. Pat. App. No. 60/690,728.
- the modified sugar bears a biomolecule.
- the biomolecule is a functional protein, enzyme, antigen, antibody, peptide, nucleic acid (e.g., single nucleotides or nucleosides, oligonucleotides, polynucleotides and single- and higher-stranded nucleic acids), lectin, receptor or a combination thereof.
- biomolecules are essentially non-fluorescent, or emit such a minimal amount of fluorescence that they are inappropriate for use as a fluorescent marker in an assay.
- biomolecules that are not sugars.
- An exception to this preference is the use of an otherwise naturally occurring sugar that is modified by covalent attachment of another entity (e.g., PEG, biomolecule, therapeutic moiety, diagnostic moiety, etc.).
- a sugar moiety which is a biomolecule, is conjugated to a linker arm and the sugar-linker arm cassette is subsequently conjugated to a peptide via a method of the invention.
- Biomolecules useful in practicing the present invention can be derived from any source.
- the biomolecules can be isolated from natural sources or they can be produced by synthetic methods.
- Peptides can be natural peptides or mutated peptides. Mutations can be effected by chemical mutagenesis, site-directed mutagenesis or other means of inducing mutations known to those of skill in the art.
- Peptides useful in practicing the instant invention include, for example, enzymes, antigens, antibodies and receptors.
- Antibodies can be either polyclonal or monoclonal; either intact or fragments.
- the peptides are optionally the products of a program of directed evolution.
- Both naturally derived and synthetic peptides and nucleic acids are of use in conjunction with the present invention; these molecules can be attached to a sugar residue component or a crosslinking agent by any available reactive group.
- peptides can be attached through a reactive amine, carboxyl, sulfhydryl, or hydroxyl group.
- the reactive group can reside at a peptide terminus or at a site internal to the peptide chain.
- Nucleic acids can be attached through a reactive group on a base (e.g., exocyclic amine) or an available hydroxyl group on a sugar moiety (e.g., 3′- or 5′-hydroxyl).
- the peptide and nucleic acid chains can be further derivatized at one or more sites to allow for the attachment of appropriate reactive groups onto the chain. See, Chrisey et al. Nucleic Acids Res. 24: 3031-3039 (1996).
- the biomolecule is selected to direct the peptide modified by the methods of the invention to a specific tissue, thereby enhancing the delivery of the peptide to that tissue relative to the amount of underivatized peptide that is delivered to the tissue.
- the amount of derivatized peptide delivered to a specific tissue within a selected time period is enhanced by derivatization by at least about 20%, more preferably, at least about 40%, and more preferably still, at least about 100%.
- preferred biomolecules for targeting applications include antibodies, hormones and ligands for cell-surface receptors.
- conjugate with biotin there is provided as conjugate with biotin.
- a selectively biotinylated peptide is elaborated by the attachment of an avidin or streptavidin moiety bearing one or more modifying groups.
- the modified sugar includes a therapeutic moiety.
- a therapeutic moiety Those of skill in the art will appreciate that there is overlap between the category of therapeutic moieties and biomolecules; many biomolecules have therapeutic properties or potential.
- the therapeutic moieties can be agents already accepted for clinical use or they can be drugs whose use is experimental, or whose activity or mechanism of action is under investigation.
- the therapeutic moieties can have a proven action in a given disease state or can be only hypothesized to show desirable action in a given disease state.
- the therapeutic moieties are compounds, which are being screened for their ability to interact with a tissue of choice.
- Therapeutic moieties, which are useful in practicing the instant invention include drugs from a broad range of drug classes having a variety of pharmacological activities.
- Preferred therapeutic moieties are essentially non-fluorescent, or emit such a minimal amount of fluorescence that they are inappropriate for use as a fluorescent marker in an assay.
- therapeutic moieties that are not sugars.
- An exception to this preference is the use of a sugar that is modified by covalent attachment of another entity, such as a PEG, biomolecule, therapeutic moiety, diagnostic moiety and the like.
- a therapeutic sugar moiety is conjugated to a linker arm and the sugar-linker arm cassette is subsequently conjugated to a peptide via a method of the invention.
- the therapeutic moiety is attached to the modified sugar via a linkage that is cleaved under selected conditions.
- exemplary conditions include, but are not limited to, a selected pH (e.g., stomach, intestine, endocytotic vacuole), the presence of an active enzyme (e.g., esterase, reductase, oxidase), light, heat and the like.
- an active enzyme e.g., esterase, reductase, oxidase
- light heat and the like.
- cleaveable groups are known in the art. See, for example, Jung et al., Biochem. Biophys. Acta, 761: 152-162 (1983); Joshi et al., J. Biol. Chem., 265: 14518-14525 (1990); Zarling et al., J.
- Glycosyltransferases catalyze the addition of activated sugars (donor NDP-sugars), in a step-wise fashion, to a protein, glycopeptide, lipid or glycolipid or to the non-reducing end of a growing oligosaccharide.
- N-linked glycopeptides are synthesized via a transferase and a lipid-linked oligosaccharide donor Dol-PP-NAG 2 Glc 3 Man 9 in an en block transfer followed by trimming of the core. In this case the nature of the “core” saccharide is somewhat different from subsequent attachments.
- a very large number of glycosyltransferases are known in the art.
- glycosyltransferase to be used in the present invention may be any as long as it can utilize the modified sugar as a sugar donor.
- enzymes include Leloir pathway glycosyltransferase, such as galactosyltransferase, N-acetylglucosaminyltransferase, N-acetylgalactosaminyltransferase, fucosyltransferase, sialyltransferase, mannosyltransferase, xylosyltransferase, glucurononyltransferase and the like.
- Leloir pathway glycosyltransferase such as galactosyltransferase, N-acetylglucosaminyltransferase, N-acetylgalactosaminyltransferase, fucosyltransferase, sialyltransferase, mannosyl
- glycosyltransferase For enzymatic saccharide syntheses that involve glycosyltransferase reactions, glycosyltransferase can be cloned, or isolated from any source. Many cloned glycosyltransferases are known, as are their polynucleotide sequences. See, e.g., “The WWW Guide To Cloned Glycosyltransferases,” (http://www.vei.co.uk/TGN/gt_guide.htm).
- Glycosyltransferase amino acid sequences and nucleotide sequences encoding glycosyltransferases from which the amino acid sequences can be deduced are also found in various publicly available databases, including GenBank, Swiss-Prot, EMBL, and others.
- Glycosyltransferases that can be employed in the methods of the invention include, but are not limited to, galactosyltransferases, fucosyltransferases, glucosyltransferases, N-acetylgalactosaminyltransferases, N-acetylglucosaminyltransferases, glucuronyltransferases, sialyltransferases, mannosyltransferases, glucuronic acid transferases, galacturonic acid transferases, and oligosaccharyltransferases.
- Suitable glycosyltransferases include those obtained from eukaryotes, as well as from prokaryotes.
- DNA encoding the enzyme glycosyltransferases may be obtained by chemical synthesis, by screening reverse transcripts of mRNA from appropriate cells or cell line cultures, by screening genomic libraries from appropriate cells, or by combinations of these procedures. Screening of mRNA or genomic DNA may be carried out with oligonucleotide probes generated from the glycosyltransferases gene sequence. Probes may be labeled with a detectable group such as a fluorescent group, a radioactive atom or a chemiluminescent group in accordance with known procedures and used in conventional hybridization assays.
- a detectable group such as a fluorescent group, a radioactive atom or a chemiluminescent group in accordance with known procedures and used in conventional hybridization assays.
- glycosyltransferases gene sequences may be obtained by use of the polymerase chain reaction (PCR) procedure, with the PCR oligonucleotide primers being produced from the glycosyltransferases gene sequence.
- PCR polymerase chain reaction
- the glycosyltransferases enzyme may be synthesized in host cells transformed with vectors containing DNA encoding the glycosyltransferases enzyme.
- a vector is a replicable DNA construct. Vectors are used either to amplify DNA encoding the glycosyltransferases enzyme and/or to express DNA which encodes the glycosyltransferases enzyme.
- An expression vector is a replicable DNA construct in which a DNA sequence encoding the glycosyltransferases enzyme is operably linked to suitable control sequences capable of effecting the expression of the glycosyltransferases enzyme in a suitable host. The need for such control sequences will vary depending upon the host selected and the transformation method chosen.
- control sequences include a transcriptional promoter, an optional operator sequence to control transcription, a sequence encoding suitable mRNA ribosomal binding sites, and sequences which control the termination of transcription and translation.
- Amplification vectors do not require expression control domains. All that is needed is the ability to replicate in a host, usually conferred by an origin of replication, and a selection gene to facilitate recognition of transformants.
- a glycosyltransferase used in the method of the invention is a fucosyltransferase.
- Fucosyltransferases are known to those of skill in the art.
- Exemplary fucosyltransferases include enzymes, which transfer L-fucose from GDP-fucose to a hydroxy position of an acceptor sugar.
- Fucosyltransferases that transfer non-nucleotide sugars to an acceptor are also of use in the present invention.
- the acceptor sugar is, for example, the GlcNAc in a Gal ⁇ (1 ⁇ 3,4)GlcNAc ⁇ -group in an oligosaccharide glycoside.
- Suitable fucosyltransferases for this reaction include the Gal ⁇ (1 ⁇ 3,4)GlcNAc ⁇ 1- ⁇ (1 ⁇ 3,4)fucosyltransferase (FTIII E.C. No. 2.4.1.65), which was first characterized from human milk (see, Palcic, et al., Carbohydrate Res. 190: 1-11 (1989); Prieels, et al., J. Biol. Chem. 256: 10456-10463 (1981); and Nunez, et al., Can. J. Chem.
- FTIV, FTV, FTVI Gal ⁇ (1 ⁇ 4)GlcNAc ⁇ - ⁇ fucosyltransferases
- FTVII E.C. No. 2.4.1.65
- a sialyl ⁇ (2 ⁇ 3)Gal ⁇ ((1 ⁇ 3)GlcNAc ⁇ fucosyltransferase has also been characterized.
- a recombinant form of the Gal ⁇ (1 ⁇ 3,4) GlcNAc ⁇ - ⁇ (1 ⁇ 3,4)fucosyltransferase has also been characterized (see, Dumas, et al., Bioorg. Med.
- fucosyltransferases include, for example, ⁇ 1,2 fucosyltransferase (E.C. No. 2.4.1.69). Enzymatic fucosylation can be carried out by the methods described in Mollicone, et al., Eur. J. Biochem. 191: 169-176 (1990) or U.S. Pat. No. 5,374,655. Cells that are used to produce a fucosyltransferase will also include an enzymatic system for synthesizing GDP-fucose.
- the glycosyltransferase is a galactosyltransferase.
- exemplary galactosyltransferases include ⁇ (1,3) galactosyltransferases (E.C. No. 2.4.1.151, see, e.g., Dabkowski et al., Transplant Proc. 25:2921 (1993) and Yamamoto et al. Nature 345: 229-233 (1990), bovine (GenBank j04989, Joziasse et al., J. Biol. Chem. 264: 14290-14297 (1989)), murine (GenBank m26925; Larsen et al., Proc. Nat'l. Acad. Sci.
- porcine GenBank L36152; Strahan et al., Immunogenetics 41: 101-105 (1995)
- Another suitable ⁇ 1,3 galactosyltransferase is that which is involved in synthesis of the blood group B antigen (EC 2.4.1.37, Yamamoto et al., J. Biol. Chem. 265: 1146-1151 (1990) (human)).
- ⁇ (1,4) galactosyltransferases which include, for example, EC 2.4.1.90 (LacNAc synthetase) and EC 2.4.1.22 (lactose synthetase) (bovine (D'Agostaro et al., Eur. J. Biochem. 183: 211-217 (1989)), human (Masri et al., Biochem. Biophys. Res. Commun. 157: 657-663 (1988)), murine (Nakazawa et al., J. Biochem. 104: 165-168 (1988)), as well as E.C.
- galactosyltransferases include, for example, ⁇ 1,2 galactosyltransferases (from e.g., Schizosaccharomyces pombe , Chapell et al., Mol. Biol. Cell 5: 519-528 (1994)).
- proteins such as the enzyme GalNAc T I-XIV from cloned genes by genetic engineering is well known. See, eg., U.S. Pat. No. 4,761,371.
- One method involves collection of sufficient samples, then the amino acid sequence of the enzyme is determined by N-terminal sequencing. This information is then used to isolate a cDNA clone encoding a full-length (membrane bound) transferase which upon expression in the insect cell line Sf9 resulted in the synthesis of a fully active enzyme.
- the acceptor specificity of the enzyme is then determined using a semiquantitative analysis of the amino acids surrounding known glycosylation sites in 16 different proteins followed by in vitro glycosylation studies of synthetic peptides.
- Sialyltransferases are another type of glycosyltransferase that is useful in the recombinant cells and reaction mixtures of the invention. Cells that produce recombinant sialyltransferases will also produce CMP-sialic acid, which is a sialic acid donor for sialyltransferases.
- ST3Gal III e.g., a rat or human ST3Gal III
- ST3Gal IV ST3Gal I, ST6Gal I, ST3Gal V, ST6Gal II, ST6GalNAc I, ST6GalNAc II, and ST6GalNAc III
- ST3Gal III e.g., a rat or human ST3Gal III
- ⁇ (2,3)sialyltransferase (EC 2.4.99.6) transfers sialic acid to the non-reducing terminal Gal of a Gal ⁇ 1 ⁇ 3Glc disaccharide or glycoside. See, Van den Eijnden et al., J. Biol. Chem. 256: 3159 (1981), Weinstein et al., J. Biol. Chem. 257: 13845 (1982) and Wen et al., J. Biol. Chem. 267: 21011 (1992).
- Another exemplary ⁇ 2,3-sialyltransferase (EC 2.4.99.4) transfers sialic acid to the non-reducing terminal Gal of the disaccharide or glycoside.
- exemplary enzymes include Gal- ⁇ -1,4-GlcNAc ⁇ -2,6 sialyltransferase (See, Kurosawa et al. Eur. J. Biochem. 219: 375-381 (1994)).
- the sialyltransferase will be able to transfer sialic acid to the sequence Gal ⁇ 1,4GlcNAc-, the most common penultimate sequence underlying the terminal sialic acid on fully sialylated carbohydrate structures (see, Table 3).
- Table 3 the most common penultimate sequence underlying the terminal sialic acid on fully sialylated carbohydrate structures (see, Table 3).
- sialyltransferase that is useful in the claimed methods is ST3Gal III, which is also referred to as ⁇ (2,3)sialyltransferase (EC 2.4.99.6).
- This enzyme catalyzes the transfer of sialic acid to the Gal of a Gal ⁇ 1,3GlcNAc or Gal ⁇ 1,4GlcNAc glycoside (see, e.g., Wen et al., J. Biol. Chem. 267: 21011 (1992); Van den Eijnden et al., J. Biol. Chem. 256: 3159 (1991)) and is responsible for sialylation of asparagine-linked oligosaccharides in glycopeptides.
- the sialic acid is linked to a Gal with the formation of an ⁇ -linkage between the two saccharides. Bonding (linkage) between the saccharides is between the 2-position of NeuAc and the 3-position of Gal.
- This particular enzyme can be isolated from rat liver (Weinstein et al., J. Biol. Chem. 257: 13845 (1982)); the human cDNA (Sasaki et al. (1993) J. Biol. Chem. 268: 22782-22787; Kitagawa & Paulson (1994) J. Biol. Chem. 269: 1394-1401) and genomic (Kitagawa et al. (1996) J. Biol. Chem. 271: 931-938) DNA sequences are known, facilitating production of this enzyme by recombinant expression.
- the claimed sialylation methods use a rat ST3Gal III.
- sialyltransferases of use in the present invention include those isolated from Campylobacter jejuni , including the ⁇ (2,3). See, e.g., WO99/49051.
- Sialyltransferases other than those listed in Table 3, are also useful in an economic and efficient large-scale process for sialylation of commercially important glycopeptides.
- various amounts of each enzyme (1-100 mU/mg protein) are reacted with asialo- ⁇ 1 AGP (at 1-10 mg/ml) to compare the ability of the sialyltransferase of interest to sialylate glycopeptides relative to either bovine ST6Gal I, ST3Gal III or both sialyltransferases.
- glycopeptides or glycopeptides, or N-linked oligosaccharides enzymatically released from the peptide backbone can be used in place of asialo- ⁇ 1 AGP for this evaluation.
- Sialyltransferases with the ability to sialylate N-linked oligosaccharides of glycopeptides more efficiently than ST6Gal I are useful in a practical large-scale process for peptide sialylation (as illustrated for ST3Gal III in this disclosure).
- glycosyltransferases can be substituted into similar transferase cycles as have been described in detail for the sialyltransferase.
- the glycosyltransferase can also be, for instance, glucosyltransferases, e.g., Alg8 (Stagljov et al., Proc. Natl. Acad. Sci. USA 91: 5977 (1994)) or AlgS (Heesen et al., Eur. J. Biochem. 224: 71 (1994)).
- N-acetylgalactosaminyltransferases are also of use in practicing the present invention. Suitable N-acetylgalactosaminyltransferases include, but are not limited to, ⁇ (1,3) N-acetylgalactosaminyltransferase, ⁇ (1,4) N-acetylgalactosaminyltransferases (Nagata et al., J. Biol. Chem. 267: 12082-12089 (1992) and Smith et al., J. Biol. Chem.
- N-acetylgalactosaminyltransferase Suitable N-acetylglucosaminyltransferases include GnTI (2.4.1.101, Hull et al., BBRC 176: 608 (1991)), GnTII, GnTIII (Ihara et al., J. Biochem. 113: 692 (1993)), GnTIV, and GnTV (Shoreiban et al., J. Biol. Chem.
- Mannosyltransferases are of use to transfer modified mannose moieties. Suitable mannosyltransferases include ⁇ (1,2) mannosyltransferase, ⁇ (1,3) mannosyltransferase, ⁇ (1,6) mannosyltransferase, ⁇ (1,4) mannosyltransferase, Dol-P-Man synthase, OCh1, and Pmt1 (see, Kornfeld et al., Annu. Rev. Biochem. 54: 631-664 (1985)).
- Xylosyltransferases are also useful in the present invention. See, for example, Rodgers, et al., Biochem. J., 288:817-822 (1992); and Elbain, et al., U.S. Pat. No. 6,168,937.
- Prokaryotic glycosyltransferases are also useful in practicing the invention.
- Such glycosyltransferases include enzymes involved in synthesis of lipooligosaccharides (LOS), which are produced by many gram negative bacteria.
- the LOS typically have terminal glycan sequences that mimic glycoconjugates found on the surface of human epithelial cells or in host secretions (Preston et al., Critical Reviews in Microbiology 23(3): 139-180 (1996)).
- Such enzymes include, but are not limited to, the proteins of the rfa operons of species such as E.
- Salmonella typhimurium which include a ⁇ 1,6 galactosyltransferase and a ⁇ 1,3 galactosyltransferase (see, e.g., EMBL Accession Nos. M80599 and M86935 ( E. coli ); EMBL Accession No. S56361 ( S. typhimurium )), a glucosyltransferase (Swiss-Prot Accession No. P25740 ( E. coli ), an ⁇ 1,2-glucosyltransferase (rfaJ)(Swiss-Prot Accession No. P27129 ( E. coli ) and Swiss-Prot Accession No.
- glycosyltransferases for which amino acid sequences are known include those that are encoded by operons such as rfaB, which have been characterized in organisms such as Klebsiella pneumoniae, E. coli, Salmonella typhimurium, Salmonella enterica, Yersinia enterocolitica, Mycobacterium leprosum , and the rh1 operon of Pseudomonas aeruginosa.
- glycosyltransferases that are involved in producing structures containing lacto-N-neotetraose, D-galactosyl- ⁇ -1,4-N-acetyl-D-glucosaminyl- ⁇ -1,3-D-galactosyl- ⁇ -1,4-D-glucose, and the P k blood group trisaccharide sequence, D-galactosyl- ⁇ -1,4-D-galactosyl- ⁇ -1,4-D-glucose, which have been identified in the LOS of the mucosal pathogens Neisseria gonnorhoeae and N.
- N. meningitidis (Scholten et al., J. Med. Microbiol. 41: 236-243 (1994)).
- the genes from N. meningitidis and N. gonorrhoeae that encode the glycosyltransferases involved in the biosynthesis of these structures have been identified from N. meningitidis immunotypes L3 and L1 (Jennings et al., Mol. Microbiol. 18: 729-740 (1995)) and the N. gonorrhoeae mutant F62 (Gotshlich, J. Exp. Med. 180: 2181-2190 (1994)).
- N. meningitidis immunotypes L3 and L1 Jennings et al., Mol. Microbiol. 18: 729-740 (1995)
- the N. gonorrhoeae mutant F62 (Gotshlich, J. Exp. Med. 180: 2181-2190 (1994)).
- meningitidis a locus consisting of three genes, lgtA, lgtB and lg E, encodes the glycosyltransferase enzymes required for addition of the last three of the sugars in the lacto-N-neotetraose chain (Wakarchuk et al., J. Biol. Chem. 271: 19166-73 (1996)). Recently the enzymatic activity of the lgtB and lgtA gene product was demonstrated, providing the first direct evidence for their proposed glycosyltransferase function (Wakarchuk et al., J. Biol. Chem. 271(45): 28271-276 (1996)). In N.
- gonorrhoeae there are two additional genes, lgtD which adds ⁇ -D-GalNAc to the 3 position of the terminal galactose of the lacto-N-neotetraose structure and lgtC which adds a terminal ⁇ -D-Gal to the lactose element of a truncated LOS, thus creating the P k blood group antigen structure (Gotshlich (1994), supra.).
- a separate immunotype L1 also expresses the P k blood group antigen and has been shown to carry an lgtC gene (Jennings et al., (1995), supra.).
- Neisseria glycosyltransferases and associated genes are also described in U.S. Pat. No. 5,545,553 (Gotschlich). Genes for ⁇ 1,2-fucosyltransferase and ⁇ 1,3-fucosyltransferase from Helicobacter pylori has also been characterized (Martin et al., J. Biol. Chem. 272: 21349-21356 (1997)). Also of use in the present invention are the glycosyltransferases of Campylobacter jejuni (see, for example, http://afmb.cnrs-mrs.fr/ ⁇ pedro/CAZY/gtf — 42.html).
- the invention also provides methods for producing peptides that include sulfated molecules, including, for example sulfated polysaccharides such as heparin, heparan sulfate, carragenen, and related compounds.
- Suitable sulfotransferases include, for example, chondroitin-6-sulphotransferase (chicken cDNA described by Fukuta et al., J. Biol. Chem. 270: 18575-18580 (1995); GenBank Accession No.
- glycosaminoglycan N-acetylglucosamine N-deacetylase/N-sulphotransferase 1 (Dixon et al., Genomics 26: 239-241 (1995); UL18918), and glycosaminoglycan N-acetylglucosamine N-deacetylase/N-sulphotransferase 2 (murine cDNA described in Orellana et al., J. Biol. Chem. 269: 2270-2276 (1994) and Eriksson et al., J. Biol. Chem. 269: 10438-10443 (1994); human cDNA described in GenBank Accession No. U2304).
- the enzymes utilized in the method of the invention are cell-bound glycosyltransferases.
- glycosyltransferases are generally in membrane-bound form when associated with cells.
- Many of the membrane-bound enzymes studied thus far are considered to be intrinsic proteins; that is, they are not released from the membranes by sonication and require detergents for solubilization.
- Surface glycosyltransferases have been identified on the surfaces of vertebrate and invertebrate cells, and it has also been recognized that these surface transferases maintain catalytic activity under physiological conditions.
- the more recognized function of cell surface glycosyltransferases is for intercellular recognition (Roth, M OLECULAR A PPROACHES to S UPRACELLULAR P HENOMENA , 1990).
- the methods of the invention utilize fusion proteins that have more than one enzymatic activity that is involved in synthesis of a desired glycopeptide conjugate.
- the fusion polypeptides can be composed of, for example, a catalytically active domain of a glycosyltransferase that is joined to a catalytically active domain of an accessory enzyme.
- the accessory enzyme catalytic domain can, for example, catalyze a step in the formation of a nucleotide sugar that is a donor for the glycosyltransferase, or catalyze a reaction involved in a glycosyltransferase cycle.
- a polynucleotide that encodes a glycosyltransferase can be joined, in-frame, to a polynucleotide that encodes an enzyme involved in nucleotide sugar synthesis.
- the resulting fusion protein can then catalyze not only the synthesis of the nucleotide sugar, but also the transfer of the sugar moiety to the acceptor molecule.
- the fusion protein can be two or more cycle enzymes linked into one expressible nucleotide sequence.
- the fusion protein includes the catalytically active domains of two or more glycosyltransferases. See, for example, U.S. Pat. No. 5,641,668.
- the modified glycopeptides of the present invention can be readily designed and manufactured utilizing various suitable fusion proteins (see, for example, PCT Patent Application PCT/CA98/01180, which was published as WO 99/31224 on Jun. 24, 1999.)
- the present invention also provides for the use of enzymes that are immobilized on a solid and/or soluble support.
- a glycosyltransferase that is conjugated to a PEG via an intact glycosyl linker according to the methods of the invention.
- the PEG-linker-enzyme conjugate is optionally attached to solid support.
- solid supported enzymes in the methods of the invention simplifies the work up of the reaction mixture and purification of the reaction product, and also enables the facile recovery of the enzyme.
- the glycosyltransferase conjugate is utilized in the methods of the invention. Other combinations of enzymes and supports will be apparent to those of skill in the art.
- the present invention also takes advantage of adding to (or removing from) a peptide one or more selected glycosyl residues, after which a modified sugar is conjugated to at least one of the selected glycosyl residues of the peptide.
- the present embodiment is useful, for example, when it is desired to conjugate the modified sugar to a selected glycosyl residue that is either not present on a peptide or is not present in a desired amount.
- the selected glycosyl residue prior to coupling a modified sugar to a peptide, the selected glycosyl residue is conjugated to the peptide by enzymatic or chemical coupling.
- the glycosylation pattern of a glycopeptide is altered prior to the conjugation of the modified sugar by the removal of a carbohydrate residue from the glycopeptide. See, for example WO 98/31826.
- Enzymatic cleavage of carbohydrate moieties on polypeptide variants can be achieved by the use of a variety of endo- and exo-glycosidases as described by Thotakura et al., Meth. Enzymol. 138: 350 (1987).
- the peptide is essentially completely desialylated with neuraminidase prior to performing glycoconjugation or remodeling steps on the peptide.
- the peptide is optionally re-sialylated using a sialyltransferase.
- the re-sialylation occurs at essentially each (e.g., >80%, preferably greater than 85%, greater than 90%, preferably greater than 95% and more preferably greater than 96%, 97%, 98% or 99%) terminal saccharyl acceptor in a population of sialyl acceptors.
- the saccharide has a substantially uniform sialylation pattern (i.e., substantially uniform glycosylation pattern).
- glycosyl moieties Chemical addition of glycosyl moieties is carried out by any art-recognized method. Enzymatic addition of sugar moieties is preferably achieved using a modification of the methods set forth herein, substituting native glycosyl units for the modified sugars used in the invention. Other methods of adding sugar moieties are disclosed in U.S. Pat. Nos. 5,876,980, 6,030,815, 5,728,554, and 5,922,577.
- Exemplary attachment points for selected glycosyl residue include, but are not limited to: (a) consensus sites for N-linked glycosylation, and sites for O-linked glycosylation; (b) terminal glycosyl moieties that are acceptors for a glycosyltransferase; (c) arginine, asparagine and histidine; (d) free carboxyl groups; (e) free sulfhydryl groups such as those of cysteine; (f) free hydroxyl groups such as those of serine, threonine, or hydroxyproline; (g) aromatic residues such as those of phenylalanine, tyrosine, or tryptophan; or (h) the amide group of glutamine.
- the peptide that is modified by a method of the invention is a glycopeptide that is produced in mammalian cells (e.g., CHO cells) or in a transgenic animal and thus, contains N- and/or O-linked oligosaccharide chains, which are incompletely sialylated.
- the oligosaccharide chains of the glycopeptide lacking a sialic acid and containing a terminal galactose residue can be PEGylated, PPGylated or otherwise modified with a modified sialic acid.
- Exemplary PEG-sialic acid derivative include: in which L is a substituted or unsubstituted alkyl or substituted or unsubstituted heteroalkyl linker moiety joining the sialic acid moiety and the PEG moiety, and “n” is 1 or greater; and in which the index “s” represents an integer from 0 to 20, and “n” is 1 or greater.
- Linker Groups Crosser Groups (Cross-Linking Groups)
- Preparation of the modified sugar for use in the methods of the present invention includes attachment of a modifying group to a sugar residue and forming a stable adduct, which is a substrate for a glycosyltransferase.
- the sugar and modifying group can be coupled by a zero- or higher-order cross-linking agent.
- Exemplary bifunctional compounds which can be used for attaching modifying groups to carbohydrate moieties include, but are not limited to, bifunctional poly(ethylene glycols), polyamides, polyethers, polyesters and the like.
- General approaches for linking carbohydrates to other molecules are known in the literature. See, for example, Lee et al., Biochemistry 28: 1856 (1989); Bhatia et al., Anal. Biochem.
- the linker group is provided with a group that can be cleaved to release the modifying group from the sugar residue.
- cleaveable groups are known in the art. See, for example, Jung et al., Biochem. Biophys. Acta 761: 152-162 (1983); Joshi et al., J. Biol. Chem. 265: 14518-14525 (1990); Zarling et al., J. Immunol. 124: 913-920 (1980); Bouizar et al., Eur. J. Biochem. 155: 141-147 (1986); Park et al., J. Biol. Chem. 261: 205-210 (1986); Browning et al., J. Immunol. 143: 1859-1867 (1989).
- cleavable, bifunctional (both homo- and hetero-bifunctional) linker groups is commercially available from suppliers such as Pierce.
- Exemplary cleaveable moieties can be cleaved using light, heat or reagents such as thiols, hydroxylamine, bases, periodate and the like. Moreover, certain preferred groups are cleaved in vivo in response to being endocytized (e.g., cis-aconityl; see, Shen et al., Biochem. Biophys. Res. Commun. 102: 1048 (1991)). Preferred cleaveable groups comprise a cleaveable moiety which is a member selected from the group consisting of disulfide, ester, imide, carbonate, nitrobenzyl, phenacyl and benzoin groups.
- the modified sugars are conjugated to a glycosylated or non-glycosylated peptide using an appropriate enzyme to mediate the conjugation.
- concentrations of the modified donor sugar(s), enzyme(s) and acceptor peptide(s) are selected such that glycosylation proceeds until the acceptor is consumed.
- the present invention is practiced using a single glycosyltransferase or a combination of glycosyltransferases.
- a single glycosyltransferase or a combination of glycosyltransferases For example, one can use a combination of a sialyltransferase and a galactosyltransferase.
- the enzymes and substrates are preferably combined in an initial reaction mixture, or the enzymes and reagents for a second enzymatic reaction are added to the reaction medium once the first enzymatic reaction is complete or nearly complete.
- each of the first and second enzyme is a glycosyltransferase.
- one enzyme is an endoglycosidase.
- more than two enzymes are used to assemble the modified glycoprotein of the invention. The enzymes are used to alter a saccharide structure on the peptide at any point either before or after the addition of the modified sugar to the peptide.
- the method makes use of one or more exo- or endoglycosidase.
- the glycosidase is typically a mutant, which is engineered to form glycosyl bonds rather than cleave them.
- the mutant glycanase typically includes a substitution of an amino acid residue for an active site acidic amino acid residue.
- the substituted active site residues will typically be Asp at position 130, Glu at position 132 or a combination thereof.
- the amino acids are generally replaced with serine, alanine, asparagine, or glutamine.
- the glycosyl donor molecule e.g., a desired oligo- or mono-saccharide structure
- the reaction proceeds with the addition of the donor molecule to a GlcNAc residue on the protein.
- the leaving group can be a halogen, such as fluoride.
- the leaving group is a Asn, or a Asn-peptide moiety.
- the GlcNAc residue on the glycosyl donor molecule is modified.
- the GlcNAc residue may comprise a 1,2 oxazoline moiety.
- each of the enzymes utilized to produce a conjugate of the invention are present in a catalytic amount.
- the catalytic amount of a particular enzyme varies according to the concentration of that enzyme's substrate as well as to reaction conditions such as temperature, time and pH value. Means for determining the catalytic amount for a given enzyme under preselected substrate concentrations and reaction conditions are well known to those of skill in the art.
- the temperature at which an above process is carried out can range from just above freezing to the temperature at which the most sensitive enzyme denatures. Preferred temperature ranges are about 0° C. to about 55° C., and more preferably about 20° C. to about 30° C. In another exemplary embodiment, one or more components of the present method are conducted at an elevated temperature using a thermophilic enzyme.
- the reaction mixture is maintained for a period of time sufficient for the acceptor to be glycosylated, thereby forming the desired conjugate. Some of the conjugate can often be detected after a few hours, with recoverable amounts usually being obtained within 24 hours or less.
- rate of reaction is dependent on a number of variable factors (e.g., enzyme concentration, donor concentration, acceptor concentration, temperature, solvent volume), which are optimized for a selected system.
- the present invention also provides for the industrial-scale production of modified peptides.
- an industrial scale generally produces at least 1 gram of finished, purified conjugate.
- the invention is exemplified by the conjugation of modified sialic acid moieties to a glycosylated peptide.
- the exemplary modified sialic acid is labeled with m-PEG.
- the focus of the following discussion on the use of PEG-modified sialic acid and glycosylated peptides is for clarity of illustration and is not intended to imply that the invention is limited to the conjugation of these two partners.
- One of skill understands that the discussion is generally applicable to the additions of modified glycosyl moieties other than sialic acid.
- the discussion is equally applicable to the modification of a glycosyl unit with agents other than m-PEG including other PEG moieties, therapeutic moieties, and biomolecules.
- An enzymatic approach can be used for the selective introduction of m-PEGylated or m-PPGylated carbohydrates onto a peptide or glycopeptide.
- the method utilizes modified sugars containing PEG, PPG, or a masked reactive functional group, and is combined with the appropriate glycosyltransferase or glycosynthase.
- the PEG or PPG can be introduced directly onto the peptide backbone, onto existing sugar residues of a glycopeptide or onto sugar residues that have been added to a peptide.
- an acceptor for a sialyltransferase is present on the peptide to be modified either as a naturally occurring structure or is placed there recombinantly, enzymatically or chemically.
- Suitable acceptors include, for example, galactosyl acceptors such as Gal ⁇ 1,4GlcNAc, Gal ⁇ 1,4GalNAc, Gal ⁇ 1,3GalNAc, lacto-N-tetraose, Gal ⁇ 1,3GlcNAc, GalNAc, Gal ⁇ 1,3GalNAc, Gal ⁇ 11,6GlcNAc, Gal ⁇ 1,4Glc (lactose), and other acceptors known to those of skill in the art (see, e.g., Paulson et al., J. Biol. Chem. 253: 5617-5624 (1978)).
- Exemplary sialytransferases are set forth herein.
- an acceptor for the sialyltransferase is present on the glycopeptide to be modified upon in vivo synthesis of the glycopeptide.
- Such glycopeptides can be sialylated using the claimed methods without prior modification of the glycosylation pattern of the glycopeptide.
- the methods of the invention can be used to sialylate a peptide that does not include a suitable acceptor; one first modifies the peptide to include an acceptor by methods known to those of skill in the art.
- a GalNAc residue is added by the action of a GalNAc transferase.
- the galactosyl acceptor is assembled by attaching a galactose residue to an appropriate acceptor linked to the peptide, e.g., a GlcNAc.
- the method includes incubating the peptide to be modified with a reaction mixture that contains a suitable amount of a galactosyltransferase (e.g., Gal ⁇ 1,3 or Gal ⁇ 1,4), and a suitable galactosyl donor (e.g., UDP-galactose).
- a galactosyltransferase e.g., Gal ⁇ 1,3 or Gal ⁇ 1,4
- a suitable galactosyl donor e.g., UDP-galactose
- glycopeptide-linked oligosaccharides are first “trimmed,” either in whole or in part, to expose either an acceptor for the sialyltransferase or a moiety to which one or more appropriate residues can be added to obtain a suitable acceptor.
- Enzymes such as glycosyltransferases and endoglycosidases (see, for example U.S. Pat. No. 5,716,812) are useful for the attaching and trimming reactions.
- the sialic acid moieties of the peptide are essentially completely removed (e.g., at least 90, at least 95 or at least 99%), exposing an acceptor for a modified sialic acid.
- high mannose is trimmed back to the first generation biantennary structure.
- a modified sugar bearing a PEG moiety is conjugated to one or more of the sugar residues exposed by the “trimming back.”
- a PEG moiety is added via a GlcNAc conjugated to the PEG moiety.
- the modified GlcNAc is attached to one or both of the terminal mannose residues of the biantennary structure.
- an unmodified GlcNAc can be added to one or both of the termini of the branched species.
- a PEG moiety is added to one or both of the terminal mannose residues of the biantennary structure via a modified sugar having a galactose residue, which is conjugated to a GlcNAc residue added onto the terminal mannose residues.
- an unmodified Gal can be added to one or both terminal GlcNAc residues.
- a PEG moiety is added onto a Gal residue using a modified sialic acid such as those discussed above.
- an O-linked glycosyl residue is “trimmed back” to the GalNAc attached to the amino acid.
- a water-soluble polymer is added via a Gal modified with the polymer.
- an unmodified Gal is added to the GalNAc, followed by a Gal with an attached water-soluble polymer.
- one or more unmodified Gal residue is added to the GalNAc, followed by a sialic acid moiety modified with a water-soluble polymer.
- a high mannose structure can also be trimmed back to the elementary tri-mannosyl core.
- high mannose is “trimmed back” to the GlcNAc to which the first mannose is attached.
- the GlcNAc is conjugated to a Gal residue bearing a PEG moiety.
- an unmodified Gal is added to the GlcNAc, followed by the addition of a sialic acid modified with a water-soluble sugar.
- the terminal GlcNAc is conjugated with Gal and the GlcNAc is subsequently fucosylated with a modified fucose bearing a PEG moiety.
- High mannose may also be trimmed back to the first GlcNAc attached to the Asn of the peptide.
- the GlcNAc of the GlcNAc-(Fuc) a residue is conjugated with a GlcNAc bearing a water soluble polymer.
- the GlcNAc of the GlcNAc-(Fuc) a residue is modified with Gal, which bears a water soluble polymer.
- the GlcNAc is modified with Gal, followed by conjugation to the Gal of a sialic acid modified with a PEG moiety.
- the Examples set forth above provide an illustration of the power of the methods set forth herein. Using the methods of the invention, it is possible to “trim back” and build up a carbohydrate residue of substantially any desired structure.
- the modified sugar can be added to the termini of the carbohydrate moiety as set forth above, or it can be intermediate between the peptide core and the terminus of the carbohydrate.
- Glycosylation of a mutant human growth hormone may also be accomplished intracellularly by recombinant means.
- a polynucleotide sequence encoding a mutant human growth hormone, which comprises at least one newly introduced N- or O-linked glycosylation site may be transfected into a suitable host cell line, e.g., a eukaryotic cell line derived from yeast, insect, or mammalian origin.
- the mutant human growth hormone recombinantly produced from such a cell line is glycosylated by the host cell glycosylation machinery.
- a hGH peptide, expressed in insect cells is remodeled such that glycans on the remodeled glycopeptide include a GlcNAc-Gal glycosyl residue.
- the addition of GlcNAc and Gal can occur as separate reactions or as a single reaction in a single vessel.
- GlcNAc-transferase I and Gal-transferase I are used.
- the modified sialyl moiety is added using ST3Gal-Ill.
- the addition of GlcNAc, Gal and modified Sia can also occur in a single reaction vessel, using the enzymes set forth above.
- Each of the enzymatic remodeling and glycoPEGylation steps are carried out individually.
- the peptide is conjugated without need for remodeling prior to conjugation by contacting the peptide with a sialyltransferase that transfers the modified sialic acid directly onto a sialic acid on the peptide forming Sia-Sia-L-R 1 , or exchanges a sialic acid on the peptide for the modified sialic acid, forming Sia-L-R 1 .
- a sialyltransferase that transfers the modified sialic acid directly onto a sialic acid on the peptide forming Sia-Sia-L-R 1 , or exchanges a sialic acid on the peptide for the modified sialic acid, forming Sia-L-R 1 .
- An exemplary enzyme of use in this method is CST-II.
- Other enzymes that add sialic acid to sialic acid are known to those of skill in the art and examples of such enzymes are set forth the figures appended hereto.
- the peptide expressed in a mammalian system is desialylated using a sialidase.
- the exposed Gal residue is sialylated with a modified sialic acid using a sialyltransferase specific for O-linked glycans, providing an hGH peptide with an O-linked modified glycan.
- the desialylated, modified hGH peptide is optionally partially or fully re-sialylated by using a sialyltransferase such as ST3GalIII.
- the invention provides a method of making a PEGylated hGH of the invention.
- the method includes: (a) contacting a substrate hGH peptide comprising a glycosyl group selected from: with a sugar donor and an enzyme for which the sugar donor is a substrate under conditions appropriate to transfer a sugar moiety from the sugar donor to the hGH peptide.
- the sugar moiety is a modified sugar moiety.
- the modified sugar moiety is a modified sialic acid residue with a water-soluble polymer (e.g., PEG) covalently attached thereto.
- An exemplary PEG-sialic acid sugar donor has the formula:
- a preferred enzyme transfers PEG-sialic acid from said donor onto a member selected from the GalNAc, Gal and the Sia of a glycosyl group, under conditions appropriate for the transfer.
- An exemplary modified sialic acid donor is CMP-sialic acid modified, through a linker moiety, with a polymer, e.g., a straight chain or branched poly(ethylene glycol) moiety.
- the peptide is optionally glycosylated with GalNAc and/or Gal and/or Sia (“Remodeled”) prior to attaching the modified sugar.
- the remodeling steps can occur in sequence in the same vessel without purification of the glycosylated peptide between steps. Alternatively, following one or more remodeling step, the glycosylated peptide can be purified prior to submitting it to the next glycosylation or glycPEGylation step.
- placement of an acceptor moiety for the PEG-sugar is accomplished in any desired number of steps.
- the addition of GalNAc to the peptide can be followed by a second step in which the PEG-sugar is conjugated to the GalNAc in the same reaction vessel.
- these two steps can be carried out in a single vessel approximately simultaneously.
- the hGH peptide is expressed in an appropriate expression system prior to being glycopegylated or remodeled.
- exemplary expression systems include Sf-9/baculovirus and Chinese Hamster Ovary (CHO) cells.
- the invention provides methods of forming a conjugate of hGH such as those set forth herein in which the hGH in the conjugate is essentially unoxidized.
- Oxidation of methionine residues of PEG-hGH can be detected by N-terminal sequencing and peptide mapping. Oxidation or its absence can be confirmed using RP-HPLC.
- RP-HPLC a peak in addition the major PEG-hGH peak was detected, which represents a PEG-hGH species in which methionine is oxidized (Met-Ox). For hGH this peak has been identified as Met127/Met138 oxidation, eluting 0.2 min before the main peak.
- Met1 oxidation was detected by RP-HPLC using the 60° C. method, but coelutes with the main peak. This N-terminal methionine oxidation is detected by peptide mapping and is referred to as G1-Ox.
- the invention provides a population of hGH conjugates, as described herein, in which less than 10%, preferably less than 5%, more preferably less than 1%, more preferably less than 0.5%, still more preferably less than 0.1%, preferably less than 0.05%, more preferably less than 0.01%, even more preferably less than 0.005% and still more preferably less than 0.001% of the members of the population include a methionine residue selected from Met127, Met138, Met 122, N-terminal Met and combinations thereof which is oxidized.
- the enzymatic conjugation of the modified sugar to the peptide is performed under conditions that prevent or retard the oxidation of methionine residues of the peptide.
- the reaction mixture includes added methionine.
- Exemplary methods of the invention use up to about 20 mM methionine in the conjugation reaction mixture.
- the products produced by the above processes can be used without purification. However, it is usually preferred to recover the product and one or more of the intermediates, e.g., nucleotide sugars, branched and linear PEG species, modified sugars and modified nucleotide sugars. Standard, well known techniques for recovery of glycosylated saccharides such as thin or thick layer chromatography, column chromatography, ion exchange chromatography, or membrane filtration can be used. It is preferred to use membrane filtration, more preferably utilizing a reverse osmotic membrane, or one or more column chromatographic techniques for the recovery as is discussed hereinafter and in the literature cited herein.
- the intermediates e.g., nucleotide sugars, branched and linear PEG species, modified sugars and modified nucleotide sugars.
- Standard, well known techniques for recovery of glycosylated saccharides such as thin or thick layer chromatography, column chromatography, ion exchange chromatography, or membrane filtration can
- Nanofilter membranes are a class of reverse osmosis membranes that pass monovalent salts but retain polyvalent salts and uncharged solutes larger than about 100 to about 2,000 Daltons, depending upon the membrane used.
- saccharides prepared by the methods of the present invention will be retained in the membrane and contaminating salts will pass through.
- the particulate debris either host cells or lysed fragments, is removed.
- the PEGylated peptide is purified by art-recognized methods, for example, by centrifugation or ultrafiltration; optionally, the protein may be concentrated with a commercially available protein concentration filter, followed by separating the polypeptide variant from other impurities by one or more steps selected from immunoaffinity chromatography, ion-exchange column fractionation (e.g., on diethylaminoethyl (DEAE) or matrices containing carboxymethyl or sulfopropyl groups), chromatography on Blue-Sepharose, CM Blue-Sepharose, MONO-Q, MONO-S, lentil lectin-Sepharose, WGA-Sepharose, Con A-Sepharose, Ether Toyopearl, Butyl Toyopearl,
- Modified glycopeptides produced in culture are usually isolated by initial extraction from cells, cell lysate, culture media, etc., followed by one or more concentration, salting-out, aqueous ion-exchange, or size-exclusion chromatography steps. Additionally, the modified glycoprotein may be purified by affinity chromatography. Finally, HPLC may be employed for final purification steps.
- a protease inhibitor e.g., methylsulfonylfluoride (PMSF) may be included in any of the foregoing steps to inhibit proteolysis and antibiotics or preservatives may be included to prevent the growth of adventitious contaminants.
- PMSF methylsulfonylfluoride
- supernatants from systems that produce the modified human growth hormone of the invention are first concentrated using a commercially available protein concentration filter, for example, an Amicon or Millipore Pellicon ultrafiltration unit.
- the concentrate may be applied to a suitable purification matrix.
- a suitable affinity matrix may comprise a ligand for the peptide, a lectin or antibody molecule bound to a suitable support.
- an anion-exchange resin may be employed, for example, a matrix or substrate having pendant DEAE groups.
- Suitable matrices include acrylamide, agarose, dextran, cellulose, or other types commonly employed in protein purification.
- a cation-exchange step may be employed.
- Suitable cation exchangers include various insoluble matrices comprising sulfopropyl or carboxymethyl groups. Sulfopropyl groups are particularly preferred.
- One or more RP-HPLC steps employing hydrophobic RP-HPLC media e.g., silica gel having pendant methyl or other aliphatic groups, may be employed to further purify a polypeptide conjugate composition.
- Some or all of the foregoing purification steps, in various combinations, can also be employed to provide a homogeneous or essentially homogeneous modified glycoprotein.
- the modified glycopeptide of the invention resulting from a large-scale fermentation may be purified by standard methods analogous to those disclosed by Urdal et al., J. Chromatog. 296: 171 (1984).
- This reference describes two sequential, RP-HPLC steps for purification of recombinant human IL-2 on a preparative HPLC column.
- techniques such as affinity chromatography may be utilized to purify the modified glycoprotein.
- chemically PEGylated mutant hGH products of the invention may be fractionated using standard chromatographic techniques known in the art to obtain a more homogenous product containing specific numbers of PEG or fractions of PEG (e.g. 1-3, 2-4, etc.).
- the purification is accomplished by the methods set forth in commonly owned, co-assigned U.S. Provisional Patent No. 60/665,588, filed Mar. 24, 2005.
- the purification is effected by SPHP chromatography using an appropriate buffer as an eluent.
- buffers include citrate and acetate buffers, with citrate presently preferred.
- a phosphate salt e.g, sodium phosphate is added to the enzymatic conjugation reaction mixture.
- the reaction mixture is centrifuged and the resulting mixture is purified by SPHP.
- free methionine which is not covalently attached to the hGH peptide, is either present or absent during the purification step.
- An exemplary purification process results in the isolation of a population of hGH conjugates, as described herein, in which less than 10%, preferably less than 5%, more preferably less than 1%, more preferably less than 0.5%, still more preferably less than 0.1%, preferably less than 0.05%, more preferably less than 0.01%, even more preferably less than 0.005% and still more preferably less than 0.001% of the members of the population include a methionine residue selected from Met127, Met138, Met 122, N-terminal Met and combinations thereof which is oxidized.
- the purified hGH conjugate composition includes a population of hGH peptides in which less than 10%, preferably less than 5%, more preferably less than 1%, more preferably less than 0.5%, still more preferably less than 0.1%, preferably less than 0.05%, more preferably less than 0.01%, even more preferably less than 0.005% and still more preferably less than 0.001% of the population of peptides is associated in a peptide aggregate as determined by size-exclusion chromatography.
- the present invention also provides protease resistant hGH mutants.
- protease resistant and proteolysis resistant refer to hGH peptides (e.g., mutants) that enhance the stability of the mutant hGH peptide relative to the wild type hGH peptide in the presence of a protease.
- the protease recognition site of the wild type is completely inactivated in the mutant and is not a site of cleavage by the protease that cleaved the corresponding site in the wild type.
- the rate of cleavage is reduced by about 30%, more preferably by about 60%, and even more preferably by about 90%.
- protease resistance is imbued by mutation of one or more amino acids within a protease recognition site.
- protease resistance is imparted by the presence of one or more water-soluble polymer moieties covalently bound to the peptide proximate the protease recognition site.
- the water-soluble peptide can be placed by reaction with an activated water-soluble polymer (e.g., NHS-ester of PEG) or enzymatically (e.g., by glycoPEGylation).
- an activated water-soluble polymer e.g., NHS-ester of PEG
- enzymatically e.g., by glycoPEGylation
- chemical PEGylation of hGH prior to and/or after glycoPEGylation is used to achieve the protease resistant hGH of the present invention.
- These two types of peptide PEGylation can be performed in any combinations and order.
- Chemical PEGylation involves the binding of PEG, or other blocking group, i.e. a group inhibiting proteolysis, either in or near various protease recognition sites, thereby allowing the PEG, or other group, to serve essentially as a protease inhibitor.
- Peptides chemically PEGylated in this manner show enhanced resistance to protease degradation.
- the molecular weights of PEG to be used include 500MW, 2 kDa, 5 kDa, 10 kDa, 20 kDa, 30 kDa, and 40 kDa, etc.
- Other acceptable branched and linear PEG structures are discussed in the preceding sections.
- protease inhibiting groups other than PEG including other water-soluble polymers, water-insoluble polymers, therapeutic moieties, and biomolecules, are also useful in practicing the present invention.
- the biological functions of the glycoprotein are tested using several methods known in the art.
- the functional assays are based on various characteristics of human growth hormone, such as its specific binding to human growth hormone receptor, activation of the hGH receptor, and its activity in promoting cell growth. In each assay, wild-type human growth hormone is included as a positive control.
- a radioreceptor binding assay can be carried out to measure the binding between a radio-labeled hGH receptor and a mutant human growth hormone of the present invention.
- Detailed description for such an assay can be found in the literature, e.g., Tsushima et al., J Clin. Endocrinol. Metab., 37: 334-337 (1973); Chin et al., Endocr. Meta. 37: 334 (1973); and U.S. Pat. Nos. 4,871,835, 5,079,230.
- a mutant human growth hormone to promote cell growth is assessed by methods such as the tibia test (Parlow et al., Endocrinology 77: 1126(1965); U.S. Pat. No. 4,871,835). Briefly, rats are hypophysectomized at 28-30 days of age and kept for 10-14 days without treatment. Human growth hormone mutants derived from recombinant source is then given to the rats by daily subcutaneous injections. The animals are sacrificed on the sixth day, their foreleg knee bones taken out and the width of the epiphyseal plates measured. The weight of these rats at the start of the experiment and before being sacrificed is also monitored and compared among different groups receiving daily injections of the mutant human growth hormone at different concentrations.
- the biological activity of a mutant human growth hormone can be demonstrated in its ability to cause hGH-dependent tyrosine phosphorylation in 14-9 cells, which are derived from a clone of human lymphoblastoma and express human growth hormone receptor on the cell surface.
- 14-9 cells which are derived from a clone of human lymphoblastoma and express human growth hormone receptor on the cell surface.
- Other cell types such as MB-2 cells may also be suitable for hGH functional assays.
- the level of tyrosine phosphorylation of cellular proteins upon exposure to the mutant human growth hormone is shown by a monoclonal antibody against phosphorylated tyrosine, as described by Silva et al., Endocrinology, 132: 101 (1993) and U.S. Pat. No. 6,238,915.
- the glycosylated mutant human growth hormone having desired oligosaccharide determinants described above can be used as therapeutics for treating a variety of diseases and conditions related to deficiency in growth hormone.
- Growth-related conditions that can be treated with the mutant human growth hormone of the present invention include: dwarfism, short-stature in children and adults, cachexia/muscle wasting, general muscular atrophy, and sex chromosome abnormality (e.g., Turner's Syndrome).
- mutant hGH of the present invention Other conditions may be treated using the mutant hGH of the present invention include: short-bowel syndrome, lipodystrophy, osteoporosis, uraemaia, burns, female infertility, bone regeneration, general diabetes, type II diabetes, osteo-arthritis, chronic obstructive pulmonary disease (COPD), and insomnia.
- the mutant hGH of the invention may also be used to promote various healing processes, e.g., general tissue regeneration, bone regeneration, and wound healing, or as a vaccine adjunct.
- the present invention also provides pharmaceutical compositions comprising an effective amount of glycosylated mutant human growth hormone, which is produced according to the methods described above.
- the pharmaceutical composition includes a pharmaceutically acceptable diluent and a covalent conjugate between a non-naturally-occurring, PEG moiety, therapeutic moiety or biomolecule and a glycosylated or non-glycosylated peptide.
- the polymer, therapeutic moiety or biomolecule is conjugated to the peptide via an intact glycosyl linking group interposed between and covalently linked to both the peptide and the polymer, therapeutic moiety or biomolecule.
- compositions of the invention are suitable for use in a variety of drug delivery systems. Suitable formulations for use in the present invention are found in Remington's Pharmaceutical Sciences , Mace Publishing Company, Philadelphia, Pa., 17th ed. (1985). For a brief review of methods for drug delivery, see, Langer, Science 249: 1527-1533 (1990).
- the pharmaceutical compositions may be formulated for any appropriate manner of administration, including for example, topical, oral, nasal, intravenous, intracranial, intraperitoneal, subcutaneous or intramuscular administration.
- the carrier preferably comprises water, saline, alcohol, a fat, a wax or a buffer.
- any of the above carriers or a solid carrier such as mannitol, lactose, starch, magnesium stearate, sodium saccharine, talcum, cellulose, glucose, sucrose, and magnesium carbonate, may be employed.
- Biodegradable microspheres e.g., polylactate polyglycolate
- suitable biodegradable microspheres are disclosed, for example, in U.S. Pat. Nos. 4,897,268 and 5,075,109.
- compositions for parenteral administration that include the compound dissolved or suspended in an acceptable carrier, preferably an aqueous carrier, e.g., water, buffered water, saline, PBS and the like.
- an acceptable carrier preferably an aqueous carrier, e.g., water, buffered water, saline, PBS and the like.
- the compositions may also contain detergents such as Tween 20 and Tween 80; stabilizers such as mannitol, sorbitol, sucrose, and trehalose; and preservatives such as EDTA and m-cresol.
- the compositions may contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions, such as pH adjusting and buffering agents, tonicity adjusting agents, wetting agents, detergents and the like.
- the glycopeptides of the invention can be incorporated into liposomes formed from standard vesicle-forming lipids.
- a variety of methods are available for preparing liposomes, as described in, e.g., Szoka et al., Ann. Rev. Biophys. Bioeng. 9: 467 (1980), U.S. Pat. Nos. 4,235,871, 4,501,728 and 4,837,028.
- the targeting of liposomes using a variety of targeting agents e.g., the sialyl galactosides of the invention is well known in the art (see, e.g., U.S. Pat. Nos. 4,957,773 and 4,603,044).
- Standard methods for coupling targeting agents to liposomes can be used. These methods generally involve incorporation into liposomes of lipid components, such as phosphatidylethanolamine, which can be activated for attachment of targeting agents, or derivatized lipophilic compounds, such as lipid-derivatized glycopeptides of the invention.
- lipid components such as phosphatidylethanolamine, which can be activated for attachment of targeting agents, or derivatized lipophilic compounds, such as lipid-derivatized glycopeptides of the invention.
- Targeting mechanisms generally require that the targeting agents be positioned on the surface of the liposome in such a manner that the target moieties are available for interaction with the target, for example, a cell surface receptor.
- the carbohydrates of the invention may be attached to a lipid molecule before the liposome is formed using methods known to those of skill in the art (e.g., alkylation or acylation of a hydroxyl group present on the carbohydrate with a long chain alkyl halide or with a fatty acid, respectively).
- the liposome may be fashioned in such a way that a connector portion is first incorporated into the membrane at the time of forming the membrane.
- the connector portion must have a lipophilic portion, which is firmly embedded and anchored in the membrane. It must also have a reactive portion, which is chemically available on the aqueous surface of the liposome. The reactive portion is selected so that it will be chemically suitable to form a stable chemical bond with the targeting agent or carbohydrate, which is added later.
- the target agent in some cases it is possible to attach the target agent to the connector molecule directly, but in most instances it is more suitable to use a third molecule to act as a chemical bridge, thus linking the connector molecule which is in the membrane with the target agent or carbohydrate which is extended, three dimensionally, off of the vesicle surface.
- the compounds prepared by the methods of the invention may also find use as diagnostic reagents.
- labeled compounds can be used to locate areas of inflammation or tumor metastasis in a patient suspected of having an inflammation.
- the compounds can be labeled with 125 I, 14 C, or tritium.
- the active ingredient used in the pharmaceutical compositions of the present invention is glycopegylated hGH and its derivatives having the biological properties of stimulating granulocyte production.
- the hGH composition of the present invention is administered parenterally (e.g. IV, IM, SC or IP).
- Effective dosages are expected to vary considerably depending on the condition being treated and the route of administration but are expected to be in the range of about 0.1 ( ⁇ 7U) to 100 ( ⁇ 7000U) ⁇ g/kg body weight of the active material.
- Preferable doses for treatment of anemic conditions are about 50 to about 300 Units/kg three times a week. Because the present invention provides a hGH with an enhanced in vivo residence time, the stated dosages are optionally lowered when a composition of the invention is administered.
- compositions of the invention are generally set forth in various patent publications, e.g., US 20040137557; WO 04/083258; and WO 04/033651.
- US 20040137557 e.g., US 20040137557
- WO 04/083258 e.g., US 20040137557
- WO 04/033651 e.g., US 20040137557
- WO 04/083258 e.g., WO 04/033651
- the following examples are provided to illustrate the conjugates, and methods and of the present invention, but not to limit the claimed invention.
- the present invention provides a pharmaceutical formulation that includes a population of hGH conjugates, such as described herein, in combination with a pharmaceutically acceptable diluent.
- a preferred formulation of the invention includes a buffer, a detergent, and a polyol.
- An exemplary formulation includes the peptide conjugate in an amount from about 1 mg/mL to about 100 mg/mL, preferably from about 5 mg/mL to about 75 mg/mL, and more preferably from about 10 mg/mL to about 50 mg/mL.
- An exemplary formulation includes a buffer at a concentration of about 1 mM to about 100 mM, preferably from about 5 mM to about 75 mM, and more preferably from about 10 mM to about 50 mM.
- the detergent is present in an amount from about 0.00001% to about 10%, preferably from about 0.00005% to about 1%, more preferably from about 0.0001% to about 0.1%, more preferably from about 0.0005% to about 0.005%, and even more preferably from about 0.001% to about 0.01%.
- the polyol is present in an amount of about 1 mg/mL to 100 mg/mL, preferably from about 10 mg/mL to about 75 mg/mL, more preferably from about 15 mg/mL to about 50 mg/mL.
- the pH of the formulation is from about 3 to about 7.5, preferably from about 4 to about 6.5 and more preferably from about 5 to about 6.
- it is generally preferred that it be formulated at a pH that is within a range of about 0.5 pH units of the pI of the peptide.
- the detergent is Tween, e.g., Tween 20.
- the polyol is sorbitol.
- the buffer is sodium acetate.
- An exemplary formulation of the invention includes hGH conjugate (2 mg/mL) in a mixture with 10 mM NaOAc, 0.003% Tween 20, and 50 mg/mL of sorbitol at pH 4.0.
- compositions may be sterilized by conventional sterilization techniques, or may be sterile filtered.
- the resulting aqueous solutions may be packaged for use as is, or lyophilized, the lyophilized preparation being combined with a sterile aqueous carrier prior to administration.
- the pH of the preparations typically will be between 3 and 11, more preferably from 5 to 9, and most preferably from 7 and 8.
- compositions containing the glycosylated mutant human growth hormone can be administered for prophylactic and/or therapeutic treatments.
- compositions are administered to a patient already suffering from a disease or condition related to growth hormone deficiency, in an amount sufficient to cure or at least partially arrest the symptoms of the disease and its complications.
- An amount adequate to accomplish this is defined as a “therapeutically effective dose.” Amounts effective for this use will depend on the severity of the disease or condition and the weight and general state of the patient, but generally range from about 0.1 mg to about 2,000 mg of glycosylated mutant human growth hormone per day for a 70 kg patient, with dosages of from about 5 mg to about 200 mg of the compounds per day being more commonly used.
- compositions containing the glycosylated mutant human growth hormone of the invention are administered to a patient susceptible to or otherwise at risk of a particular disease.
- a patient susceptible to or otherwise at risk of a particular disease is defined to be a “prophylactically effective dose.”
- prophylactically effective dose the precise amounts again depend on the patient's state of health and weight, but generally range from about 0.1 mg to about 1,000 mg per 70 kilogram patient, more commonly from about 5 mg to about 200 mg per 70 kg of body weight.
- compositions can be carried out with dose levels and pattern being selected by the treating physician.
- pharmaceutical formulations should provide a quantity of the glycosylated mutant human growth hormone of this invention sufficient to effectively treat the patient.
- Human growth hormone occurs in a variety of different isoforms and different amino acid sequences.
- the two best characterized forms include placental derived hGH, which is also known as GH-V (PDB P01242) and pituitary derived hGH, which is also known as somatotropin or GH-N(P01241); see FIG. 1 .
- the pituitary derived hGH is not glycosylated and is produced in Escherichia coli as a therapeutic.
- the placental derived hGH (GH-V) has one N-glycosylation site at amino acid 140 (see Table 4 and FIG. 1 , see arrow).
- the pituitary derived hGH (GH-N) can be modified at amino acid position 140 to introduce an N-linked glycosylation site by mutating the nucleotide sequence encoding this polypeptide so that instead of encoding the wild-type lysine (abbreviated as “k” at amino acid 140 of the GH-N polypeptide sequence in Table 5 and FIG. 1 , see arrow), the nucleotide sequence will encode an asparagine (abbreviated “n”) at amino acid position 140 of GH-N (see also FIG. 2 ).
- This mutated pituitary derived hGH can then be glycosylated or glycoconjugated (see WO 03/31464).
- the mutated pituitary derived hGH is glycoPEGylated, wherein a polyethylene glycol (PEG) moiety is conjugated to the mutated pituitary derived hGH polypeptide via a glycosyl linkage (see WO 03/31464, incorporated herein by reference).
- FIG. 3 describes the GlycoPEGylation of an hGH N-linked glycan mutant produced in either Sf9 insect cells or mammalian cells.
- GlycoPEGylation of the mutated pituitary derived hGH is expected to result in improved biophysical properties that may include but are not limited to improved half-life, improved area under the curve (AUC) values, reduced clearance, and reduced immunogenicity.
- An alternative approach is to create an O-linked glycosylation site into the pituitary derived hGH polypeptide.
- This O-linked glycosylation site may then be used as a site on which the mutated hGH polypeptide can be glycoPEGylated using a GalNAcT 2 enzyme or the like.
- One or more additional transferases may then be used to add glycans or glycoconjugates to that site.
- the mutated pituitary derived hGH polypeptide is glycoPEGylated.
- FIG. 4 describes the glycoPEGylation of an hGH O-linked glycan mutant produced in Escherichia coli.
- the protein loop regions on pituitary derived hGH are best suited for mutation to introduce a glycosylation site ( FIG. 5 ).
- the nucleotide sequence that encodes amino acids 1-6 (FPTIPL; SEQ ID NO:10), amino acids 48-52 (PQTSL; SEQ ID NO:11), amino acids 59-64 (PTPSNR; SEQ ID NO:12), amino acids 133-139 (PRTGQIF; SEQ ID NO:13), amino acids 133-145 (PRTGQIFKQTYSK; SEQ ID NO:14), or amino acids 139-142 (FKQT; SEQ ID NO:15) of the wild-type pituitary derived hGH amino acid sequence (see Table 5 and FIG. 1 ) can be mutated so that either an N-linked or an O-linked glycosylation site is introduced into the resulting mutated pituitary-derived hGH polypeptide.
- FIG. 6 illustrates six (6) of these introduced O-linked glycosylation sites.
- the arrows in FIG. 6 each represent the threonine residue on which O-linked glycosylation will occur in the GH-N O-linked glycan hGH mutant.
- FIG. 7 and FIG. 8 each illustrates two additional GH-N O-linked glycan hGH mutants.
- This example describes amino acid sequence mutations introducing O-linked glycosylation sites, i.e., serine or threonine residues, into a preferably proline-containing site of a wild-type human growth hormone sequence or any modified version thereof.
- the N-terminus of a wild-type hGH, FP 2 TIP 5 LS; SEQ ID NO:16 is replaced with either MXnTP 2 TIP 5 LS or MAPTSSXnP 2 TIP 5 LS.
- Preferred examples include: MVTPTIPLS; SEQ ID NO:17 MQTPTIPLS; SEQ ID NO:18 MAPTSSPTIPLS; SEQ ID NO:19 MAPTSSSPTIPLS SEQ ID NO:20 (IL-2 N-terminus); MPTTFPTIPLS; SEQ ID NO:21 MPTSSPTIPLS; SEQ ID NO:22 MPTSSSPTIPLS; SEQ ID NO:23 Internal Mutation Site 1
- mutants the N-terminus of a wild-type hGH, FP 2 TIP 5 LS; SEQ ID NO:24, is replaced with ZmP 2 T XnBoP 5 LS.
- Preferred mutations include: MFPTQIPLS; SEQ ID NO:25 MFPTSIPLS; SEQ ID NO:26 MFPTSSPLS; SEQ ID NO:27 MTPTQIPLS; SEQ ID NO:28 MFPTTTPLS; SEQ ID NO:29 Internal Mutation Site 2
- the amino acid sequence surrounding p 37 , AYIP 37 KEQKY; SEQ ID NO:30 is replace with AZmJqP 37 OrXnBo ⁇ pY, where at least one of Z, J, O, X, and B is independently selected from either Thr or Ser; ⁇ may include Lys (K) and X may be Asp (D).
- Preferred examples include: AYIP 37 TQGAY; SEQ ID NO:31 AYIP 37 TSSSY; SEQ ID NO:32 AQITP 37 TEQKY; SEQ ID NO:33 AYIP 37 TEQSY; SEQ ID NO:34 Internal Mutation Site 3
- the amino acid sequence surrounding p 48 , LQNP 48 QTSLC; SEQ ID NO:35 is replaced with LZmJqP 48 OrXnBoLC, where at least one of Z, J, O, and X are independently selected from either Thr or Ser.
- Preferred examples include: LQTP 48 QTSLC; SEQ ID NO:36 LQNP 48 TTSLC; SEQ ID NO:37 Internal Mutation Site 4
- the amino acid sequence surrounding p 59 , SESIP 59 TPNREET; SEQ ID NO:38, is replaced with SZmUsJqP 59 TPOrXnBo ⁇ rT, where at least one of Z, J, O, B, ⁇ , U, and X is independently selected from either Thr or Ser; B, ⁇ , and Z may include charged amino acids.
- Preferred examples include: SESTP 59 TPNREET; SEQ ID NO:39 SSSTP 59 TPNREET; SEQ ID NO:40 SESIP 59 TPNTEET; SEQ ID NO:41 SESIP 59 TPNTQET; SEQ ID NO:42 SESIP 59 TPTQGAT; SEQ ID NO:43 SESIP 59 TPTESST; SEQ ID NO:44 SQSTP 59 TPNREET; SEQ ID NO:45 SQSTP 59 TPNQEET; SEQ ID NO:46 SESTP 59 TPTSSST; SEQ ID NO:47 Internal Mutation Site 5
- the amino acid sequence surrounding p 89 , SWLEP 89 VQFLRS; SEQ ID NO:48, is replaced with SZmUsJqP 89 OrXnBo ⁇ r ⁇ tS, where at least one of Z, U, J, O, B, and X is independently selected from either Thr or Ser; J and ⁇ may include charged amino acids.
- Preferred examples include: SWLEP 89 TQGLRS; SEQ ID NO:49 SWLEP 89 TQGATS; SEQ ID NO:50 SSQTP 89 VQFLRS; SEQ ID NO:51 SWLEP 89 TSSLSS; SEQ ID NO:52 SMVTP 89 VQFLRS; SEQ ID NO:53 Internal Mutation Site 6
- EDGSP 133 TTGQIF EDGSP 133 TTGQIF
- SEQ ID NO:55 EDGSP 133 NTGQIF EDGSP 133 NTGQIF
- SEQ ID NO:56 EDGSP 133 TQGQIF EDGSP 133 TVGQIF
- SEQ ID NO:58 EDGSP 133 TTTQIF
- SEQ ID NO:59 EDGSP 133 TSSQIF
- SEQ ID NO:60 EDGSP 133 TTQGIF
- SEQ ID NO:62 EDGTP 133 NTGQIF EDGTP 133 NTGQIF
- SEQ ID NO:63 EDQTP 133 NTGQIF SEQ ID NO:64 Internal Mutation Site 7
- the amino acid sequence surrounding p 140 is replace with GZmUsJq ⁇ r 140 OrXnBoS, where at least one of Z, U, J, O, B, and X is independently selected from either Thr or Ser.
- GQIFN 140 QTYS SEQ ID NO:66 GQIFN 140 ITYS; SEQ ID NO:67 GQIFP 140 QTSS; SEQ ID NO:68 GQIFP 140 TTTS; SEQ ID NO:69 GQITP 140 QTYS; SEQ ID NO:70 GQIFT 140 QTYS; SEQ ID NO:71 GQIST 140 QTYS; SEQ ID NO:72 GQIPT 140 TTYS; SEQ ID NO:73 C-terminal Mutations
- VEGSCG 190 F the amino acid sequence at the C-terminus of a wild-type hGH, VEGSCG 190 F; SEQ ID NO:74, is replaced with VEGSCG 190 PXnBoZmUsP, where at least one of Z, U, B, and X is independently selected from either Thr or Ser.
- Preferred examples include: VEGSCGPTTTP; SEQ ID NO:75 VEGSCGPTSSP; SEQ ID NO:76 VEGSCGPTQGAMP; SEQ ID NO:77 VEGSCGPTTIP; SEQ ID NO:78 VEGSCGPMVTP; SEQ ID NO:79
- X, Z, B, A, J, U, O, and A are independently selected from E (glutamate), any uncharged amino acid or dipeptide combination including M, F, MF, and the like; m, n, o, p, q, r, s, and t are independently selected from integers from 0 to 3.
- the N-terminal Met may be present or absent on any hGH mutant.
- the numbering of the amino acid residues is based on the initial unmodified sequence in which the left most residue is numbered 1. The numbering of unmodified amino acids remains unchanged following the modification. More than one of the above described sequence modifications may be present in a hGH mutant of the present invention.
- This example illustrates one embodiment of the present invention, wherein a mutant hGH with the P 134 TINT glycosylation site motif first undergoes glycoPEGylation with the use of GalNAcT 2 and UDP-GalNAc in combination with ST6GalNAc-I and CMP-SA-PEG (30 kDa), then chemical PEGylation, resulting in a hGH with protease resistance.
- This example illustrates one embodiment of the present invention, wherein a mutant hGH with the P 134 TQGAM glycosylation site motif first undergoes chemical PEGylation, then glycoPEGylation with the use of GalNAcT 2 , core-1-GalT 1 , ST3Gal 1 in combination with CMP-SA-PEG-Cys (40 kDa), thereby resulting in a hGH with protease resistance.
- This example illustrates one embodiment of the present invention, wherein a mutant hGH with the P 134 TINT glycosylation site motif first undergoes glycoPEGylation with the use of GalNAcT 2 and UDP-GalNAc in combination with core-1-GalT 1 /UDP-Gal and ST3Gal 1 /CMP-SA-PEG (40 kDa), then chemical PEGylation, resulting in a hGH with protease resistance. It should be noted that only one size for m should be used for any single reaction and product.
- This example illustrates one embodiment of the present invention, wherein hGH mutants are expressed in E. coli JM 109 and W3110.
- Miniprep plasmid DNA from hGH mutants were used to transform E. coli JM109 and W3110, respectively.
- the resulting transformants were inoculated into 2 ml Martone LB containing 10 ⁇ g/ml kanamycin and grown overnight at 37° C. as starter cultures.
- One half milliliter of the starter culture were transferred to 50 ml Martone LB containing 10 ⁇ g/ml kanamycin and allowed to grow at 37° C./250 rpm until OD 600 reached 0.8 ⁇ 1.0.
- IPTG was then added to a final concentration of 1 mM and the induction was performed for 5 hrs at 37° C. with a reduced agitation rate of 150 rpm.
- Plasmid DNA for each hGH mutant were transformed into E. coli W3110. Several colonies from each transformation plate were inoculated into 20 ml Martone LB containing 10 ⁇ g/ml kanamycin and grown at 37° C./250 rpm for ⁇ 6 hrs as starter culture. Ten milliliters of the starter culture were then transferred to 500 ml Martone LB containing 10 ⁇ g/ml kanamycin and grown at 37° C./250 rpm until OD 600 reached 0.8-1.0. IPTG was added to a final concentration of 1 mM and the induction was performed overnight at 37° C. with 150 rpm. For some of the mutants, the hGH mutant expression was analyzed by SDS-PAGE as described above.
- the starter culture was inoculated using a scraping from a glycerol stock of each individual mutant.
- the bacteria were incubated at 37° C., 135 rpm overnight.
- Ten milliliters of starter culture were transferred to 1 L Martone LB containing Kanamycin (10 ⁇ g/ml) in 2 L-shaking flask (baffled or non-baffled) and grown at 37° C., 250 rpm until OD 600 of 0.8 ⁇ 1.0 (around 3 hrs).
- IPTG was added to a final concentration of 1 mM and the induction was performed at 37° C., 135 rpm for 15 hrs.
- the Martone LB media contained 1% Martone B-1, 0.5% Marcor Yeast Extract, 1% NaCl.
- the pH was adjusted to 7.0 by adding 3.25 ml 1N NaOH to 1 L medium.
- the parameters for the 150-L fermentor were designed to mimic those of the above mentioned 10-L fermentor. Kanamycin was used through all stages of culture at a final concentration of 10 ⁇ g/ml.
- a 200 ml shake flask seed culture was inoculated with 100 ⁇ l from a thawed 1 ml glycerol stock and grown at 37° C./135 rpm for 16-18 hrs. The shake flask seed culture was then transferred to 15-L seed fermentor containing 10 L media and grown overnight. Two to ten liters of the seed culture, preferably 2 L, were used to inoculate up to 98 L production culture (with combined volume of 100 L in a 150-L fermentor).
- the cultures were grown to an OD 600 of 0.6 to 3.0, preferably 0.6, at 37° C. and 25% pO 2 under cascade mode.
- the expression of each hGH mutant was induced by the addition of IPTG at a final concentration of 1 mM.
- the fermentation was continued at an agitation of 75 rpm and 10% pO 2 (cascade mode) at 37° C. for 24 hrs.
- Cells were harvested using a disc stack centrifuge.
- Induced cultures were harvested by centrifugation at 4° C./5000 rpm for 15 min.
- the pellets obtained were resuspended in a buffer containing 20 mM Tris-HCl, pH 8.5, 5 mM EDTA.
- the resuspended bacterial cells were disrupted by passing through a microfluidizer twice at ⁇ 16,000 Psi.
- the IBs were collected by centrifugation at 4° C., 5000 rpm for 10 min and washed twice, first with 35 ml and second with 10 ml washing buffer containing 20 mM Tris-HCl, pH 8.5, 5 mM EDTA, 100 mM NaCl, 1% Triton X-100 and 1% sodium deoxycholate.
- the IBs were finally resuspended in 30 ml H 2 O and aliquoted equally into 3 50-ml conical tubes.
- the IBs were collected and stored at ⁇ 80° C. Five to ten microliter aliquots were analyzed on 14% acrylamide Tris-Glycine precast gels as described above (see FIG. 37 ).
- the induced cultures were harvested by centrifugation at 4° C. with 5000 rpm for 10 min.
- the pellets obtained were resuspended ( ⁇ 4 g/100 ml) in a buffer containing 20 mM Tris-HCl, pH 8.5, 5 mM EDTA.
- the resuspended bacterial cells were disrupted by passing through a microfluidizer twice.
- the IBs were collected by centrifugation at 4° C., 4150 rpm for 10 min and washed repeatedly as shown in Table 6 below.
- IBs 150 mg washed IBs were first solubilized in 7.5 ml buffer containing 6 M guanidine HCl, 5 mM EDTA, 100 mM NaCl, and 50 mM Tris-HCl (pH 8.5) by constant stirring at room temperature.
- the solubilized IBs were then diluted slowly into a refolding buffer with combined volume of 150 ml containing, 0.5 M L-Arg+, 250 mM NaCl, 10 mM KCl, 0.05% PEG 3350, 50 mM MES, 1 mM GSH, 0.1 mM GSSG, 0.3 mM lauryl maltoside, pH approximately 10.5.
- the refolding was performed at 4° C.
- the pH of the dialysis buffer can be varied from 4.0 to 7.4, but preferably 7.4.
- the refolded aliquots were pooled and filtered through a 0.45 ⁇ m membrane prior to loading onto DEAE ion exchange chromatography.
- the formulation was used as received for dose administration. All animals were dosed once, intravenous or subcutaneous or subcutaneous, on Study Day 1. Dose volume was dependent upon final Dosage Concentration to yield a final dose per animal of 90 ⁇ g/rat (see Table 7 below).
- Blood was processed to serum, frozen ( ⁇ 70° C. ⁇ 5° C.) and shipped overnight to Neose Technologies, Inc. for concentration analysis.
- An ELISA was used to measure the concentration of hGH. Pharmacokinetic analysis was then performed.
- a total of 65 hypophysectomized female Sprague-Dawley rats were assigned to 13 groups (5/group). Animals were administered either 200 ⁇ L of Vehicle (a solution of phosphate buffered saline at pH 7.4, 0.3% Pluronic F-68, and 2% Mannitol), 180 ⁇ g or 30 ⁇ g/dose of the reference control article (P148), or 180 ⁇ g of one of the test articles (P241, P242, P249-64, P249-72, P250, P256, P257, P258, P259, or P240) via subcutaneous injection.
- Vehicle a solution of phosphate buffered saline at pH 7.4, 0.3% Pluronic F-68, and 2% Mannitol
- P148 a solution of phosphate buffered saline at pH 7.4, 0.3% Pluronic F-68, and 2% Mannitol
- P148 a solution of phosphate buffered saline at pH 7.4, 0.3% Pluronic
- Rats were administered a subcutaneous injection once on Study Day 1 for Groups 1, 2, and 4-13 and once daily (approximately the same time each day, ⁇ 1 hour) on Study Day 1-10 for Group 3. Dosing materials were maintained on wet ice prior to and during dosing. All animals were checked for general health/mortality twice daily, clinical observations predose and termination and body weights recorded predose, Study Day 1 and daily thereafter.
- IGF-1 insulin-like growth factor 1
- a gross necropsy which included examination of the external surface of the body, injection site, all orifices, the cranial, thoracic, and abdominal cavities, and their contents, was performed on surviving animals on Study Day 11. Organs were weighed as soon as possible after dissection at scheduled necropsies. Paired organs were weighed together. Moribund animals were subjected to a gross necropsy and protocol specified-tissues were collected; however no organ weights were collected. At scheduled termination, the absence of the pituitary gland was documented. The eyes were fixed in modified Davidson's fixative for approximately 24 hours and then transferred to 70% alcohol. All gross lesions and protocol-required tissues were preserved in 10% neutral buffered formalin (NBF).
- NBF neutral buffered formalin
- Body weights, body weight changes, absolute and relative organ weights, and IGF-1 concentration were statistically analyzed. Analysis was performed for all test articles against each reference control group (Groups 2 and 3).
- the refolded hGH (2 L) was passed through a 0.2 micron in-line filter and was loaded on a DEAE Sepharose column (200 mL) pre-equilibrated with 20 mM tris buffer pH 8.5, 5 mM EDTA, 0.4 M urea and connected to an HPLC system that monitored the absorbance at 280 nm.
- the hGH was eluted with a step gradient from 20 mM tris buffer pH 8.5, 5 mM EDTA to 20 mM tris buffer pH 8.5, 5 mM EDTA, 50 mM NaCl followed by a linear gradient to 20 mM tris buffer pH 8.5, 5 mM EDTA, 2 M NaCl.
- Fractions were collected in a chilled fraction collector and concentrated to approximately 1 mg/mL using a centrifugal filter (5 kDa MWCO). Samples were stored at 4° C.
- the concentrated DEAE-sepharose purified hGH samples (approximately 9 mL) were loaded on a Superdex 75 column connected to an HPLC system monitoring absorbance at 280 nm.
- the hGH product was eluted with 50 mM Tris, pH 7.4, 20 mM NaCl at a flow rate of 4 mL/min. Fractions containing monomeric product were collected and stored at 4° C.
- the hGH mutant (14.0 mg, 0.63 micromole) was adjusted to 0.001% Polysorbate 80 and concentrated to a volume of 2-3 mL using a centrifugal filter (5 kDa MWCO).
- the UDP-GalNAc (6.3 micromoles) and 1M MnCl 2 (to a final concentration of 10 mM MnCl 2 ) were then added to the concentrated hGH solution.
- the GalNAcT2 50 microliters, 105 mU was added, mixed very gently and incubated at room temperature for 18.5 hrs. The addition of GalNAc was determined to be complete by MALDI analysis of the reaction mixture.
- the CMP-SA-PEG-30 kDa (1.9 micromoles) was added to the hGH-GalNAc reaction mixture as a concentrated solution in reaction buffer and ST6GalNAc1 (0.72 mL, 0.7 U) was added with gentle mixing.
- the reaction mixture was incubated at room temperature for 20 hrs and was monitored for extent of PEGylation by SDS PAGE and RP-HPLC.
- the product, hGH-GalNAc-SA-PEG-30 kDa was purified using SP Sepharose and SEC (Superdex 200) chromatography. The purified hGH-GalNAc-SA-PEG-30 kDa was concentrated and then formulated.
- the hGH mutant (42 mg, 1.9 micromoles) was adjusted to 0.001% Polysorbate 80 and concentrated to a volume of 6-7 mL using a centrifugal filter (5 kDa MWCO).
- the UDP-GalNAc (19.1 micromoles) was added as a concentrated solution in Reaction buffer: 50 mM Tris, 20 mM NaCl, 0.001% Polysorbate 80, 0.02% NaN 3 , pH 7.4 (0.2 mL) and the resulting solution was adjusted to 10 mM MnCl 2 (1 M MnCl 2 , 0.08 mL).
- the GalNAcT2 (200-400 mU) was added, mixed very gently and incubated at room temperature for 18.5 hours.
- GalNAc was determined to be complete by MALDI analysis of the reaction mixture.
- a concentrated solution of UDP-Gal in Reaction buffer (19 micromoles, 0.1 mL) and Core-1-GalT1 enzyme (0.42 U) were added to the hGH-GalNAc reaction mixture with gentle mixing and the resulting solution was incubated for 16.5 hrs at room temperature.
- the addition of Gal was determined to be complete by MALDI analysis of the reaction mixture.
- the CMP-SA-cys-PEG-40 kDa (3.8 micromoles) was added to the hGH-GalNAc-Gal reaction mixture as a concentrated solution in reaction buffer (0.8 mL) and ST3 Gal 1 enzyme (1.68 U) was added with gentle mixing.
- the reaction mixture was incubated at room temperature for 20-65 hrs and was monitored for extent of PEGylation by SDS PAGE and RP-HPLC.
- the product, hGH-GalNAc-Gal-SA-cys-PEG-40 kDa was purified using SP Sepharose and SEC (Superdex 200) chromatography.
- the purified hGH-GalNAc-Gal-SA-cys-PEG-40 kDa was concentrated and then formulated.
- the product was analyzed by a BCA protein assay, SDS-PAGE gels (silver stain), MALDI, SEC for aggregation, and for cell proliferation.
- SP Sepharose Chromatography The hGH-GalNAc-SA-PEG-30 kDa and hGH-GalNAc-Gal-SA-Cys-PEG-40 kDa were purified using an SP Sepharose column (20 mL) connected to an HPLC system that monitored the absorbance at 280 nm.
- the hGH reaction mixtures were diluted into 5 volumes of cold 25 mM sodium acetate (pH 4.2) and were injected onto the column.
- the product was eluted at a flow rate of 5.0 mL/min. using a NaCl gradient.
- Product containing fractions were collected, neutralized to pH>7 with 1 M Tris, pH 8 and concentrated to approximately 1.0 mL using a centrifugal filter, 5 kDa MWCO. Samples were stored at 4° C.
- SDS PAGE Analysis The 4-20% polyacrylamide gradient slab gels were used. Samples (approximately 10 mcg of protein) were mixed with 10 microliters SDS Sample Buffer containing 0.1 M DTT, and heated at 85° C. for 6 min, unless otherwise noted. Gels were run at a constant voltage of 125 V for 1 hr 50 min. After electrophoresis, the proteins were stained with a colloidal stain solution for 2-24 hours at room temperature as necessary to visualize the protein or with a silver stain kit.
- Nb2-11 cell proliferation assay was used to determine the in vitro activity of the hGH mutants and glycoPEGylated hGH mutants.
- the assay was based that described in Patra, A. K., Mukhopadhyay, R., Mukhiga, R., Krishnan, A., Garg, L. C. and Panda, A. K. Optimization of inclusion body solubilization and renaturation of recombinant human growth hormone from Escherichia coli . Protein Expr. Purif. 18, 182-192 (2000).
- Nb2-11 cells were grown in Fischer's media with lactogen-free 10% horse serum and 10% fetal bovine serum, 2 mM glutamine, 0.05 mM 2-mercaptoethanol in a humidified chamber at 37° C., 5% CO 2 .
- Nb2-11 cells were washed twice with PBS to remove the growth media and then resuspended and incubated in Arrest Media containing Fischer's media with lactogen-free 10% horse serum and 1% fetal bovine serum, 2 mM glutamine, 0.05 mM 2-mercaptoethanol at 37 C, 5% CO 2 for 24 h.
- Nb2-11 cells were dispensed into a 96-well plate at a density of 5 ⁇ 10 4 cells/mL.
- hGH samples were sterile filtered and diluted at different concentrations in dilution medium (Fischer's media with lactogen-free 10% horse serum, 2 mM glutamine, 0.05 mM 2-mercaptoethanol and 2 mM HEPES).
- the diluted hGH samples were added to the plated cells in 6 replicates.
- the cells were then incubated for 72 hours in a humidified chamber at 37° C. with 5% CO 2 . After incubating for 72 hours, MTS reagent was added to each plate as a colorimetric indicator of cell density.
- the reduced by-product of MTS was measured calorimetrically at an absorbance of 490 nm using an ELISA Plate.
- Nb2-11 cells Prior to addition of the MTS, Nb2-11 cells, maintained separately under normal growth conditions, were dispensed at known cell densities into reserved empty wells on each plate were used to generate a standard curve. Using a linear regression analysis of the standard curve, the cell density at each sample concentration was interpolated from the average of the 6 replicates.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Endocrinology (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Zoology (AREA)
- Genetics & Genomics (AREA)
- General Health & Medical Sciences (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Medicinal Chemistry (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- Wood Science & Technology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- General Engineering & Computer Science (AREA)
- Biotechnology (AREA)
- Biomedical Technology (AREA)
- Gastroenterology & Hepatology (AREA)
- Biophysics (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Toxicology (AREA)
- Physics & Mathematics (AREA)
- Epidemiology (AREA)
- Plant Pathology (AREA)
- Microbiology (AREA)
- Immunology (AREA)
- Diabetes (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US11/402,105 US20070154992A1 (en) | 2005-04-08 | 2006-04-10 | Compositions and methods for the preparation of protease resistant human growth hormone glycosylation mutants |
Applications Claiming Priority (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US66973605P | 2005-04-08 | 2005-04-08 | |
US71040105P | 2005-08-22 | 2005-08-22 | |
US72003005P | 2005-09-23 | 2005-09-23 | |
US11/402,105 US20070154992A1 (en) | 2005-04-08 | 2006-04-10 | Compositions and methods for the preparation of protease resistant human growth hormone glycosylation mutants |
Publications (1)
Publication Number | Publication Date |
---|---|
US20070154992A1 true US20070154992A1 (en) | 2007-07-05 |
Family
ID=37397043
Family Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US11/402,105 Abandoned US20070154992A1 (en) | 2005-04-08 | 2006-04-10 | Compositions and methods for the preparation of protease resistant human growth hormone glycosylation mutants |
US11/910,958 Expired - Fee Related US9187546B2 (en) | 2005-04-08 | 2006-04-10 | Compositions and methods for the preparation of protease resistant human growth hormone glycosylation mutants |
Family Applications After (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US11/910,958 Expired - Fee Related US9187546B2 (en) | 2005-04-08 | 2006-04-10 | Compositions and methods for the preparation of protease resistant human growth hormone glycosylation mutants |
Country Status (3)
Country | Link |
---|---|
US (2) | US20070154992A1 (de) |
EP (2) | EP1871795A4 (de) |
WO (1) | WO2006121569A2 (de) |
Cited By (35)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20080102083A1 (en) * | 2003-05-09 | 2008-05-01 | Neose Technologies, Inc. | Compositions and Methods for the Preparation of Human Growth Hormone Glycosylation Mutants |
US20090000924A1 (en) * | 2007-06-29 | 2009-01-01 | Harley-Davidson Motor Company Group, Inc. | Integrated ignition and key switch |
US20090292110A1 (en) * | 2004-07-23 | 2009-11-26 | Defrees Shawn | Enzymatic modification of glycopeptides |
US7795210B2 (en) | 2001-10-10 | 2010-09-14 | Novo Nordisk A/S | Protein remodeling methods and proteins/peptides produced by the methods |
US7803777B2 (en) | 2003-03-14 | 2010-09-28 | Biogenerix Ag | Branched water-soluble polymers and their conjugates |
US7842661B2 (en) | 2003-11-24 | 2010-11-30 | Novo Nordisk A/S | Glycopegylated erythropoietin formulations |
US7956032B2 (en) | 2003-12-03 | 2011-06-07 | Novo Nordisk A/S | Glycopegylated granulocyte colony stimulating factor |
US8008252B2 (en) | 2001-10-10 | 2011-08-30 | Novo Nordisk A/S | Factor VII: remodeling and glycoconjugation of Factor VII |
US8053410B2 (en) | 2002-06-21 | 2011-11-08 | Novo Nordisk Health Care A/G | Pegylated factor VII glycoforms |
US8063015B2 (en) | 2003-04-09 | 2011-11-22 | Novo Nordisk A/S | Glycopegylation methods and proteins/peptides produced by the methods |
US8076292B2 (en) | 2001-10-10 | 2011-12-13 | Novo Nordisk A/S | Factor VIII: remodeling and glycoconjugation of factor VIII |
US8207112B2 (en) | 2007-08-29 | 2012-06-26 | Biogenerix Ag | Liquid formulation of G-CSF conjugate |
US8268967B2 (en) | 2004-09-10 | 2012-09-18 | Novo Nordisk A/S | Glycopegylated interferon α |
US8361961B2 (en) | 2004-01-08 | 2013-01-29 | Biogenerix Ag | O-linked glycosylation of peptides |
US8404809B2 (en) | 2005-05-25 | 2013-03-26 | Novo Nordisk A/S | Glycopegylated factor IX |
US8632770B2 (en) | 2003-12-03 | 2014-01-21 | Novo Nordisk A/S | Glycopegylated factor IX |
US8633157B2 (en) | 2003-11-24 | 2014-01-21 | Novo Nordisk A/S | Glycopegylated erythropoietin |
US8716239B2 (en) | 2001-10-10 | 2014-05-06 | Novo Nordisk A/S | Granulocyte colony stimulating factor: remodeling and glycoconjugation G-CSF |
US8716240B2 (en) | 2001-10-10 | 2014-05-06 | Novo Nordisk A/S | Erythropoietin: remodeling and glycoconjugation of erythropoietin |
US8791070B2 (en) | 2003-04-09 | 2014-07-29 | Novo Nordisk A/S | Glycopegylated factor IX |
US8791066B2 (en) | 2004-07-13 | 2014-07-29 | Novo Nordisk A/S | Branched PEG remodeling and glycosylation of glucagon-like peptide-1 [GLP-1] |
US20140248247A1 (en) * | 2011-10-18 | 2014-09-04 | Nestec S.A. | Composition for use in the promotion of healthy bone growth and/or in the prevention and/or treatment of bone disease |
US8841439B2 (en) | 2005-11-03 | 2014-09-23 | Novo Nordisk A/S | Nucleotide sugar purification using membranes |
US8911967B2 (en) | 2005-08-19 | 2014-12-16 | Novo Nordisk A/S | One pot desialylation and glycopegylation of therapeutic peptides |
US8916360B2 (en) | 2003-11-24 | 2014-12-23 | Novo Nordisk A/S | Glycopegylated erythropoietin |
US8969532B2 (en) | 2006-10-03 | 2015-03-03 | Novo Nordisk A/S | Methods for the purification of polypeptide conjugates comprising polyalkylene oxide using hydrophobic interaction chromatography |
US9005625B2 (en) | 2003-07-25 | 2015-04-14 | Novo Nordisk A/S | Antibody toxin conjugates |
US9029331B2 (en) | 2005-01-10 | 2015-05-12 | Novo Nordisk A/S | Glycopegylated granulocyte colony stimulating factor |
US9050304B2 (en) | 2007-04-03 | 2015-06-09 | Ratiopharm Gmbh | Methods of treatment using glycopegylated G-CSF |
US9150848B2 (en) | 2008-02-27 | 2015-10-06 | Novo Nordisk A/S | Conjugated factor VIII molecules |
US9187532B2 (en) | 2006-07-21 | 2015-11-17 | Novo Nordisk A/S | Glycosylation of peptides via O-linked glycosylation sequences |
US9187546B2 (en) | 2005-04-08 | 2015-11-17 | Novo Nordisk A/S | Compositions and methods for the preparation of protease resistant human growth hormone glycosylation mutants |
US9200049B2 (en) | 2004-10-29 | 2015-12-01 | Novo Nordisk A/S | Remodeling and glycopegylation of fibroblast growth factor (FGF) |
US9493499B2 (en) | 2007-06-12 | 2016-11-15 | Novo Nordisk A/S | Process for the production of purified cytidinemonophosphate-sialic acid-polyalkylene oxide (CMP-SA-PEG) as modified nucleotide sugars via anion exchange chromatography |
EP3820497A4 (de) * | 2018-07-11 | 2022-03-23 | Ohio University | Inhibitoren der wachstumshormonwirkung auf peptid-basis und verfahren zu deren verwendung |
Families Citing this family (8)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
AU2004293103C1 (en) * | 2003-11-24 | 2010-12-02 | Ratiopharm Gmbh | Glycopegylated erythropoietin |
KR101237884B1 (ko) * | 2003-12-03 | 2013-02-27 | 바이오제너릭스 에이지 | 글리코 peg화 과립구 콜로니 자극인자 |
JP2008526864A (ja) * | 2005-01-06 | 2008-07-24 | ネオス テクノロジーズ インコーポレイテッド | 糖断片を用いる糖結合 |
US20110003744A1 (en) * | 2005-05-25 | 2011-01-06 | Novo Nordisk A/S | Glycopegylated Erythropoietin Formulations |
KR101556248B1 (ko) * | 2006-10-04 | 2015-09-30 | 노보 노르디스크 에이/에스 | 글리세롤이 연결된 페길화된 당 및 글리코펩티드 |
JP5647899B2 (ja) * | 2008-01-08 | 2015-01-07 | ラツィオファルム ゲーエムベーハーratiopharm GmbH | オリゴサッカリルトランスフェラーゼを使用するポリペプチドの複合糖質化 |
CN102131825A (zh) * | 2008-06-27 | 2011-07-20 | 诺沃—诺迪斯克保健股份有限公司 | 具有延长的循环半衰期的n-糖基化的人生长激素 |
US20110105735A1 (en) * | 2009-10-29 | 2011-05-05 | Heather Desaire | Methods of producing and purifying proteins |
Citations (81)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4055635A (en) * | 1973-07-05 | 1977-10-25 | Beecham Group Limited | Fibrinolytic compositions |
US4088538A (en) * | 1975-05-30 | 1978-05-09 | Battelle Memorial Institute | Reversibly precipitable immobilized enzyme complex and a method for its use |
US4179337A (en) * | 1973-07-20 | 1979-12-18 | Davis Frank F | Non-immunogenic polypeptides |
US4385260A (en) * | 1975-09-09 | 1983-05-24 | Beckman Instruments, Inc. | Bargraph display |
US4412989A (en) * | 1981-06-10 | 1983-11-01 | Ajinomoto Company Incorporated | Oxygen carrier |
US4414147A (en) * | 1981-04-17 | 1983-11-08 | Massachusetts Institute Of Technology | Methods of decreasing the hydrophobicity of fibroblast and other interferons |
US4496689A (en) * | 1983-12-27 | 1985-01-29 | Miles Laboratories, Inc. | Covalently attached complex of alpha-1-proteinase inhibitor with a water soluble polymer |
US4565653A (en) * | 1984-03-30 | 1986-01-21 | Pfizer Inc. | Acyltripeptide immunostimulants |
US4806595A (en) * | 1985-08-12 | 1989-02-21 | Koken Co., Ltd. | Method of preparing antithrombogenic medical materials |
US4879236A (en) * | 1984-05-16 | 1989-11-07 | The Texas A&M University System | Method for producing a recombinant baculovirus expression vector |
US4925796A (en) * | 1986-03-07 | 1990-05-15 | Massachusetts Institute Of Technology | Method for enhancing glycoprotein stability |
US5147788A (en) * | 1988-05-06 | 1992-09-15 | Burroughs Wellcome Co. | Baculovirus vectors and methods of use |
US5153265A (en) * | 1988-01-20 | 1992-10-06 | Cetus Corporation | Conjugation of polymer to colony stimulating factor-1 |
US5154924A (en) * | 1989-09-07 | 1992-10-13 | Alkermes, Inc. | Transferrin receptor specific antibody-neuropharmaceutical agent conjugates |
US5169933A (en) * | 1988-08-15 | 1992-12-08 | Neorx Corporation | Covalently-linked complexes and methods for enhanced cytotoxicity and imaging |
US5182107A (en) * | 1989-09-07 | 1993-01-26 | Alkermes, Inc. | Transferrin receptor specific antibody-neuropharmaceutical or diagnostic agent conjugates |
US5194376A (en) * | 1989-02-28 | 1993-03-16 | University Of Ottawa | Baculovirus expression system capable of producing foreign gene proteins at high levels |
US5346696A (en) * | 1991-06-19 | 1994-09-13 | Korea Green Cross Corporation | Asialoglycoprotein - conjugated medicinal agent |
US5352670A (en) * | 1991-06-10 | 1994-10-04 | Alberta Research Council | Methods for the enzymatic synthesis of alpha-sialylated oligosaccharide glycosides |
US5369017A (en) * | 1994-02-04 | 1994-11-29 | The Scripps Research Institute | Process for solid phase glycopeptide synthesis |
US5374541A (en) * | 1993-05-04 | 1994-12-20 | The Scripps Research Institute | Combined use of β-galactosidase and sialyltransferase coupled with in situ regeneration of CMP-sialic acid for one pot synthesis of oligosaccharides |
US5405753A (en) * | 1990-03-26 | 1995-04-11 | Brossmer; Reinhard | CMP-activated, fluorescing sialic acids, as well as processes for their preparation |
US5432059A (en) * | 1994-04-01 | 1995-07-11 | Specialty Laboratories, Inc. | Assay for glycosylation deficiency disorders |
US5492841A (en) * | 1994-02-18 | 1996-02-20 | E. I. Du Pont De Nemours And Company | Quaternary ammonium immunogenic conjugates and immunoassay reagents |
US5527527A (en) * | 1989-09-07 | 1996-06-18 | Alkermes, Inc. | Transferrin receptor specific antibody-neuropharmaceutical agent conjugates |
US5545553A (en) * | 1994-09-26 | 1996-08-13 | The Rockefeller University | Glycosyltransferases for biosynthesis of oligosaccharides, and genes encoding them |
US5605793A (en) * | 1994-02-17 | 1997-02-25 | Affymax Technologies N.V. | Methods for in vitro recombination |
US5614184A (en) * | 1992-07-28 | 1997-03-25 | New England Deaconess Hospital | Recombinant human erythropoietin mutants and therapeutic methods employing them |
US5621039A (en) * | 1993-06-08 | 1997-04-15 | Hallahan; Terrence W. | Factor IX- polymeric conjugates |
US5635603A (en) * | 1993-12-08 | 1997-06-03 | Immunomedics, Inc. | Preparation and use of immunoconjugates |
US5646113A (en) * | 1994-04-07 | 1997-07-08 | Genentech, Inc. | Treatment of partial growth hormone insensitivity syndrome |
US5672662A (en) * | 1995-07-07 | 1997-09-30 | Shearwater Polymers, Inc. | Poly(ethylene glycol) and related polymers monosubstituted with propionic or butanoic acids and functional derivatives thereof for biotechnical applications |
US5672683A (en) * | 1989-09-07 | 1997-09-30 | Alkermes, Inc. | Transferrin neuropharmaceutical agent fusion protein |
US5716812A (en) * | 1995-12-12 | 1998-02-10 | The University Of British Columbia | Methods and compositions for synthesis of oligosaccharides, and the products formed thereby |
US5728554A (en) * | 1995-04-11 | 1998-03-17 | Cytel Corporation | Enzymatic synthesis of glycosidic linkages |
US5834251A (en) * | 1994-12-30 | 1998-11-10 | Alko Group Ltd. | Methods of modifying carbohydrate moieties |
US5837458A (en) * | 1994-02-17 | 1998-11-17 | Maxygen, Inc. | Methods and compositions for cellular and metabolic engineering |
US5849535A (en) * | 1995-09-21 | 1998-12-15 | Genentech, Inc. | Human growth hormone variants |
US5876980A (en) * | 1995-04-11 | 1999-03-02 | Cytel Corporation | Enzymatic synthesis of oligosaccharides |
US5922577A (en) * | 1995-04-11 | 1999-07-13 | Cytel Corporation | Enzymatic synthesis of glycosidic linkages |
US5932462A (en) * | 1995-01-10 | 1999-08-03 | Shearwater Polymers, Inc. | Multiarmed, monofunctional, polymer for coupling to molecules and surfaces |
US5945314A (en) * | 1997-03-31 | 1999-08-31 | Abbott Laboratories | Process for synthesizing oligosaccharides |
US5977307A (en) * | 1989-09-07 | 1999-11-02 | Alkermes, Inc. | Transferrin receptor specific ligand-neuropharmaceutical agent fusion proteins |
US6015555A (en) * | 1995-05-19 | 2000-01-18 | Alkermes, Inc. | Transferrin receptor specific antibody-neuropharmaceutical or diagnostic agent conjugates |
US6030815A (en) * | 1995-04-11 | 2000-02-29 | Neose Technologies, Inc. | Enzymatic synthesis of oligosaccharides |
US6037452A (en) * | 1992-04-10 | 2000-03-14 | Alpha Therapeutic Corporation | Poly(alkylene oxide)-Factor VIII or Factor IX conjugate |
US6087325A (en) * | 1996-10-15 | 2000-07-11 | The Liposome Company, Inc. | Peptide-lipid conjugates |
US6096512A (en) * | 1993-05-14 | 2000-08-01 | Pharmacia & Upjohn Company | Cloned DNA encoding a UDP-GalNAc: Polypeptide, N-acetylgalactosaminyltransferase |
US6166183A (en) * | 1992-11-30 | 2000-12-26 | Kirin-Amgen, Inc. | Chemically-modified G-CSF |
US6183738B1 (en) * | 1997-05-12 | 2001-02-06 | Phoenix Pharamacologics, Inc. | Modified arginine deiminase |
US6261805B1 (en) * | 1999-07-15 | 2001-07-17 | Boyce Thompson Institute For Plant Research, Inc. | Sialyiation of N-linked glycoproteins in the baculovirus expression vector system |
US6362254B2 (en) * | 1998-03-12 | 2002-03-26 | Shearwater Corporation | Poly(ethylene glycol) derivatives with proximal reactive groups |
US6376604B2 (en) * | 1999-12-22 | 2002-04-23 | Shearwater Corporation | Method for the preparation of 1-benzotriazolylcarbonate esters of poly(ethylene glycol) |
US6399336B1 (en) * | 1997-01-16 | 2002-06-04 | Neose Technologies, Inc. | Practical in vitro sialylation of recombinant glycoproteins |
US6440703B1 (en) * | 1997-12-01 | 2002-08-27 | Neose Technologies, Inc. | Enzymatic synthesis of gangliosides |
US20020137134A1 (en) * | 2000-06-28 | 2002-09-26 | Gerngross Tillman U. | Methods for producing modified glycoproteins |
US20020150981A1 (en) * | 1999-09-14 | 2002-10-17 | Novazyme Pharmaceuticals, Inc. | Methods for producing highly phosphorylated lysosomal hydrolases |
US20020168323A1 (en) * | 2001-05-11 | 2002-11-14 | Igor Gonda | Optimization of the molecular properties and formulation of proteins delivered by inhalation |
US20030027257A1 (en) * | 1997-08-21 | 2003-02-06 | University Technologies International, Inc. | Sequences for improving the efficiency of secretion of non-secreted protein from mammalian and insect cells |
US20030040037A1 (en) * | 2000-05-12 | 2003-02-27 | Neose Technologies, Inc. | In vitro modification of glycosylation patterns of recombinant glycopeptides |
US6531121B2 (en) * | 2000-12-29 | 2003-03-11 | The Kenneth S. Warren Institute, Inc. | Protection and enhancement of erythropoietin-responsive cells, tissues and organs |
US6555346B1 (en) * | 1997-12-18 | 2003-04-29 | Stichting Instituut Voor Dierhouderij En Diergezondheid | Protein expression in baculovirus vector expression systems |
US20030207406A1 (en) * | 1995-06-07 | 2003-11-06 | Neose Technologies, Inc. | Method of transferring at least two saccharide units with a polyglycosyltransferase |
US6692931B1 (en) * | 1998-11-16 | 2004-02-17 | Werner Reutter | Recombinant glycoproteins, method for the production thereof, medicaments containing said glycoproteins and use thereof |
US20040063911A1 (en) * | 2001-10-10 | 2004-04-01 | Neose Technologies, Inc. | Protein remodeling methods and proteins/peptides produced by the methods |
US20040126838A1 (en) * | 2001-11-28 | 2004-07-01 | Neose Technologies, Inc. | Follicle stimulating hormone: remodeling and glycoconjugation of FSH |
US20040132640A1 (en) * | 2001-10-10 | 2004-07-08 | Neose Technologies, Inc. | Glycopegylation methods and proteins/peptides produced by the methods |
US20040136955A1 (en) * | 2002-09-05 | 2004-07-15 | Barker Nicholas P | Modified asialo-interferons and uses thereof |
US20040142856A1 (en) * | 2001-10-10 | 2004-07-22 | Neose Technologies, Inc. | Glycoconjugation methods and proteins/peptides produced by the methods |
US20050118672A1 (en) * | 2001-11-28 | 2005-06-02 | Defrees Shawn | Glycopeptide remodeling using amidases |
US20050143292A1 (en) * | 2003-11-24 | 2005-06-30 | Defrees Shawn | Glycopegylated erythropoietin |
US20060024286A1 (en) * | 2004-08-02 | 2006-02-02 | Paul Glidden | Variants of tRNA synthetase fragments and uses thereof |
US20060111279A1 (en) * | 2003-11-24 | 2006-05-25 | Neose Technologies, Inc. | Glycopegylated erythropoietin |
US7125843B2 (en) * | 2001-10-19 | 2006-10-24 | Neose Technologies, Inc. | Glycoconjugates including more than one peptide |
US7138371B2 (en) * | 2001-10-10 | 2006-11-21 | Neose Technologies, Inc | Remodeling and glycoconjugation of peptides |
US20070027068A1 (en) * | 2001-10-10 | 2007-02-01 | Defrees Shawn | Erythropoietin: remodeling and glycoconjugation of erythropoietin |
US7202208B2 (en) * | 2000-05-15 | 2007-04-10 | Hoffman-La Roche Inc. | Erythropoietin composition |
US7214660B2 (en) * | 2001-10-10 | 2007-05-08 | Neose Technologies, Inc. | Erythropoietin: remodeling and glycoconjugation of erythropoietin |
US20070105755A1 (en) * | 2005-10-26 | 2007-05-10 | Neose Technologies, Inc. | One pot desialylation and glycopegylation of therapeutic peptides |
US20080015142A1 (en) * | 2003-12-03 | 2008-01-17 | Defrees Shawn | Glycopegylated Follicle Stimulating Hormone |
US7338933B2 (en) * | 2004-01-08 | 2008-03-04 | Neose Technologies, Inc. | O-linked glycosylation of peptides |
Family Cites Families (343)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
GB1451798A (en) | 1973-08-02 | 1976-10-06 | Ici Ltd | Prostanoic acid derivatives |
US4235871A (en) | 1978-02-24 | 1980-11-25 | Papahadjopoulos Demetrios P | Method of encapsulating biologically active materials in lipid vesicles |
US4898830A (en) | 1979-07-05 | 1990-02-06 | Genentech, Inc. | Human growth hormone DNA |
US4342832A (en) | 1979-07-05 | 1982-08-03 | Genentech, Inc. | Method of constructing a replicable cloning vehicle having quasi-synthetic genes |
US4376110A (en) | 1980-08-04 | 1983-03-08 | Hybritech, Incorporated | Immunometric assays using monoclonal antibodies |
US4366241A (en) | 1980-08-07 | 1982-12-28 | Syva Company | Concentrating zone method in heterogeneous immunoassays |
US4517288A (en) | 1981-01-23 | 1985-05-14 | American Hospital Supply Corp. | Solid phase system for ligand assay |
US4451566A (en) * | 1981-12-04 | 1984-05-29 | Spencer Donald B | Methods and apparatus for enzymatically producing ethanol |
US4522811A (en) | 1982-07-08 | 1985-06-11 | Syntex (U.S.A.) Inc. | Serial injection of muramyldipeptides and liposomes enhances the anti-infective activity of muramyldipeptides |
US4438253A (en) * | 1982-11-12 | 1984-03-20 | American Cyanamid Company | Poly(glycolic acid)/poly(alkylene glycol) block copolymers and method of manufacturing the same |
US5618697A (en) | 1982-12-10 | 1997-04-08 | Novo Nordisk A/S | Process for preparing a desired protein |
US4673641A (en) | 1982-12-16 | 1987-06-16 | Molecular Genetics Research And Development Limited Partnership | Co-aggregate purification of proteins |
US4501728A (en) | 1983-01-06 | 1985-02-26 | Technology Unlimited, Inc. | Masking of liposomes from RES recognition |
US4603044A (en) | 1983-01-06 | 1986-07-29 | Technology Unlimited, Inc. | Hepatocyte Directed Vesicle delivery system |
DE3308806A1 (de) | 1983-03-12 | 1984-09-13 | Basf Ag, 6700 Ludwigshafen | Fungizide mittel, substituierte glucopyranosylamine und verfahren zur bekaempfung von pilzen |
JPS59172425A (ja) | 1983-03-18 | 1984-09-29 | Nippon Chemiphar Co Ltd | 新規な血液凝固因子誘導体およびその製造法ならびにそれを含有する血液凝固促進剤 |
BG49718A3 (en) | 1983-07-15 | 1992-01-15 | Bio Technology General Corp | Method for preparing of polypeptid with superoxiddismutasne activitty |
US4761371A (en) | 1985-02-12 | 1988-08-02 | Genentech, Inc. | Insulin receptor |
US4675414A (en) * | 1985-03-08 | 1987-06-23 | The United States Of America As Represented By The Secretary Of The Navy | Maleimidomethyl-carbonate polyethers |
US4683195A (en) | 1986-01-30 | 1987-07-28 | Cetus Corporation | Process for amplifying, detecting, and/or-cloning nucleic acid sequences |
US4683202A (en) | 1985-03-28 | 1987-07-28 | Cetus Corporation | Process for amplifying nucleic acid sequences |
GR860984B (en) | 1985-04-17 | 1986-08-18 | Zymogenetics Inc | Expression of factor vii and ix activities in mammalian cells |
JP2524586B2 (ja) | 1985-06-26 | 1996-08-14 | シタス コーポレイション | ポリマ−接合を利用する医薬組成物用蛋白質の可溶化 |
US5206344A (en) * | 1985-06-26 | 1993-04-27 | Cetus Oncology Corporation | Interleukin-2 muteins and polymer conjugation thereof |
SE451849B (sv) * | 1985-12-11 | 1987-11-02 | Svenska Sockerfabriks Ab | Sett att syntetisera glykosidiska bindningar samt anvendning av pa detta sett erhallna produkter |
CA1291031C (en) | 1985-12-23 | 1991-10-22 | Nikolaas C.J. De Jaeger | Method for the detection of specific binding agents and their correspondingbindable substances |
IT1213029B (it) | 1986-01-30 | 1989-12-07 | Bracco Ind Chimica Spa | Chelati di ioni metallici paramagnetici. |
US4767702A (en) | 1986-02-06 | 1988-08-30 | Cohenford Menashi A | Paper strip assay for neisseria species |
US5272066A (en) | 1986-03-07 | 1993-12-21 | Massachusetts Institute Of Technology | Synthetic method for enhancing glycoprotein stability |
JPS63502716A (ja) | 1986-03-07 | 1988-10-13 | マサチューセッツ・インステチュート・オブ・テクノロジー | 糖タンパク安定性の強化方法 |
US4902505A (en) | 1986-07-30 | 1990-02-20 | Alkermes | Chimeric peptides for neuropeptide delivery through the blood-brain barrier |
US5075109A (en) | 1986-10-24 | 1991-12-24 | Southern Research Institute | Method of potentiating an immune response |
US4837028A (en) | 1986-12-24 | 1989-06-06 | Liposome Technology, Inc. | Liposomes with enhanced circulation time |
IL82834A (en) | 1987-06-09 | 1990-11-05 | Yissum Res Dev Co | Biodegradable polymeric materials based on polyether glycols,processes for the preparation thereof and surgical artiicles made therefrom |
US4897268A (en) | 1987-08-03 | 1990-01-30 | Southern Research Institute | Drug delivery system and method of making the same |
US4847325A (en) | 1988-01-20 | 1989-07-11 | Cetus Corporation | Conjugation of polymer to colony stimulating factor-1 |
US5874261A (en) | 1988-09-02 | 1999-02-23 | The Trustees Of The University Of Pennsylvania | Method for the purification of glycosyltransferases |
US5079230A (en) | 1988-09-12 | 1992-01-07 | Pitman-Moore, Inc. | Stable bioactive somatotropins |
US5218092A (en) | 1988-09-29 | 1993-06-08 | Kyowa Hakko Kogyo Co., Ltd. | Modified granulocyte-colony stimulating factor polypeptide with added carbohydrate chains |
US5104651A (en) | 1988-12-16 | 1992-04-14 | Amgen Inc. | Stabilized hydrophobic protein formulations of g-csf |
US5047335A (en) | 1988-12-21 | 1991-09-10 | The Regents Of The University Of Calif. | Process for controlling intracellular glycosylation of proteins |
ATE135370T1 (de) | 1988-12-22 | 1996-03-15 | Kirin Amgen Inc | Chemisch modifizierte granulocytenkolonie erregender faktor |
ATE358176T1 (de) | 1988-12-23 | 2007-04-15 | Genentech Inc | Menschliche dnase |
KR910700264A (ko) | 1989-01-19 | 1991-03-14 | 로버트 에이. 아미테이지 | 소마토트로핀 유사물 |
WO1990008823A1 (en) | 1989-01-31 | 1990-08-09 | The Upjohn Company | Somatotropin analogs |
US4957773A (en) | 1989-02-13 | 1990-09-18 | Syracuse University | Deposition of boron-containing films from decaborane |
US5059535A (en) | 1989-04-12 | 1991-10-22 | Chembiomed, Ltd. | Process for the separation and purification of sialyl transferases |
US5122614A (en) | 1989-04-19 | 1992-06-16 | Enzon, Inc. | Active carbonates of polyalkylene oxides for modification of polypeptides |
US5324844A (en) | 1989-04-19 | 1994-06-28 | Enzon, Inc. | Active carbonates of polyalkylene oxides for modification of polypeptides |
EP0893439B1 (de) | 1989-04-19 | 2005-07-27 | Enzon, Inc. | Verfahren zum Herstellen von modifizierten Polypeptiden die eine Polypeptid und ein Polyalkylenoxid enthalten |
US5166322A (en) | 1989-04-21 | 1992-11-24 | Genetics Institute | Cysteine added variants of interleukin-3 and chemical modifications thereof |
US5342940A (en) | 1989-05-27 | 1994-08-30 | Sumitomo Pharmaceuticals Company, Limited | Polyethylene glycol derivatives, process for preparing the same |
US5032519A (en) | 1989-10-24 | 1991-07-16 | The Regents Of The Univ. Of California | Method for producing secretable glycosyltransferases and other Golgi processing enzymes |
US5312808A (en) | 1989-11-22 | 1994-05-17 | Enzon, Inc. | Fractionation of polyalkylene oxide-conjugated hemoglobin solutions |
IL96477A0 (en) | 1989-12-01 | 1991-08-16 | Amgen Inc | Megakaryocyte production |
SE465222C5 (sv) | 1989-12-15 | 1998-02-10 | Pharmacia & Upjohn Ab | Ett rekombinant, humant faktor VIII-derivat och förfarande för dess framställning |
US5324663A (en) | 1990-02-14 | 1994-06-28 | The Regents Of The University Of Michigan | Methods and products for the synthesis of oligosaccharide structures on glycoproteins, glycolipids, or as free molecules, and for the isolation of cloned genetic sequences that determine these structures |
US5595900A (en) * | 1990-02-14 | 1997-01-21 | The Regents Of The University Of Michigan | Methods and products for the synthesis of oligosaccharide structures on glycoproteins, glycolipids, or as free molecules, and for the isolation of cloned genetic sequences that determine these structures |
US5583042A (en) | 1990-04-16 | 1996-12-10 | Neose Pharmaceuticals, Inc. | Apparatus for the synthesis of saccharide compositions |
EP0481038B1 (de) * | 1990-04-16 | 2002-10-02 | The Trustees Of The University Of Pennsylvania | Saccharidzusammensetzungen, Verfahren und Apparate zu deren Synthese |
GB9107846D0 (en) | 1990-04-30 | 1991-05-29 | Ici Plc | Polypeptides |
US5951972A (en) * | 1990-05-04 | 1999-09-14 | American Cyanamid Company | Stabilization of somatotropins and other proteins by modification of cysteine residues |
US5399345A (en) * | 1990-05-08 | 1995-03-21 | Boehringer Mannheim, Gmbh | Muteins of the granulocyte colony stimulating factor |
US5219564A (en) | 1990-07-06 | 1993-06-15 | Enzon, Inc. | Poly(alkylene oxide) amino acid copolymers and drug carriers and charged copolymers based thereon |
CU22302A1 (es) | 1990-09-07 | 1995-01-31 | Cigb | Secuencia nucleotidica codificante para una proteina de la membrana externa de neisseria meningitidis y uso de dicha proteina en preparados vacunales |
AU650893B2 (en) | 1990-07-10 | 1994-07-07 | Boehringer Ingelheim International Gmbh | O-glycosylated alpha-2 interferon |
JP3051145B2 (ja) | 1990-08-28 | 2000-06-12 | 住友製薬株式会社 | 新規なポリエチレングリコール誘導体修飾ペプチド |
DE4028800A1 (de) | 1990-09-11 | 1992-03-12 | Behringwerke Ag | Gentechnische sialylierung von glykoproteinen |
US5410016A (en) | 1990-10-15 | 1995-04-25 | Board Of Regents, The University Of Texas System | Photopolymerizable biodegradable hydrogels as tissue contacting materials and controlled-release carriers |
US5529914A (en) | 1990-10-15 | 1996-06-25 | The Board Of Regents The Univeristy Of Texas System | Gels for encapsulation of biological materials |
US5164374A (en) | 1990-12-17 | 1992-11-17 | Monsanto Company | Use of oligosaccharides for treatment of arthritis |
US5861374A (en) * | 1991-02-28 | 1999-01-19 | Novo Nordisk A/S | Modified Factor VII |
US5788965A (en) | 1991-02-28 | 1998-08-04 | Novo Nordisk A/S | Modified factor VII |
US5833982A (en) | 1991-02-28 | 1998-11-10 | Zymogenetics, Inc. | Modified factor VII |
EP0575464B1 (de) | 1991-02-28 | 2004-08-11 | Zymogenetics, Inc. | Modifizierter faktor-vii |
JPH06506217A (ja) | 1991-03-18 | 1994-07-14 | エンゾン,インコーポレーテッド | ポリペプチドまたはグリコポリペプチドとポリマーとのヒドラジン含有結合体 |
WO1992016640A1 (en) | 1991-03-18 | 1992-10-01 | The Scripps Research Institute | Oligosaccharide enzyme substrates and inhibitors: methods and compositions |
US5278299A (en) * | 1991-03-18 | 1994-01-11 | Scripps Clinic And Research Foundation | Method and composition for synthesizing sialylated glycosyl compounds |
US5212075A (en) | 1991-04-15 | 1993-05-18 | The Regents Of The University Of California | Compositions and methods for introducing effectors to pathogens and cells |
EP0586549B1 (de) | 1991-05-10 | 2000-09-20 | Genentech, Inc. | Auswählen von agonisten und antagonisten von liganden |
GB2256197B (en) | 1991-05-31 | 1995-11-22 | Ciba Geigy Ag | Yeast as host for expression of heterologous glycosyl transferase enzymes |
SE9201544L (sv) | 1991-05-31 | 1992-12-01 | Ciba Geigy Ag | Saett att framstaella glykosyltransferaser |
US5374655A (en) | 1991-06-10 | 1994-12-20 | Alberta Research Council | Methods for the synthesis of monofucosylated oligosaccharides terminating in di-N-acetyllactosaminyl structures |
US5281698A (en) * | 1991-07-23 | 1994-01-25 | Cetus Oncology Corporation | Preparation of an activated polymer ester for protein conjugation |
EP0863154A1 (de) | 1991-10-12 | 1998-09-09 | The Regents Of The University Of California | Verwendung von Thiol-Redox-Proteinen zur Reduktion des intramolekularen Disulfid-Bindung bei Proteinen, zur Besserung der Qualität der Getreidenprodukte, des Teigs und der gebackenen Ware |
US6319695B1 (en) | 1991-10-15 | 2001-11-20 | The Scripps Research Insitute | Production of fucosylated carbohydrates by enzymatic fucosylation synthesis of sugar nucleotides; and in situ regeneration of GDP-fucose |
EP0611306B1 (de) | 1991-11-08 | 1998-07-08 | Somatogen, Inc. | Hämoglobine als arzneimittelabgabesystem |
US5384249A (en) * | 1991-12-17 | 1995-01-24 | Kyowa Hakko Kogyo Co., Ltd. | α2→3 sialyltransferase |
IT1260468B (it) | 1992-01-29 | 1996-04-09 | Metodo per mantenere l'attivita' di enzimi proteolitici modificati con polietilenglicole | |
HU219260B (en) | 1992-03-09 | 2001-03-28 | Cytel Corp | Recombinant polypeptid with sialyltransferase activity, dna molecule coding thereof and vectors |
US5858751A (en) | 1992-03-09 | 1999-01-12 | The Regents Of The University Of California | Compositions and methods for producing sialyltransferases |
US5962294A (en) | 1992-03-09 | 1999-10-05 | The Regents Of The University Of California | Compositions and methods for the identification and synthesis of sialyltransferases |
WO1993018787A1 (en) | 1992-03-25 | 1993-09-30 | New York University | Trans-sialidase and methods of use and making thereof |
JPH0686684A (ja) | 1992-05-26 | 1994-03-29 | Monsanto Co | シアロ抱合体の合成 |
EP0664710A4 (de) * | 1992-08-07 | 1998-09-30 | Progenics Pharm Inc | IMMUNOKONJUGATE BESTEHEND AUS EINEM NICHT-PEPTIDYLEN TEIL UND EINEM CD4-GAMMA2- ODER CD4-IgG2 TEIL, UND VERWENDUNGEN DAVON. |
WO1994004193A1 (en) | 1992-08-21 | 1994-03-03 | Enzon, Inc. | Novel attachment of polyalkylene oxides to bio-effecting substances |
JP3979678B2 (ja) | 1992-08-24 | 2007-09-19 | サントリー株式会社 | 新規糖転移酵素及びそれをコードする遺伝子並びに該酵素の製造方法 |
WO1994005332A2 (en) | 1992-09-01 | 1994-03-17 | Berlex Laboratories, Inc. | Glycolation of glycosylated macromolecules |
US5308460A (en) * | 1992-10-30 | 1994-05-03 | Glyko, Incorporated | Rapid synthesis and analysis of carbohydrates |
US6361977B1 (en) * | 1992-11-24 | 2002-03-26 | S. Christopher Bauer | Methods of using multivariant IL-3 hematopoiesis fusion protein |
CA2110543A1 (en) | 1992-12-09 | 1994-06-10 | David E. Wright | Peg hydrazone and peg oxime linkage forming reagents and protein derivatives thereof |
NO934477L (no) | 1992-12-09 | 1994-06-10 | Ortho Pharma Corp | PEG hydrazon- og PEG oksim-bindingdannende reagenser og proteinderivater derav |
NZ250375A (en) | 1992-12-09 | 1995-07-26 | Ortho Pharma Corp | Peg hydrazone and peg oxime linkage forming reagents and protein derivatives |
AU6029594A (en) | 1993-01-15 | 1994-08-15 | Enzon, Inc. | Factor viii - polymeric conjugates |
US5349001A (en) | 1993-01-19 | 1994-09-20 | Enzon, Inc. | Cyclic imide thione activated polyalkylene oxides |
US5321095A (en) | 1993-02-02 | 1994-06-14 | Enzon, Inc. | Azlactone activated polyalkylene oxides |
US5202413A (en) | 1993-02-16 | 1993-04-13 | E. I. Du Pont De Nemours And Company | Alternating (ABA)N polylactide block copolymers |
US6180134B1 (en) | 1993-03-23 | 2001-01-30 | Sequus Pharmaceuticals, Inc. | Enhanced ciruclation effector composition and method |
DE69434749T2 (de) | 1993-03-29 | 2007-04-26 | Kyowa Hakko Kogyo Co., Ltd. | Alpha-1,3-Fucosyltransferase |
US5409817A (en) * | 1993-05-04 | 1995-04-25 | Cytel, Inc. | Use of trans-sialidase and sialyltransferase for synthesis of sialylα2→3βgalactosides |
CN1125449A (zh) | 1993-05-14 | 1996-06-26 | 萨依特尔有限公司 | 作为细胞粘附抑制剂的唾液基Lex类似物 |
ATE210458T1 (de) | 1993-05-21 | 2001-12-15 | Zymogenetics Inc | Modifizierter faktor vii zur hemmung der vaskulären restenosis und thrombozytenablagerung |
WO1994028024A1 (en) | 1993-06-01 | 1994-12-08 | Enzon, Inc. | Carbohydrate-modified polymer conjugates with erythropoietic activity |
JPH09503905A (ja) | 1993-07-15 | 1997-04-22 | ネオゼ ファーマシューティカルス | 糖組成物の合成方法 |
DE4325317C2 (de) | 1993-07-29 | 1998-05-20 | Univ Dresden Tech | Verfahren zur radioaktiven Markierung von Immunglobulinen |
IL110669A (en) | 1993-08-17 | 2008-11-26 | Kirin Amgen Inc | Erythropoietin analogs |
JPH0770195A (ja) * | 1993-08-23 | 1995-03-14 | Yutaka Mizushima | 糖修飾インターフェロン |
US6485930B1 (en) | 1993-09-15 | 2002-11-26 | The Scripps Research Institute | Mannosyl transfer with regeneration of GDP-mannose |
DE69432231T2 (de) | 1993-09-22 | 2004-02-05 | Ajinomoto Co., Inc. | Peptide mit antithrombotischer aktivität und verfahren zu ihrer herstellung |
US5874075A (en) * | 1993-10-06 | 1999-02-23 | Amgen Inc. | Stable protein: phospholipid compositions and methods |
US5919455A (en) | 1993-10-27 | 1999-07-06 | Enzon, Inc. | Non-antigenic branched polymer conjugates |
US5643575A (en) | 1993-10-27 | 1997-07-01 | Enzon, Inc. | Non-antigenic branched polymer conjugates |
US5446090A (en) | 1993-11-12 | 1995-08-29 | Shearwater Polymers, Inc. | Isolatable, water soluble, and hydrolytically stable active sulfones of poly(ethylene glycol) and related polymers for modification of surfaces and molecules |
JP3516272B2 (ja) | 1994-02-10 | 2004-04-05 | 株式会社成和化成 | 化粧品基材 |
JPH08510761A (ja) * | 1994-03-07 | 1996-11-12 | ザ・ダウ・ケミカル・カンパニー | 生物活性及び/又はターゲテッドデンドリマー複合体 |
IL113010A (en) | 1994-03-31 | 1999-10-28 | Pharmacia & Upjohn Ab | Pharmaceutical formulation comprising factor viii with an activity of at least 500iu/ml and an enhancer for improved subcutaneous intramuscular or intradermal administration |
US5629384A (en) * | 1994-05-17 | 1997-05-13 | Consiglio Nazionale Delle Ricerche | Polymers of N-acryloylmorpholine activated at one end and conjugates with bioactive materials and surfaces |
EP0785276A4 (de) | 1994-09-29 | 2002-01-09 | Ajinomoto Kk | Modifizierung eines peptids und eines proteins |
US5824784A (en) * | 1994-10-12 | 1998-10-20 | Amgen Inc. | N-terminally chemically modified protein compositions and methods |
IL116730A0 (en) | 1995-01-13 | 1996-05-14 | Amgen Inc | Chemically modified interferon |
SE9501285L (sv) | 1995-04-06 | 1996-10-07 | Johanna Ljung | Förfarande för framställning av biologiskt aktiva proteiner |
JPH11503328A (ja) | 1995-04-11 | 1999-03-26 | サイテル コーポレイション | オリゴ糖類の改善された酵素合成法 |
US5695760A (en) | 1995-04-24 | 1997-12-09 | Boehringer Inglehiem Pharmaceuticals, Inc. | Modified anti-ICAM-1 antibodies and their use in the treatment of inflammation |
EP0833663A4 (de) | 1995-05-15 | 1999-04-07 | Constantin A Bona | Karbohydratmediierte kuppelung von peptiden an immunglobulinen |
US5824864A (en) | 1995-05-25 | 1998-10-20 | Pioneer Hi-Bred International, Inc. | Maize gene and protein for insect control |
US5858752A (en) | 1995-06-07 | 1999-01-12 | The General Hospital Corporation | Fucosyltransferase genes and uses thereof |
WO1996040731A1 (en) | 1995-06-07 | 1996-12-19 | Mount Sinai School Of Medicine Of The City University Of New York | Pegylated modified proteins |
US6251864B1 (en) | 1995-06-07 | 2001-06-26 | Glaxo Group Limited | Peptides and compounds that bind to a receptor |
KR19990035963A (ko) | 1995-07-27 | 1999-05-25 | 마이클 제이. 켈리 | 에이에스에이 사이징을 위한 촉진제로서의 합성 양이온성중합체 |
US5770420A (en) | 1995-09-08 | 1998-06-23 | The Regents Of The University Of Michigan | Methods and products for the synthesis of oligosaccharide structures on glycoproteins, glycolipids, or as free molecules, and for the isolation of cloned genetic sequences that determine these structures |
SE9503380D0 (sv) | 1995-09-29 | 1995-09-29 | Pharmacia Ab | Protein derivatives |
US5965408A (en) | 1996-07-09 | 1999-10-12 | Diversa Corporation | Method of DNA reassembly by interrupting synthesis |
WO1997021822A2 (en) | 1995-12-12 | 1997-06-19 | The University Of British Columbia | Methods and compositions for synthesis of oligosaccharides using mutant glycosidase enzymes |
CA2165041C (en) | 1995-12-12 | 2005-07-05 | The University Of British Columbia | Methods and compositions for synthesis of oligosaccharides, and the products formed thereby |
JP3065925B2 (ja) | 1996-01-30 | 2000-07-17 | 日清製油株式会社 | 活性酸素種消去剤及び退色防止剤 |
ATE216723T1 (de) | 1996-02-13 | 2002-05-15 | Japan Chem Res | Hormones de croissance humaines mutantes et leur utilisation |
DE69738368T2 (de) | 1996-03-08 | 2008-12-04 | The Regents Of The University Of Michigan, Ann Arbor | MURINE alpha(1,3)-FUCOSYLTRANSFERASE (Fuc-TVII) |
KR20000029673A (ko) | 1996-08-02 | 2000-05-25 | 오르토-맥네일 파마슈티칼, 인코퍼레이티드 | 단일의공유결합된n-말단수용성폴리머를갖는폴리펩티드 |
US6495365B1 (en) | 1996-08-13 | 2002-12-17 | Fujisawa Pharmaceutical Co., Ltd. | Hematopoietic stem cell proliferating agents |
US20020064546A1 (en) | 1996-09-13 | 2002-05-30 | J. Milton Harris | Degradable poly(ethylene glycol) hydrogels with controlled half-life and precursors therefor |
NZ335203A (en) | 1996-10-10 | 2000-10-27 | Neose Technologies Inc | Carbohydrate, purification using ultrafiltration, reverse osmosis and nanofiltration |
IL129843A0 (en) | 1996-11-08 | 2000-02-29 | Cytel Corp | Improved expression vectors |
EP0921817B1 (de) | 1997-01-29 | 2001-03-28 | PolyMASC Pharmaceuticals plc | Pegylationsverfahren |
DE19709787A1 (de) | 1997-03-11 | 1998-09-17 | Bayer Ag | Oligosaccaride und deren Derivate sowie ein chemo-enzymatisches Verfahren zu deren Herstellung |
CA2288992C (en) | 1997-04-30 | 2012-06-12 | Enzon, Inc. | Single-chain antigen-binding proteins capable of glycosylation, production and uses thereof |
JPH10307356A (ja) | 1997-05-08 | 1998-11-17 | Konica Corp | ハロゲン化銀乳剤およびそれを用いたハロゲン化銀写真感光材料 |
US6075134A (en) | 1997-05-15 | 2000-06-13 | The Regents Of The University Of California | Glycoconjugates and methods |
US6399337B1 (en) | 1997-06-06 | 2002-06-04 | The Governors Of The University Of Alberta | α1,3-fucosyltransferase |
PT994903E (pt) | 1997-06-24 | 2005-10-31 | Genentech Inc | Metodos e composicoes para glicoproteinas galactosiladas |
AU8269898A (en) | 1997-06-27 | 1999-01-19 | Regents Of The University Of California, The | Drug targeting of a peptide radiopharmaceutical through the primate blood-brain barrier in vivo with a monoclonal antibody to the human insulin receptor |
WO1999013063A1 (en) | 1997-09-09 | 1999-03-18 | Nycomed Imaging As | Factor vii fragments and analogs thereof and their use in the treatment of blood clottng disorders |
WO1999022764A1 (en) | 1997-10-31 | 1999-05-14 | Genentech, Inc. | Methods and compositions comprising glycoprotein glycoforms |
US6168937B1 (en) | 1997-12-08 | 2001-01-02 | Alan D. Elbein | Purified β1,2-xylosyltransferase and uses thereof |
US7244601B2 (en) | 1997-12-15 | 2007-07-17 | National Research Council Of Canada | Fusion proteins for use in enzymatic synthesis of oligosaccharides |
US6362276B1 (en) | 1998-01-07 | 2002-03-26 | Debio Recherche Pharmaceutique S.A. | Degradable heterobifunctional poly(ethylene glycol) acrylates and gels and conjugates derived therefrom |
AU2559799A (en) | 1998-01-22 | 1999-08-09 | Genentech Inc. | Antibody fragment-polymer conjugates and humanized anti-il-8 monoclonal antibodies and uses of same |
US6689604B1 (en) | 1998-03-20 | 2004-02-10 | National Research Council Of Canada | Lipopolysaccharide α-2,3 sialyltransferase of Campylobacter jejuni and its uses |
WO1999048515A1 (en) | 1998-03-25 | 1999-09-30 | Sloan-Kettering Institute For Cancer Research | Trimeric antigenic o-linked glycopeptide conjugates, methods of preparation and uses thereof |
WO1999054342A1 (en) | 1998-04-20 | 1999-10-28 | Pablo Umana | Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity |
DE69925830T2 (de) | 1998-04-28 | 2006-05-04 | Applied Research Systems Ars Holding N.V. | Peg-lhrh analog konjugate |
AU731758B2 (en) | 1998-07-08 | 2001-04-05 | Mitsui Chemicals, Inc. | Method for secretory production of human growth hormone |
US20030166525A1 (en) | 1998-07-23 | 2003-09-04 | Hoffmann James Arthur | FSH Formulation |
EE04967B1 (et) | 1998-10-16 | 2008-02-15 | Biogen, Incorporated | Glkoslitud interferoon-beeta, selle kasutamineja seda sisaldav farmatseutiline kompositsioon, meetod interferoon-beeta-1a aktiivsuse pikendamiseks ja leiutisekohase valgu valmistamiseks |
US7304150B1 (en) | 1998-10-23 | 2007-12-04 | Amgen Inc. | Methods and compositions for the prevention and treatment of anemia |
JP2002531067A (ja) | 1998-10-30 | 2002-09-24 | ノボザイムス アクティーゼルスカブ | 低下したアレルゲン性を有するグリコシル化タンパク質 |
EP1129179B1 (de) | 1998-11-13 | 2008-09-10 | Henrick Clausen | Udp-galaktose: beta-i(n)-acetyl-glukosamin beta1,3 galaktosyltransferasen, beta3gal-t5 |
AU773845B2 (en) | 1998-11-18 | 2004-06-10 | Neose Technologies, Inc. | Low cost manufacture of oligosaccharides |
US6465220B1 (en) | 1998-12-21 | 2002-10-15 | Glycozym Aps | Glycosylation using GalNac-T4 transferase |
KR100689212B1 (ko) | 1999-01-29 | 2007-03-09 | 암겐 인코포레이티드 | Gcsf 결합체 |
US6503744B1 (en) | 1999-02-01 | 2003-01-07 | National Research Council Of Canada | Campylobacter glycosyltransferases for biosynthesis of gangliosides and ganglioside mimics |
US6949372B2 (en) | 1999-03-02 | 2005-09-27 | The Johns Hopkins University | Engineering intracellular sialylation pathways |
CA2370469A1 (en) | 1999-04-22 | 2000-11-02 | Astrazeneca Ab | Assay for detecting phospho-n-acetylmuramyl-pentapeptide translocase activity |
PE20010288A1 (es) * | 1999-07-02 | 2001-03-07 | Hoffmann La Roche | Derivados de eritropoyetina |
AU6357900A (en) | 1999-07-20 | 2001-02-05 | Amgen, Inc. | Hyaluronic acid-protein conjugates, pharmaceutical compositions and related methods |
US6716626B1 (en) * | 1999-11-18 | 2004-04-06 | Chiron Corporation | Human FGF-21 nucleic acids |
AU1804201A (en) | 1999-12-02 | 2001-06-12 | Zymogenetics Inc. | Methods for targeting cells that express fibroblast growth receptor-3 or-2 |
US6348558B1 (en) * | 1999-12-10 | 2002-02-19 | Shearwater Corporation | Hydrolytically degradable polymers and hydrogels made therefrom |
AU2223401A (en) | 1999-12-24 | 2001-07-09 | Kyowa Hakko Kogyo Co. Ltd. | Branched polyalkylene glycols |
EP1246915A2 (de) | 1999-12-30 | 2002-10-09 | Maxygen Aps | Verbesserte lysosomale enzyme und lysosomale enzymaktivatoren |
AR027509A1 (es) | 2000-01-10 | 2003-04-02 | Maxygen Aps | Conjugados g-csf |
US6555660B2 (en) | 2000-01-10 | 2003-04-29 | Maxygen Holdings Ltd. | G-CSF conjugates |
US6646110B2 (en) * | 2000-01-10 | 2003-11-11 | Maxygen Holdings Ltd. | G-CSF polypeptides and conjugates |
WO2001058493A1 (en) | 2000-02-11 | 2001-08-16 | Maxygen Aps | Conjugates of follicle stimulating hormones |
ES2325877T3 (es) | 2000-02-11 | 2009-09-23 | Bayer Healthcare Llc | Moleculas de tipo factor vii o viia. |
AU2001232337A1 (en) | 2000-02-18 | 2001-08-27 | Kanagawa Academy Of Science And Technology | Pharmaceutical composition, reagent and method for intracerebral delivery of pharmaceutically active ingredient or labeling substance |
US20010041683A1 (en) | 2000-03-09 | 2001-11-15 | Schmitz Harold H. | Cocoa sphingolipids, cocoa extracts containing sphingolipids and methods of making and using same |
AU2001281463A1 (en) | 2000-03-16 | 2001-09-24 | The Regents Of The University Of California | Chemoselective ligation |
US6586398B1 (en) | 2000-04-07 | 2003-07-01 | Amgen, Inc. | Chemically modified novel erythropoietin stimulating protein compositions and methods |
AU2001254624A1 (en) | 2000-05-03 | 2001-11-12 | Novo-Nordisk A/S | Human coagulation factor vii variants |
US6905683B2 (en) | 2000-05-03 | 2005-06-14 | Novo Nordisk Healthcare A/G | Human coagulation factor VII variants |
US7338932B2 (en) | 2000-05-11 | 2008-03-04 | Glycozym Aps | Methods of modulating functions of polypeptide GalNAc-transferases and of screening test substances to find agents herefor, pharmaceutical compositions comprising such agents and the use of such agents for preparing medicaments |
ATE367398T1 (de) | 2000-05-16 | 2007-08-15 | Bolder Biotechnology Inc | Verfahren zur rückfaltung von proteinen mit freien cysteinresten |
WO2002002597A2 (en) | 2000-06-30 | 2002-01-10 | Maxygen Aps | Peptide extended glycosylated polypeptides |
US6423826B1 (en) | 2000-06-30 | 2002-07-23 | Regents Of The University Of Minnesota | High molecular weight derivatives of vitamin K-dependent polypeptides |
KR100396983B1 (ko) | 2000-07-29 | 2003-09-02 | 이강춘 | 고반응성의 가지 달린 고분자 유도체 및 고분자와 단백질또는 펩타이드의 접합체 |
AU2001283740A1 (en) | 2000-08-17 | 2002-02-25 | University Of British Columbia | Chemotherapeutic agents conjugated to p97 and their methods of use in treating neurological tumours |
AU2001285020A1 (en) | 2000-08-17 | 2002-02-25 | Synapse Technologies, Inc. | P97-active agent conjugates and their methods of use |
DE60141908D1 (de) | 2000-10-02 | 2010-06-02 | Novo Nordisk Healthcare Ag | Glykoformen von faktor vii |
US20020142964A1 (en) | 2000-11-02 | 2002-10-03 | Nissen Torben Lauesgaard | Single-chain polypeptides |
AU2002229603B2 (en) | 2000-11-27 | 2007-11-08 | Rmf Dictagene S.A. | Process for folding chemically synthesized polypeptides |
WO2002044196A1 (en) | 2000-11-28 | 2002-06-06 | University Of Massachusetts | Methods and reagents for introducing a sulfhydryl group into the 5'-terminus of rna |
CA2431964C (en) | 2000-12-20 | 2013-09-10 | F. Hoffmann-La Roche Ag | Conjugates of erythropoietin (pep) with polyethylene glycol (peg) |
DE60144439D1 (de) | 2000-12-20 | 2011-05-26 | Hoffmann La Roche | Konjugate von erythropoietin (epo) mit polyethylenglykol (peg) |
US7892730B2 (en) | 2000-12-22 | 2011-02-22 | Sagres Discovery, Inc. | Compositions and methods for cancer |
PA8536201A1 (es) | 2000-12-29 | 2002-08-29 | Kenneth S Warren Inst Inc | Protección y mejoramiento de células, tejidos y órganos que responden a la eritropoyetina |
SE0004932D0 (sv) * | 2000-12-31 | 2000-12-31 | Apbiotech Ab | A method for mixed mode adsorption and mixed mode adsorbents |
EP1366075B1 (de) | 2001-02-27 | 2009-05-27 | Maxygen Aps | Neue interferon-beta-ähnliche moleküle |
CA2441580A1 (en) | 2001-03-22 | 2002-10-03 | Novo Nordisk Health Care Ag | Coagulation factor vii derivatives |
US7235638B2 (en) | 2001-03-22 | 2007-06-26 | Novo Nordisk Healthcare A/G | Coagulation factor VII derivatives |
WO2002085923A2 (en) | 2001-04-19 | 2002-10-31 | The Scripps Research Institute | In vivo incorporation of unnatural amino acids |
CA2446087C (en) | 2001-05-03 | 2013-06-18 | Stephen D. Gillies | Recombinant tumor specific antibody and use thereof |
WO2002092619A2 (en) | 2001-05-14 | 2002-11-21 | The Gouvernment Of The United States Of America, Represented By The Secretary, Department Of Health And Human Services | Modified growth hormone |
AU2002325819B2 (en) | 2001-07-11 | 2008-06-19 | Maxygen, Inc. | G-CSF Conjugates |
KR100453877B1 (ko) | 2001-07-26 | 2004-10-20 | 메덱스젠 주식회사 | 연쇄체화에 의한 면역 글로블린 융합 단백질의 제조 방법 및 이 방법에 의해 제조된 TNFR/Fc 융합 단백질, 상기 단백질을 코딩하는 DNA, 상기 DNA를 포함하는벡터, 및 상기 벡터에 의한 형질전환체 |
NZ530955A (en) | 2001-08-01 | 2006-12-22 | Neose Technologies Inc | Neutral glycosphingolipids and glycosyl-sphingosines and methods for isolating the same |
EP1435972B1 (de) | 2001-08-29 | 2016-03-09 | Seneb Biosciences Inc. | Neue synthetische gangliosid-derivate und zusammensetzungen davon |
US6930086B2 (en) | 2001-09-25 | 2005-08-16 | Hoffmann-La Roche Inc. | Diglycosylated erythropoietin |
US7052868B2 (en) * | 2001-09-27 | 2006-05-30 | Novo Nordisk Healthcare A/G | Human coagulation factor VII polypeptides |
US7179617B2 (en) | 2001-10-10 | 2007-02-20 | Neose Technologies, Inc. | Factor IX: remolding and glycoconjugation of Factor IX |
US8008252B2 (en) | 2001-10-10 | 2011-08-30 | Novo Nordisk A/S | Factor VII: remodeling and glycoconjugation of Factor VII |
US7399613B2 (en) | 2001-10-10 | 2008-07-15 | Neose Technologies, Inc. | Sialic acid nucleotide sugars |
US7297511B2 (en) | 2001-10-10 | 2007-11-20 | Neose Technologies, Inc. | Interferon alpha: remodeling and glycoconjugation of interferon alpha |
US7439043B2 (en) | 2001-10-10 | 2008-10-21 | Neose Technologies, Inc. | Galactosyl nucleotide sugars |
US7226903B2 (en) | 2001-10-10 | 2007-06-05 | Neose Technologies, Inc. | Interferon beta: remodeling and glycoconjugation of interferon beta |
US7173003B2 (en) * | 2001-10-10 | 2007-02-06 | Neose Technologies, Inc. | Granulocyte colony stimulating factor: remodeling and glycoconjugation of G-CSF |
US6784154B2 (en) | 2001-11-01 | 2004-08-31 | University Of Utah Research Foundation | Method of use of erythropoietin to treat ischemic acute renal failure |
US7473680B2 (en) | 2001-11-28 | 2009-01-06 | Neose Technologies, Inc. | Remodeling and glycoconjugation of peptides |
DE60228492D1 (de) | 2001-11-28 | 2008-10-02 | Neose Technologies Inc | Remodellierung von glycoproteinen unter verwendung von endoglycanasen |
US20060035224A1 (en) * | 2002-03-21 | 2006-02-16 | Johansen Jack T | Purification methods for oligonucleotides and their analogs |
EP1504023A4 (de) | 2002-05-03 | 2006-03-22 | Neose Technologies Inc | Rekombinante glycosyltransferase-fusionsproteine |
DE60336555D1 (de) * | 2002-06-21 | 2011-05-12 | Novo Nordisk Healthcare Ag | Pegylierte glykoformen von faktor vii |
KR101186140B1 (ko) | 2002-06-21 | 2012-09-27 | 노보 노르디스크 헬스 케어 악티엔게젤샤프트 | 페길화된 인자 vii 글리코형태 |
DE10232916B4 (de) | 2002-07-19 | 2008-08-07 | Fraunhofer-Gesellschaft zur Förderung der angewandten Forschung e.V. | Vorrichtung und Verfahren zum Charakterisieren eines Informationssignals |
WO2004009838A2 (en) | 2002-07-23 | 2004-01-29 | Neose Technologies, Inc. | H. Pylori FUCOSYLTRANSFERASES |
US7598354B2 (en) | 2002-08-01 | 2009-10-06 | National Research Council Of Canada | Campylobacter glycans and glycopeptides |
SI2255826T1 (sl) | 2002-08-02 | 2016-07-29 | Glaxosmithkline Biologicals S.A. | Neisserijski vakcinski sestavki, ki obsegajo kombinacijo antigenov |
JP2006501820A (ja) | 2002-09-06 | 2006-01-19 | バイエル・フアーマシユーチカルズ・コーポレーシヨン | 修飾glp−1受容体アゴニストおよびそれらの薬理学的使用法 |
WO2005025606A1 (en) | 2003-09-09 | 2005-03-24 | Warren Pharmaceuticals, Inc. | Long acting erythropoietins that maintain tissue protective activity of endogenous erythropoietin |
US7470779B2 (en) * | 2002-09-20 | 2008-12-30 | Pfizer Inc. | Process for decreasing aggregate levels of pegylated protein |
WO2004029090A1 (en) | 2002-09-25 | 2004-04-08 | Novo Nordisk Health Care Ag | Human coagulation factor vii polypeptides |
WO2004029091A2 (en) | 2002-09-30 | 2004-04-08 | Maxygen Holdings Ltd. | FVII OR FVIIa VARIANTS HAVING INCREASED CLOTTING ACTIVITY |
US20040062748A1 (en) | 2002-09-30 | 2004-04-01 | Mountain View Pharmaceuticals, Inc. | Polymer conjugates with decreased antigenicity, methods of preparation and uses thereof |
BR0315178A (pt) | 2002-10-09 | 2005-08-16 | Neose Technologies Inc | Eritropoietina: remodelagem e glicoconjugação de eritropoietina |
WO2004042075A2 (en) | 2002-11-08 | 2004-05-21 | Glycozym Aps | Inactivated ga1 - nac - transferases, methods for inhibitors of such transferases and their use |
JP4412461B2 (ja) | 2002-11-20 | 2010-02-10 | 日油株式会社 | 修飾された生体関連物質、その製造方法および中間体 |
US7459436B2 (en) | 2002-11-22 | 2008-12-02 | Hoffmann-La Roche Inc. | Treatment of disturbances of iron distribution |
US20050064540A1 (en) | 2002-11-27 | 2005-03-24 | Defrees Shawn Ph.D | Glycoprotein remodeling using endoglycanases |
EP1424344A1 (de) | 2002-11-29 | 2004-06-02 | Aventis Behring Gesellschaft mit beschränkter Haftung | Modifizierte cDNA des Factors VIII und Derivate davon |
ES2312523T3 (es) | 2002-12-13 | 2009-03-01 | Bioceuticals Arzneimittel Ag | Procedimiento para la produccion y purificacion de eritropoyetina. |
BR0317742A (pt) | 2002-12-26 | 2005-11-22 | Mountain View Pharmaceuticals | Conjugados poliméricos de interferon-beta com potência biológica aumentada |
US7041635B2 (en) | 2003-01-28 | 2006-05-09 | In2Gen Co., Ltd. | Factor VIII polypeptide |
EP1596887B1 (de) * | 2003-02-26 | 2022-03-23 | Nektar Therapeutics | Polymer-factor viii-konjugate |
KR20060003862A (ko) | 2003-03-14 | 2006-01-11 | 네오스 테크놀로지스, 인크. | 수용성분기폴리머 및 그 접합체 |
EP1603954A4 (de) | 2003-03-18 | 2006-04-12 | Neose Technologies Inc | Aktivierte formen wasserlöslicher polymere |
PT1605897E (pt) | 2003-03-19 | 2012-09-10 | Lilly Co Eli | Compostos de glp-1 ligado a polietilenoglicol |
US8791070B2 (en) * | 2003-04-09 | 2014-07-29 | Novo Nordisk A/S | Glycopegylated factor IX |
EP1613261A4 (de) | 2003-04-09 | 2011-01-26 | Novo Nordisk As | Intrazelluläre bildung von peptidkonjugaten |
MXPA05010773A (es) | 2003-04-09 | 2005-12-12 | Neose Technologies Inc | Metodos de glicopegilacion y proteinas/peptidos producidos por los metodos. |
US7718363B2 (en) | 2003-04-25 | 2010-05-18 | The Kenneth S. Warren Institute, Inc. | Tissue protective cytokine receptor complex and assays for identifying tissue protective compounds |
ES2558102T3 (es) | 2003-05-06 | 2016-02-02 | Biogen Hemophilia Inc. | Proteínas quiméricas del factor de coagulación para el tratamiento de un trastorno hemostático |
TWI353991B (en) | 2003-05-06 | 2011-12-11 | Syntonix Pharmaceuticals Inc | Immunoglobulin chimeric monomer-dimer hybrids |
EP1624847B1 (de) * | 2003-05-09 | 2012-01-04 | BioGeneriX AG | Zusammensetzungen und Verfahren zur Herstellung von Glykosylierungsmutanten des menschlichen Wachstumshormons |
WO2004101597A2 (en) | 2003-05-13 | 2004-11-25 | Frutarom Ltd. | Methods for the reduction of disulfide bonds |
US7074755B2 (en) | 2003-05-17 | 2006-07-11 | Centocor, Inc. | Erythropoietin conjugate compounds with extended half-lives |
EP1481985A1 (de) | 2003-05-28 | 2004-12-01 | Innogenetics N.V. | Modifiziertes Hepatitis C Virus (HCV) NS3 Protein zur medizinischen Behandlung |
GB0315457D0 (en) | 2003-07-01 | 2003-08-06 | Celltech R&D Ltd | Biological products |
WO2005012484A2 (en) | 2003-07-25 | 2005-02-10 | Neose Technologies, Inc. | Antibody-toxin conjugates |
BRPI0412671A (pt) | 2003-08-08 | 2006-10-03 | Fresenius Kabi De Gmbh | conjugados de um polìmero e uma proteìna ligados por um grupo de ligação de oxima |
US20060198819A1 (en) | 2003-08-08 | 2006-09-07 | Novo Nordisk Healthcare A/G | Use of galactose oxidase for selective chemical conjugation of protractor molecules to proteins of therapeutic interest |
JP2007501811A (ja) | 2003-08-08 | 2007-02-01 | ノボ ノルディスク ヘルス ケア アクチェンゲゼルシャフト | 治療的な関心対象のタンパク質に対する遅延分子の選択的な化学物質接合のためのガラクトースオキシダーゼの使用。 |
US7524813B2 (en) | 2003-10-10 | 2009-04-28 | Novo Nordisk Health Care Ag | Selectively conjugated peptides and methods of making the same |
US20080305992A1 (en) | 2003-11-24 | 2008-12-11 | Neose Technologies, Inc. | Glycopegylated erythropoietin |
US7842661B2 (en) | 2003-11-24 | 2010-11-30 | Novo Nordisk A/S | Glycopegylated erythropoietin formulations |
JP4738346B2 (ja) | 2003-12-03 | 2011-08-03 | ノヴォ ノルディスク アー/エス | GlycoPEG化された第IX因子 |
KR101237884B1 (ko) | 2003-12-03 | 2013-02-27 | 바이오제너릭스 에이지 | 글리코 peg화 과립구 콜로니 자극인자 |
US20060040856A1 (en) | 2003-12-03 | 2006-02-23 | Neose Technologies, Inc. | Glycopegylated factor IX |
US20080318850A1 (en) | 2003-12-03 | 2008-12-25 | Neose Technologies, Inc. | Glycopegylated Factor Ix |
US7956032B2 (en) | 2003-12-03 | 2011-06-07 | Novo Nordisk A/S | Glycopegylated granulocyte colony stimulating factor |
WO2005067601A2 (en) | 2004-01-09 | 2005-07-28 | Neose Technologies, Inc. | Vectors for recombinant protein expression in e.coli |
US20070105770A1 (en) | 2004-01-21 | 2007-05-10 | Novo Nordisk A/S | Transglutaminase mediated conjugation of peptides |
EP1720892B1 (de) | 2004-01-26 | 2013-07-24 | BioGeneriX AG | Mit verzweigten Polymeren modifizierte Zucker und Nukleotide |
DK2860251T3 (en) | 2004-02-12 | 2018-06-06 | Archemix Llc | APTAPMER PHARMACEUTICALS USEFUL IN TREATMENT OF COMPLEMENT-RELATED DISEASES |
US20070265200A1 (en) | 2004-03-17 | 2007-11-15 | Eli Lilly And Company | Glycol Linked Fgf-21 Compounds |
US20070037966A1 (en) | 2004-05-04 | 2007-02-15 | Novo Nordisk A/S | Hydrophobic interaction chromatography purification of factor VII polypeptides |
BRPI0510295A (pt) | 2004-05-04 | 2007-11-06 | Novo Nordisk Healthcare Ag | preparação de uma glicoproteìna, e, método para produzir a mesma |
JP4251399B2 (ja) | 2004-05-21 | 2009-04-08 | 独立行政法人産業技術総合研究所 | O結合型糖鎖が付加されたペプチドのスクリーニング方法 |
JP2008501344A (ja) | 2004-06-03 | 2008-01-24 | ネオス テクノロジーズ インコーポレイティッド | 切り詰め型ST6GalNAcIポリペプチドおよび核酸 |
JP2008512085A (ja) | 2004-06-03 | 2008-04-24 | ネオス テクノロジーズ インコーポレイティッド | 切断型GalNAcT2ポリペプチドおよび核酸 |
CA2572751A1 (en) * | 2004-06-30 | 2006-01-12 | Egen Corporation | Pegylated interferon alpha-1b |
MXPA06015234A (es) | 2004-06-30 | 2007-11-22 | Nektar Therapeutics Al Corp | Conjugados de fraccion polimero-factor ix. |
WO2006014466A2 (en) | 2004-07-02 | 2006-02-09 | The Kenneth S. Warren Institute, Inc. | Novel carbamylated epo and method for its production |
JP2008505184A (ja) | 2004-07-02 | 2008-02-21 | ザ ケネス エス.ウォーレン インスティテュート,インコーポレーテッド | 完全にカルバミル化されたエリトロポイエチンを生成する方法 |
US20080300173A1 (en) | 2004-07-13 | 2008-12-04 | Defrees Shawn | Branched Peg Remodeling and Glycosylation of Glucagon-Like Peptides-1 [Glp-1] |
US20090292110A1 (en) | 2004-07-23 | 2009-11-26 | Defrees Shawn | Enzymatic modification of glycopeptides |
SE0401951D0 (sv) | 2004-07-29 | 2004-07-29 | Amersham Biosciences Ab | Chromatography method |
JP2008507990A (ja) | 2004-08-02 | 2008-03-21 | ノボ ノルディスク ヘルス ケア アクチェンゲゼルシャフト | Fviiの抱合体 |
ATE469216T1 (de) | 2004-08-17 | 2010-06-15 | Csl Behring Gmbh | Modifizierte vitamin-k-abhängige polypeptide |
US8268967B2 (en) | 2004-09-10 | 2012-09-18 | Novo Nordisk A/S | Glycopegylated interferon α |
EP1797192A1 (de) | 2004-09-29 | 2007-06-20 | Novo Nordisk Health Care AG | Modifizierte proteine |
JP5948627B2 (ja) | 2004-10-29 | 2016-07-20 | レイショファーム ゲーエムベーハー | 線維芽細胞成長因子(fgf)のリモデリングと糖質ペグ化 |
LT3130601T (lt) | 2004-11-12 | 2020-09-10 | Bayer Healthcare Llc | Į vietą nukreipta fviii modifikacija |
US20090054623A1 (en) | 2004-12-17 | 2009-02-26 | Neose Technologies, Inc. | Lipo-Conjugation of Peptides |
BRPI0518661A2 (pt) * | 2004-12-22 | 2008-12-02 | Ambrx Inc | mÉtodos para expressço e purificaÇço do hormânio do crescimento humano recombinante |
JP2008526864A (ja) | 2005-01-06 | 2008-07-24 | ネオス テクノロジーズ インコーポレイテッド | 糖断片を用いる糖結合 |
EP1858543B1 (de) | 2005-01-10 | 2013-11-27 | BioGeneriX AG | Glycopegylierten Granulocyten-Kolonie-stimulierender Faktor |
WO2006078645A2 (en) | 2005-01-19 | 2006-07-27 | Neose Technologies, Inc. | Heterologous polypeptide expression using low multiplicity of infection of viruses |
PA8660701A1 (es) | 2005-02-04 | 2006-09-22 | Pfizer Prod Inc | Agonistas de pyy y sus usos |
US8137928B2 (en) | 2005-03-24 | 2012-03-20 | BioGeneriX | Expression of soluble, active eukaryotic glycosyltransferases in prokaryotic organisms |
WO2006105426A2 (en) | 2005-03-30 | 2006-10-05 | Neose Technologies, Inc. | Manufacturing process for the production of peptides grown in insect cell lines |
JP2008534559A (ja) | 2005-04-01 | 2008-08-28 | ノボ ノルディスク ヘルス ケア アクチェンゲゼルシャフト | 血液凝固fviii類似体 |
US20070154992A1 (en) | 2005-04-08 | 2007-07-05 | Neose Technologies, Inc. | Compositions and methods for the preparation of protease resistant human growth hormone glycosylation mutants |
PT2311972E (pt) | 2005-05-11 | 2015-05-13 | Eth Zuerich | Proteínas n-glicosiladas recombinantes de células procarióticas |
JP5216580B2 (ja) | 2005-05-25 | 2013-06-19 | ノヴォ ノルディスク アー/エス | グリコペグ化第ix因子 |
US20110003744A1 (en) | 2005-05-25 | 2011-01-06 | Novo Nordisk A/S | Glycopegylated Erythropoietin Formulations |
EP1893632B1 (de) | 2005-06-17 | 2015-08-12 | Novo Nordisk Health Care AG | Selektive reduktion und derivatisierung manipulierter faktor vii proteine mit mindestens einem nichtnativen zystein |
JP2009515508A (ja) | 2005-08-19 | 2009-04-16 | ネオス テクノロジーズ インコーポレイテッド | グリコpeg化因子viiおよび因子viia |
JP5690047B2 (ja) | 2005-09-14 | 2015-03-25 | ノボ ノルディスク ヘルス ケア アーゲー | ヒト凝固第vii因子ポリペプチド |
US20090048440A1 (en) | 2005-11-03 | 2009-02-19 | Neose Technologies, Inc. | Nucleotide Sugar Purification Using Membranes |
DE202006020194U1 (de) | 2006-03-01 | 2007-12-06 | Bioceuticals Arzneimittel Ag | G-CSF-Flüssigformulierung |
US7645860B2 (en) * | 2006-03-31 | 2010-01-12 | Baxter Healthcare S.A. | Factor VIII polymer conjugates |
AU2007253264A1 (en) | 2006-05-24 | 2007-11-29 | Novo Nordisk Health Care Ag | Factor IX analogues having prolonged in vivo half life |
CN101516388B (zh) | 2006-07-21 | 2012-10-31 | 诺和诺德公司 | 通过o-联糖基化序列的肽的糖基化 |
ITMI20061624A1 (it) | 2006-08-11 | 2008-02-12 | Bioker Srl | Mono-coniugati sito-specifici di g-csf |
US20100056428A1 (en) | 2006-09-01 | 2010-03-04 | Novo Nordisk Health Care Ag | Modified proteins |
EP2054521A4 (de) | 2006-10-03 | 2012-12-19 | Novo Nordisk As | Verfahren zur reinigung von polypeptid-konjugate |
KR101556248B1 (ko) * | 2006-10-04 | 2015-09-30 | 노보 노르디스크 에이/에스 | 글리세롤이 연결된 페길화된 당 및 글리코펩티드 |
WO2008073620A2 (en) | 2006-11-02 | 2008-06-19 | Neose Technologies, Inc. | Manufacturing process for the production of polypeptides expressed in insect cell-lines |
RS52845B (en) | 2007-04-03 | 2013-12-31 | Biogenerix Ag | TREATMENT PROCEDURES USING GLYCOPEGILATED G-CSF |
US20090053167A1 (en) | 2007-05-14 | 2009-02-26 | Neose Technologies, Inc. | C-, S- and N-glycosylation of peptides |
JP2010531135A (ja) | 2007-06-04 | 2010-09-24 | ノボ ノルディスク アクティーゼルスカブ | N−アセチルグルコサミニルトランスフェラーゼを使用したo結合型グリコシル化 |
US9493499B2 (en) | 2007-06-12 | 2016-11-15 | Novo Nordisk A/S | Process for the production of purified cytidinemonophosphate-sialic acid-polyalkylene oxide (CMP-SA-PEG) as modified nucleotide sugars via anion exchange chromatography |
US8207112B2 (en) | 2007-08-29 | 2012-06-26 | Biogenerix Ag | Liquid formulation of G-CSF conjugate |
JP5647899B2 (ja) | 2008-01-08 | 2015-01-07 | ラツィオファルム ゲーエムベーハーratiopharm GmbH | オリゴサッカリルトランスフェラーゼを使用するポリペプチドの複合糖質化 |
-
2006
- 2006-04-10 US US11/402,105 patent/US20070154992A1/en not_active Abandoned
- 2006-04-10 EP EP20060758326 patent/EP1871795A4/de not_active Withdrawn
- 2006-04-10 US US11/910,958 patent/US9187546B2/en not_active Expired - Fee Related
- 2006-04-10 WO PCT/US2006/013903 patent/WO2006121569A2/en active Application Filing
- 2006-04-10 EP EP11173427.3A patent/EP2386571B1/de not_active Not-in-force
Patent Citations (90)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4055635A (en) * | 1973-07-05 | 1977-10-25 | Beecham Group Limited | Fibrinolytic compositions |
US4179337A (en) * | 1973-07-20 | 1979-12-18 | Davis Frank F | Non-immunogenic polypeptides |
US4088538A (en) * | 1975-05-30 | 1978-05-09 | Battelle Memorial Institute | Reversibly precipitable immobilized enzyme complex and a method for its use |
US4385260A (en) * | 1975-09-09 | 1983-05-24 | Beckman Instruments, Inc. | Bargraph display |
US4414147A (en) * | 1981-04-17 | 1983-11-08 | Massachusetts Institute Of Technology | Methods of decreasing the hydrophobicity of fibroblast and other interferons |
US4412989A (en) * | 1981-06-10 | 1983-11-01 | Ajinomoto Company Incorporated | Oxygen carrier |
US4496689A (en) * | 1983-12-27 | 1985-01-29 | Miles Laboratories, Inc. | Covalently attached complex of alpha-1-proteinase inhibitor with a water soluble polymer |
US4565653A (en) * | 1984-03-30 | 1986-01-21 | Pfizer Inc. | Acyltripeptide immunostimulants |
US4879236A (en) * | 1984-05-16 | 1989-11-07 | The Texas A&M University System | Method for producing a recombinant baculovirus expression vector |
US4806595A (en) * | 1985-08-12 | 1989-02-21 | Koken Co., Ltd. | Method of preparing antithrombogenic medical materials |
US4925796A (en) * | 1986-03-07 | 1990-05-15 | Massachusetts Institute Of Technology | Method for enhancing glycoprotein stability |
US5153265A (en) * | 1988-01-20 | 1992-10-06 | Cetus Corporation | Conjugation of polymer to colony stimulating factor-1 |
US5147788A (en) * | 1988-05-06 | 1992-09-15 | Burroughs Wellcome Co. | Baculovirus vectors and methods of use |
US5169933A (en) * | 1988-08-15 | 1992-12-08 | Neorx Corporation | Covalently-linked complexes and methods for enhanced cytotoxicity and imaging |
US5194376A (en) * | 1989-02-28 | 1993-03-16 | University Of Ottawa | Baculovirus expression system capable of producing foreign gene proteins at high levels |
US5833988A (en) * | 1989-09-07 | 1998-11-10 | Alkermes, Inc. | Transferrin receptor specific antibody-neuropharmaceutical or diagnostic agent conjugates |
US5154924A (en) * | 1989-09-07 | 1992-10-13 | Alkermes, Inc. | Transferrin receptor specific antibody-neuropharmaceutical agent conjugates |
US5182107A (en) * | 1989-09-07 | 1993-01-26 | Alkermes, Inc. | Transferrin receptor specific antibody-neuropharmaceutical or diagnostic agent conjugates |
US5672683A (en) * | 1989-09-07 | 1997-09-30 | Alkermes, Inc. | Transferrin neuropharmaceutical agent fusion protein |
US5527527A (en) * | 1989-09-07 | 1996-06-18 | Alkermes, Inc. | Transferrin receptor specific antibody-neuropharmaceutical agent conjugates |
US5977307A (en) * | 1989-09-07 | 1999-11-02 | Alkermes, Inc. | Transferrin receptor specific ligand-neuropharmaceutical agent fusion proteins |
US5405753A (en) * | 1990-03-26 | 1995-04-11 | Brossmer; Reinhard | CMP-activated, fluorescing sialic acids, as well as processes for their preparation |
US5352670A (en) * | 1991-06-10 | 1994-10-04 | Alberta Research Council | Methods for the enzymatic synthesis of alpha-sialylated oligosaccharide glycosides |
US5346696A (en) * | 1991-06-19 | 1994-09-13 | Korea Green Cross Corporation | Asialoglycoprotein - conjugated medicinal agent |
US6037452A (en) * | 1992-04-10 | 2000-03-14 | Alpha Therapeutic Corporation | Poly(alkylene oxide)-Factor VIII or Factor IX conjugate |
US5614184A (en) * | 1992-07-28 | 1997-03-25 | New England Deaconess Hospital | Recombinant human erythropoietin mutants and therapeutic methods employing them |
US6166183A (en) * | 1992-11-30 | 2000-12-26 | Kirin-Amgen, Inc. | Chemically-modified G-CSF |
US5374541A (en) * | 1993-05-04 | 1994-12-20 | The Scripps Research Institute | Combined use of β-galactosidase and sialyltransferase coupled with in situ regeneration of CMP-sialic acid for one pot synthesis of oligosaccharides |
US6096512A (en) * | 1993-05-14 | 2000-08-01 | Pharmacia & Upjohn Company | Cloned DNA encoding a UDP-GalNAc: Polypeptide, N-acetylgalactosaminyltransferase |
US5969040A (en) * | 1993-06-08 | 1999-10-19 | Hallahan; Terrence W. | Factor IX -- polymeric conjugates |
US5621039A (en) * | 1993-06-08 | 1997-04-15 | Hallahan; Terrence W. | Factor IX- polymeric conjugates |
US5635603A (en) * | 1993-12-08 | 1997-06-03 | Immunomedics, Inc. | Preparation and use of immunoconjugates |
US5369017A (en) * | 1994-02-04 | 1994-11-29 | The Scripps Research Institute | Process for solid phase glycopeptide synthesis |
US5837458A (en) * | 1994-02-17 | 1998-11-17 | Maxygen, Inc. | Methods and compositions for cellular and metabolic engineering |
US5605793A (en) * | 1994-02-17 | 1997-02-25 | Affymax Technologies N.V. | Methods for in vitro recombination |
US5811238A (en) * | 1994-02-17 | 1998-09-22 | Affymax Technologies N.V. | Methods for generating polynucleotides having desired characteristics by iterative selection and recombination |
US5830721A (en) * | 1994-02-17 | 1998-11-03 | Affymax Technologies N.V. | DNA mutagenesis by random fragmentation and reassembly |
US5492841A (en) * | 1994-02-18 | 1996-02-20 | E. I. Du Pont De Nemours And Company | Quaternary ammonium immunogenic conjugates and immunoassay reagents |
US5432059A (en) * | 1994-04-01 | 1995-07-11 | Specialty Laboratories, Inc. | Assay for glycosylation deficiency disorders |
US5646113A (en) * | 1994-04-07 | 1997-07-08 | Genentech, Inc. | Treatment of partial growth hormone insensitivity syndrome |
US5545553A (en) * | 1994-09-26 | 1996-08-13 | The Rockefeller University | Glycosyltransferases for biosynthesis of oligosaccharides, and genes encoding them |
US5834251A (en) * | 1994-12-30 | 1998-11-10 | Alko Group Ltd. | Methods of modifying carbohydrate moieties |
US5932462A (en) * | 1995-01-10 | 1999-08-03 | Shearwater Polymers, Inc. | Multiarmed, monofunctional, polymer for coupling to molecules and surfaces |
US5922577A (en) * | 1995-04-11 | 1999-07-13 | Cytel Corporation | Enzymatic synthesis of glycosidic linkages |
US5876980A (en) * | 1995-04-11 | 1999-03-02 | Cytel Corporation | Enzymatic synthesis of oligosaccharides |
US6030815A (en) * | 1995-04-11 | 2000-02-29 | Neose Technologies, Inc. | Enzymatic synthesis of oligosaccharides |
US5728554A (en) * | 1995-04-11 | 1998-03-17 | Cytel Corporation | Enzymatic synthesis of glycosidic linkages |
US6015555A (en) * | 1995-05-19 | 2000-01-18 | Alkermes, Inc. | Transferrin receptor specific antibody-neuropharmaceutical or diagnostic agent conjugates |
US20030207406A1 (en) * | 1995-06-07 | 2003-11-06 | Neose Technologies, Inc. | Method of transferring at least two saccharide units with a polyglycosyltransferase |
US5672662A (en) * | 1995-07-07 | 1997-09-30 | Shearwater Polymers, Inc. | Poly(ethylene glycol) and related polymers monosubstituted with propionic or butanoic acids and functional derivatives thereof for biotechnical applications |
US5849535A (en) * | 1995-09-21 | 1998-12-15 | Genentech, Inc. | Human growth hormone variants |
US6057292A (en) * | 1995-09-21 | 2000-05-02 | Genentech, Inc. | Method for inhibiting growth hormone action |
US5716812A (en) * | 1995-12-12 | 1998-02-10 | The University Of British Columbia | Methods and compositions for synthesis of oligosaccharides, and the products formed thereby |
US6087325A (en) * | 1996-10-15 | 2000-07-11 | The Liposome Company, Inc. | Peptide-lipid conjugates |
US20020142370A1 (en) * | 1997-01-16 | 2002-10-03 | Neose Technologies, Inc. | Practical in vitro sialylation of recombinant glycoproteins |
US6399336B1 (en) * | 1997-01-16 | 2002-06-04 | Neose Technologies, Inc. | Practical in vitro sialylation of recombinant glycoproteins |
US20030124645A1 (en) * | 1997-01-16 | 2003-07-03 | Neose Technologies, Inc. | Practical in vitro sialylation of recombinant glycoproteins |
US5945314A (en) * | 1997-03-31 | 1999-08-31 | Abbott Laboratories | Process for synthesizing oligosaccharides |
US6183738B1 (en) * | 1997-05-12 | 2001-02-06 | Phoenix Pharamacologics, Inc. | Modified arginine deiminase |
US20030027257A1 (en) * | 1997-08-21 | 2003-02-06 | University Technologies International, Inc. | Sequences for improving the efficiency of secretion of non-secreted protein from mammalian and insect cells |
US6440703B1 (en) * | 1997-12-01 | 2002-08-27 | Neose Technologies, Inc. | Enzymatic synthesis of gangliosides |
US6555346B1 (en) * | 1997-12-18 | 2003-04-29 | Stichting Instituut Voor Dierhouderij En Diergezondheid | Protein expression in baculovirus vector expression systems |
US6362254B2 (en) * | 1998-03-12 | 2002-03-26 | Shearwater Corporation | Poly(ethylene glycol) derivatives with proximal reactive groups |
US6692931B1 (en) * | 1998-11-16 | 2004-02-17 | Werner Reutter | Recombinant glycoproteins, method for the production thereof, medicaments containing said glycoproteins and use thereof |
US6261805B1 (en) * | 1999-07-15 | 2001-07-17 | Boyce Thompson Institute For Plant Research, Inc. | Sialyiation of N-linked glycoproteins in the baculovirus expression vector system |
US20020150981A1 (en) * | 1999-09-14 | 2002-10-17 | Novazyme Pharmaceuticals, Inc. | Methods for producing highly phosphorylated lysosomal hydrolases |
US6376604B2 (en) * | 1999-12-22 | 2002-04-23 | Shearwater Corporation | Method for the preparation of 1-benzotriazolylcarbonate esters of poly(ethylene glycol) |
US20030040037A1 (en) * | 2000-05-12 | 2003-02-27 | Neose Technologies, Inc. | In vitro modification of glycosylation patterns of recombinant glycopeptides |
US20030180835A1 (en) * | 2000-05-12 | 2003-09-25 | Neose Technologies, Inc. | In vitro modification of glycosylation patterns of recombinant glycopeptides |
US7202208B2 (en) * | 2000-05-15 | 2007-04-10 | Hoffman-La Roche Inc. | Erythropoietin composition |
US20020137134A1 (en) * | 2000-06-28 | 2002-09-26 | Gerngross Tillman U. | Methods for producing modified glycoproteins |
US6531121B2 (en) * | 2000-12-29 | 2003-03-11 | The Kenneth S. Warren Institute, Inc. | Protection and enhancement of erythropoietin-responsive cells, tissues and organs |
US20020168323A1 (en) * | 2001-05-11 | 2002-11-14 | Igor Gonda | Optimization of the molecular properties and formulation of proteins delivered by inhalation |
US20040063911A1 (en) * | 2001-10-10 | 2004-04-01 | Neose Technologies, Inc. | Protein remodeling methods and proteins/peptides produced by the methods |
US20040132640A1 (en) * | 2001-10-10 | 2004-07-08 | Neose Technologies, Inc. | Glycopegylation methods and proteins/peptides produced by the methods |
US7214660B2 (en) * | 2001-10-10 | 2007-05-08 | Neose Technologies, Inc. | Erythropoietin: remodeling and glycoconjugation of erythropoietin |
US20040142856A1 (en) * | 2001-10-10 | 2004-07-22 | Neose Technologies, Inc. | Glycoconjugation methods and proteins/peptides produced by the methods |
US20070027068A1 (en) * | 2001-10-10 | 2007-02-01 | Defrees Shawn | Erythropoietin: remodeling and glycoconjugation of erythropoietin |
US7138371B2 (en) * | 2001-10-10 | 2006-11-21 | Neose Technologies, Inc | Remodeling and glycoconjugation of peptides |
US7125843B2 (en) * | 2001-10-19 | 2006-10-24 | Neose Technologies, Inc. | Glycoconjugates including more than one peptide |
US20040126838A1 (en) * | 2001-11-28 | 2004-07-01 | Neose Technologies, Inc. | Follicle stimulating hormone: remodeling and glycoconjugation of FSH |
US20050118672A1 (en) * | 2001-11-28 | 2005-06-02 | Defrees Shawn | Glycopeptide remodeling using amidases |
US20040136955A1 (en) * | 2002-09-05 | 2004-07-15 | Barker Nicholas P | Modified asialo-interferons and uses thereof |
US20060111279A1 (en) * | 2003-11-24 | 2006-05-25 | Neose Technologies, Inc. | Glycopegylated erythropoietin |
US20050143292A1 (en) * | 2003-11-24 | 2005-06-30 | Defrees Shawn | Glycopegylated erythropoietin |
US7405198B2 (en) * | 2003-11-24 | 2008-07-29 | Neose Technologies, Inc. | Glycopegylated erythropoietin |
US20080015142A1 (en) * | 2003-12-03 | 2008-01-17 | Defrees Shawn | Glycopegylated Follicle Stimulating Hormone |
US7338933B2 (en) * | 2004-01-08 | 2008-03-04 | Neose Technologies, Inc. | O-linked glycosylation of peptides |
US20060024286A1 (en) * | 2004-08-02 | 2006-02-02 | Paul Glidden | Variants of tRNA synthetase fragments and uses thereof |
US20070105755A1 (en) * | 2005-10-26 | 2007-05-10 | Neose Technologies, Inc. | One pot desialylation and glycopegylation of therapeutic peptides |
Cited By (41)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US8008252B2 (en) | 2001-10-10 | 2011-08-30 | Novo Nordisk A/S | Factor VII: remodeling and glycoconjugation of Factor VII |
US8716240B2 (en) | 2001-10-10 | 2014-05-06 | Novo Nordisk A/S | Erythropoietin: remodeling and glycoconjugation of erythropoietin |
US8716239B2 (en) | 2001-10-10 | 2014-05-06 | Novo Nordisk A/S | Granulocyte colony stimulating factor: remodeling and glycoconjugation G-CSF |
US7795210B2 (en) | 2001-10-10 | 2010-09-14 | Novo Nordisk A/S | Protein remodeling methods and proteins/peptides produced by the methods |
US8076292B2 (en) | 2001-10-10 | 2011-12-13 | Novo Nordisk A/S | Factor VIII: remodeling and glycoconjugation of factor VIII |
US8053410B2 (en) | 2002-06-21 | 2011-11-08 | Novo Nordisk Health Care A/G | Pegylated factor VII glycoforms |
US7803777B2 (en) | 2003-03-14 | 2010-09-28 | Biogenerix Ag | Branched water-soluble polymers and their conjugates |
US8247381B2 (en) | 2003-03-14 | 2012-08-21 | Biogenerix Ag | Branched water-soluble polymers and their conjugates |
US8063015B2 (en) | 2003-04-09 | 2011-11-22 | Novo Nordisk A/S | Glycopegylation methods and proteins/peptides produced by the methods |
US8853161B2 (en) | 2003-04-09 | 2014-10-07 | Novo Nordisk A/S | Glycopegylation methods and proteins/peptides produced by the methods |
US8791070B2 (en) | 2003-04-09 | 2014-07-29 | Novo Nordisk A/S | Glycopegylated factor IX |
US20080102083A1 (en) * | 2003-05-09 | 2008-05-01 | Neose Technologies, Inc. | Compositions and Methods for the Preparation of Human Growth Hormone Glycosylation Mutants |
US7932364B2 (en) | 2003-05-09 | 2011-04-26 | Novo Nordisk A/S | Compositions and methods for the preparation of human growth hormone glycosylation mutants |
US9005625B2 (en) | 2003-07-25 | 2015-04-14 | Novo Nordisk A/S | Antibody toxin conjugates |
US8633157B2 (en) | 2003-11-24 | 2014-01-21 | Novo Nordisk A/S | Glycopegylated erythropoietin |
US7842661B2 (en) | 2003-11-24 | 2010-11-30 | Novo Nordisk A/S | Glycopegylated erythropoietin formulations |
US8916360B2 (en) | 2003-11-24 | 2014-12-23 | Novo Nordisk A/S | Glycopegylated erythropoietin |
US8632770B2 (en) | 2003-12-03 | 2014-01-21 | Novo Nordisk A/S | Glycopegylated factor IX |
US7956032B2 (en) | 2003-12-03 | 2011-06-07 | Novo Nordisk A/S | Glycopegylated granulocyte colony stimulating factor |
US8361961B2 (en) | 2004-01-08 | 2013-01-29 | Biogenerix Ag | O-linked glycosylation of peptides |
US8791066B2 (en) | 2004-07-13 | 2014-07-29 | Novo Nordisk A/S | Branched PEG remodeling and glycosylation of glucagon-like peptide-1 [GLP-1] |
US20090292110A1 (en) * | 2004-07-23 | 2009-11-26 | Defrees Shawn | Enzymatic modification of glycopeptides |
US8268967B2 (en) | 2004-09-10 | 2012-09-18 | Novo Nordisk A/S | Glycopegylated interferon α |
US10874714B2 (en) | 2004-10-29 | 2020-12-29 | 89Bio Ltd. | Method of treating fibroblast growth factor 21 (FGF-21) deficiency |
US9200049B2 (en) | 2004-10-29 | 2015-12-01 | Novo Nordisk A/S | Remodeling and glycopegylation of fibroblast growth factor (FGF) |
US9029331B2 (en) | 2005-01-10 | 2015-05-12 | Novo Nordisk A/S | Glycopegylated granulocyte colony stimulating factor |
US9187546B2 (en) | 2005-04-08 | 2015-11-17 | Novo Nordisk A/S | Compositions and methods for the preparation of protease resistant human growth hormone glycosylation mutants |
US8404809B2 (en) | 2005-05-25 | 2013-03-26 | Novo Nordisk A/S | Glycopegylated factor IX |
US8911967B2 (en) | 2005-08-19 | 2014-12-16 | Novo Nordisk A/S | One pot desialylation and glycopegylation of therapeutic peptides |
US8841439B2 (en) | 2005-11-03 | 2014-09-23 | Novo Nordisk A/S | Nucleotide sugar purification using membranes |
US9187532B2 (en) | 2006-07-21 | 2015-11-17 | Novo Nordisk A/S | Glycosylation of peptides via O-linked glycosylation sequences |
US8969532B2 (en) | 2006-10-03 | 2015-03-03 | Novo Nordisk A/S | Methods for the purification of polypeptide conjugates comprising polyalkylene oxide using hydrophobic interaction chromatography |
US9050304B2 (en) | 2007-04-03 | 2015-06-09 | Ratiopharm Gmbh | Methods of treatment using glycopegylated G-CSF |
US9493499B2 (en) | 2007-06-12 | 2016-11-15 | Novo Nordisk A/S | Process for the production of purified cytidinemonophosphate-sialic acid-polyalkylene oxide (CMP-SA-PEG) as modified nucleotide sugars via anion exchange chromatography |
US20090000924A1 (en) * | 2007-06-29 | 2009-01-01 | Harley-Davidson Motor Company Group, Inc. | Integrated ignition and key switch |
US8207112B2 (en) | 2007-08-29 | 2012-06-26 | Biogenerix Ag | Liquid formulation of G-CSF conjugate |
US9150848B2 (en) | 2008-02-27 | 2015-10-06 | Novo Nordisk A/S | Conjugated factor VIII molecules |
US20140248247A1 (en) * | 2011-10-18 | 2014-09-04 | Nestec S.A. | Composition for use in the promotion of healthy bone growth and/or in the prevention and/or treatment of bone disease |
US9662358B2 (en) * | 2011-10-18 | 2017-05-30 | Nestec S.A. | Composition for use in the promotion of healthy bone growth and/or in the treatment of bone disease |
EP3820497A4 (de) * | 2018-07-11 | 2022-03-23 | Ohio University | Inhibitoren der wachstumshormonwirkung auf peptid-basis und verfahren zu deren verwendung |
US11524986B2 (en) | 2018-07-11 | 2022-12-13 | Ohio University | Peptide-based inhibitors of growth hormone action and methods of use thereof |
Also Published As
Publication number | Publication date |
---|---|
WO2006121569A3 (en) | 2008-11-20 |
EP1871795A2 (de) | 2008-01-02 |
US9187546B2 (en) | 2015-11-17 |
EP2386571B1 (de) | 2016-06-01 |
EP2386571A3 (de) | 2012-02-15 |
EP2386571A2 (de) | 2011-11-16 |
WO2006121569A2 (en) | 2006-11-16 |
EP1871795A4 (de) | 2010-03-31 |
US20090124544A1 (en) | 2009-05-14 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US9187546B2 (en) | Compositions and methods for the preparation of protease resistant human growth hormone glycosylation mutants | |
US20210100876A1 (en) | Method of Treating of Fibroblast Growth Factor 21 (FGF-21) Deficiency | |
EP1694274B1 (de) | Glykopegylierter Granulocyten-Kolonie-stimulierender Faktor | |
KR101209111B1 (ko) | 글리코페질화 인자 나인 | |
US9050304B2 (en) | Methods of treatment using glycopegylated G-CSF | |
US8791066B2 (en) | Branched PEG remodeling and glycosylation of glucagon-like peptide-1 [GLP-1] | |
US7338933B2 (en) | O-linked glycosylation of peptides | |
US20150111245A1 (en) | Glycopegylated follicle stimulating hormone | |
US20080318850A1 (en) | Glycopegylated Factor Ix |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AS | Assignment |
Owner name: NEOSE TECHNOLOGIES, INC., PENNSYLVANIA Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:DEFREES, SHAWN;REEL/FRAME:017857/0225 Effective date: 20060410 |
|
AS | Assignment |
Owner name: NOVO NORDISK A/S, DENMARK Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:NEOSE TECHNOLOGIES, INC.;REEL/FRAME:022441/0937 Effective date: 20090127 Owner name: NOVO NORDISK A/S,DENMARK Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:NEOSE TECHNOLOGIES, INC.;REEL/FRAME:022441/0937 Effective date: 20090127 |
|
STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |