WO2020159169A2 - 당화된 ag85a 단백질을 포함하는 결핵 예방용 백신 조성물 및 이의 제조방법 - Google Patents

당화된 ag85a 단백질을 포함하는 결핵 예방용 백신 조성물 및 이의 제조방법 Download PDF

Info

Publication number
WO2020159169A2
WO2020159169A2 PCT/KR2020/001230 KR2020001230W WO2020159169A2 WO 2020159169 A2 WO2020159169 A2 WO 2020159169A2 KR 2020001230 W KR2020001230 W KR 2020001230W WO 2020159169 A2 WO2020159169 A2 WO 2020159169A2
Authority
WO
WIPO (PCT)
Prior art keywords
tuberculosis
ag85a
protein
seq
glycated
Prior art date
Application number
PCT/KR2020/001230
Other languages
English (en)
French (fr)
Other versions
WO2020159169A3 (ko
Inventor
이용직
손은주
신성재
김홍민
조관구
오명열
Original Assignee
주식회사 바이오앱
연세대학교 산학협력단
주식회사 큐라티스
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 주식회사 바이오앱, 연세대학교 산학협력단, 주식회사 큐라티스 filed Critical 주식회사 바이오앱
Priority to CN202080011317.9A priority Critical patent/CN113365655A/zh
Priority to JP2021543360A priority patent/JP7233662B2/ja
Priority to US17/426,275 priority patent/US20220088167A1/en
Priority to EP20748794.3A priority patent/EP3919075A4/en
Publication of WO2020159169A2 publication Critical patent/WO2020159169A2/ko
Publication of WO2020159169A3 publication Critical patent/WO2020159169A3/ko

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/02—Bacterial antigens
    • A61K39/04—Mycobacterium, e.g. Mycobacterium tuberculosis
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04—Antibacterial agents
    • A61P31/06—Antibacterial agents for tuberculosis
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • C07K14/35—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Mycobacteriaceae (F)
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
    • C12N15/8241—Phenotypically and genetically modified plants via recombinant DNA technology
    • C12N15/8242—Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits
    • C12N15/8257—Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits for the production of primary gene products, e.g. pharmaceutical products, interferon
    • C12N15/8258—Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits for the production of primary gene products, e.g. pharmaceutical products, interferon for the production of oral vaccines (antigens) or immunoglobulins
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/57—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/57—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
    • A61K2039/572—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 cytotoxic response
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/50—Fusion polypeptide containing protease site

Definitions

  • the present invention relates to a vaccine composition for preventing tuberculosis comprising a glycosylated Ag85A protein, a vector for preparing the protein, a transformant using the vector, and a method for producing a glycosylated Ag85A protein using the transformant, etc. will be.
  • Tuberculosis is one of the three major infectious diseases prescribed by the WHO and was discovered by microbiologist Robert Koch in 1882 and is a fatal disease with high incidence and mortality caused by Mycobacerium tuberculosis. About 60 million people worldwide are infected with active tuberculosis, and it is estimated that about 50 to 100 million new cases of tuberculosis occur annually, and at least 9 million new cases of tuberculosis occur annually, and more than 1.5 million people per year. It is known that he dies from tuberculosis. The incidence of tuberculosis is 146 per 100,000 people and the mortality rate of tuberculosis is 49 per 100,000 people, making it the most common cause of death among single infectious diseases and remains a serious health problem worldwide.
  • Host organisms include bacteria, yeast, insects, and eukaryotic organisms such as mammalian and plant cells.
  • bacteria can produce relatively large amounts of protein, they often make insoluble inclusion bodies and also have limitations in the post-translational transformation process.
  • eukaryotic cell expression systems may produce proteins that are not the same as the originally intended protein due to different post-translational processes, but can attach sugar to the protein and perform post-translational processing.
  • Plant production systems are currently commercially used to synthesize foreign proteins, and post-translational modifications of plant cells are very similar to those done in animal cells, so that they can accurately produce multimeric proteins.
  • amino acid residues that are glycosylated occur the same as in the original protein.
  • the process of N-linked glycan in the secretion pathway of plant cells shows various types of glycation than those produced in animal expression systems, but the activity of glycoproteins is often maintained.
  • Vaccines that are currently attempted to be developed using plants are mainly antigens composed of proteins that perform adhesion functions essential for mucosal infections of bacteria or viruses, toxin proteins that display bacterial toxicity, and proteins that form viruses.
  • the main enzyme that produces a substance or a causative agent causing disease is used as an antigen.
  • a recombinant antigen protein derived from a plant has a structure having the same function as an animal-derived vaccine, and various and in-depth studies applying it are required.
  • the present inventors performed an experiment on the immune response and protective efficacy against tuberculosis by immunizing mice with glycated Ag85A antigen protein and non-glycosylated Ag85A antigen protein. As a result, glycated Ag85A was not expressed in plant cells. The present invention was completed by experimentally confirming that the tuberculosis defense effect is superior to that of Ag85A.
  • an object of the present invention is to provide a vaccine composition for preventing tuberculosis, which contains a glycated Ag85A protein comprising the amino acid sequence of SEQ ID NO: 1.
  • the present invention provides a vaccine composition for preventing tuberculosis, which contains a glycated Ag85A protein comprising the amino acid sequence of SEQ ID NO: 1.
  • the glycated Ag85A protein can induce inhibition of lung tissue damage infected by Mycobacterium tuberculosis.
  • the glycated Ag85A protein can induce a decrease in the number of Mycobacterium tuberculosis in the lung.
  • the glycosylated Ag85A protein is selected from the group consisting of IFN- ⁇ (Interferon- ⁇ ), TNF- ⁇ (tumor necrosis factor- ⁇ ), and IL-2 (Interleukin-2). It can induce an increase in CD4 + CD44 + T cells secreting the above cytokines simultaneously.
  • the glycosylated Ag85A protein is selected from the group consisting of IFN- ⁇ (Interferon- ⁇ ), TNF- ⁇ (tumor necrosis factor- ⁇ ), and IL-2 (Interleukin-2). It can induce an increase in CD8 + CD44 + T cells secreting the above cytokines simultaneously.
  • the present invention is a gene encoding a glycated Ag85A protein comprising the amino acid sequence of SEQ ID NO: 1; And a gene encoding cellulose binding module 3 (hereinafter referred to as CBM3), which includes the nucleotide sequence of SEQ ID NO:2.
  • CBM3 cellulose binding module 3
  • the present invention is a gene encoding a glycated Ag85A protein comprising the amino acid sequence of SEQ ID NO: 1; A gene encoding cellulose binding module 3 (CBM3), comprising the nucleotide sequence of SEQ ID NO: 2; And it provides a vaccine expression vector for preventing tuberculosis, comprising a gene encoding a BiP signal peptide (signal peptide), comprising the nucleotide sequence of SEQ ID NO: 3.
  • CBM3 cellulose binding module 3
  • the present invention is a gene encoding a glycated Ag85A protein comprising the amino acid sequence of SEQ ID NO: 1; A gene encoding cellulose binding module 3 (CBM3), comprising the nucleotide sequence of SEQ ID NO: 2; And it provides a vaccine expression vector for preventing tuberculosis, comprising a gene encoding the HDEL peptide, comprising the nucleotide sequence of SEQ ID NO: 4.
  • CBM3 cellulose binding module 3
  • the vector may further include a sequence recognized and cleaved by enterokinase, comprising the nucleotide sequence of SEQ ID NO: 5.
  • the vector may further include a gene encoding a linking peptide comprising the nucleotide sequence of SEQ ID NO: 6.
  • the present invention provides a transformant for producing a vaccine for preventing tuberculosis transformed with the vector.
  • the transformant may be a plant.
  • the plant is Arabidopsis, soybean, tobacco, eggplant, pepper, potato, tomato, Chinese cabbage, radish, cabbage, lettuce, peach, pear, strawberry, watermelon, melon, cucumber, carrot and celery
  • the present invention (a) culturing the transformant
  • (B) provides a method for producing a vaccine composition for preventing tuberculosis, comprising the step of isolating and purifying the glycated Ag85A protein from the transformant or the culture medium.
  • the present invention provides a method for preventing tuberculosis, comprising administering to a subject a vaccine composition containing a glycosylated Ag85A protein comprising the amino acid sequence of SEQ ID NO: 1.
  • the present invention provides a tuberculosis prevention use of a vaccine composition containing a glycated Ag85A protein comprising the amino acid sequence of SEQ ID NO: 1.
  • the present invention provides a use for preparing a vaccine used for preventing tuberculosis of a glycated Ag85A protein comprising the amino acid sequence of SEQ ID NO: 1.
  • the vaccine composition comprising the glycated Ag85A protein of the present invention is useful as a vaccine for preventing tuberculosis because it has an effect of inducing multifunctional T cell secretion simultaneously secreting IFN- ⁇ , TNF- ⁇ and IL-2, which are important for the tuberculosis defense effect. Further, the glycosylated Ag85A protein can be effectively expressed in plants and separated with a high yield using a vector optimized for protein production, thereby enabling mass production at low cost.
  • FIG. 1 shows an arrangement of genes for expression of glycated Ag85A protein according to an embodiment of the present invention.
  • Figure 2 is a result of performing a Western blot to confirm the glycosylation of the plant expression Ag85A protein.
  • 5A to 5C are results comparing the ratio of T cells secreting one or more cytokines by antigen stimulation such as Ag85A protein in mice 4 weeks after the final immunization.
  • Figure 6a shows the results of observation by the visual examination and H&E (hematoxylin-eosin) staining method of lung tissue after infection of tuberculosis bacteria in immunized mice.
  • H&E hematoxylin-eosin
  • Figure 6b is a result of measuring the CFU (colony forming unit) in the lungs and spleen 4 weeks and 12 weeks after infection with tuberculosis bacteria in the immunized mouse.
  • CFU colony forming unit
  • Figures 7a to 7c is a result of comparing the proportion of T cells secreting one or more cytokines 4 weeks after infection with tuberculosis bacteria in immunized mice.
  • Figure 8 shows the results of operating the prediction program for glycosylation using the amino acid sequence of SEQ ID NO: 1 used in the present invention.
  • the present inventors performed an experiment on immune responses and protective efficacy against tuberculosis by immunizing mice with glycated Ag85A antigen protein and non-glycosylated Ag85A antigen protein. As a result, glycated Ag85A expressed in plant cells was not glycosylated. The present invention was completed by experimentally confirming that the tuberculosis defense effect is superior to that of Ag85A.
  • the protein produced by using the Ag85A expression vector expressed in plants was isolated and purified to produce glycated Ag85A in plants (see Example 1).
  • Western blot was performed to confirm that the Ag85A protein produced in the plant was glycated, and as a result, the glycan cleavage was confirmed to confirm that the plant-expressed Ag85A protein was glycated (see Example 2). .
  • the present invention provides a glycated Ag85A protein comprising the amino acid sequence of SEQ ID NO: 1.
  • Ag85A used in the present invention is one of the antigens that have been extensively studied and is known to exhibit an effective effect not only as a protein but also as a DNA vaccine.
  • glycosylation used in the present invention is a post-protein translation process of cells (eukaryotes), which is divided into N-glycosylation and O-glycosylation, which differs depending on the attached functional group and lactose, etc.
  • the process of attaching the sugar of the whole is called "glycation”.
  • the oligosaccharide When the oligosaccharide is connected to the protein through the saccharification process, the protein undergoes a “folding” process to form a three-dimensional structure, which gives stability that the protein cannot be released for a long time.
  • the oligosaccharide attached to the protein goes to the cell membrane to become a cell membrane protein, and it has the same effect as an antigen.
  • glycosylated protein as described above is called a glycoprotein.
  • Representative glycoproteins include antibodies that play an important role in the immune response.
  • the present invention provides a vaccine composition for preventing tuberculosis, comprising a glycated Ag85A protein comprising the amino acid sequence of SEQ ID NO: 1.
  • antigen used in the present invention refers to all substances that cause an immune response in the body, preferably viruses, compounds, bacteria, pollen, cancer cells, shrimp, etc., or some peptides or proteins thereof, If it is a substance capable of causing an immune response in the body, it is not limited thereto.
  • the term "vaccine” used in the present invention is a biological agent containing an antigen that causes an immune response in a living body.
  • the animal is a human or non-human animal, and the non-human animal refers to pigs, cows, horses, dogs, goats, sheep, and the like, but is not limited thereto.
  • the term "vaccine composition” used in the present invention may be formulated and used in the form of oral dosage forms, such as powders, granules, tablets, capsules, suspensions, emulsions, syrups, aerosols, and sterile injectable solutions, according to a conventional method. have. When formulated, it can be prepared using diluents or excipients such as fillers, extenders, binders, wetting agents, disintegrating agents, surfactants, etc., which are usually used. Solid preparations for oral administration include tablets, pills, powders, granules, capsules, etc. These solid preparations include at least one excipient such as starch, calcium carbonate, sucrose in the lecithin-like emulsifier.
  • compositions for oral administration can be prepared by mixing (sucrose) or lactose, gelatin, and the like. It is also possible to use lubricants, such as magnesium stearate, in addition to simple excipients.
  • lubricants such as magnesium stearate
  • suspending agents such as intravenous solutions, emulsions, syrups, etc. can be used.
  • various excipients such as wetting agents, sweeteners, fragrances, preservatives, etc. Can be included.
  • Formulations for non-oral administration include sterile aqueous solutions, non-aqueous agents, suspensions, emulsions, and lyophilized preparations.
  • Non-aqueous preparations, suspensions may include propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable esters such as ethyl oleate.
  • it may further include a conventionally known "immunoantigen adjuvant (adjuvant)".
  • the adjuvant may be used without limitation as long as it is known in the art, but may further increase immunity, for example, further comprising Freund's complete adjuvant or incomplete adjuvant.
  • the vaccine composition or pharmaceutical composition of the present invention is formulated in the form of an oral dosage form such as a powder, a granule, a tablet, a capsule, a suspension, an emulsion, a syrup, an aerosol, an external preparation, a suppository, or a sterile injection solution, respectively, according to a conventional method.
  • an oral dosage form such as a powder, a granule, a tablet, a capsule, a suspension, an emulsion, a syrup, an aerosol, an external preparation, a suppository, or a sterile injection solution, respectively, according to a conventional method.
  • the route of administration of the vaccine composition according to the present invention is not limited to these, but oral, intravenous, intramuscular, intraarterial, intramedullary, intrathecal, intracardiac, transdermal, subcutaneous, intraperitoneal, intranasal, intestinal, topical, This includes sublingual or rectal. Oral or parenteral administration is preferred.
  • parenteral as used herein includes subcutaneous, intradermal, intravenous, intramuscular, intraarticular, synovial, intrasternal, intrathecal, intralesional and intracranial injection or infusion techniques.
  • the vaccine composition of the present invention can also be administered in the form of suppositories for rectal administration.
  • the dosage of the vaccine composition or pharmaceutical composition according to the present invention is selected in consideration of the age, weight, sex, and physical condition of the individual.
  • the amount required to induce an immune protective response in an individual without significant side effects may vary depending on the presence of recombinant proteins and excipients used as immunogens.
  • each dose contains 0.1 to 1000 ⁇ g of protein, preferably 0.1 to 100 ⁇ g per ml of sterile solution of the recombinant protein of the present invention.
  • the initial dose may be followed by optionally repeated antigen stimulation.
  • adjuvant generally refers to any substance that increases the humoral and/or cellular immune response to an antigen.
  • prevention used in the present invention means all actions to inhibit tuberculosis or delay the onset of disease by administration of the glycated Ag85A protein according to the present invention.
  • tuberculosis refers to ocular tuberculosis, skin tuberculosis, adrenal tuberculosis, kidney tuberculosis, epididymal tuberculosis, lymphatic tuberculosis, laryngeal tuberculosis, middle ear tuberculosis, intestinal tuberculosis, multidrug-resistant tuberculosis, pulmonary tuberculosis, bile tuberculosis, bone tuberculosis, throat tuberculosis, lymphatic tuberculosis , Lung disease, breast tuberculosis and spinal tuberculosis.
  • inhibitor inhibition
  • tuberculosis in advance by administering the glycated Ag85A protein according to the present invention.
  • the present invention provides a method for preventing tuberculosis, comprising administering to a subject a vaccine composition containing a glycosylated Ag85A protein comprising the amino acid sequence of SEQ ID NO: 1.
  • the present invention provides a tuberculosis prevention use of a vaccine composition containing a glycated Ag85A protein comprising the amino acid sequence of SEQ ID NO: 1.
  • the present invention provides the use of a glycated Ag85A protein comprising the amino acid sequence of SEQ ID NO: 1 to produce a vaccine for use in the prevention of tuberculosis.
  • ⁇ refers to a subject to which the glycated Ag85A protein of the present invention can be administered, and the subject is not limited.
  • administration means providing a vaccine composition of the present invention to an individual in any suitable way.
  • the glycated Ag85A protein can induce inhibition of lung tissue damage infected by Mycobacterium tuberculosis.
  • the glycated Ag85A protein can induce a decrease in the number of Mycobacterium tuberculosis in the lung.
  • the glycated Ag85A protein secretes two or more cytokines simultaneously selected from the group consisting of IFN- ⁇ (Interferon- ⁇ ), TNF- ⁇ (tumor necrosis factor- ⁇ ), and IL-2 (Interleukin-2).
  • IFN- ⁇ Interferon- ⁇
  • TNF- ⁇ tumor necrosis factor- ⁇
  • IL-2 Interleukin-2
  • the T cells may be CD4 + CD44 + T cells, or CD8 + CD44 + T cells, but are not limited thereto.
  • the present invention provides a gene encoding a glycated Ag85A protein comprising the amino acid sequence of SEQ ID NO: 1; And comprising a gene encoding the cellulose binding module 3 (cellulose binding module 3; CBM3), comprising the nucleotide sequence of SEQ ID NO: 2, provides a vector for the prevention of tuberculosis vaccine expression.
  • expression vector used in the present invention refers to a vector capable of expressing a peptide or protein encoded by a heterologous nucleic acid inserted in a vector, preferably expressing a glycosylated Ag85A protein. It means a vector prepared to be able to.
  • the "vector” refers to any medium for introduction and/or transfer of a base into a host cell in vitro, in vivo, or in vivo, and a replication unit capable of binding other DNA fragments to obtain replication of the bound fragments ( can be a replicon, and a “replica unit” is any genetic unit (eg, plasmid, phage, cosmid, that functions as an autologous unit of DNA replication in vivo, ie, is capable of replication by self-regulation). Chromosome, virus, etc.).
  • the recombinant expression vector of the present invention is preferably a promoter that is an RNA polymerase-binding transcription initiator, any operator sequence for controlling transcription, a sequence encoding a suitable mRNA ribosomal binding site, and termination of transcription and translation.
  • It may include a sequence, a terminator, and the like, more preferably, may further include a 5'UTR site gene of M17 to increase the amount of protein synthesis, such as pEMU promoter, MAS as an example of the promoter Promoter, histone promoter, Clp promoter, 35S promoter from cauliflower mosaic virus, 19S RNA promoter from cauliflower mosaic virus, plant actin protein promoter, ubiquitin protein promoter, CMV (Cytomegalovirus) promoter , SV40 (Simian virus 40) promoter, RSV (Respiratory syncytial virus) promoter, EF-1 ⁇ (Elongation factor-1 alpha) promoter, etc.
  • pEMU promoter MAS as an example of the promoter Promoter
  • histone promoter histone promoter
  • Clp promoter 35S promoter from cauliflower mosaic virus
  • 19S RNA promoter from cauliflower mosaic virus
  • plant actin protein promoter ubiquitin protein promoter
  • CMV Cytomegalovirus
  • the terminator is, for example, nopaline synthase (NOS), rice amylase RAmy1
  • NOS nopaline synthase
  • rice amylase RAmy1 The terminator A, the paseoolin terminator, the terminator of the Agrobacterium tomafaciens octopine gene, the Escherichia coli rrnB1/B2 terminator, and the like, but the examples are not limited thereto.
  • the present invention is a gene encoding a glycated Ag85A protein comprising the amino acid sequence of SEQ ID NO: 1; A gene encoding cellulose binding module 3 (CBM3), comprising the nucleotide sequence of SEQ ID NO: 2; And it provides a vaccine expression vector for preventing tuberculosis, comprising a gene encoding a BiP signal peptide (signal peptide), comprising the nucleotide sequence of SEQ ID NO: 3.
  • CBM3 cellulose binding module 3
  • the present invention is a gene encoding a glycated Ag85A protein comprising the amino acid sequence of SEQ ID NO: 1; A gene encoding cellulose binding module 3 (CBM3), comprising the nucleotide sequence of SEQ ID NO: 2; And it provides a vaccine expression vector for preventing tuberculosis, comprising a gene encoding the HDEL peptide, comprising the nucleotide sequence of SEQ ID NO: 4.
  • CBM3 cellulose binding module 3
  • the vector may further include a sequence recognized and recognized by enterokinase containing the nucleotide sequence of SEQ ID NO: 5.
  • the vector may further include a gene encoding a linking peptide comprising the nucleotide sequence of SEQ ID NO: 6.
  • the vector is composed of a gene encoding CBM3, a gene encoding a linking peptide, an enterokinase cleavage site, and a gene encoding Ag85A protein, and in the plant cell at the 3'end of the CBM3
  • a gene encoding a BiP signal peptide capable of targeting a target protein into a vesicle may be linked, and a HDEL (His-Asp) that allows a vector to be retained in the vesicle at the carboxyl end of the target protein-encoding gene.
  • -Glu-Leu may be linked, but is not limited thereto.
  • the present invention provides a transformant for the production of a vaccine for preventing tuberculosis transformed with the glycosylated Ag85A protein expression vector.
  • transformation used in the present invention collectively refers to a change in the genetic properties of an organism by the injected DNA
  • transgenic organism refers to the injection of an external gene by a molecular genetic method.
  • a living organism prepared by it is preferably a living organism transformed by the recombinant expression vector of the present invention
  • the living organism is a microorganism, eukaryotic cells, insects, animals, plants, if there is no life, there is no limitation, preferably E. coli , Salmonella, Bacillus, yeast, animal cells, mice, rats, dogs, monkeys, pigs, horses, cows, Acrobacterium tumefaciens, plants and the like.
  • the transformants include transformation, transfection, Agrobacterium-mediated transformation methods, particle gun bombardment, sonication, and electroporation.
  • PEG Polyethylen glycol
  • the transformant in the present invention is preferably a plant.
  • Producing useful substances in plants has several advantages: 1) can significantly reduce production costs, and 2) can occur in conventional popular methods (separate and purify proteins synthesized from animal cells or microorganisms). Contaminants (viruses, oncogenes, enterotoxins, etc.) can be excluded from the source, and 3) It has an advantage in that it is possible to manage seed stock as seeds, unlike animal cells or microorganisms, in the commercialization stage. In addition, 4) If the demand for the corresponding material increases rapidly, it is also advantageous in terms of facility technology or cost required for mass production compared to the existing animal cell system.
  • the plant is selected from the group consisting of Arabidopsis thaliana, soybean, tobacco, eggplant, pepper, potato, tomato, cabbage, radish, cabbage, lettuce, peach, pear, strawberry, watermelon, melon, cucumber, carrot and celery.
  • the present invention (a) culturing the transformant
  • (B) provides a method for producing a vaccine composition for preventing tuberculosis, comprising the step of isolating and purifying the glycated Ag85A protein from the transformant or the culture medium.
  • Sequence number order 1 (amino acid sequence of Ag85A protein) FSRPGLPVEYLQVPSPSMGRDIKVQFQSGGANSPALYLLDGLRAQDDFSGWDINTPAFEWYDQSGLSVVMPVGGQSSFYSDWYQPACGKAGCQTYKWETFLTSELPGWLQANRHVKPTGSAVVGLSMAASSALTLAIYHPQQFVYAGAMSGLLDPSQAMGPTLIGLAMGDAGGYKASDMWGPKEDPAWQRNDPLLNVGKLIANNTRVWVYCGNGKPSDLGGNNLPAKFLEGFVRTSNIKFQDAYNAGGGHNGVFDFPDSGTHSWEYWGAQLNAMKPDLQRALGATPNTGPAPQGAGSGSGS 2 (base sequence of CBM3) GTATCAGGTAACCTTAAGGTGGAGTTTTACAACTCGAACCCTTCTGATACAACTAACTCAATAAACCCACAGTTCAAAGTTACAAACACAGGCAGCTCTGCGATCGATCG
  • a recombinant plant expression vector was constructed so that the plant can express CBM3 fusion Ag85A.
  • the target protein can be transferred to the vesicle using a BiP signal peptide so that the CBM3 fusion Ag85A protein can be transferred to the vesicle, and the HDEL at the carboxyl terminal is used to allow the fusion protein to accumulate in the vesicle. (His-Asp-Glu-Leu) was bound and preserved in the endoplasmic reticulum.
  • a recombinant vector is prepared by combining CBM3, a sequence encoding a linking peptide, and a sequence recognized by enterokinase for cleavage of a fusion protein in front of the gene encoding Ag85A, and then inserting it into the plant expression vector pCAMBIA 1300. (See FIG. 1).
  • the plant expression vector prepared in Example 1-1 was transformed into the Agrobacterium strain LBA4404 using electroshock (Electrophoration). After transforming the transformed agrobacterium in 5 ml of YEP liquid medium (10 g of yeast extract, 10 g of peptone, 5 g of NaCl, 50 mg/L of kanamycin, 25 mg/L of rifampicin) and shaking culture for 16 hours at 28°C. 1 ml of the primary culture solution was inoculated into 50 ml of fresh YEP medium and shake cultured at 28° C. for 6 hours.
  • YEP liquid medium 10 g of yeast extract, 10 g of peptone, 5 g of NaCl, 50 mg/L of kanamycin, 25 mg/L of rifampicin
  • the agrobacteria cultured as above were collected by centrifugation (7,000 rpm, 4°C, 5 minutes), followed by an infiltration buffer (10 mM MES (pH 5.7), 10 mM MgCl2, 200 ⁇ M acetosyringon (acetosyringone)) OD at a wavelength of 600 nm It was suspended again at a concentration of 1.0.
  • Agro-infiltration was performed by injecting the Agrobacteria suspension into the back side of the leaves of Nicotiana benthamiana using a syringe with a needle removed.
  • Protein extraction buffer 50mM Tris (pH 7.2), 150mM NaCl, 0.1% Triton X-100, 1X protease inhibitor 50 mL in 10 g of Nicotiana Ventamia prepared in Example 1-2
  • the protein extract was recovered by centrifugation at 4°C for 20 minutes at 13,000 rpm.
  • the mixture was well mixed at 4° C. for 1 hour so that the CBM3 fused Ag85A protein was bound to the microcrystalline cellulose.
  • CBM3 fused Ag85A protein-coupled microcrystalline cellulose was recovered by centrifugation at 13,000 rpm for 10 minutes at 4°C, then washed twice with 50 mL of wash buffer (50 mM Tris (pH 7.2), 150 mM NaCl) and 10 mL of It was suspended again in the enterokinase reaction solution (50 mM Tris (pH 7.2), 150 mM NaCl, 1 mM CaCl2). After adding 20 units of enterokinase to the suspension and reacting for 4 hours at 28° C., the reaction solution containing enterokinase and Ag85A was separated from cellulose through centrifugation (14,000 rpm, 4° C., 10 minutes).
  • STI-Sepharose was added to the reaction solution and reacted at 4°C for 1 hour, followed by centrifugation (14,000rpm, 4°C, 10 minutes), followed by separation and purification without binding to STI-Sepharose. Ag85A was obtained.
  • Endo-H (NEB, Cat. No. P0702S) and PNGase F (NEB, Cat. No. P0704S) were used to determine whether Ag85A was glycosylated.
  • 1 ug of purified Ag85A protein was mixed with 1 uL of 10X (multiple) glycoprotein denaturing buffer (5% SDS, 400 mM DTT) and filled with distilled water to make a final volume of 10 uL. It was prepared as much as possible.
  • 10X multiple glycoprotein denaturing buffer
  • reaction solution was denatured by placing it in boiling water for 10 minutes, then placed on ice for a while to cool gently, then 10X Glycobuffer 3 (500 mM sodium acetate, pH 6) 2 uL and Endo-H enzyme 1 uL , And 7uL of distilled water were added to the reaction solution, respectively, and reacted at 37°C for 1 hour.
  • 10X Glycobuffer 3 500 mM sodium acetate, pH 6)
  • Endo-H enzyme 1 uL distilled water were added to the reaction solution, respectively, and reacted at 37°C for 1 hour.
  • Treatment of PNGase F was performed in the same way as Endo-H in the above denaturing process, 2 uL of 10X Glycobuffer 2 (500 mM sodium phosphate, pH 7.5) and 2 ⁇ L of 10% NP-40.
  • mice Using mouse lung cells infected with Mycobacterium tuberculosis, the degree of IFN- ⁇ secretion was investigated to determine whether the antigen acts as an antigen when it is actually infected with Mycobacterium tuberculosis.
  • Beijing strain HN878 Mycobacterium tuberculosis 200 CFU colony forming unit
  • 6 mice are sacrificed, respectively, with non-infected controls, and lung cells (5X10 5 cells) are sacrificed. Separated and produced by E.
  • G-Ag85A glycosylated Ag85A
  • the plant expression Ag85A (G-Ag85A) was confirmed to continuously secrete IFN- ⁇ by acting on mouse lung cells 4 weeks or 12 weeks after infection with Mycobacterium tuberculosis. It was confirmed that the amount was increased to a significant level compared to NG-Ag85A).
  • mice were immunized with BCG, NG-Ag85A, and G-Ag85A three times every two weeks. Mice were sacrificed 4 weeks after the final immunization (2 weeks before the TB immunization), 4 weeks after the immunization, and 12 weeks after the immunization, to investigate the immune response and protective efficacy (see FIG. 4).
  • Multifunctional T cells are known to be one of the important host components for the defense against tuberculosis and are T cells that secrete all of IFN- ⁇ , TNF- ⁇ and IL-2.
  • 6 mice were sacrificed for each group to separate each lung cell (5X10 5 cells), and the NG-Ag85A or G-Ag85A antigen protein was 5ug/ml at a concentration of 5ug/ml for 12 hours at 37°C. To react.
  • CD4 + CD62L - and CD8 + CD62L - T cells secreting IFN- ⁇ , TNF- ⁇ , and/or IL-2 after the reaction were analyzed by cytometry, wherein gating for CD4 + and CD8 + (gating) The results were confirmed.
  • HN878 was infected with 200 CFU of Mycobacterium tuberculosis, and then 4 and 12 weeks later, the mice were sacrificed to visually examine lung tissue lesions and to investigate CFU (colony forming unit) in lung and spleen cells. Did.
  • the degree of lung tissue damage in the G-Ag85A group was less than that in the BCG or NG-Ag85A group, even by visual observation, and in the observation by H&E (hematoxylin-eosin) staining, the G-Ag85A group It was confirmed that the degree of tissue damage was mild, indicating that the protective effect of G-Ag85A was better. In particular, after 12 weeks after infection, it was confirmed that the effect of the degree of defense was clearly confirmed by the naked eye.
  • lung and spleen tissues were cultured by crushing, and the bacteria were enumerated and calculated as log10CFU to be used for statistical analysis.
  • mice in each group were sacrificed to separate each lung cell (5X10 5 cells) and NG-Ag85A Alternatively, the G-Ag85A antigen protein was reacted at a concentration of 5 ug/ml for 12 hours at 37°C. After the reaction, CD4 + CD62L - and CD8 + CD62L - T cells secreting IFN- ⁇ , TNF- ⁇ , and/or IL-2 were analyzed by cytometry, and gating for CD4 + and CD8 + was performed. The results were confirmed.
  • CD4 + CD44 + T cells increased the poly-cytokine secretion ratio to a significant level compared to the NG-Ag85A group, especially in the tuberculosis defense effect. It was confirmed that CD4 + CD44 + multifunctional T cells secreting important IFN- ⁇ , TNF- ⁇ , and IL-2 simultaneously increased to a significant level.
  • the glycosylated Ag85A protein according to the present invention can be usefully used as a vaccine for preventing tuberculosis, and furthermore, it can be effectively expressed in plants and separated with a high yield using a vector optimized for the production of the protein, so that it can be mass produced at low cost. It is expected to be possible.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Medicinal Chemistry (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Molecular Biology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Engineering & Computer Science (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Communicable Diseases (AREA)
  • Public Health (AREA)
  • Pulmonology (AREA)
  • Immunology (AREA)
  • Microbiology (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Engineering & Computer Science (AREA)
  • Biotechnology (AREA)
  • Biomedical Technology (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Mycology (AREA)
  • Epidemiology (AREA)
  • Oncology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Plant Pathology (AREA)
  • Physics & Mathematics (AREA)
  • Cell Biology (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)

Abstract

본 발명은 당화된 Ag85A 단백질을 포함하는 결핵 예방용 백신 조성물, 상기 단백질의 제조를 위한 벡터, 상기 벡터를 이용한 형질전환체, 및 상기 형질전환체를 이용하여 당화된 Ag85A 단백질을 생산하는 방법 등에 관한 것으로, 본 발명의 당화된 Ag85A 단백질을 포함하는 백신 조성물은, 결핵 방어 효과에 중요한 IFN-γ, TNF-α 및 IL-2를 동시에 분비하는 다기능성 T세포 증가를 유도하는 효과가 있어 결핵 예방용 백신으로 유용하게 이용될 수 있으며, 나아가, 상기 당화된 Ag85A 단백질은 단백질 생산에 최적화된 벡터를 이용하여 식물체에서 효과적으로 발현되고 높은 수율로 분리될 수 있어 저렴한 비용으로 대량 생산이 가능하다.

Description

당화된 AG85A 단백질을 포함하는 결핵 예방용 백신 조성물 및 이의 제조방법
본 발명은 당화된 Ag85A 단백질을 포함하는 결핵 예방용 백신 조성물, 상기 단백질의 제조를 위한 벡터, 상기 벡터를 이용한 형질전환체, 및 상기 형질전환체를 이용하여 당화된 Ag85A 단백질을 생산하는 방법 등에 관한 것이다.
본 출원은 2019년 01월 28일에 출원된 한국특허출원 제10-2019-0010431호에 기초한 우선권을 주장하며, 해당 출원의 명세서 및 도면에 개시된 모든 내용은 본 출원에 원용된다.
결핵은 WHO에서 규정한 3대 감염질환 중 하나로 1882년 미생물학자인 로베르트 코흐에 의해 발견되었으며, 마이코박테리움 튜버쿨로시스(Mycobacerium tuberculosis)에 의하여 유발되는 높은 발병률과 사망률을 보이는 치명적인 질병이다. 전 세계적으로 약 6천만명 환자가 활동성 결핵에 감염되어 있으며, 매년 약 5천만에서 1억여명이 새로 결핵에 감염되는 것으로 추정되고 있고, 적어도 매년 900만명 이상의 새로운 결핵 환자가 발생하며, 연간 150만명 이상이 결핵으로 사망한다고 알려졌다. 결핵 발병률은 인구 10만명당 146명, 결핵 사망률은 인구 10만명당 49명으로 단일 감염병 중에서 가장 많은 사망 원인을 차지하고 있어, 세계적으로 심각한 보건 문제로 남아 있다.
한편, 상기와 같은 결핵 예방을 위한 백신 제조와 관련하여 동물 단백질을 대량 생산하기 위한 의료산업계의 요구는 여러 가지 복잡한 단백질이나 펩타이드를 생산하기 위한 혼합 발현계의 개발이다. 기주생물(寄主生物)로는 세균에서부터 효모, 곤충, 포유동물과 식물세포와 같은 진핵생물 모두가 포함된다. 다만, 세균은 상대적으로 많은 양의 단백질을 생산할 수 있지만, 불용성 봉입체(Inclusion bodies)를 만드는 경우가 많으며, 또한 번역 후-변형공정에 한계가 있다. 반면에 진핵세포 발현계는 서로 다른 번역 후 공정으로 인해 원래 의도했던 단백질과 동일하지 않은 단백질을 만들 수도 있지만, 단백질에 당을 접합시킬 수 있고 번역 후 공정 과정을 수행할 수 있다. 식물 생산시스템은 현재 외래단백질을 합성하기 위하여 상업적으로 이용되고 있으며, 식물세포의 번역 후 변형은 동물세포에서 이루어지는 것과 매우 유사하여 정확하게 복합 단백질(Multimeric protein)을 생성할 수 있다. 식물 유래 동물단백질의 경우 당화(Glycosylation)되는 아미노산 잔기는 원래의 단백질에서와 동일하게 일어난다. 그러나 식물세포의 분비경로에 있는 N-linked glycan의 공정은 동물 발현계에서 생산된 것보다 다양한 형태의 당화를 보이지만, 당단백질의 활성은 그대로 유지되는 경우가 많다.
현재 식물을 이용하여 개발이 시도되는 백신은 병원성인 경우 세균이나 바이러스의 점막 감염에 필수적인 부착(Adhesion)기능을 수행하는 단백질과 세균의 독성을 나타내는 독소단백질, 바이러스의 구조를 이루는 단백질들이 항원으로 주로 이용되고 있으며, 비병원성 질병의 경우 질병을 야기하는 물질이나 원인 물질을 생산하는 주된 효소가 항원으로 이용되고 있다. 지금까지의 연구결과로 식물체에서 유래된 재조합 항원단백질은 동물 유래 백신과 동일한 기능을 갖는 구조를 가지고 있음이 보고되고 있어 이를 응용한 다양하고 심도 깊은 연구가 요구되고 있다.
본 발명자들은 당화된 Ag85A 항원 단백질 및 당화되지 않은 Ag85A 항원 단백질을 마우스에 면역접종 하여 면역반응 및 결핵에 대한 방어효능 등에 대한 실험을 수행한 결과, 식물 세포에서 발현되어 당화된 Ag85A의 경우 당화되지 않은 Ag85A에 비하여 결핵방어 효과가 뛰어남을 실험적으로 확인하여 본 발명을 완성하였다.
이에, 본 발명의 목적은 서열번호 1의 아미노산 서열을 포함하는 당화된 Ag85A 단백질을 함유하는, 결핵 예방용 백신 조성물을 제공하는 것이다.
그러나 본 발명이 이루고자 하는 기술적 과제는 이상에서 언급한 과제에 제한되지 않으며, 언급되지 않은 또 다른 과제들은 아래의 기재로부터 당해 기술분야의 통상의 기술자에게 명확하게 이해될 수 있을 것이다.
상기와 같은 발명의 목적을 달성하기 위하여, 본 발명은 서열번호 1의 아미노산 서열을 포함하는 당화된 Ag85A 단백질을 함유하는, 결핵 예방용 백신 조성물을 제공한다.
본 발명의 일 구현예로, 상기 당화된 Ag85A 단백질은 결핵균에 의해 감염된 폐 조직 손상 억제를 유도할 수 있다.
본 발명의 다른 구현예로, 상기 당화된 Ag85A 단백질은 폐에서 결핵균 수 감소를 유도할 수 있다.
본 발명의 또 다른 구현예로, 상기 당화된 Ag85A 단백질은 IFN-γ(Interferon-γ), TNF-α(tumor necrosis factor-α), 및 IL-2(Interleukin-2)으로 이루어진 군으로부터 선택된 2 이상의 사이토카인을 동시에 분비하는 CD4 +CD44 + T세포 증가를 유도할 수 있다.
본 발명의 또 다른 구현예로, 상기 당화된 Ag85A 단백질은 IFN-γ(Interferon-γ), TNF-α(tumor necrosis factor-α), 및 IL-2(Interleukin-2)으로 이루어진 군으로부터 선택된 2 이상의 사이토카인을 동시에 분비하는 CD8 +CD44 + T세포 증가를 유도할 수 있다.
또한, 본 발명은 서열번호 1의 아미노산 서열을 포함하는 당화된 Ag85A 단백질을 코딩하는 유전자; 및 서열번호 2의 염기 서열을 포함하는, 셀룰로오스 바인딩 모듈 3(cellulose binding module 3; 이하 CBM3)을 코딩하는 유전자를 포함하는, 결핵 예방용 백신 발현용 벡터를 제공한다.
또한, 본 발명은 서열번호 1의 아미노산 서열을 포함하는 당화된 Ag85A 단백질을 코딩하는 유전자; 서열번호 2의 염기 서열을 포함하는, 셀룰로오스 바인딩 모듈 3(cellulose binding module 3; CBM3)을 코딩하는 유전자; 및 서열번호 3의 염기 서열을 포함하는, BiP 신호 펩타이드(signal peptide)를 코딩하는 유전자를 포함하는, 결핵 예방용 백신 발현 벡터를 제공한다.
또한 본 발명은 서열번호 1의 아미노산 서열을 포함하는 당화된 Ag85A 단백질을 코딩하는 유전자; 서열번호 2의 염기 서열을 포함하는, 셀룰로오스 바인딩 모듈 3(cellulose binding module 3; CBM3)을 코딩하는 유전자; 및 서열번호 4의 염기 서열을 포함하는, HDEL 펩타이드를 코딩하는 유전자를 포함하는, 결핵 예방용 백신 발현 벡터를 제공한다.
본 발명의 일 구현예로, 상기 벡터는 서열번호 5의 염기 서열을 포함하는, 엔테로키나제(enterokinase)에 의해 인식되어 절단되는 서열을 추가로 포함할 수 있다.
본 발명의 다른 구현예로, 상기 벡터는 서열번호 6의 염기 서열을 포함하는, 연결 펩타이드를 코딩하는 유전자를 추가로 포함할 수 있다.
또한, 본 발명은 상기 벡터로 형질 전환된 결핵 예방용 백신 제조용 형질전환체를 제공한다.
본 발명의 일 구현예로, 상기 형질전환체는 식물체일 수 있다.
본 발명의 다른 구현예로, 상기 식물체는 애기장대, 대두, 담배, 가지, 고추, 감자, 토마토, 배추, 무, 양배추, 상추, 복숭아, 배, 딸기, 수박, 참외, 오이, 당근 및 샐러리로 이루어진 군 중에서 선택되는 하나 이상의 쌍자엽 식물; 또는 벼, 보리, 밀, 호밀, 옥수수, 사탕수수, 귀리 및 양파로 이루어진 군 중에서 선택되는 하나 이상의 단자엽 식물일 수 있다.
또한, 본 발명은 (a) 상기 형질전환체를 배양하는 단계; 및
(b) 상기 형질전환체 또는 배양액으로부터 당화된 Ag85A 단백질을 분리 및 정제하는 단계를 포함하는, 결핵 예방용 백신 조성물의 생산 방법을 제공한다.
또한, 본 발명은 서열번호 1의 아미노산 서열을 포함하는 당화된 Ag85A 단백질을 함유하는 백신 조성물을 개체에 투여하는 단계를 포함하는, 결핵 예방 방법을 제공한다.
또한, 본 발명은 서열번호 1의 아미노산 서열을 포함하는 당화된 Ag85A 단백질을 함유하는 백신 조성물의 결핵 예방 용도를 제공한다.
또한, 본 발명은 서열번호 1의 아미노산 서열을 포함하는 당화된 Ag85A 단백질의, 결핵 예방에 이용되는 백신을 제조하기 위한 용도를 제공한다.
본 발명의 당화된 Ag85A 단백질을 포함하는 백신 조성물은, 결핵 방어 효과에 중요한 IFN-γ, TNF-α 및 IL-2를 동시에 분비하는 다기능 T세포 증가를 유도하는 효과가 있어 결핵 예방용 백신으로 유용하게 이용될 수 있으며, 나아가, 상기 당화된 Ag85A 단백질은 상기 단백질 생산에 최적화된 벡터를 이용하여 식물체에서 효과적으로 발현되고 높은 수율로 분리될 수 있어 저렴한 비용으로 대량 생산이 가능하다.
도 1은 본 발명의 일 실시예에 따른 당화된 Ag85A 단백질의 발현을 위한 유전자의 배열을 나타낸 것이다.
도 2는 식물발현 Ag85A 단백질의 당화를 확인하기 위해 웨스턴 블랏을 수행한 결과이다.
도 3은 당화된 Ag85A 단백질의 백신항원으로서 가능성을 타진하기 위해 결핵균을 마우스에 감염시킨 뒤 IFN-γ 분비를 비교한 결과이다.
도 4는 당화된 Ag85A 단백질의 면역성 조사를 위해 설계된 실험방법을 간략히 나타낸 것이다.
도 5a 내지 5c는 최종 면역접종 4주 후 마우스에서 Ag85A 단백질 등의 항원 자극에 의하여 하나 이상의 사이토카인을 분비하는 T세포의 비율을 비교한 결과이다.
도 6a는 면역된 마우스에 결핵균을 감염시킨 후 폐의 조직을 육안검사 및 H&E(hematoxylin-eosin)염색법에 의한 관찰결과로 나타낸 것이다.
도 6b는 면역된 마우스에 결핵균을 감염시킨 후 4주 및 12주 후 폐와 비장에서 CFU(colony forming unit)를 측정한 결과이다.
도 7a 내지 7c는 면역된 마우스에 결핵균을 감염시키고 4주 후 하나 이상의 사이토카인을 분비하는 T세포의 비율을 비교한 결과이다.
도 8은 본 발명에 사용된 서열번호 1의 아미노산 서열을 이용하여 당화여부 예측 프로그램을 작동시킨 결과를 나타낸 것이다.
본 발명자들은 당화된 Ag85A 항원 단백질 및 당화되지 않은 Ag85A 항원 단백질을 마우스에 면역 접종하여 면역반응 및 결핵에 대한 방어효능 등에 대한 실험을 수행한 결과, 식물 세포에서 발현되어 당화된 Ag85A의 경우 당화되지 않은 Ag85A에 비하여 결핵 방어 효과가 뛰어남을 실험적으로 확인하여 본 발명을 완성하였다.
본 발명의 일 실시예에서는, 식물에서 발현되는 Ag85A 발현 벡터를 이용하여 생산된 단백질을 분리, 정제하여 당화된 Ag85A를 식물에서 생산 가능함을 확인하였다(실시예 1 참조).
본 발명의 다른 실시예에서는, 식물에서 생산된 Ag85A 단백질이 당화되었는지 확인하기 위해 웨스턴 블랏을 수행하였으며 그 결과, 글리칸의 절단을 확인하여 식물발현 Ag85A 단백질이 당화되었음을 확인하였다(실시예 2 참조).
본 발명의 또 다른 실시예에서는, 결핵균을 감염시킨 마우스를 이용하여 폐 세포에서 IFN-γ 분비를 측정한 결과, 지속적인 IFN-γ 분비를 확인하여 당화된 Ag85A의 백신 항원으로서 가능성을 타진하였다(실시예 3 참조).
본 발명의 또 다른 실시예에서는, 당화된 Ag85A 단백질의 면역원성을 조사한 결과 당화된 Ag85A 단백질로 면역된 마우스의 경우 IFN-γ, TNF-α, 및 IL-2를 동시에 분비하는 T세포의 비율이 증가함을 확인하였다(실시예 4 참조).
이하 본 발명을 상세히 설명한다.
본 발명은, 서열번호 1의 아미노산 서열을 포함하는 당화된 Ag85A 단백질을 제공한다.
본 발명에서 사용되는 용어 "Ag85A"는 광범위하게 연구되고 있는 항원중의 하나로, 단백질뿐 아니라 DNA 백신으로서도 유효한 효과를 나타내고 있다고 알려져 있다.
본 발명에서 사용하는 용어 "당화(glycosylation)"는 세포(진핵생물)의 단백질 번역 후 과정으로써 N-당화와 O-당화로 나뉘는데 이는 붙는 작용기에 따라 다르며 세포에서 생성된 단백질에 락토스(lactose) 등의 당이 붙는 과정을 통틀어 "당화"라고 한다. 당화 과정으로 당사슬이 단백질에 연결되면 단백질이 "폴딩"과정을 거쳐 입체적인 구조물을 형성하며 이는 단백질이 풀어지지 않고 오랫동안 유지될 수 있는 안정성을 부여한다. 또한 단백질에 붙어진 당사슬을 세포막으로 가서 세포막 단백질이 되어 항원과 같은 효과를 내기도 한다. 상기와 같이 당화된 단백질을 당단백질이라고 하는데 대표적인 당단백질에는 면역반응에서 중요한 역할을 하는 항체 등이 있다. 본 발명에 사용된 서열번호 1의 아미노산 서열을 이용하여 당화여부 예측 프로그램(http://www.cbs.dtu.dk/services/NetNGlyc/)을 작동시켜 본 결과 203번째 Asparagine(N)에서 N-당화가 일어날 것으로 예측되었으나(도 8 참조), 이에 제한되는 것은 아니고 본 발명과 동등한 효과를 갖는 범위 내에서 변형이 가능하다.
본 발명의 다른 양태로서, 본 발명은 서열번호 1의 아미노산 서열을 포함하는 당화된 Ag85A 단백질을 함유하는, 결핵 예방용 백신 조성물을 제공한다.
본 발명에서 사용하는 용어 "항원(antigen)"이란 체내에서 면역 반응을 일으키는 모든 물질을 총칭하며, 바람직하게는 바이러스, 화합물질, 세균, 꽃가루, 암세포, 새우 등 또는 이들의 일부 펩타이드 또는 단백질이나, 체내에서 면역 반응을 일으킬 수 있는 물질이라면 이에 제한되지 않는다.
본 발명에서 사용하는 용어 "백신(vaccine)"이란 생체에 면역 반응을 일으키는 항원을 함유하는 생물학적인 제제로서, 감염증의 예방을 위하여 사람이나 동물에 주사하거나 경구 투여함으로써 생체에 면역이 생기게 하는 면역원을 말한다. 상기 동물은 인간 또는 비인간 동물로서, 상기 비인간 동물은 돼지, 소, 말, 개, 염소, 양 등을 지칭하나, 이에 제한되지 않는다.
본 발명에서 사용하는 용어 "백신 조성물"은 각각 통상의 방법에 따라 산제, 과립제, 정제, 캡슐제, 현탁액, 에멀젼, 시럽, 에어로졸 등의 경구형 제형 및 멸균 주사용액의 형태로 제형화하여 사용될 수 있다. 제제화할 경우에는 보통 사용되는 충진제, 증량제, 결합제, 습윤제, 붕해제, 계면활성제 등의 희석제 또는 부형제를 사용하여 조제할 수 있다. 경구투여를 위한 고형제제에는 정제, 환제, 산제, 과립제, 캡슐제 등이 포함되며, 이러한 고형제제는 상기 레시틴 유사 유화제에 적어도 하나 이상의 부형제 예를 들면, 전분, 칼슘카보네이트(calcium carbonate), 슈크로스(sucrose) 또는 락토오스(lactose), 젤라틴 등을 섞어 조제할 수 있다. 또한 단순한 부형제 이외에 마그네슘 스티레이트 탈크 같은 윤활제들도 사용할 수 있다. 경구투여를 위한 액상제제로는 현탁제, 내용액제, 유제, 시럽제 등을 사용할 수 있으며, 흔히 사용되는 단순 희석제인 물, 리퀴드 파라핀 이외에 여러 가지 부형제, 예를 들면 습윤제, 감미제, 방향제, 보존제 등이 포함될 수 있다. 비 경구투여를 위한 제제에는 멸균된 수용액, 비수용성제, 현탁제, 유제, 동결건조제제가 포함된다. 비수용성제제, 현탁제로는 프로필렌글리콜(propylene glycol), 폴리에틸렌 글리콜, 올리브 오일과 같은 식물성 기름, 에틸올레이트와 같은 주사 가능한 에스테르 등이 사용될 수 있다. 또한, 추가로 기존에 알려져 있는 "면역항원보강제(adjuvant)"를 추가로 포함할 수 있다. 상기 보강제는 당해 기술분야에 알려진 것이라면 어느 것이나 제한없이 사용할 수 있으나, 예를 들어 프로인트(Freund)의 완전 보조제 또는 불완전 보조제를 더 포함하여 그 면역성을 증가시킬 수 있다.
본 발명의 백신 조성물 또는 약학적 조성물은 각각 통상의 방법에 따라 산제, 과립제, 정제, 캡슐제, 현탁액, 에멀전, 시럽, 에어로졸 등의 경구형 제형, 외용제, 좌제 또는 멸균 주사용액의 형태로 제형화하여 사용될 수 있다.
본 발명에 따른 백신 조성물의 투여 경로는 이들로 한정되는 것은 아니지만 구강, 정맥내, 근육내, 동맥내, 골수내, 경막내, 심장내, 경피, 피하, 복강내, 비강내, 장관, 국소, 설하 또는 직장이 포함된다. 경구 또는 비경구 투하가 바람직하다. 본원에 사용된 용어 "비경구"는 피하, 피내, 정맥내, 근육내, 관절내, 활액낭내, 흉골내, 경막내, 병소내 및 두개골 내 주사 또는 주입기술을 포함한다. 본 발명의 백신 조성물은 또한 직장 투여를 위한 좌제의 형태로 투여될 수 있다.
본 발명에 따른 백신 조성물 또는 약학적 조성물의 투여량은 개체의 연령, 체중, 성별, 신체 상태 등을 고려하여 선택된다. 별다른 부작용 없이 개체에 면역보호반응을 유도하기에 필요한 양은 면역원으로서 사용된 재조합 단백질 및 부형제의 임의 존재에 따라 다양할 수 있다. 일반적으로 각각의 용량은 본 발명의 재조합 단백질의 멸균용액 ㎖ 당 0.1 내지 1000 ㎍의 단백질, 바람직하게는 0.1 내지 100 ㎍을 함유한다. 백신 조성물의 경우에는 필요에 따라 초기 용량에 이어 임의로 반복된 항원자극을 수행할 수 있다.
본 발명에서 사용하는 용어 "면역항원보강제(adjuvant)"란 일반적으로 항원에 대한 체액 및/또는 세포 면역 반응을 증가시키는 임의의 물질을 지칭한다.
본 발명에서 사용하는 용어 "예방(prevention)"이란 본 발명에 따른 당화된 Ag85A 단백질 투여에 의해 결핵을 억제시키거나 발병을 지연시키는 모든 행위를 의미한다.
본 발명에서 "결핵"은 안 결핵, 피부 결핵, 부신 결핵, 신장 결핵, 부고환 결핵, 림프선 결핵, 후두 결핵, 중이 결핵, 장결핵, 다제내성 결핵, 폐결핵, 담결핵, 골결핵, 인후 결핵, 임파선 결핵, 폐허증, 유방 결핵 및 척추 결핵을 포함하며, 이에 제한되지 않는다.
본 발명에서 “억제(inhibition)”란 본 발명에 따른 당화된 Ag85A 단백질 투여에 의해 결핵을 미연에 방지하는 것, 경감시키는 것, 또는 치료하는 것을 포함하는 의미이다.
본 발명의 또 다른 양태로서, 본 발명은 서열번호 1의 아미노산 서열을 포함하는 당화된 Ag85A 단백질을 함유하는 백신 조성물을 개체에 투여하는 단계를 포함하는, 결핵 예방 방법을 제공한다.
본 발명의 또 다른 양태로서, 본 발명은 서열번호 1의 아미노산 서열을 포함하는 당화된 Ag85A 단백질을 함유하는 백신 조성물의 결핵 예방 용도를 제공한다.
본 발명의 또 다른 양태로서, 본 발명은 서열번호 1의 아미노산 서열을 포함하는 당화된 Ag85A 단백질의, 결핵 예방에 이용되는 백신을 제조하기 위한 용도를 제공한다.
본 명세서에 있어서, "개체(individual)"란 본 발명의 당화된 Ag85A 단백질이 투여될 수 있는 대상을 말하며, 그 대상에는 제한이 없다.
본 명세서에 있어서, “투여”란 임의의 적절한 방법으로 개체에게 소정의 본 발명의 백신 조성물을 제공하는 것을 의미한다.
본 발명에서 상기 당화된 Ag85A 단백질은 결핵균에 의해 감염된 폐 조직 손상 억제를 유도할 수 있다.
본 발명에서 상기 당화된 Ag85A 단백질은 폐에서 결핵균 수 감소를 유도할 수 있다.
본 발명에서 상기 당화된 Ag85A 단백질은 IFN-γ(Interferon-γ), TNF-α(tumor necrosis factor-α), 및 IL-2(Interleukin-2)으로 이루어진 군으로부터 선택된 2 이상의 사이토카인을 동시에 분비하는 다 기능성 T세포의 증가를 유도할 수 있으며, 상기 T세포는 CD4 +CD44 + T세포, 또는 CD8 +CD44 + T세포일 수 있으나 이에 제한되는 것은 아니다.
본 발명의 또 다른 양태로서, 본 발명은 서열번호 1의 아미노산 서열을 포함하는 당화된 Ag85A 단백질을 코딩하는 유전자; 및 서열번호 2의 염기 서열을 포함하는, 셀룰로오스 바인딩 모듈 3(cellulose binding module 3; CBM3)을 코딩하는 유전자를 포함하는, 결핵 예방용 백신 발현용 벡터를 제공한다.
본 발명에서 사용하는 용어 "발현 벡터(expression vector)"란 벡터 내에 삽입된 이종의 핵산에 의해 코딩되는 펩타이드 또는 단백질을 발현할 수 있는 벡터를 지칭하는 것으로, 바람직하게는 당화된 Ag85A 단백질을 발현할 수 있도록 제조된 벡터를 의미한다. 상기 "벡터"는 시험관 내, 생체 왜 또는 생체 내에서 숙주 세포로 염기의 도입 및/또는 전이를 위한 임의의 매개물을 말하며, 다른 DNA 단편이 결합하여 결합된 단편의 복제를 가져올 수 있는 복제단위(replicon)일 수 있으며, "복제 단위"란 생체 내에서 DNA 복제의 자가 유닛으로서 기능하는, 즉, 스스로의 조절에 의해 복제 가능한, 임의의 유전적 단위(예를 들면, 플라스미드, 파지, 코스미드, 염색체, 바이러스 등)를 말한다. 본 발명의 재조합 발현 벡터는 바람직하게는 RNA 중합효소가 결합하는 전사개시인자인 프로모터(promoter), 전사를 조절하기 위한 임의의 오퍼레이터 서열, 적합한 mRNA 리보좀 결합 부위를 코딩하는 서열과 전사 및 해독의 종결을 조절하는 서열, 터미네이터 등을 포함할 수 있으며, 더욱 바람직하게는 단백질의 합성량을 증가시키기 위한 M17의 5' UTR 부위 유전자 등을 추가로 포함할 수 있으며, 상기 프로모터에는 일례로 pEMU 프로모터, MAS 프로모터, 히스톤 프로모터, Clp 프로모터, 꽃양배추 모자이크 바이러스(cauliflower mosaic virus) 유래 35S 프로모터, 꽃양배추 모자이크 바이러스(cauliflower mosaic virus) 유래 19S RNA 프로모터, 식물의 액틴 단백질 프로모터, 유비퀴틴 단백질 프로모터, CMV(Cytomegalovirus) 프로모터, SV40(Simian virus 40) 프로모터, RSV(Respiratory syncytial virus) 프로모터, EF-1α(Elongation factor-1 alpha) 프로모터 등이 포함될 수 있으며, 상기 터미네이터는 일례로 노팔린 신타아제(NOS), 벼 아밀라아제 RAmy1 A 터미네이터, 파세올린 터미네이터, 아그로박테리움 투마파시엔스의 옥토파인(Octopine) 유전자의 터미네이터, 대장균의 rrnB1/B2 터미네이터 등이나, 상기 예는 예시일 뿐 이에 제한되지 않는다.
또한 본 발명은 서열번호 1의 아미노산 서열을 포함하는 당화된 Ag85A 단백질을 코딩하는 유전자; 서열번호 2의 염기 서열을 포함하는, 셀룰로오스 바인딩 모듈 3(cellulose binding module 3; CBM3)을 코딩하는 유전자; 및 서열번호 3의 염기 서열을 포함하는, BiP 신호 펩타이드(signal peptide)를 코딩하는 유전자를 포함하는, 결핵 예방용 백신 발현 벡터를 제공한다.
또한 본 발명은 서열번호 1의 아미노산 서열을 포함하는 당화된 Ag85A 단백질을 코딩하는 유전자; 서열번호 2의 염기 서열을 포함하는, 셀룰로오스 바인딩 모듈 3(cellulose binding module 3; CBM3)을 코딩하는 유전자; 및 서열번호 4의 염기 서열을 포함하는, HDEL 펩타이드를 코딩하는 유전자를 포함하는, 결핵 예방용 백신 발현 벡터를 제공한다.
본 발명에서 상기 벡터는 서열번호 5의 염기서열을 포함하는, 엔테로키나제에 의해 인식되어 절단되는 서열을 추가로 포함할 수 있다.
본 발명에서 상기 벡터는 서열번호 6의 염기서열을 포함하는, 연결 펩타이드를 코딩하는 유전자를 추가로 포함할 수 있다.
본 발명에서 상기 벡터는, CBM3를 코딩하는 유전자, 연결 펩타이드를 코딩하는 유전자, 엔테로키나제 절단 부위, 및 Ag85A 단백질을 코딩하는 유전자가 순차적으로 연결되어 구성되고, 상기 CBM3의 3' 말단에는 식물 세포에서 소포체로 목적 단백질을 타켓팅할 수 있는 BiP 신호 펩타이드(signal peptide)를 코딩하는 유전자가 연결될 수 있으며, 상기 목적 단백질 암호화 유전자의 카르복실 말단에는 벡터가 소포체에 보존(retention)되도록 하는 HDEL(His-Asp-Glu-Leu)을 코딩하는 유전자가 연결될 수 있으나 이에 제한되는 것은 아니다.
본 발명의 또 다른 양태로서, 본 발명은 상기 당화된 Ag85A 단백질 발현 벡터로 형질전환된 결핵 예방용 백신 제조용 형질전환체를 제공한다.
본 발명에서 사용하는 용어 "형질전환(transformation)"이란 주입된 DNA에 의하여 생물의 유전적인 성질이 변하는 것을 총칭하며, "형질전환체(transgenic organism)"란 분자유전학적 방법으로 외부의 유전자를 주입하여 제조된 생명체로서, 바람직하게는 본 발명의 재조합 발현 벡터에 의하여 형질전환된 생명체이며, 상기 생명체는 미생물, 진핵세포, 곤충, 동물, 식물 등 생명이 있는 생물이라면 제한이 없으며, 바람직하게는 대장균, 살모넬라, 바실러스, 효모, 동물 세포, 마우스, 래트, 개, 원숭이, 돼지, 말, 소, 아크로박테리움 튜머패시언스, 식물 등이나 이에 제한되지 않는다. 상기 형질전환체는 형질전환(transformation), 형질감염(transfection), 아그로박테리움(Agrobacterium)-매개 형질전환 방법, 입자 총 충격법(particle gun bombardment), 초음파 처리법(sonication), 전기천공법(electroporation) 및 PEG(Polyethylen glycol)-매개 형질전환 방법 등의 방법으로 제조될 수 있으나, 본 발명의 벡터를 주입할 수 있는 방법이라면 제한이 없다.
본 발명에서 형질전환체는 바람직하게는 식물체이다. 식물에서 유용물질을 생산하는 것은 여러 가지 장점이 있는데, 1)생산 단가를 파격적으로 줄일 수 있고, 2)종래 대중적 방법(동물세포나 미생물에서 합성하여 단백질을 분리 정제하는)에서 발생할 수 있는 여러 가지 오염원(바이러스, 암유전자, 장독소 등)을 원천 배제할 수 있으며, 3)상품화 단계에서도 동물세포나 미생물과는 달리 종자로 seed stock 관리가 가능하다는 점에서 유리한 점을 갖는다. 또한, 4) 해당물질의 수요가 급증할 경우 대량생산에 필요한 설비 기술이나 비용 면에서 기존의 동물세포시스템에 비해 절대적으로 유리하기 때문에 최단 기간에 높아진 수요에 따른 공급이 가능하다는 것도 장점이다. 이와 같이 식물체를 형질 전환시켜 이로부터 유용물질을 생산하는 방법이 주목을 받는 배경은 식물체의 단백질 합성경로에 있다. 포유동물의 단백질 합성에는 해독 후 수식 과정이 필수적인데, 식물체는 진핵생물 단백질의 합성 경로를 가지고 있기 때문에 포유동물에서 발현되는 단백질과 거의 유사한 단백질을 생산할 수 있다.
본 발명에서 상기 식물체는 애기장대, 대두, 담배, 가지, 고추, 감자, 토마토, 배추, 무, 양배추, 상추, 복숭아, 배, 딸기, 수박, 참외, 오이, 당근 및 샐러리로 이루어진 군 중에서 선택되는 하나 이상의 쌍자엽 식물; 또는 벼, 보리, 밀, 호밀, 옥수수, 사탕수수, 귀리 및 양파로 이루어진 군 중에서 선택되는 하나 이상의 단자엽 식물일 수 있으나 이에 제한되는 것은 아니다.
본 발명의 또 다른 양태로서, 본 발명은 (a) 상기 형질전환체를 배양하는 단계; 및
(b) 상기 형질전환체 또는 배양액으로부터 당화된 Ag85A 단백질을 분리 및 정제하는 단계를 포함하는, 결핵 예방용 백신 조성물의 생산 방법을 제공한다.
한편 하기 표 1에서 본 발명에서 이용한 서열을 정리하였다.
서열번호 서열
1(Ag85A 단백질의 아미노산 서열) FSRPGLPVEYLQVPSPSMGRDIKVQFQSGGANSPALYLLDGLRAQDDFSGWDINTPAFEWYDQSGLSVVMPVGGQSSFYSDWYQPACGKAGCQTYKWETFLTSELPGWLQANRHVKPTGSAVVGLSMAASSALTLAIYHPQQFVYAGAMSGLLDPSQAMGPTLIGLAMGDAGGYKASDMWGPKEDPAWQRNDPLLNVGKLIANNTRVWVYCGNGKPSDLGGNNLPAKFLEGFVRTSNIKFQDAYNAGGGHNGVFDFPDSGTHSWEYWGAQLNAMKPDLQRALGATPNTGPAPQGAGSGSGS
2(CBM3의 염기서열) GTATCAGGTAACCTTAAGGTGGAGTTTTACAACTCGAACCCTTCTGATACAACTAACTCAATAAACCCACAGTTCAAAGTTACAAACACAGGCAGCTCTGCGATCGATTTGTCTAAATTAACCCTCAGATACTATTATACGGTTGATGGACAGAAGGACCAGACTTTCTGGTGTGATCATGCAGCTATCATTGGTTCTAACGGTAGCTACAACGGAATTACATCAAACGTGAAGGGCACTTTCGTTAAGATGTCCTCTAGCACTAACAACGCAGACACATATTTGGAGATCAGTTTTACGGGGGGAACCCTTGAACCAGGTGCTCACGTCCAGATTCAAGGAAGATTCGCTAAAAACGACTGGTCGAACTATACCCAAAGTAATGATTACAGTTTTAAATCCGCCTCACAATTTGTTGAGTGGGATCAGGTCACTGCTTACCTGAACGGGGTTCTAGTGTGGGGAAAGGAACCTGGT
3(BiP의 염기서열) ATGGCTCGCTCGTTTGGAGCTAACAGTACCGTTGTGTTGGCGATCATCTTCTTCGGTGAGTGATTTTCCGATCTTCTTCTCCGATTTAGATCTCCTCTACATTGTTGCTTAATCTCAGAACCTTTTTTCGTTGTTCCTGGATCTGAATGTGTTTGTTTGCAATTTCACGATCTTAAAAGGTTAGATCTCGATTGGTATTGACGATTGGAATCTTTACGATTTCAGGATGTTTATTTGCGTTGTCCTCTGCAATAGAAGAGGCTACGAAGTTA
4(HDEL의 염기서열) CACGATGAGCTC
5(엔테로키나제에 의해 인식되어 절단되는 염기서열) GATGACGACGATAAA
6(연결펩타이드의 염기서열) GAGGCAGCCGCTAAGGAAGCTGCAGCGAAAGCC
7(Ag85A의 염기서열) TTTAGCCGGCCTGGCCTGCCTGTGGAATACCTGCAGGTGCCTAGCCCTAGCATGGGCCGGGACATCAAAGTGCAGTTTCAGAGCGGCGGGGCTAATAGCCCTGCTCTGTACCTGCTCGATGGCCTGCGGGCTCAGGATGATTTTAGCGGCTGGGACATCAACACCCCTGCTTTTGAATGGTACGATCAGAGCGGCCTGAGCGTCGTGATGCCTGTGGGCGGGCAGAGCAGCTTCTACAGCGATTGGTATCAGCCTGCTTGCGGCAAAGCTGGCTGCCAGACCTACAAGTGGGAAACCTTTCTGACCAGCGAACTGCCTGGCTGGCTGCAGGCTAATCGGCACGTGAAACCTACCGGCAGCGCCGTGGTGGGCCTGAGCATGGCTGCTAGCTCCGCTCTGACCCTGGCTATCTACCACCCTCAGCAGTTTGTGTACGCTGGCGCTATGAGCGGCCTGCTCGATCCCTCCCAGGCTATGGGCCCTACCCTGATCGGGCTCGCTATGGGGGATGCTGGGGGGTACAAAGCTAGCGATATGTGGGGCCCTAAAGAAGATCCTGCTTGGCAGCGGAATGATCCTCTGCTCAACGTGGGCAAACTGATCGCTAATAATACCCGAGTGTGGGTGTACTGCGGCAATGGCAAACCTAGCGATCTGGGCGGGAACAATCTGCCTGCTAAATTTCTGGAAGGCTTCGTGCGGACCAGCAACATCAAGTTTCAGGATGCTTACAATGCTGGCGGGGGCCACAATGGCGTATTTGATTTTCCTGATAGCGGCACCCACAGCTGGGAATACTGGGGCGCTCAGCTGAATGCTATGAAACCTGATCTGCAGCGGGCTCTGGGCGCTACCCCTAATACCGGCCCTGCTCCTCAGGGCGCTGGCTCCGGATCTGGTAGT
8(CBM3의 아미노산 서열) VSGNLKVEFYNSNPSDTTNSINPQFKVTNTGSSAIDLSKLTLRYYYTVDGQKDQTFWCDHAAIIGSNGSYNGITSNVKGTFVKMSSSTNNADTYLEISFTGGTLEPGAHVQIQGRFAKNDWSNYTQSNDYSFKSASQFVEWDQVTAYLNGVLVWGKEPG
이하, 본 발명의 이해를 돕기 위하여 바람직한 실시예를 제시한다. 그러나 하기의 실시예는 본 발명을 보다 쉽게 이해하기 위하여 제공되는 것일 뿐, 하기 실시예에 의해 본 발명의 내용이 한정되는 것은 아니다.
[실시예]
실시예 1. 식물 발현 Ag85A 발현 벡터 제작 및 단백질 분리 정제
1-1. CBM3 융합 Ag85A 식물 발현 벡터 제작
식물체에서 CBM3 융합 Ag85A를 발현시킬 수 있도록 재조합한 식물 발현 벡터를 제작하였다. 보다 자세하게는, CBM3 융합 Ag85A 단백질을 소포체로 이동시킬 수 있도록 BiP 신호 펩타이드(signal peptide)를 이용하여 목적 단백질을 소포체로 이동시킬 수 있도록 하였고, 융합 단백질이 소포체에 축적될 수 있도록 카르복실말단에 HDEL(His-Asp-Glu-Leu)을 결합하여 소포체에 보존시켰다. Ag85A를 코딩하는 유전자의 앞쪽에 융합 단백질 분리에 필요한 CBM3와 연결 펩타이드를 코딩하는 서열, 그리고 엔테로키나제에 의해 인식되어 절단되는 서열을 결합시킨 다음, 식물발현 벡터인 pCAMBIA 1300에 삽입하여 재조합 벡터를 제조하였다(도 1 참조).
1-2. 식물 발현 벡터 일시적 발현(transient expression)
상기의 실시예 1-1에서 준비한 식물 발현 벡터를 아그로박테리아 균주 LBA4404에 전기충격법 (Electrophoration)을 이용하여 형질전환 시켰다. 형질전환 된 아그로박테리아를 5ml의 YEP 액체 배지(효모 추출물 10 g, 펩톤 10 g, NaCl 5 g, 카나마이신 50 mg/L, 리팜피신 25 mg/L)에서 28 ℃의 조건에서 16시간 동안 진탕 배양 한 후 1차 배양액 1ml을 50ml의 새 YEP 배지에 접종하여 28 ℃의 조건에서 6시간 동안 진탕 배양 하였다.
상기와 같이 배양된 아그로박테리아는 원심분리 (7,000 rpm, 4℃, 5분)하여 수집한 후, 인필트레이션 (Infiltration) 버퍼 (10 mM MES (pH 5.7), 10 mM MgCl2, 200 μM 아세토시링곤(acetosyringone))에 600 nm의 파장에서 O.D. 1.0의 농도로 다시 현탁 시켰다. 아그로박테리아 현탁액은 주사 바늘을 제거한 주사기를 이용하여 니코티아나 벤타미아나(Nicotiana benthamiana) 잎의 뒷면에 주입하는 방법으로 아그로-인필트레이션 (Agro-infiltration)을 수행하였다.
1-3. Ag85A 분리 정제
상기 실시예 1-2에서 준비한 니코티아나 벤타미아 10 g에 단백질 추출 완충용액 (50mM Tris (pH 7.2), 150mM NaCl, 0.1 % Triton X-100, 1X 단백질가수분해효소 억제제 (protease inhibitor)) 50 mL을 첨가하고 블랜더로 조직을 파쇄한 후 13,000 rpm에서 20분간 4 ℃에서 원심 분리하여 단백질 추출액을 회수하였다. 단백질 추출액에 수화시킨 미세결정셀룰로오스 10g을 첨가한 후 1시간 동안 4℃에서 잘 혼합시켜 CBM3 융합 Ag85A 단백질이 미세결정셀룰로오스에 결합되도록 하였다. CBM3 융합 Ag85A 단백질이 결합된 미세결정셀룰로오스는 13,000 rpm에서 10분간 4 ℃에서 원심 분리하여 회수한 후 50 mL의 세척 완충용액(50mM Tris (pH 7.2), 150mM NaCl)으로 2회 세척하고 10 mL의 엔테로키나제 반응 용액 (50mM Tris (pH 7.2), 150mM NaCl, 1mM CaCl2)에 다시 현탁 시켰다. 현탁액에 엔테로키나제를 20 단위만큼 첨가하고 28 ℃에서 4시간 반응시킨 후 원심분리(14,000rpm, 4℃, 10분)를 통해 엔테로키나제와 Ag85A를 포함하는 반응액을 셀룰로오스로부터 분리하였다. 그리고 반응액에서 엔테로키나제를 제거하기 위하여 반응액에 STI-Sepharose를 넣어 4℃에서 1시간 동안 반응시킨 후 원심분리(14,000rpm, 4℃, 10분)를 통해 STI-Sepharose에 결합하지 않은 분리 정제된 Ag85A를 획득하였다.
실시예 2. 식물발현 Ag85A 단백질의 당화 확인
Ag85A의 당화(Glycosylation) 여부를 확인하기 위하여 Endo-H(NEB, Cat. No. P0702S)와 PNGase F (NEB, Cat. No. P0704S)를 사용하였다. Endo-H 처리를 위하여 분리 정제된 Ag85A 단백질 1 ug을 1 uL의 10X(배수) 글리코프로틴 디네이쳐링(Glycoprotein denaturing) 버퍼(5% SDS, 400mM DTT)와 혼합하고 증류수를 채워 최종 부피를 10uL가 되도록 제조하였다. 상기 반응액을 끓는 물에서 10분간 두어 디네이쳐링 시킨 뒤 얼음 위에 잠시 두어 가볍게 열을 식힌 후, 10X 글리코버퍼(Glycobuffer) 3 (500 mM sodium acetate, pH 6) 2 uL와 Endo-H 효소 1 uL, 및 7uL의 증류수를 각각 반응액에 추가하여 37 ℃에서 1시간 동안 반응시켰다. PNGase F의 처리는 상기 디네이쳐링(denaturing) 과정의 Endo-H와 동일한 방법으로 진행하고, 10X 글리코버퍼(Glycobuffer) 2 (500 mM sodium phosphate, pH 7.5) 2uL와 10% NP-40 2 μL, PNGase F 효소 1 μL, 및 증류수 5 μL 넣어 최종 부피는 20uL로 만들어 동일하게 37℃에서 1시간 반응시켰다. 반응을 마친 단백질은 처리하지 않은 단백질과 동시에 웨스턴 블랏을 수행하였으며, 이때 항체는 Ag85A 항체 (Abcam, Cat. No. ab193499) 를 사용하였다.
그 결과, 도 2에 나타난 바와 같이 Endo-H 또는 PNGase F 효소를 사용한 경우 모두, 웨스턴 블랏 을 수행하였을때 디-글리코실레이션 밴드가 나타난 바 글리칸(Glycan)들이 절단(cleave) 되었음을 확인하였다.
실시예 3. G-Ag85A의 결핵 항원으로서의 잠재력 검증
결핵균에 감염된 마우스 폐세포를 이용하여 해당 항원이 실제 결핵균 감염시 항원으로 작용하는지, 백신 후보 물질로서 가능성이 있는지를 알아보기 위해서 IFN-γ 분비(secretion) 정도를 조사하였다. 우선, Beijing strain HN878 결핵균 200 CFU(colony forming unit)를 에어로졸(aerosol) 루트로 마우스에 감염시키고 각각 4주 또는 12주 후에 비감염 대조군과 함께 각각 마우스 6마리씩을 희생시켜 폐세포 (5X10 5 cells)를 분리하고 대장균에서 생산한 논-글리코실레이트 Ag85A(non-glycosylated Ag85A, 이하 NG-Ag85A)와 식물에서 생산한 글리코실레이트 Ag85A (glycosylated Ag85A, 이하 G-Ag85A)를 각각 5ug/ml 농도로 37℃에서 12시간 반응시킨 다음 반응액의 상층액에 분비된 인터페론 감마를 ELISA 키트로 측정하였다.
그 결과, 도 3에 나타난 바와 같이 식물 발현 Ag85A(G-Ag85A)는 결핵균 감염 후 4주 후 혹은 12주 후의 마우스 폐세포에 작용하여 IFN-γ를 지속적으로 분비하는 것을 확인하였으며, 대장균 발현 Ag85A(NG-Ag85A)에 비해 그 양이 유의한 수준으로 증가된 것을 확인하였다. 이는 Ag85A가 결핵균 감염에 대한 면역원성을 가지는 항원이며, NG-Ag85A와 더불어 G-Ag85A의 백신항원으로서 가능성을 타진하였다.
실시예 4. G-Ag85A의 면역원성 조사
4-1. 면역원성 실험 설계
식물 발현 당화 결핵 항원 G-Ag85A의 면역성 조사를 위하여, BCG, NG-Ag85A, 및 G-Ag85A로 마우스를 2주 간격으로 3회 면역하였다. 최종 면역접종 4주(결핵균 공격접종 2주전) 후와 공격접종 후 4주, 및 12주 후에 각각 마우스를 희생하여(sacrificed) 면역반응 및 방어 효능을 조사하였다(도 4 참조).
4-2. 면역 후 항원 특이적 다기능(multifunctional) T 세포 유도
다기능 T 세포는 결핵균을 방어하는 데 중요한 숙주의 구성요소 중 하나로 알려져 있으며, IFN-γ, TNF-α 및 IL-2를 모두 분비하는 T 세포이다. 이와 관련하여 최종 면역접종 4주 후에 각 그룹별로 6마리의 마우스를 희생하여 각 폐세포 (5X10 5 cells)를 분리하고 NG-Ag85A 또는 G-Ag85A 항원 단백질을 5ug/ml농도로 37℃에서 12시간 반응시켰다. 반응 후 IFN-γ, TNF-α, 및/또는 IL-2을 분비하는 CD4 +CD62L - 및 CD8 +CD62L - T세포는 사이토메트리(cytometry)로 분석하였고, 이때 CD4 +와 CD8 +에 대한 게이팅(gating) 결과를 확인하였다.
그 결과, 도 5a 내지 5c에 나타난 바와 같이 G-Ag85A 면역된 경우 CD4 +CD44 + T세포는 폴리-사이토카인(poly-cytokine) 분비 비율이 NG-Ag85A 그룹에 비해 유의미한 수준으로 증가했음을 확인하였다.
4-3 식물 발현 항원 G-Ag85A의 결핵 방어 효능
최종 면역접종 4주 후에 HN878 결핵균 200 CFU로 마우스를 감염시킨 다음 4주 후 및 12주 후에 마우스를 희생하여 폐조직 병변을 육안검사 하였고 폐와 비장(spleen) 세포에서 CFU(colony forming unit)을 조사하였다.
그 결과, 도 6a에 나타난 바와 같이 육안 소견으로도 BCG 나 NG-Ag85A 군에 비해 G-Ag85A 군의 폐조직 손상 정도가 경미 하였으며, H&E(hematoxylin-eosin) 염색법에 의한 관찰에서도 G-Ag85A 군의 조직 손상 정도가 더 경미한 것을 확인하였는바 G-Ag85A의 방어효과가 더 좋은 것을 확인하였으며 특히 감염 후 12주 이후에는 방어 효과가 육안으로 확연히 확인될 정도의 효과 차이가 나타남을 확인하였다.
또한, 폐와 비장 조직을 파쇄하여 배양하고 균을 이뉴머레이팅(enumerating)하면서 log10CFU 로 계산하여 통계 분석에 활용하였다.
그 결과, 도 6b에 나타난 바와 같이 감염 4주 후 폐에서는 비접종군에 비해 BCG, NG-Ag85A, 및 G-Ag85A 모두에서 의미 있는 CFU 감소를 확인하였고, 비장에서 역시 상기 3종류 접종군 모두 비접종에 비해 CFU 감소를 보이는 것을 확인하였다. 감염 12주 후 폐에서는 G-Ag85A 접종군이 가장 낮은 CFU을 보여 가장 높은 방어효과가 있음을 확인하였고 비장에서 역시 G-Ag85A 군이 NG-Ag85A 군에 비해 더 좋은 효과를 보임을 확인하였다.
4-4. 감염 4주 이후 항원 특이적 다기능 T세포 유도
마우스에 결핵균을 감염시키고 폐 조직에 감염 억제를 위한 T세포 반응이 자리잡는 시점인 감염 4주 후에, 각 그룹별로 6마리의 마우스를 희생하여 각 폐 세포 (5X10 5 cells)를 분리하고 NG-Ag85A 또는 G-Ag85A 항원 단백질을 5ug/ml농도로 37℃에서 12시간 반응시켰다. 반응 후 IFN-γ, TNF-α, 및/또는 IL-2을 분비하는 CD4 +CD62L - 및 CD8 +CD62L - T세포를 사이토메트리로 분석하였으며 이때 CD4 +와 CD8 +에 대한 게이팅(gating)한 결과를 확인하였다.
그 결과, 도 7a 내지 7c에 나타난 바와 같이 G-Ag85A 면역된 경우 CD4 +CD44 + T세포는 폴리-사이토카인 분비 비율이 NG-Ag85A 그룹에 비해 유의미한 수준으로 증가했음을 확인하였고, 특히 결핵방어 효과에 중요한 IFN-γ, TNF-α, 및 IL-2를 동시에 분비하는 CD4 +CD44 + 다기능성 T세포가 유의미한 수준으로 증가하였음을 확인하였다.
전술한 본 발명의 설명은 예시를 위한 것이며, 본 발명이 속하는 기술분야의 통상의 지식을 가진 자는 본 발명의 기술적 사상이나 필수적인 특징을 변경하지 않고서 다른 구체적인 형태로 쉽게 변형이 가능하다는 것을 이해할 수 있을 것이다. 그러므로 이상에서 기술한 실시예들은 모든 면에서 예시적인 것이며 한정적이 아닌 것으로 이해해야만 한다.
본 발명에 따른 당화된 Ag85A 단백질은 결핵 예방용 백신으로 유용하게 이용될 수 있으며, 나아가, 상기 단백질 생산에 최적화된 벡터를 이용하여 식물체에서 효과적으로 발현되고 높은 수율로 분리될 수 있어 저렴한 비용으로 대량 생산이 가능할 것으로 기대된다.

Claims (17)

  1. 서열번호 1의 아미노산 서열을 포함하는 당화된 Ag85A 단백질을 함유하는, 결핵 예방용 백신 조성물.
  2. 제1항에 있어서,
    상기 당화된 Ag85A 단백질은 결핵균에 의해 감염된 폐조직 손상 억제를 유도하는 것을 특징으로 하는, 결핵 예방용 백신 조성물.
  3. 제1항에 있어서,
    상기 당화된 Ag85A 단백질은 폐에서 결핵균 수 감소를 유도하는 것을 특징으로 하는, 결핵 예방용 백신 조성물.
  4. 제1항에 있어서,
    상기 당화된 Ag85A 단백질은 IFN-γ(Interferon-γ), TNF-α(tumor necrosis factor-α), 및 IL-2(Interleukin-2)으로 이루어진 군으로부터 선택된 2 이상의 사이토카인을 동시에 분비하는 CD4 +CD44 + T세포 증가를 유도하는 것을 특징으로 하는, 결핵 예방용 백신 조성물.
  5. 제1항에 있어서,
    상기 당화된 Ag85A 단백질은 IFN-γ(Interferon-γ), TNF-α(tumor necrosis factor-α), 및 IL-2(Interleukin-2)으로 이루어진 군으로부터 선택된 2 이상의 사이토카인을 동시에 분비하는 CD8 +CD44 + T세포 증가를 유도하는 것을 특징으로 하는, 결핵 예방용 백신 조성물.
  6. 서열번호 1의 아미노산 서열을 포함하는 당화된 Ag85A 단백질을 코딩하는 유전자; 및 서열번호 2의 염기 서열을 포함하는, 셀룰로오스 바인딩 모듈 3(cellulose binding module 3; CBM3)을 코딩하는 유전자를 포함하는, 결핵 예방용 백신 발현 벡터.
  7. 서열번호 1의 아미노산 서열을 포함하는 당화된 Ag85A 단백질을 코딩하는 유전자; 서열번호 2의 염기 서열을 포함하는, 셀룰로오스 바인딩 모듈 3(cellulose binding module 3; CBM3)을 코딩하는 유전자; 및 서열번호 3의 염기 서열을 포함하는, BiP 신호 펩타이드(signal peptide)를 코딩하는 유전자를 포함하는, 결핵 예방용 백신 발현 벡터.
  8. 서열번호 1의 아미노산 서열을 포함하는 당화된 Ag85A 단백질을 코딩하는 유전자; 서열번호 2의 염기 서열을 포함하는, 셀룰로오스 바인딩 모듈 3(cellulose binding module 3; CBM3)을 코딩하는 유전자; 및 서열번호 4의 염기 서열을 포함하는, HDEL 펩타이드를 코딩하는 유전자를 포함하는, 결핵 예방용 백신 발현 벡터.
  9. 제6항에 있어서,
    상기 벡터는 서열번호 5의 염기서열을 포함하는, 엔테로키나제(enterokinase)에 의해 인식되어 절단되는 서열을 추가로 포함하는 것을 특징으로 하는, 결핵 예방용 백신 발현 벡터.
  10. 제6항에 있어서,
    상기 벡터는 서열번호 6의 염기서열을 포함하는, 연결 펩타이드를 코딩하는 유전자를 추가로 포함하는 것을 특징으로 하는, 결핵 예방용 백신 발현 벡터.
  11. 제6항 내지 제10항 중 어느 한 항의 벡터로 형질전환된 결핵 예방용 백신 제조용 형질전환체.
  12. 제11항에 있어서,
    상기 형질전환체는 식물체인 것을 특징으로 하는, 결핵 예방용 백신 제조용 형질전환체.
  13. 제12항에 있어서,
    상기 식물체는 애기장대, 대두, 담배, 가지, 고추, 감자, 토마토, 배추, 무, 양배추, 상추, 복숭아, 배, 딸기, 수박, 참외, 오이, 당근 및 샐러리로 이루어진 군 중에서 선택되는 하나 이상의 쌍자엽 식물; 또는 벼, 보리, 밀, 호밀, 옥수수, 사탕수수, 귀리 및 양파로 이루어진 군 중에서 선택되는 하나 이상의 단자엽 식물인 것을 특징으로 하는, 결핵 예방용 백신 제조용 형질전환체.
  14. (a) 제11항의 형질전환체를 배양하는 단계; 및
    (b) 상기 형질전환체 또는 배양액으로부터 당화된 Ag85A 단백질을 분리 및 정제하는 단계를 포함하는, 결핵 예방용 백신 조성물의 생산 방법.
  15. 서열번호 1의 아미노산 서열을 포함하는 당화된 Ag85A 단백질을 함유하는 백신 조성물을 개체에 투여하는 단계를 포함하는, 결핵 예방 방법.
  16. 서열번호 1의 아미노산 서열을 포함하는 당화된 Ag85A 단백질을 함유하는 백신 조성물의 결핵 예방 용도.
  17. 서열번호 1의 아미노산 서열을 포함하는 당화된 Ag85A 단백질의, 결핵 예방에 이용되는 백신을 제조하기 위한 용도.
PCT/KR2020/001230 2019-01-28 2020-01-23 당화된 ag85a 단백질을 포함하는 결핵 예방용 백신 조성물 및 이의 제조방법 WO2020159169A2 (ko)

Priority Applications (4)

Application Number Priority Date Filing Date Title
CN202080011317.9A CN113365655A (zh) 2019-01-28 2020-01-23 包含糖基化ag85a蛋白的用于预防结核病的疫苗组合物及其制备方法
JP2021543360A JP7233662B2 (ja) 2019-01-28 2020-01-23 グリコシル化したａｇ８５ａタンパク質を含む結核予防用ワクチン組成物およびその製造方法
US17/426,275 US20220088167A1 (en) 2019-01-28 2020-01-23 Vaccine composition for preventing tuberculosis, comprising glycosylated ag85a protein and method for preparing same
EP20748794.3A EP3919075A4 (en) 2019-01-28 2020-01-23 VACCINE COMPOSITION FOR THE PREVENTION OF TUBERCULOSIS WITH GLYCOSYLATED AG85A PROTEIN AND METHOD OF MANUFACTURE THEREOF

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR10-2019-0010431 2019-01-28
KR1020190010431A KR102317403B1 (ko) 2019-01-28 2019-01-28 당화된 Ag85A 단백질을 포함하는 결핵 예방용 백신 조성물 및 이의 제조방법

Publications (2)

Publication Number Publication Date
WO2020159169A2 true WO2020159169A2 (ko) 2020-08-06
WO2020159169A3 WO2020159169A3 (ko) 2020-10-15

Family

ID=71841615

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2020/001230 WO2020159169A2 (ko) 2019-01-28 2020-01-23 당화된 ag85a 단백질을 포함하는 결핵 예방용 백신 조성물 및 이의 제조방법

Country Status (6)

Country Link
US (1) US20220088167A1 (ko)
EP (1) EP3919075A4 (ko)
JP (1) JP7233662B2 (ko)
KR (1) KR102317403B1 (ko)
CN (1) CN113365655A (ko)
WO (1) WO2020159169A2 (ko)

Families Citing this family (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR102557824B1 (ko) * 2020-08-18 2023-07-20 주식회사 바이오앱 식물 발현 재조합 지카바이러스 외피단백질을 포함하는 백신 조성물 및 이의 제조방법
KR102630105B1 (ko) * 2020-11-26 2024-01-29 전남대학교산학협력단 Cel12A 단백질을 포함하는 셀룰로오스 분해용 조성물 및 이의 제조방법
KR20230119865A (ko) * 2022-02-08 2023-08-16 연세대학교 산학협력단 당사슬이 절단된 신규 항체를 유효성분으로 포함하는 암의 예방 또는 치료용 조성물

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20190010431A (ko) 2017-07-20 2019-01-30 가부시키가이샤 스크린 홀딩스 열처리 장치

Family Cites Families (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2002004018A2 (en) 2000-07-10 2002-01-17 Colorado State University Research Foundation Mid-life vaccine and methods for boosting anti-mycobacterial immunity
KR100609813B1 (ko) 2005-02-24 2006-08-08 학교법인연세대학교 결핵 예방 백신
CN101468201B (zh) 2007-12-27 2012-09-05 上海万兴生物制药有限公司 一种结核分枝杆菌多价重组蛋白疫苗的制备
CN101969976A (zh) 2008-01-11 2011-02-09 美国政府健康与人类服务部秘书处 针对分枝杆菌的多肽疫苗和接种策略
AU2010277222A1 (en) * 2009-07-29 2012-03-08 Bryce Malcolm Buddle Polymer particles and uses thereof
KR101262300B1 (ko) * 2009-10-06 2013-05-20 헬릭스 주식회사 형질전환 식물 유래의 고병원성 조류독감 바이러스 단백질 백신 및 그 제조방법
CN101845456B (zh) * 2010-03-31 2012-11-21 暨南大学 结核Ag85B基因的玉米表达载体及其应用
PL2654783T3 (pl) * 2010-12-21 2017-08-31 MAX-PLANCK-Gesellschaft zur Förderung der Wissenschaften e.V. Rekombinowane Mycobacterium jako szczepionka
EA038931B9 (ru) * 2014-11-20 2022-02-18 Йиссум Рисерч Дивелопмент Компани Оф Зе Хебрю Юниверсити Оф Иерусалим Лтд. Композиции и способы получения полипептидов с модифицированным профилем гликозилирования в клетках растений
KR101579861B1 (ko) 2015-04-10 2015-12-23 연세대학교 산학협력단 Ｒｖ３１３１ 단백질을 포함하는 결핵 예방용 백신 조성물
KR101848082B1 (ko) 2017-05-11 2018-04-12 주식회사 바이오앱 셀룰로오즈 결합 도메인을 포함하는 재조합 벡터 및 상기 벡터를 사용하여 단백질을 분리정제하는 방법

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20190010431A (ko) 2017-07-20 2019-01-30 가부시키가이샤 스크린 홀딩스 열처리 장치

Also Published As

Publication number Publication date
KR102317403B1 (ko) 2021-10-29
WO2020159169A3 (ko) 2020-10-15
EP3919075A2 (en) 2021-12-08
JP2022518807A (ja) 2022-03-16
CN113365655A (zh) 2021-09-07
KR20200093723A (ko) 2020-08-06
JP7233662B2 (ja) 2023-03-07
US20220088167A1 (en) 2022-03-24
EP3919075A4 (en) 2022-11-09

Similar Documents

Publication Publication Date Title
WO2020159169A2 (ko) 당화된 ag85a 단백질을 포함하는 결핵 예방용 백신 조성물 및 이의 제조방법
CN105164151B (zh) TNFα抑制剂多肽、编码多肽的多核苷酸、表达多肽的细胞和生成多肽的方法
WO2020060117A1 (ko) 돼지 열병 백신용 조성물 및 이의 제조 방법
WO2020213898A1 (ko) 돼지 유행성 설사병 바이러스 백신 조성물 및 이의 제조 방법
WO2020059961A1 (ko) 돼지의 fc 단편과 융합된 항원 및 이를 포함하는 백신 조성물
US20180291084A1 (en) Chimeric polypeptides, polynucleotides encoding same, cells expressing same and methods of producing same
WO2020256374A1 (ko) 아프리카 돼지열병의 예방을 위한 항원 생산용 재조합 벡터 및 이의 용도
WO2023027402A1 (ko) 아프리카 돼지열병 바이러스 유래 항원 단백질을 포함하는 아프리카 돼지열병의 예방용 백신
WO2021215857A1 (ko) 삼량체를 형성하는 코로나-19 바이러스 (covid-19, coronavirus disease 2019)의 재조합 스파이크 단백질 및 식물에서의 상기 재조합 스파이크 단백질의 대량 생산 방법과 이를 기반으로하는 백신조성물 제조 방법
WO2020111814A1 (ko) 광견병 예방용 백신 조성물 및 이의 제조 방법
WO2020256372A1 (ko) 아프리카 돼지열병의 진단을 위한 항원 생산용 재조합 벡터 및 이의 용도
KR20120066555A (ko) 돼지 유행성 설사병 바이러스의 에피토프 단백질을 발현하는 형질전환체 및 이를 포함하는 ｐｅｄｖ 백신 조성물
KR20200144068A (ko) 아프리카 돼지열병의 예방을 위한 항원 생산용 재조합 벡터 및 이의 용도
WO2020139031A1 (ko) Crispr-cas를 기반으로 하는 유전자 교정용 조성물
WO2020256419A1 (ko) 개 파보바이러스 감염증 치료를 위한 항체 생산용 재조합 벡터 및 이의 용도
WO2023003332A1 (ko) 식물 기반 covid-19 변이 재조합 스파이크 단백질 발현 벡터 및 상기 발현 벡터를 이용한 재조합 단백질
KR102557550B1 (ko) 식물 기반 covid-19 변이 재조합 스파이크 단백질 발현 벡터 및 상기 발현 벡터를 이용한 재조합 단백질
WO2022039438A1 (ko) 식물 발현 재조합 지카바이러스 외피단백질을 포함하는 백신 조성물 및 이의 제조방법
WO2012053856A2 (ko) 호흡기 신시치아 바이러스 백신 조성물 및 그의 제조방법
WO2022182033A1 (ko) 식물 발현 시스템을 이용한 알팔파 모자이크 바이러스 유사 입자 제조 방법 및 이의 활용
CN113755421B (zh) 一种用于covid-19的口服性疫苗及抗体加强剂
WO2023075421A1 (ko) 수지상 세포를 표적하는 신규한 펩타이드, 및 이를 포함하는 암 치료용 조성물
WO2022050520A1 (ko) 코로나바이러스 유래 수용체 결합 도메인 및 뉴클레오캡시드 단백질을 포함하는 융합단백질 및 이의 용도
KR101783677B1 (ko) 식물 바이러스 발현 시스템을 이용한 재조합 뎅기 바이러스 백신을 대량 생산하는 방법
KR20230034141A (ko) 아프리카 돼지열병 바이러스 유래 항원 단백질을 포함하는 아프리카 돼지열병의 예방용 백신

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 20748794

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 2021543360

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2020748794

Country of ref document: EP

Effective date: 20210830