WO2023075421A1 - 수지상 세포를 표적하는 신규한 펩타이드, 및 이를 포함하는 암 치료용 조성물 - Google Patents
수지상 세포를 표적하는 신규한 펩타이드, 및 이를 포함하는 암 치료용 조성물 Download PDFInfo
- Publication number
- WO2023075421A1 WO2023075421A1 PCT/KR2022/016492 KR2022016492W WO2023075421A1 WO 2023075421 A1 WO2023075421 A1 WO 2023075421A1 KR 2022016492 W KR2022016492 W KR 2022016492W WO 2023075421 A1 WO2023075421 A1 WO 2023075421A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- peptide
- seq
- flab
- cells
- treating
- Prior art date
Links
- 108090000765 processed proteins & peptides Proteins 0.000 title claims abstract description 154
- 206010028980 Neoplasm Diseases 0.000 title claims abstract description 143
- 210000004443 dendritic cell Anatomy 0.000 title claims abstract description 107
- 201000011510 cancer Diseases 0.000 title claims abstract description 66
- 230000008685 targeting Effects 0.000 title claims abstract description 36
- 239000000203 mixture Substances 0.000 title claims abstract description 32
- 239000000427 antigen Substances 0.000 claims abstract description 50
- 108091007433 antigens Proteins 0.000 claims abstract description 50
- 102000036639 antigens Human genes 0.000 claims abstract description 50
- 108010040721 Flagellin Proteins 0.000 claims abstract description 39
- 102000004196 processed proteins & peptides Human genes 0.000 claims abstract description 39
- 238000001727 in vivo Methods 0.000 claims description 39
- 229960005486 vaccine Drugs 0.000 claims description 25
- 238000011282 treatment Methods 0.000 claims description 19
- 239000008194 pharmaceutical composition Substances 0.000 claims description 18
- 230000004083 survival effect Effects 0.000 claims description 14
- 230000000694 effects Effects 0.000 claims description 13
- 230000002265 prevention Effects 0.000 claims description 6
- 230000007774 longterm Effects 0.000 claims description 5
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 4
- 230000027455 binding Effects 0.000 claims description 3
- 230000002708 enhancing effect Effects 0.000 claims description 3
- 150000007523 nucleic acids Chemical group 0.000 claims description 3
- 108091033319 polynucleotide Proteins 0.000 claims description 3
- 102000040430 polynucleotide Human genes 0.000 claims description 3
- 239000002157 polynucleotide Substances 0.000 claims description 3
- 125000003275 alpha amino acid group Chemical group 0.000 claims 10
- 108010003342 flaB flagellin Proteins 0.000 description 87
- 210000004027 cell Anatomy 0.000 description 52
- 150000001413 amino acids Chemical group 0.000 description 40
- 241000699670 Mus sp. Species 0.000 description 35
- 102100022297 Integrin alpha-X Human genes 0.000 description 22
- 210000001165 lymph node Anatomy 0.000 description 19
- 102000008234 Toll-like receptor 5 Human genes 0.000 description 15
- 108010060812 Toll-like receptor 5 Proteins 0.000 description 15
- 210000001185 bone marrow Anatomy 0.000 description 15
- 230000028993 immune response Effects 0.000 description 13
- 101000979572 Homo sapiens NLR family CARD domain-containing protein 4 Proteins 0.000 description 12
- 102100023435 NLR family CARD domain-containing protein 4 Human genes 0.000 description 12
- 102000004169 proteins and genes Human genes 0.000 description 12
- 108090000623 proteins and genes Proteins 0.000 description 12
- 210000000952 spleen Anatomy 0.000 description 12
- 210000001744 T-lymphocyte Anatomy 0.000 description 11
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 11
- 108020004414 DNA Proteins 0.000 description 10
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 10
- 230000002950 deficient Effects 0.000 description 8
- 230000001965 increasing effect Effects 0.000 description 8
- 238000000034 method Methods 0.000 description 8
- 230000004913 activation Effects 0.000 description 7
- 230000001580 bacterial effect Effects 0.000 description 7
- 239000000872 buffer Substances 0.000 description 7
- 239000012634 fragment Substances 0.000 description 7
- 244000052769 pathogen Species 0.000 description 7
- 230000001717 pathogenic effect Effects 0.000 description 7
- 101000767631 Human papillomavirus type 16 Protein E7 Proteins 0.000 description 6
- 230000004700 cellular uptake Effects 0.000 description 6
- 238000011156 evaluation Methods 0.000 description 6
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 6
- 210000004881 tumor cell Anatomy 0.000 description 6
- 239000004471 Glycine Substances 0.000 description 5
- 101000914484 Homo sapiens T-lymphocyte activation antigen CD80 Proteins 0.000 description 5
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 5
- 241000699666 Mus <mouse, genus> Species 0.000 description 5
- 108010057466 NF-kappa B Proteins 0.000 description 5
- 102000003945 NF-kappa B Human genes 0.000 description 5
- 239000012980 RPMI-1640 medium Substances 0.000 description 5
- 102100027222 T-lymphocyte activation antigen CD80 Human genes 0.000 description 5
- 239000002671 adjuvant Substances 0.000 description 5
- 210000000612 antigen-presenting cell Anatomy 0.000 description 5
- 239000006285 cell suspension Substances 0.000 description 5
- 201000010099 disease Diseases 0.000 description 5
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 5
- 230000036039 immunity Effects 0.000 description 5
- 208000024891 symptom Diseases 0.000 description 5
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 4
- 239000004472 Lysine Substances 0.000 description 4
- 241001465754 Metazoa Species 0.000 description 4
- 229930182555 Penicillin Natural products 0.000 description 4
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 4
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 4
- 241000607598 Vibrio Species 0.000 description 4
- 230000000259 anti-tumor effect Effects 0.000 description 4
- 229940022399 cancer vaccine Drugs 0.000 description 4
- 239000002158 endotoxin Substances 0.000 description 4
- 238000005516 engineering process Methods 0.000 description 4
- 239000012091 fetal bovine serum Substances 0.000 description 4
- 238000000684 flow cytometry Methods 0.000 description 4
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 4
- 229920006008 lipopolysaccharide Polymers 0.000 description 4
- 230000001404 mediated effect Effects 0.000 description 4
- 239000013642 negative control Substances 0.000 description 4
- 229940049954 penicillin Drugs 0.000 description 4
- 239000013612 plasmid Substances 0.000 description 4
- 238000002360 preparation method Methods 0.000 description 4
- 108091008146 restriction endonucleases Proteins 0.000 description 4
- 238000011740 C57BL/6 mouse Methods 0.000 description 3
- 108010034143 Inflammasomes Proteins 0.000 description 3
- 102100037850 Interferon gamma Human genes 0.000 description 3
- 108010074328 Interferon-gamma Proteins 0.000 description 3
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 3
- 230000033289 adaptive immune response Effects 0.000 description 3
- 238000011224 anti-cancer immunotherapy Methods 0.000 description 3
- 238000005119 centrifugation Methods 0.000 description 3
- 238000012790 confirmation Methods 0.000 description 3
- 210000003743 erythrocyte Anatomy 0.000 description 3
- RAXXELZNTBOGNW-UHFFFAOYSA-N imidazole Natural products C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 3
- 210000000987 immune system Anatomy 0.000 description 3
- 238000011534 incubation Methods 0.000 description 3
- 230000001939 inductive effect Effects 0.000 description 3
- 208000015181 infectious disease Diseases 0.000 description 3
- 238000002826 magnetic-activated cell sorting Methods 0.000 description 3
- 238000012163 sequencing technique Methods 0.000 description 3
- 230000004936 stimulating effect Effects 0.000 description 3
- 229960005322 streptomycin Drugs 0.000 description 3
- 239000000126 substance Substances 0.000 description 3
- 239000006228 supernatant Substances 0.000 description 3
- 230000005760 tumorsuppression Effects 0.000 description 3
- 238000011725 BALB/c mouse Methods 0.000 description 2
- 241000894006 Bacteria Species 0.000 description 2
- 241000282412 Homo Species 0.000 description 2
- 101000935040 Homo sapiens Integrin beta-2 Proteins 0.000 description 2
- 102100025390 Integrin beta-2 Human genes 0.000 description 2
- 108700018351 Major Histocompatibility Complex Proteins 0.000 description 2
- 206010027476 Metastases Diseases 0.000 description 2
- 108700020796 Oncogene Proteins 0.000 description 2
- 108091023040 Transcription factor Proteins 0.000 description 2
- 102000040945 Transcription factor Human genes 0.000 description 2
- 241000607265 Vibrio vulnificus Species 0.000 description 2
- 230000000890 antigenic effect Effects 0.000 description 2
- 239000011324 bead Substances 0.000 description 2
- 229960002685 biotin Drugs 0.000 description 2
- 235000020958 biotin Nutrition 0.000 description 2
- 239000011616 biotin Substances 0.000 description 2
- 210000004369 blood Anatomy 0.000 description 2
- 239000008280 blood Substances 0.000 description 2
- 238000009566 cancer vaccine Methods 0.000 description 2
- 239000002775 capsule Substances 0.000 description 2
- 230000020411 cell activation Effects 0.000 description 2
- 230000008859 change Effects 0.000 description 2
- 238000004624 confocal microscopy Methods 0.000 description 2
- 210000000805 cytoplasm Anatomy 0.000 description 2
- 230000003247 decreasing effect Effects 0.000 description 2
- 230000001419 dependent effect Effects 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- UQLDLKMNUJERMK-UHFFFAOYSA-L di(octadecanoyloxy)lead Chemical compound [Pb+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O UQLDLKMNUJERMK-UHFFFAOYSA-L 0.000 description 2
- 238000010586 diagram Methods 0.000 description 2
- 238000009826 distribution Methods 0.000 description 2
- 150000002148 esters Chemical class 0.000 description 2
- 238000002474 experimental method Methods 0.000 description 2
- 210000003495 flagella Anatomy 0.000 description 2
- 230000006870 function Effects 0.000 description 2
- 239000001963 growth medium Substances 0.000 description 2
- 210000005260 human cell Anatomy 0.000 description 2
- 210000002865 immune cell Anatomy 0.000 description 2
- 230000001976 improved effect Effects 0.000 description 2
- 238000000338 in vitro Methods 0.000 description 2
- 230000006698 induction Effects 0.000 description 2
- 230000003993 interaction Effects 0.000 description 2
- 230000003834 intracellular effect Effects 0.000 description 2
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 2
- 230000004807 localization Effects 0.000 description 2
- 239000006166 lysate Substances 0.000 description 2
- 239000012139 lysis buffer Substances 0.000 description 2
- 239000002609 medium Substances 0.000 description 2
- 230000009401 metastasis Effects 0.000 description 2
- 239000011325 microbead Substances 0.000 description 2
- 230000030648 nucleus localization Effects 0.000 description 2
- 238000004091 panning Methods 0.000 description 2
- 210000005259 peripheral blood Anatomy 0.000 description 2
- 239000011886 peripheral blood Substances 0.000 description 2
- YBYRMVIVWMBXKQ-UHFFFAOYSA-N phenylmethanesulfonyl fluoride Chemical compound FS(=O)(=O)CC1=CC=CC=C1 YBYRMVIVWMBXKQ-UHFFFAOYSA-N 0.000 description 2
- 239000013641 positive control Substances 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- 230000001681 protective effect Effects 0.000 description 2
- 238000011084 recovery Methods 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 230000003248 secreting effect Effects 0.000 description 2
- 230000019491 signal transduction Effects 0.000 description 2
- 239000011780 sodium chloride Substances 0.000 description 2
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 2
- 238000010186 staining Methods 0.000 description 2
- 230000000638 stimulation Effects 0.000 description 2
- 230000020382 suppression by virus of host antigen processing and presentation of peptide antigen via MHC class I Effects 0.000 description 2
- 238000001356 surgical procedure Methods 0.000 description 2
- 238000012360 testing method Methods 0.000 description 2
- 229940022511 therapeutic cancer vaccine Drugs 0.000 description 2
- 230000004614 tumor growth Effects 0.000 description 2
- 239000012646 vaccine adjuvant Substances 0.000 description 2
- 229940124931 vaccine adjuvant Drugs 0.000 description 2
- 238000012800 visualization Methods 0.000 description 2
- 238000005406 washing Methods 0.000 description 2
- 238000001262 western blot Methods 0.000 description 2
- DGVVWUTYPXICAM-UHFFFAOYSA-N β‐Mercaptoethanol Chemical compound OCCS DGVVWUTYPXICAM-UHFFFAOYSA-N 0.000 description 2
- FWBHETKCLVMNFS-UHFFFAOYSA-N 4',6-Diamino-2-phenylindol Chemical compound C1=CC(C(=N)N)=CC=C1C1=CC2=CC=C(C(N)=N)C=C2N1 FWBHETKCLVMNFS-UHFFFAOYSA-N 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- 229920000936 Agarose Polymers 0.000 description 1
- 101100221836 Arabidopsis thaliana CPL3 gene Proteins 0.000 description 1
- 101100065702 Arabidopsis thaliana ETC3 gene Proteins 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 1
- 108010078791 Carrier Proteins Proteins 0.000 description 1
- 102000014914 Carrier Proteins Human genes 0.000 description 1
- 102000011727 Caspases Human genes 0.000 description 1
- 108010076667 Caspases Proteins 0.000 description 1
- 206010053567 Coagulopathies Diseases 0.000 description 1
- 208000035473 Communicable disease Diseases 0.000 description 1
- 108010062580 Concanavalin A Proteins 0.000 description 1
- 241000588724 Escherichia coli Species 0.000 description 1
- 241000672609 Escherichia coli BL21 Species 0.000 description 1
- 102000004457 Granulocyte-Macrophage Colony-Stimulating Factor Human genes 0.000 description 1
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 1
- 102000002812 Heat-Shock Proteins Human genes 0.000 description 1
- 108010004889 Heat-Shock Proteins Proteins 0.000 description 1
- 101000934372 Homo sapiens Macrosialin Proteins 0.000 description 1
- 101000946889 Homo sapiens Monocyte differentiation antigen CD14 Proteins 0.000 description 1
- 241000341655 Human papillomavirus type 16 Species 0.000 description 1
- 229940076838 Immune checkpoint inhibitor Drugs 0.000 description 1
- 102000037984 Inhibitory immune checkpoint proteins Human genes 0.000 description 1
- 108091008026 Inhibitory immune checkpoint proteins Proteins 0.000 description 1
- 108010052369 Integrin alphaXbeta2 Proteins 0.000 description 1
- 108090000978 Interleukin-4 Proteins 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- 102100025136 Macrosialin Human genes 0.000 description 1
- 102100035877 Monocyte differentiation antigen CD14 Human genes 0.000 description 1
- 101001044384 Mus musculus Interferon gamma Proteins 0.000 description 1
- 229930040373 Paraformaldehyde Natural products 0.000 description 1
- 108010067902 Peptide Library Proteins 0.000 description 1
- 206010057249 Phagocytosis Diseases 0.000 description 1
- 206010035664 Pneumonia Diseases 0.000 description 1
- 229920001213 Polysorbate 20 Polymers 0.000 description 1
- 206010038111 Recurrent cancer Diseases 0.000 description 1
- 208000035415 Reinfection Diseases 0.000 description 1
- 206010040047 Sepsis Diseases 0.000 description 1
- 230000006044 T cell activation Effects 0.000 description 1
- 230000006052 T cell proliferation Effects 0.000 description 1
- 108091008874 T cell receptors Proteins 0.000 description 1
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 1
- 239000013504 Triton X-100 Substances 0.000 description 1
- 229920004890 Triton X-100 Polymers 0.000 description 1
- GLNADSQYFUSGOU-GPTZEZBUSA-J Trypan blue Chemical compound [Na+].[Na+].[Na+].[Na+].C1=C(S([O-])(=O)=O)C=C2C=C(S([O-])(=O)=O)C(/N=N/C3=CC=C(C=C3C)C=3C=C(C(=CC=3)\N=N\C=3C(=CC4=CC(=CC(N)=C4C=3O)S([O-])(=O)=O)S([O-])(=O)=O)C)=C(O)C2=C1N GLNADSQYFUSGOU-GPTZEZBUSA-J 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 201000006449 West Nile encephalitis Diseases 0.000 description 1
- 206010057293 West Nile viral infection Diseases 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 230000003213 activating effect Effects 0.000 description 1
- 210000005006 adaptive immune system Anatomy 0.000 description 1
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 1
- 229960000723 ampicillin Drugs 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 230000001093 anti-cancer Effects 0.000 description 1
- 230000005904 anticancer immunity Effects 0.000 description 1
- 239000002246 antineoplastic agent Substances 0.000 description 1
- 230000005975 antitumor immune response Effects 0.000 description 1
- 230000001640 apoptogenic effect Effects 0.000 description 1
- 230000006907 apoptotic process Effects 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 238000002819 bacterial display Methods 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 210000000601 blood cell Anatomy 0.000 description 1
- 210000002798 bone marrow cell Anatomy 0.000 description 1
- 238000011088 calibration curve Methods 0.000 description 1
- 230000005907 cancer growth Effects 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 239000013592 cell lysate Substances 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 238000002659 cell therapy Methods 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 238000002512 chemotherapy Methods 0.000 description 1
- 238000011109 contamination Methods 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 230000009089 cytolysis Effects 0.000 description 1
- 230000001461 cytolytic effect Effects 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 230000007812 deficiency Effects 0.000 description 1
- 230000001934 delay Effects 0.000 description 1
- 230000004069 differentiation Effects 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- 231100000673 dose–response relationship Toxicity 0.000 description 1
- 230000008030 elimination Effects 0.000 description 1
- 238000003379 elimination reaction Methods 0.000 description 1
- 230000001747 exhibiting effect Effects 0.000 description 1
- 239000013604 expression vector Substances 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 238000000799 fluorescence microscopy Methods 0.000 description 1
- 108020001507 fusion proteins Proteins 0.000 description 1
- 102000037865 fusion proteins Human genes 0.000 description 1
- 230000002496 gastric effect Effects 0.000 description 1
- 239000007973 glycine-HCl buffer Substances 0.000 description 1
- 210000004013 groin Anatomy 0.000 description 1
- 239000000833 heterodimer Substances 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- 238000000703 high-speed centrifugation Methods 0.000 description 1
- 230000002519 immonomodulatory effect Effects 0.000 description 1
- 230000005965 immune activity Effects 0.000 description 1
- 239000012274 immune-checkpoint protein inhibitor Substances 0.000 description 1
- 230000004957 immunoregulator effect Effects 0.000 description 1
- 230000003308 immunostimulating effect Effects 0.000 description 1
- 238000009169 immunotherapy Methods 0.000 description 1
- 230000005917 in vivo anti-tumor Effects 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 230000015788 innate immune response Effects 0.000 description 1
- 210000005007 innate immune system Anatomy 0.000 description 1
- 238000011081 inoculation Methods 0.000 description 1
- 230000001926 lymphatic effect Effects 0.000 description 1
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- 238000002824 mRNA display Methods 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- 201000004792 malaria Diseases 0.000 description 1
- 238000004519 manufacturing process Methods 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 208000037819 metastatic cancer Diseases 0.000 description 1
- 208000011575 metastatic malignant neoplasm Diseases 0.000 description 1
- 210000001616 monocyte Anatomy 0.000 description 1
- 235000019799 monosodium phosphate Nutrition 0.000 description 1
- 230000035772 mutation Effects 0.000 description 1
- 210000003928 nasal cavity Anatomy 0.000 description 1
- 210000000822 natural killer cell Anatomy 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 239000002773 nucleotide Substances 0.000 description 1
- 125000003729 nucleotide group Chemical group 0.000 description 1
- 229920002866 paraformaldehyde Polymers 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 102000007863 pattern recognition receptors Human genes 0.000 description 1
- 108010089193 pattern recognition receptors Proteins 0.000 description 1
- 239000008188 pellet Substances 0.000 description 1
- 208000028169 periodontal disease Diseases 0.000 description 1
- 230000002093 peripheral effect Effects 0.000 description 1
- 230000008823 permeabilization Effects 0.000 description 1
- 238000002823 phage display Methods 0.000 description 1
- 230000008782 phagocytosis Effects 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 1
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 1
- 229920001184 polypeptide Polymers 0.000 description 1
- 229920000136 polysorbate Polymers 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 238000002818 protein evolution Methods 0.000 description 1
- 238000001959 radiotherapy Methods 0.000 description 1
- 230000007115 recruitment Effects 0.000 description 1
- 230000002829 reductive effect Effects 0.000 description 1
- 238000002702 ribosome display Methods 0.000 description 1
- 230000008054 signal transmission Effects 0.000 description 1
- AJPJDKMHJJGVTQ-UHFFFAOYSA-M sodium dihydrogen phosphate Chemical compound [Na+].OP(O)([O-])=O AJPJDKMHJJGVTQ-UHFFFAOYSA-M 0.000 description 1
- 229910000162 sodium phosphate Inorganic materials 0.000 description 1
- 239000002904 solvent Substances 0.000 description 1
- 210000004989 spleen cell Anatomy 0.000 description 1
- 230000003393 splenic effect Effects 0.000 description 1
- 210000004988 splenocyte Anatomy 0.000 description 1
- 238000003756 stirring Methods 0.000 description 1
- 238000010254 subcutaneous injection Methods 0.000 description 1
- 239000007929 subcutaneous injection Substances 0.000 description 1
- 230000001629 suppression Effects 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- 229940021747 therapeutic vaccine Drugs 0.000 description 1
- 210000002303 tibia Anatomy 0.000 description 1
- 210000001519 tissue Anatomy 0.000 description 1
- 201000008827 tuberculosis Diseases 0.000 description 1
- 230000005740 tumor formation Effects 0.000 description 1
- 210000000689 upper leg Anatomy 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
- C07K7/04—Linear peptides containing only normal peptide links
- C07K7/08—Linear peptides containing only normal peptide links having 12 to 20 amino acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55516—Proteins; Peptides
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- the present invention relates to a novel peptide targeting dendritic cells in vivo, and a composition for treating cancer comprising the same. Specifically, it relates to a composition for treating or preventing cancer comprising a novel peptide targeting dendritic cells in vivo, a tumor antigen, and flagellin.
- the novel peptide targeting dendritic cells in vivo, the tumor antigen, and flagellin of the present invention may be linked as one peptide or included as individual peptides.
- Existing cancer treatment methods include methods to remove cancer cells as much as possible through surgery, radiation therapy, and chemotherapy using anticancer agents, and these can be used for cancer treatment relatively widely, but have side effects and are difficult to cure. There is currently no cure. In particular, in the case of metastatic cancer or recurrent cancer, most of them are inoperable and often have resistance to chemical treatments, so the development of new treatments for these cancer patients is urgently required.
- Anticancer immunotherapy is a method of treating cancer by increasing immune activity against cancer cells using the characteristics of immune cells in the body or suppressing the way cancer cells evade from immune cell attack. , immune checkpoint inhibitors, therapeutic cancer vaccines, and therapeutic antibodies.
- Therapeutic cancer vaccines are anti-cancer vaccines using intact tumor cells, tumor cell lysates or tumor antigens derived from cancer cell lines, and cancer cell-derived antigens or There is a DC-based cancer vaccine using autologous dendritic cells (DC) generated by exposing cancer lysates.
- DC autologous dendritic cells
- dendritic cell cancer vaccines can be used as a treatment that can prevent metastasis and recurrence after surgical removal of primary cancer, which will give it considerable competitiveness in the cancer treatment market.
- Dendritic cells are antigen-presenting cells of the mammalian immune system, and have membranous or thorn-like twig-like projections. The primary function of dendritic cells is to process and present antigenic material to the T cells of the immune system. Therefore, dendritic cells are major antigen-marking cells that activate non-sensitized T lymphocytes and serve as messengers between the innate and adaptive immune systems. Until now, cancer treatment using the immune system has been demonstrated through many animal experiments, and the identification of tumor-specific antigens recognized by human T lymphocytes is facilitating the development of immunotherapy.
- dendritic cells are differentiated from blood cells taken from a patient. That is, they are cultured and matured in vitro together with tumor antigen peptides, tumor lysates, apoptotic tumor cells, or heat shock proteins extracted from autologous tumors, and finally injected back into the patient.
- dendritic cells when immature dendritic cells are used as a cell therapy, it rather activates cancer more, so there is a problem that sufficiently matured mature dendritic cells must be used, and a customized treatment tailored to the individual is expensive. Lifting is also a downside. In the latter case, stimulation of dendritic cells occurs after injection into the patient of peptides, proteins, irradiated tumor cells or other viruses containing antigenic peptides targeting dendritic cells. However, since the activation of dendritic cells affects the ability to effectively activate cytolytic T lymphocytes, the degree of dendritic cell activation is considered to be a tricky factor.
- flagellin the structural unit protein constituting the filament of the flagellum is called flagellin, and flagellin is regularly combined to form a filament so that bacteria can move.
- Flagellin is a substance that stimulates pattern recognition receptors and has been studied as a target for developing vaccine carrier proteins or vaccine adjuvants.
- a fusion protein of antigen and flagellin has been demonstrated to be effective as an experimental vaccine against various infectious diseases including pneumonia, West Nile fever, malaria, tuberculosis, and bacterial periodontal disease. It has been reported to protect gastrointestinal tissue and affect the survival and growth of cancer cells.
- flagellin a component of Vibrio sepsis, acts on Toll-like receptor 5 of host cells to induce a strong immunomodulatory effect, thereby making an excellent mucosal vaccine adjuvant. (adjuvant) proved to be effective.
- the inventors of the present invention discovered novel peptides targeting dendritic cells in vivo through biopanning, and developed a recombinant integral polypeptide vaccine containing the novel peptides targeting dendritic cells, tumor antigen and flagellin. Thus, a composition having a more excellent effect in cancer treatment was completed.
- Patent Document 1 Korean Patent Registration No. 10-0795839
- Non-Patent Document 1 Lee SE, Kim SY, Jeong BC, Kim YR, Bae SJ, Ahn OS, et al. A bacterial flagellin, Vibrio vulnificus FlaB, has a strong mucosal adjuvant activity to induce protective immunity. Infect Immun. 2006;74(1):694-702.
- An object of the present invention is to provide novel peptides that target dendritic cells in vivo.
- An object of the present invention is to provide a novel peptide targeting dendritic cells in vivo, a peptide for treating or preventing cancer, including a tumor antigen and flagellin.
- An object of the present invention is to provide a pharmaceutical composition for treating or preventing cancer containing a novel peptide targeting dendritic cells in vivo, a tumor antigen, and flagellin.
- An object of the present invention is to provide a vaccine composition for treating or preventing cancer, which includes a novel peptide targeting dendritic cells in vivo, a tumor antigen, and flagellin.
- the present invention provides a peptide for treating or preventing cancer that targets dendritic cells.
- a polynucleotide comprising a nucleic acid sequence encoding the peptide is provided.
- the peptide for treating or preventing cancer targeting dendritic cells may include an amino acid sequence selected from the group consisting of SEQ ID NO: 1 to SEQ ID NO: 11, and preferably, the peptide is SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 6, It may include any one amino acid sequence selected from the group consisting of SEQ ID NO: 9 and SEQ ID NO: 10. More preferably, it may include any one amino acid sequence selected from the group consisting of SEQ ID NO: 6, SEQ ID NO: 9, and SEQ ID NO: 10, and most preferably may include the amino acid sequence of SEQ ID NO: 6.
- the dendritic cell-targeting peptide for cancer treatment or prevention may bind to dendritic cells in vivo and induce their activity.
- the dendritic cell-targeting peptide for cancer treatment or prevention may further contain at least one selected from the group consisting of a tumor antigen and flagellin, and may contain four consecutive tumor antigens.
- the tumor antigen may include the amino acid sequence of SEQ ID NO: 22, and the flagellin may include the amino acid sequence of SEQ ID NO: 23.
- the peptide for treating or preventing cancer targeting the dendritic cells may include the amino acid sequence of SEQ ID NO: 6, the amino acid sequence of SEQ ID NO: 22, and the amino acid sequence of SEQ ID NO: 23, preferably the amino acid sequence of SEQ ID NO: 25 can include
- the dendritic cell-targeting peptide for treating or preventing cancer may induce long-term survival and may have an immune enhancing effect.
- the present invention provides a pharmaceutical composition for treating or preventing cancer comprising a peptide for treating or preventing cancer that targets the dendritic cells.
- the present invention provides a vaccine composition for treating or preventing cancer comprising a peptide for treating or preventing cancer that targets the dendritic cells.
- the pharmaceutical composition for treating or preventing cancer including the peptide for treating or preventing cancer targeting the dendritic cells, or the vaccine composition may further include at least one selected from the group consisting of a tumor antigen and flagellin, and the tumor It may contain 4 antigens in a row.
- a pharmaceutical composition or vaccine composition for treating or preventing cancer comprising the dendritic cell-targeting peptide for cancer treatment or prevention, or a vaccine composition, wherein the dendritic cell-targeting peptide, tumor antigen, and flagellin are linked as one peptide, or each peptide can be included with
- composition comprising a novel peptide targeting dendritic cells in vivo, a tumor antigen, and flagellin of the present invention induces potent dendritic cell activation and immunostimulant effect, thereby increasing tumor antigen-specific anti-cancer immune response and excellent cancer suppression have an effect
- FIG 1 shows an overall schematic of the present invention.
- Figure 2 is a schematic diagram of the in vivo biopanning process in mice.
- Figure 3 shows the concentration and frequency of phagemid particles according to rounds of in vivo biopanning in mice.
- Figure 4 shows the sequences of peptides obtained following rounds of in vivo biopanning in mice.
- Figure 5 shows six peptides selected after two rounds of in vivo biopanning in mice.
- Figure 6 shows the results of measuring cellular uptake of the dendritic cell-targeting peptide of the present invention in bone marrow-derived dendritic cells (BMDC).
- BMDC bone marrow-derived dendritic cells
- Figure 7 shows the results of measuring cellular uptake of the dendritic cell-targeting peptides of the present invention in lymph node cells, spleen dendritic cells, and bone marrow-derived dendritic cells (BMDC).
- BMDC bone marrow-derived dendritic cells
- Figure 8 shows the localization of the DCpep6 peptide of the present invention in cervical lymph node (cLN) cells through confocal microscopy after administration of the peptide to the mouse nasal cavity.
- cLN cervical lymph node
- FIG. 9 is a schematic diagram of the peptide component of the present invention.
- 11 and 12 show the tumor volume and size of mice according to single administration and mixed administration of E7 FL , E7 ⁇ NLS, and FlaB.
- FIG. 13 shows the activity levels of NF- ⁇ B by TLR-5 stimulation of FlaB, EF, and DEF.
- Figure 14 shows the results of measuring cellular uptake of EF and DEF in bone marrow-derived dendritic cells (BMDC) through flow cytometry.
- BMDC bone marrow-derived dendritic cells
- Figure 15 shows the location of EF and DEF in bone marrow-derived dendritic cells (BMDC) and Raw264.7 cells through confocal microscopy.
- BMDC bone marrow-derived dendritic cells
- Figure 16 shows the distribution in living lymph nodes over time after administration of EF and DEF.
- FIG. 17 shows the results of measuring cellular uptake of EF and DEF in draining inguinal lymph node (iLN) cells.
- BMDC bone marrow-derived dendritic cells
- 21 and 22 show the results of measuring tetramer-positive cells selective for the E7-CTL epitope in peripheral blood CD8 + cells of mice following administration of E7 ⁇ NLS, EF, and DEF.
- WT wild-type
- TLR5-/- TLR5-deficient mice
- NLRC4-/- mice mice following EF and DEF administration.
- Figure 26 shows the division index of CD8 + T cells of wild-type (WT) and NLRC4 deficient (NLRC4-/-) mice according to EF and DEF administration.
- the present invention provides a novel peptide targeting dendritic cells in vivo discovered through biopanning.
- the novel peptide targeting dendritic cells in vivo has excellent ability to target dendritic cells isolated from spleen and lymph nodes and dendritic cells derived from various bone marrows, and thus can effectively activate dendritic cells in vivo.
- the novel peptide targeting dendritic cells in vivo of the present invention may include an amino acid sequence of SEQ ID NO: 1 to SEQ ID NO: 11, preferably SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 6 , It may be one comprising the amino acid sequences of SEQ ID NO: 9 and SEQ ID NO: 10. More preferably, it may include the amino acid sequences of SEQ ID NO: 6, SEQ ID NO: 9, and SEQ ID NO: 10, and most preferably, it may include the amino acid sequence of SEQ ID NO: 6.
- biopanning refers to various displays such as bacterial display including phage display or mRNA display, ribosome display, yeast display, and the like. It is a technology that selects peptides having affinity for a given target from a peptide library constructed by the technology.
- the “dendritic cell (DC)” of the present invention interacts with the T cell receptor through the major histocompatibility complex (MHC)/peptide complex to regulate the activation and differentiation of T cells, thereby leading to an innate immune response and These are specialized antigen-presenting cells that play a central role in linking the adaptive immune response. It is known that dendritic cells are CD14 positive when derived from human peripheral circulating blood, and show positive CD11c and CD68 cell markers as they differentiate into dendritic cells.
- MHC major histocompatibility complex
- CD11c is one of the integrin CD18 family and forms a heterodimer in the form of CD11c/CD18, and is involved in phagocytosis as complement receptor 4.
- CD11c in humans is known to be expressed mainly in the plasma membrane of monocytes, macrophages, natural killer cells, and most dendritic cells, but in mice It is expressed almost exclusively in dendritic cells and is known as the best marker for dendritic cells.
- the present invention provides a peptide for treating or preventing cancer that targets dendritic cells.
- a polynucleotide comprising a nucleic acid sequence encoding the peptide is provided.
- the peptide may include an amino acid sequence selected from the group consisting of SEQ ID NO: 1 to SEQ ID NO: 11, and preferably the peptide is SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 6, SEQ ID NO: 9 and sequence It may include any one amino acid sequence selected from the group consisting of number 10. More preferably, it may include any one amino acid sequence selected from the group consisting of SEQ ID NO: 6, SEQ ID NO: 9, and SEQ ID NO: 10, and most preferably may include the amino acid sequence of SEQ ID NO: 6.
- the peptide can bind to dendritic cells in vivo and induce their activity.
- the dendritic cell-targeting peptide for treating or preventing cancer may further include at least one selected from the group consisting of a tumor antigen and flagellin.
- the peptide may include the amino acid sequence of SEQ ID NO: 6, the amino acid sequence of SEQ ID NO: 22, and the amino acid sequence of SEQ ID NO: 23.
- the peptide may include four consecutive amino acid sequences of SEQ ID NO: 22, and may preferably include an amino acid sequence of SEQ ID NO: 25 (DCpep6-4xE7 ⁇ NLS-FlaB).
- the amino acid sequence of SEQ ID NO: 22 represents a tumor antigen, and the tumor antigen is a tumor-specific antigen expressed only in tumor cells, and may be a protein by mutation, a tumor-specific oncogene, or a viral oncogene.
- the tumor antigen may be E7NLS in which the N-terminal nuclear localization sequence (NLS) is deleted from HPV16 E7 (E7 FL ).
- NLS N-terminal nuclear localization sequence
- the amino acid sequence of SEQ ID NO: 23 represents flagellin B (FlaB) derived from Vibrio vunificus , and the flagellin is a major protein constituting the filament of bacterial flagellum, and the flagellar bacteria are infected.
- an immune response can be induced in the infected host.
- TLR5 Toll-like receptor 5
- NF- ⁇ B a transcription factor
- NAIP NLR family, apoptosis inhibitory protein
- NLRC4 NLR containing a caspase activating and recruitment domain protein 4
- NF- ⁇ B a transcription factor
- the flagellin may be flagellin B (FlaB) derived from Vibrio vunificus , and may be prepared according to a method disclosed in Korean Patent Registration No. 10-0795839, which is described in these documents. Its entirety is incorporated herein by reference.
- FeB flagellin B
- the present invention provides a pharmaceutical composition for treating or preventing cancer comprising a peptide for treating or preventing cancer that targets dendritic cells in vivo.
- the present invention provides a vaccine composition for treating or preventing cancer comprising a peptide for treating or preventing cancer that targets dendritic cells in vivo.
- a pharmaceutical composition for treating or preventing cancer, or a vaccine composition comprising the dendritic cell-targeting peptide for treating or preventing cancer may further include at least one selected from the group consisting of a tumor antigen and flagellin.
- a pharmaceutical composition or vaccine composition for treating or preventing cancer comprising the dendritic cell-targeting peptide for cancer treatment or prevention, or a vaccine composition, wherein the dendritic cell-targeting peptide, tumor antigen, and flagellin are linked as one peptide, or each peptide can be included with
- the pharmaceutical composition or vaccine composition comprises a peptide comprising the amino acid sequence of SEQ ID NO: 6, the amino acid sequence of SEQ ID NO: 22, and the amino acid sequence of SEQ ID NO: 23, or comprising the amino acid sequence of SEQ ID NO: 6
- a peptide, a peptide having the amino acid sequence of SEQ ID NO: 22, and a peptide including the amino acid sequence of SEQ ID NO: 23 may be included, respectively.
- the peptide may include four consecutive amino acid sequences of SEQ ID NO: 22, and may preferably include an amino acid sequence of SEQ ID NO: 25 (DCpep6-4xE7 ⁇ NLS-FlaB).
- the pharmaceutical composition or vaccine composition of the present invention may induce an overall immune response in vivo and a specific immune response to a specific antigen, including antigen-specific and specific immunity-inducing substances.
- the pharmaceutical composition or vaccine composition of the present invention may exhibit an antitumor effect.
- the pharmaceutical composition or vaccine composition of the present invention may exhibit an immune enhancing effect.
- the pharmaceutical composition or vaccine composition of the present invention can induce long-term survival in a subject receiving the composition.
- the term “pharmaceutical composition” refers to a composition administered for a specific purpose.
- the pharmaceutical composition of the present invention is a composition for treating or preventing cancer containing a peptide targeting dendritic cells in vivo, a tumor antigen, and flagellin.
- the term "vaccine” refers to preventing infection or re-infection of a pathogen by inducing an immune response against the pathogen in an animal, including a human, as a host, reducing the severity of symptoms caused by the pathogen, or eliminating symptoms, or corresponding It is meant to include the substantial or complete elimination of a pathogen or a disease caused by that pathogen.
- the term “vaccine” used in the present invention refers to reducing the severity of disease symptoms or eliminating symptoms associated with the antigen by modulating the immune response to the specific antigen in an animal, including human, as a host, or substantially or completely eliminating the disease. It means to include removal. Therefore, the "vaccine composition" of the present invention can be administered to animals, including humans, prophylactically before infection with the corresponding pathogen or therapeutically after infection with the corresponding pathogen.
- treatment refers to all activities that improve or beneficially change the symptoms of a suspected or affected subject of a disease by administration of a composition
- prevention inhibits or delays the onset of a disease by administration of a composition. means all actions.
- dendritic cells not only can dendritic cells be effectively activated, but also tumor cell-specific immunity can be effectively induced, thereby significantly improved anticancer immunity can be induced.
- mice For in vivo biopanning, 10 ⁇ l of the CPL3 peptide phagemid library (10 12 pfu/ml) was injected into each nostril of Balb/c mice. Library phages were injected into 3 mice. After 6 hours of in vivo panning, mice were euthanized and cervical lymph nodes (cLNs) harvested. The collected cLNs were centrifuged, washed three or more times with 0.2% PBST, and then washed once with 100 ⁇ l of 0.2M glycine-HCl buffer, pH 2.2. Then, cLNs were put in the same buffer and incubated at room temperature for 10 minutes, and then the glycine buffer was replaced with cold 1x PBS.
- CPL3 peptide phagemid library 10 12 pfu/ml
- Library phages were injected into 3 mice. After 6 hours of in vivo panning, mice were euthanized and cervical lymph nodes (cL
- the cLN's capsule was gently broken and the cell suspension passed through a 40 ⁇ m cell strainer (Falcon, 352340). The resulting single cell suspension was centrifuged and treated with glycine buffer for 5 minutes, then the cells were washed with PBS and suspended in MACS buffer.
- Cell suspensions were labeled with CD11c + MicroBeads MACS (Miltenyi Biotec, 130-052-001), and DCs were purified by applying a magnetic field according to the manufacturer's recommendations. After the purified DCs were added to glycine buffer for another 5 minutes, the cells were washed three or more times using PBST (1 x PBS + 0.05% Tween20). Then, in order to elute intracellular phages, they were suspended in 100 ⁇ l glycine buffer and disrupted by 5 freeze-thaw cycles using high-speed centrifugation (13000 rpm, 10 minutes). Cell destruction was confirmed by trypan blue staining.
- the glycine buffer was neutralized by adding an equal volume of 1 x PBS (pH 7.5). Finally, the preparation was centrifuged, and the supernatant containing the eluted phage was collected and stored at -20 °C. Phage titres of preparations were determined by standard protocols. Individual bacterial clones containing phagemids were cultured in Luria Broth containing ampicillin (200 ⁇ g/ml) until an OD 600 value of 0.5. Equal volumes of all 45 bacterial clones were mixed together, and phages were eluted using M13KO7 helper phage for 13 hours before amplification in E. coli TG1.
- Phage in the cell-free supernatant were recovered by PEG/NaCl precipitation (4 °C/o/n).
- 2 rounds of panning were performed using the phages amplified in round 1, and the DNA sequences of the phages obtained in round 1 were determined by dideoxy sequencing.
- the femurs and tibias of C57BL/6 mice were flushed to separate bone marrow cells, and red blood cells (RBCs) were removed by ACK lysis (Gibco, A10492-01). After centrifugation, the cells were filtered through a 70 ⁇ m filter and suspended in RPMI 1640 medium supplemented with 10% heat-inactivated FBS, 100 units/ml penicillin and 100 ⁇ g/ml streptomycin.
- BMDCs bone marrow-derived DCs
- DCs dendritic cells
- the peptide was synthesized using 9-fluorenylmethyoxycarbonyl chemistry, purified to a purity of 95% or more using high-pressure liquid chromatography, and biotinylated on the side chain (Anygen Inc., Korea). Peptides were dissolved at a concentration of 0.5 mg/ml in an appropriate solvent.
- dendritic cell CD11c +
- cervical lymph node (cLN) cells, spleen dendritic cells and bone marrow-derived dendritic cells (BMDC) were treated with the six peptides in RPMI 1640 medium and cultured for 2 hours.
- DCpep 1, 2 and 5 As shown in FIG. 6, as a result of measuring the cellular uptake of the peptide in bone marrow-derived dendritic cells, the targeting ability of DCpep 1, 2 and 5 was similar to that of the negative control group, whereas DCpep 3, 4 and 6 showed CD11c It was shown to efficiently target + -BMDC. In particular, DCpep 6 peptide showed a remarkably high value.
- DCpep 3, 4, and 6 exhibiting excellent efficiency showed an increased pattern in all of cervical lymph node cells, spleen DCs, and bone marrow-derived DCs.
- DCpep6 peptide SEQ ID NO: 6
- SEQ ID NO: 6 showed a remarkably high value.
- DCpep 3 DCpep 4
- DCpep 6 peptide SEQ ID NO: 6
- Example 2 In order to confirm the ability of the DCpep 6 peptide selected in Example 2 to target dendritic cells in vivo, the following procedure was performed.
- mice were intranasally administered with appropriate concentrations of the peptides in a total volume of 10 ⁇ l/nostril.
- a scrambled peptide previously shown to be non-specific for dendritic cells was used as a negative control.
- mice were sacrificed and cervical lymph nodes (cLNs) were harvested.
- the cLN's capsule was gently torn to prepare a single cell suspension. After gently washing with 1 x PBS, cells were stained with anti-mouse CD11c + APC-conjugated antibody (eBioscience, Clone: N418, 170114-82) or Streptaviden-AF488 and analyzed using FACS.
- the DCpep 6 peptide of the present invention was clearly localized in the cytoplasm of CD11c + cells in the cervical lymph node. Therefore, the ability of the DCpep 6 peptide (SEQ ID NO: 6) of the present invention discovered through biopanning to target dendritic cells (CD11c + ) was confirmed.
- the E7NLS peptide an HPV16 E7 (E7 FL ) mutant in which the N-terminal nuclear localization sequence (NLS) was deleted to exclude the possibility of tumor formation by HPV16 E7
- E7 FL an HPV16 E7
- NLS N-terminal nuclear localization sequence
- a pET30a+ plasmid Novagen, 69909 - Merck Millipore
- the insert DNA fragment was amplified by PCR using a codon-optimized DNA template and primers of SEQ ID NOs: 14 and 15.
- FlaB from Vibrio vunificus was described by Lee SE, et al.
- a bacterial flagellin, Vibrio vulnificus FlaB has a strong mucosal adjuvant activity to induce protective immunity.
- the synthesized 4xE7 ⁇ NLS DNA fragment ( NdeI -E7 ⁇ NLS- EcoRI -E7 ⁇ NLS- SalI -E7 ⁇ NLS- SalI -E7 ⁇ NLS- HindIII ) was firstly digested with specific restriction enzymes (RE) of NdeI and HindIII . cloned into a pET30a+ plasmid with an overhang recognized by Next, DNA fragments of FlaB were generated through PCR using primers of SEQ ID NOs: 18 and 19 having HindIII and XhoI overhangs, respectively. The DNA fragment of FlaB was digested with HindIII and XhoI restriction enzymes and fused to the C-terminus of 4xE7 ⁇ NLS to generate pET30a+::4xE7 ⁇ NLS::FlaB.
- RE specific restriction enzymes
- the DNA fragment of the synthesized DCpep6-E7 ⁇ NLS ( NdeI -DCpep6-E7 ⁇ NLS- EcoRI ) was amplified by PCR using primers of SEQ ID NOs: 16 and 20 with NdeI and EcoRI overhangs, respectively, and pET30a+::3xE7 ⁇ NLS::FlaB was cloned into the N-terminus of pET30a+::DCpep6::4xE7 ⁇ NLS::FlaB.
- the DNA nucleotide sequence of the expression vector was confirmed by dideoxy-chain termination sequencing using the Macrogen Online Sequencing Order System (http://dna.macrogen.com/kor/).
- the resulting plasmid was transformed into competent E. coli BL21 cells. Protein expression was induced by treatment with 0.2 mM isopropyl- ⁇ -D-thiogalactoside (IPTG) and incubation at 20 °C for 18 hours, and the cells were pelleted by centrifugation and stored at -80 °C.
- IPTG isopropyl- ⁇ -D-thiogalactoside
- Bacterial cell pellets were lysed with 50 ml of lysis buffer (pH 8; 50 mM NaH2PO4, 300 mM NaCl, 10 mM imidazole, 0.1% Triton X-100, 0.1% Tween and 20 ⁇ M phenylmethylsulfonyl fluoride). After centrifugation at 18,000 rpm for 30 minutes, the cell-free supernatant was loaded onto a column containing Ni-NTA agarose beads (Qiagen, Hilden, Germany) according to the manufacturer's instructions.
- lysis buffer pH 8; 50 mM NaH2PO4, 300 mM NaCl, 10 mM imidazole, 0.1% Triton X-100, 0.1% Tween and 20 ⁇ M phenylmethylsulfonyl fluoride. After centrifugation at 18,000 rpm for 30 minutes, the cell-free supernatant was loaded onto a column containing Ni-NTA agarose beads (Q
- E7 FL E7 ⁇ NLS
- FlaB F
- 4xE7 ⁇ NLS::FlaB EF
- DCpep6::4xE7 ⁇ NLS::FlaB DCpep6::4xE7 ⁇ NLS::FlaB
- TC-1 cells were cultured at 37 °C, 5% CO 2 in 10% heat-inactivated FBS, 100 units/ml penicillin and 100 ⁇ g/ml penicillin. It was cultured in RPMI 1640 medium supplemented with ml streptomycin. Tumors were established by subcutaneous injection of 5 x 10 4 TC-1 cells in 100 ⁇ l PBS into the right central flank of each mouse.
- tumor-bearing mice were randomly divided, anesthetized, and treated with 200 ⁇ l PBS, 4 ⁇ g FlaB (F), 10 ⁇ g E7 FL (E FL ), 10 ⁇ g E7 FL + 4 ⁇ g FlaB ( E FL +F), 8 ⁇ g E7 ⁇ NLS and 8 ⁇ g E7 ⁇ NLS + 4 ⁇ g FlaB (E+F) were administered 3 times at 5-day intervals around the tumor.
- E7 ⁇ NLS (E) and E7 FL (E FL ) induced tumor suppression at a similar level, and flagellin (F) was reinforced with E7 ⁇ NLS + FlaB ( E+F) and E7 FL +FlaB (E FL +F) appeared to induce better tumor suppression.
- flagellin (F) administration alone did not inhibit tumor growth.
- the E7 ⁇ NLS peptide of the present invention is an optimal tumor antigen, and that flagellin (FlaB) can enhance antigen-mediated tumor suppression.
- 4xE7 ⁇ NLS::FlaB (EF) and DCpep6::4xE7 ⁇ NLS::FlaB (DEF) of the present invention do not interfere with TLR5 binding activity and stabilize the TLR5 binding motif. Furthermore, it can be seen that DCpep6::4xE7 ⁇ NLS::FlaB (DEF) shows a more excellent effect compared to 4xE7 ⁇ NLS::FlaB (EF).
- DCpep6::4xE7 ⁇ NLS::FlaB (DEF) of the present invention stably maintains its biological activity even though structurally or functionally different peptides are included.
- Bone marrow-derived dendritic cells prepared in the same manner as in Example 2 were treated with 4xE7 ⁇ NLS::FlaB (EF) and DCpep6::4xE7 ⁇ NLS::FlaB (DEF) at each concentration in RMPI 1640 medium and cultured for 2 hours. .
- Cells treated with only PBS were used as a negative control. After incubation, cells were washed twice with cold 1x PBS containing 3% FBS and stained with anti-mouse CD11c + antibody (eBioscience, Clone: N418, 25-0114-82) for 1 hour at 4 °C. , and fixed with 4% paraformaldehyde (T&I, BPP-9004) for 10 min at room temperature.
- BMDC or Raw264.7 cells were treated with 20 ⁇ g/ml of 4xE7 ⁇ NLS::FlaB (EF) and DCpep6::4xE7 ⁇ NLS::FlaB (DEF) in RMPI 1640 medium and cultured for 2 hours. After incubation, the cells were harvested, washed, fixed with 100% methanol for 15 minutes at room temperature, and stained with anti-mouse CD11c + APC-conjugated antibody and DAPI for nuclei staining at room temperature for 1 hour. After washing twice with cold 1 x PBS, the localization of dendritic cells (CD11c + ) was observed using a confocal microscope. The results are shown in FIG. 15 .
- DCpep6::4xE7 ⁇ NLS::FlaB is 4xE7 ⁇ NLS::FlaB (EF) exhibited little, whereas cell uptake in a dependent manner.
- DCpep6::4xE7 ⁇ NLS::FlaB (DEF) was located in the cytoplasm of CD11c + cells and accumulated in a punctuated pattern.
- DCpep6::4xE7 ⁇ NLS::FlaB (DEF) of the present invention has excellent dendritic cell (CD11c + ) targeting ability by including the dendritic cell targeting peptide (DCpep6).
- PBS, 50 ⁇ g EF-FNR675 and 50 ⁇ g DEF-FNR675 were administered subcutaneously to the right side of the groin of C57BL/6 mice.
- Draining inguinal lymph nodes (iLNs) were isolated and determined for fluorescence imaging at 1, 6, 12 and 24 hours after administration and are shown in FIG. 16 .
- draining inguinal lymph node (iLN) cells were prepared 6 hours after administration and the dendritic cell (CD11c + ) population was analyzed using FACS, as shown in FIG. 17 .
- DCpep6::4xE7 ⁇ NLS::FlaB (DEF) of the present invention when administered in vivo, not only efficiently reached the draining lymph node through the lymphatic circulation, but also could interact with dendritic cells (CD11c + ) in vivo. .
- DEF administered in vivo is removed from the draining lymph node within 24 hours of administration.
- the integrated vaccine of the present invention was administered to tumor-bearing mice, and the survival rate and tumor volume of the mice were measured.
- an HPV16 E7 CTL peptide (amino acids 49-57: RAHYNIVTF) known as a cytotoxic T lymphocyte (CTL) inducing peptide was administered.
- CTL cytotoxic T lymphocyte
- the group administered with E7 ⁇ NLS + FlaB (E+F) and DCpep6-4xE7 ⁇ NLS-FlaB (DEF) showed longer survival than the group administered with E7 ⁇ NLS (E), especially DCpep6-4xE7 ⁇ NLS- Administration of FlaB (DEF) showed the longest survival.
- survival was significantly longer than that of the group administered with HPV16 E7 CTL peptide + FlaB (E7 Pep+F).
- DCpep6::4xE7 ⁇ NLS::FlaB (DEF) of the present invention not only has excellent in vivo antitumor efficacy, but also maintains long-term survival.
- the peptide of the present invention comprising a peptide (DCpep6) targeting dendritic cells in vivo, a tumor antigen (E7 ⁇ NLS), and flagellin (FlaB) has better antitumor efficacy than a peptide containing only a tumor antigen and flagellin. confirmed that
- Bone marrow-derived dendritic cells prepared in the same manner as in Example 2 were treated with PBS, 0.5 ⁇ g/ml 4xE7 ⁇ NLS::FlaB (EF) and 0.5 ⁇ g/ml DCpep6::4xE7 ⁇ NLS::FlaB (DEF) for 24 hours. After that, they were stained on ice with fluorescently labeled antibodies and analyzed by flow cytometry.
- CD80 and CD86 expression on the surface of BMDC was measured, and DCpep6::4xE7 ⁇ NLS::FlaB (DEF) enhanced the expression of CD80 and CD86, whereas 4xE7 ⁇ NLS::FlaB (EF) enhanced CD80 and CD80 and CD86 expression. It was found that it did not induce a statistically significant change in the expression of CD86.
- DCpep6::4xE7 ⁇ NLS::FlaB (DEF) of the present invention activates antigen presenting cells (APCs).
- the peptides of the present invention were administered to tumor-bearing mice and tumor-free mice, and the peripheral blood of the mice was collected.
- RBC-free blood using RBC lysis buffer was stained with a tetramer antibody (PE-conjugated HPV16 H-2Db-RAHYNIVTF, TB-5008-1, MBL) and CD8 antibody and analyzed by flow cytometry.
- DCpep6::4xE7 ⁇ NLS::FlaB (DEF) of the present invention effectively induces an antigen-specific T cell immune response.
- CTL Cytotoxic T lymphocyte
- a single cell suspension was prepared from the spleen (SPL) or tumor lymph node (TDLN) of the mouse by administering the peptide of the present invention to tumor-bearing mice and tumor-free mice in the same manner as in Example 5.
- 1 x 10 6 SPL or 2.5 x 10 5 TDLN cells were placed in a 96-well Filtration ELISpot plate (Merc, HAMAS4510) and stimulated with 1 ⁇ g/ml E7 CTL peptide (amino acids 49-57: RAHYNIVTF). Cells stimulated with 10 ng/ml concanavalin A were used as a positive control.
- IFN was performed using Mouse IFN- ⁇ ELISpot Set (BD Bioscience, 551083) according to the manufacturer's instructions. - ⁇ producing cells were detected. IFN- ⁇ producing cells (SPOT) were analyzed using CTL-ImmunoSpot Analyzer and ImmunoSpot Professional Software version 5.0 (Cellular Technology, Shaker Heights, OH, USA).
- DCpep6::4xE7 ⁇ NLS::FlaB (DEF) of the present invention effectively induces a specific immune response by the CTL peptide.
- DCpep6::4xE7 ⁇ NLS::FlaB (DEF) of the present invention effectively induces an antigen-specific immune response in vivo, and that an excellent anti-tumor immune response can be induced through the induction of such immunoregulatory activity. Able to know.
- TC-1 cells were transplanted into the right middle flank of groups of wild-type (WT), TLR5-deficient (TLR5 -/- ) and NLRC4-deficient (NLRC4 -/- ) mice, and the tumor size reached approximately 3-5 mm in diameter.
- 200 ⁇ l of PBS alone, 20 ⁇ g of 4xE7 ⁇ NLS::FlaB (EF), and 20 ⁇ g of DCpep6::4xE7 ⁇ NLS::FlaB (DEF) were administered around the tumor three times at 5-day intervals. Tumor volume and survival of tumor-bearing mice were measured and shown in FIG. 25 . Additionally, prior experiments confirmed that TLR5 or NLRC4 deficiency (knockout) did not affect TC-1 tumor growth.
- Bone marrow-derived dendritic cells prepared in the same manner as in Example 2 were activated with 4xE7 ⁇ NLS::FlaB (EF) and DCpep6::4xE7 ⁇ NLS::FlaB (DEF) at 1 ⁇ g/mL for 24 hours.
- CD8 + splenocytes from TC-1 tumor-bearing mice were prepared using the MagniSortTM Mouse CD8 T Cells Enrichment kit (Invitrogen, 8804-6822) according to the manufacturer's instructions and labeled with 5 ⁇ M CFSE.
- BMDC stimulated with EF or DEF were treated with 10% fetal bovine serum (Hyclone, Logan, UT) and 1% penicillin/streptomycin (Life Tech-nologies, Grand Island, NY, USA) and 50 mM 2-mercaptoethanol (Sigma , 516732) were co-cultured with CFSE-stained CD8 + cells at a ratio of 1:5 for 3 days in RPMI 1640 medium.
- CD8 + T cell proliferation was assessed by CFSE dilution using flow cytometry.
- DCpep6::4xE7 ⁇ NLS::FlaB (DEF) of the present invention activates CD8 + T cells, which is influenced by the NLRC4 inflammasome signaling pathway.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Organic Chemistry (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- General Chemical & Material Sciences (AREA)
- Epidemiology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Immunology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Oncology (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Abstract
Description
펩타이드 | 아미노산 서열 | 서열번호 |
1 | ARPGVSMRIEAHGG | 서열번호 1 |
2 | ARQYNGIFHPVRS | 서열번호 2 |
3 | SPACLDLGLVPWRI | 서열번호 3 |
4 | VDLYPCYTFHSRVV | 서열번호 4 |
5 | HFAWRTILWGTTHH | 서열번호 5 |
6 | RFFCLGPLGFTKVD | 서열번호 6 |
펩타이드 | 아미노산 서열 | 서열번호 |
DCpep1 | ARPGVSMKIEAHGG | 서열번호 7 |
DCpep2 | ARQYNGIFHPVKS | 서열번호 8 |
DCpep3 | SPACLDLGLVPWKI | 서열번호 9 |
DCpep4 | VDLYPCYTFHSKVV | 서열번호 10 |
DCpep5 | HFAWKTILWGTTHH | 서열번호 11 |
DCpep6 | RFFCLGPLGFTKVD | 서열번호 6 |
프라이머 | 염기 서열 (5'→3') | 서열번호 | |
E7 full length (E7FL) | E7-F (NdeI) | GGGAATTCCATATGCATGGTGACACGCCCAC | 서열번호 12 |
E7-R (XhoI) | CCGCTCGAGTGGTTTCTGGGAGCATAT | 서열번호 13 | |
E7ΔNLS(E) | E7ΔNLS-F (NdeI) | GGGAATTCCATATGATCGATGGGCCGGCCGGT | 서열번호 14 |
E7ΔNLS-R (XhoI) | CCGCTCGAGTGGTTTCTGGGAGCATAT | 서열번호 15 | |
4xE7ΔNLS::FlaB (EF) | E7ΔNLS-F (NdeI) | GGGAATTCCATATGATCGATGGGCCGGCCGGT | 서열번호 14 |
E7ΔNLS-F (EcoRI) | CCGGAATTCAATTGGATCGATGTACGCTA | 서열번호 16 | |
E7ΔNLS-R (HindIII) | CCCAAGCTTTGGTTTCTGGGAGCATAT | 서열번호 17 | |
FlaB-F (HindIII) | CCCAAGCTTATGGCAGTGAATGTAAATAC | 서열번호 18 | |
FlaB-R (XhoI) | CCGCTCGAGGCCTAGTAGACTTAGCGCTG | 서열번호 19 | |
DCpep6::4xE7ΔNLS::FlaB (DEF) | DCpep6-F (NdeI) | GGGAATTCCATATGCGCTTCTTCTGTTTGGGTCCA | 서열번호 20 |
E7ΔNLS-F (EcoRI) | CCGGAATTCAATTGGATCGATGTACGCTA | 서열번호 16 | |
E7ΔNLS-R (HindIII) | CCCAAGCTTTGGTTTCTGGGAGCATAT | 서열번호 17 | |
FlaB-F (HindIII) | CCCAAGCTTATGGCAGTGAATGTAAATAC | 서열번호 18 | |
FlaB-R (XhoI) | CCGCTCGAGGCCTAGTAGACTTAGCGCTG | 서열번호 19 |
아미노산 서열 | 서열번호 | |
E7FL | MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTVDIRTLEDLLMGTLGIVCPICSQKPLEHHHHHH | 서열번호 21 |
E7ΔNLS (E) | MIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKPLEHHHHHH | 서열번호 22 |
FlaB (F) | MAVNVNTNVAAMTAQRYLNNANSAQQTSMERLSSGFKINSAKDDAAGLQISNRLNVQSRGLDVAVRNANDGISIAQTAEGAMNETTNILQRMRDLSLQSANGSNSKSERVAIQEEVTALNDELNRIAETTSFGGNKLLNGTYGTKAMQIGADNGEAVMLSLKDMRSDNVMMGGVSYQAEEGKDKNWNVAAGDNDLTIALTDSFGNEQEIEINAKAGDDIEELATYINGQTDLVKASVGEGGKLQIFAGNNKVQGEIAFSGSLAGELGLGEGKNVTVDTIDVTTVQGAQESVAIVDAALKYVDSHRAELGAFQNRFNHAISNLDNINENVNASKSRIKDTDFAKETTQLTKTQILSQASSSILAQAKQAPNSALSLLG | 서열번호 23 |
4xE7ΔNLS::FlaB (EF) | MIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKPEFIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKPVDIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKPVDIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKPKLMAVNVNTNVAAMTAQRYLNNANSAQQTSMERLSSGFKINSAKDDAAGLQISNRLNVQSRGLDVAVRNANDGISIAQTAEGAMNETTNILQRMRDLSLQSANGSNSKSERVAIQEEVTALNDELNRIAETTSFGGNKLLNGTYGTKAMQIGADNGEAVMLSLKDMRSDNVMMGGVSYQAEEGKDKNWNVAAGDNDLTIALTDSFGNEQEIEINAKAGDDIEELATYINGQTDLVKASVGEGGKLQIFAGNNKVQGEIAFSGSLAGELGLGEGKNVTVDTIDVTTVQGAQESVAIVDAALKYVDSHRAELGAFQNRFNHAISNLDNINENVNASKSRIKDTDFAKETTQLTKTQILSQASSSILAQAKQAPNSALSLLGLEHHHHHH | 서열번호 24 |
DCpep6::4xE7ΔNLS::FlaB (DEF) | MRFFCLGPLGFTKVDIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKPEFIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKPVDIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKPVDIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKPKLMAVNVNTNVAAMTAQRYLNNANSAQQTSMERLSSGFKINSAKDDAAGLQISNRLNVQSRGLDVAVRNANDGISIAQTAEGAMNETTNILQRMRDLSLQSANGSNSKSERVAIQEEVTALNDELNRIAETTSFGGNKLLNGTYGTKAMQIGADNGEAVMLSLKDMRSDNVMMGGVSYQAEEGKDKNWNVAAGDNDLTIALTDSFGNEQEIEINAKAGDDIEELATYINGQTDLVKASVGEGGKLQIFAGNNKVQGEIAFSGSLAGELGLGEGKNVTVDTIDVTTVQGAQESVAIVDAALKYVDSHRAELGAFQNRFNHAISNLDNINENVNASKSRIKDTDFAKETTQLTKTQILSQASSSILAQAKQAPNSALSLLGLEHHHHHH | 서열번호 25 |
Claims (22)
- 수지상 세포를 표적하는, 서열번호 1 내지 서열번호 11로 이루어진 군에서 선택된 아미노산 서열을 포함하는 것을 특징으로 하는, 암 치료 또는 예방용 펩타이드.
- 제1항에 있어서, 서열번호 3, 서열번호 4, 서열번호 6, 서열번호 9 및 서열번호 10으로 이루어진 군에서 선택된 어느 하나의 아미노산 서열을 포함하는 것을 특징으로 하는, 암 치료 또는 예방용 펩타이드.
- 제1항에 있어서, 서열번호 6, 서열번호 9 및 서열번호 10으로 이루어진 군에서 선택된 어느 하나의 아미노산 서열을 포함하는 것을 특징으로 하는, 암 치료 또는 예방용 펩타이드.
- 제1항에 있어서, 서열번호 6의 아미노산 서열을 포함하는 것을 특징으로 하는, 암 치료 또는 예방용 펩타이드.
- 제1항에 있어서, 생체 내 수지상 세포와 결합하여 이의 활성을 유도하는 것을 특징으로 하는, 암 치료 또는 예방용 펩타이드.
- 제1항에 있어서, 종양 항원 및 플라젤린으로 이루어진 군에서 선택된 하나 이상을 추가로 포함하는 것을 특징으로 하는, 암 치료 또는 예방용 펩타이드.
- 제6항에 있어서, 상기 종양 항원 4개를 연속하여 포함하는 것을 특징으로 하는, 암 치료 또는 예방용 펩타이드.
- 제6항에 있어서, 상기 종양 항원은 서열번호 22의 아미노산 서열을 포함하는 것을 특징으로 하는, 암 치료 또는 예방용 펩타이드.
- 제6항에 있어서, 상기 플라젤린은 서열번호 23의 아미노산 서열을 포함하는 것을 특징으로 하는, 암 치료 또는 예방용 펩타이드.
- 제6항에 있어서, 서열번호 6의 아미노산 서열, 서열번호 22의 아미노산 서열, 및 서열번호 23의 아미노산 서열을 포함하는 것을 특징으로 하는, 암 치료 또는 예방용 펩타이드.
- 제6항에 있어서, 서열번호 25의 아미노산 서열을 포함하는, 암 치료 또는 예방용 펩타이드.
- 제6항에 있어서, 장기 생존을 유도하는 것을 특징으로 하는, 암 치료 또는 예방용 펩타이드.
- 제6항에 있어서, 면역 증강 효과를 갖는 것을 특징으로 하는, 암 치료 또는 예방용 펩타이드.
- 제1항 내지 제11항 중 어느 한 항의 펩타이드를 코딩하는 핵산 서열을 포함하는 폴리뉴클레오타이드.
- 제1항의 펩타이드를 포함하는 암 치료 또는 예방용 약학 조성물.
- 제15항에 있어서, 종양 항원 및 플라젤린으로 이루어진 군에서 선택된 하나 이상을 추가로 포함하는 것을 특징으로 하는, 암 치료 또는 예방용 약학 조성물.
- 제16항에 있어서, 상기 종양 항원 4개를 포함하는 것을 특징으로 하는, 암 치료 또는 예방용 약학 조성물.
- 제16항에 있어서, 상기 제1항의 펩타이드, 종양 항원 및 플라젤린은 하나의 펩타이드로 연결되거나, 각각의 펩타이드로 포함될 수 있는 것을 특징으로 하는, 암 치료 또는 예방용 약학 조성물.
- 제1항의 펩타이드를 포함하는 암 치료 또는 예방용 백신 조성물.
- 제19항에 있어서, 종양 항원 및 플라젤린으로 이루어진 군에서 선택된 하나 이상을 추가로 포함하는 것을 특징으로 하는, 암 치료 또는 예방용 백신 조성물.
- 제20항에 있어서, 상기 종양 항원 4개를 포함하는 것을 특징으로 하는, 암 치료 또는 예방용 백신 조성물.
- 제20항에 있어서, 상기 제1항의 펩타이드, 종양 항원 및 플라젤린은 하나의 펩타이드로 연결되거나, 각각의 펩타이드로 포함될 수 있는 것을 특징으로 하는, 암 치료 또는 예방용 백신 조성물.
Priority Applications (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202280046109.1A CN117580852A (zh) | 2021-10-28 | 2022-10-26 | 靶向树突状细胞的新型肽及包含该新型肽的癌症治疗用组合物 |
US18/555,988 US20240207380A1 (en) | 2021-10-28 | 2022-10-26 | Novel peptide targeting dendritic cells, and composition for treating cancer comprising same |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR1020210146081A KR102514849B1 (ko) | 2021-10-28 | 2021-10-28 | 수지상 세포를 표적하는 신규한 펩타이드, 및 이를 포함하는 암 치료용 조성물 |
KR10-2021-0146081 | 2021-10-28 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2023075421A1 true WO2023075421A1 (ko) | 2023-05-04 |
Family
ID=85800205
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/KR2022/016492 WO2023075421A1 (ko) | 2021-10-28 | 2022-10-26 | 수지상 세포를 표적하는 신규한 펩타이드, 및 이를 포함하는 암 치료용 조성물 |
Country Status (4)
Country | Link |
---|---|
US (1) | US20240207380A1 (ko) |
KR (1) | KR102514849B1 (ko) |
CN (1) | CN117580852A (ko) |
WO (1) | WO2023075421A1 (ko) |
Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2004092195A2 (en) * | 2003-04-09 | 2004-10-28 | Administrators Of The Tulane Educational Fund | Dendritic cell binding proteins and uses thereof |
KR100795839B1 (ko) | 2004-01-12 | 2008-01-17 | 전남대학교산학협력단 | 세균의 편모 구성인자 플라젤린을 유효성분으로 함유하는점막 백신 보조제 |
KR20170031251A (ko) * | 2014-07-30 | 2017-03-20 | 클리브랜드 바이오랩스, 아이엔씨. | 플라젤린 조성물 및 용도 |
JP2018100243A (ja) * | 2016-12-21 | 2018-06-28 | ジェムバックス アンド カエル カンパニー,リミティド | テロメラーゼ由来のペプチドを含む樹状細胞治療剤及び免疫治療剤、及びこれを用いる治療方法 |
-
2021
- 2021-10-28 KR KR1020210146081A patent/KR102514849B1/ko active IP Right Grant
-
2022
- 2022-10-26 WO PCT/KR2022/016492 patent/WO2023075421A1/ko active Application Filing
- 2022-10-26 US US18/555,988 patent/US20240207380A1/en active Pending
- 2022-10-26 CN CN202280046109.1A patent/CN117580852A/zh active Pending
Patent Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2004092195A2 (en) * | 2003-04-09 | 2004-10-28 | Administrators Of The Tulane Educational Fund | Dendritic cell binding proteins and uses thereof |
KR100795839B1 (ko) | 2004-01-12 | 2008-01-17 | 전남대학교산학협력단 | 세균의 편모 구성인자 플라젤린을 유효성분으로 함유하는점막 백신 보조제 |
KR20170031251A (ko) * | 2014-07-30 | 2017-03-20 | 클리브랜드 바이오랩스, 아이엔씨. | 플라젤린 조성물 및 용도 |
JP2018100243A (ja) * | 2016-12-21 | 2018-06-28 | ジェムバックス アンド カエル カンパニー,リミティド | テロメラーゼ由来のペプチドを含む樹状細胞治療剤及び免疫治療剤、及びこれを用いる治療方法 |
Non-Patent Citations (2)
Title |
---|
CURIEL TYLER J., MORRIS CINDY, BRUMLIK MICHAEL, LANDRY SAMUEL J., FINSTAD KRISTIAAN, NELSON ANNE, JOSHI VIRENDRA, HAWKINS CHRISTOP: "Peptides Identified through Phage Display Direct Immunogenic Antigen to Dendritic Cells", THE JOURNAL OF IMMUNOLOGY, vol. 172, no. 12, 15 June 2004 (2004-06-15), US , pages 7425 - 7431, XP093060492, ISSN: 0022-1767, DOI: 10.4049/jimmunol.172.12.7425 * |
LEE SEKIM SYJEONG BCKIM YRBAE SJAHN OS ET AL.: "A bacterial flagellin, Vibrio vulnificus FlaB, has a strong mucosal adjuvant activity to induce protective immunity", INFECT IMMUN., vol. 74, no. 1, 2006, pages 694 - 702, XP008117348, DOI: 10.1128/IAI.74.1.694-702.2006 |
Also Published As
Publication number | Publication date |
---|---|
US20240207380A1 (en) | 2024-06-27 |
CN117580852A (zh) | 2024-02-20 |
KR102514849B1 (ko) | 2023-03-28 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
WO2021221486A1 (en) | Vaccine composition for preventing or treating infection of sars-cov-2 | |
WO2018097540A2 (ko) | 무혈청면역세포배양용 배지첨가키트, 상기 키트를 이용한 면역세포배양방법, 상기 키트 또는 배양방법에 의해 얻어진 무혈청면역세포배양액 및 상기 배양액을 포함하는 화장료조성물 | |
WO2010147268A1 (ko) | 자궁경부암 백신 | |
WO2021172971A1 (ko) | 수두 대상포진 바이러스 융합 단백질 및 이를 포함하는 면역원성 조성물 | |
WO2020159169A2 (ko) | 당화된 ag85a 단백질을 포함하는 결핵 예방용 백신 조성물 및 이의 제조방법 | |
WO2017034244A1 (ko) | 중추신경계 질환에 대한 예방 또는 치료효과를 갖는 펩타이드 및 이를 유효성분으로 하는 중추신경계 질환 예방 및 치료용 약학적 조성물 | |
WO2019151759A1 (ko) | 신규 백신 면역보조제 | |
WO2023075421A1 (ko) | 수지상 세포를 표적하는 신규한 펩타이드, 및 이를 포함하는 암 치료용 조성물 | |
WO2021040064A1 (ko) | 백시니아 바이러스 및 히드록시유레아를 유효성분으로 포함하는 암 치료용 약학 조성물 | |
WO2016027990A1 (ko) | Dusp5를 유효성분으로 모두 포함하는 골대사성 질환의 예방 또는 치료용 약학적 조성물 | |
WO2021107635A1 (ko) | Il-2 단백질 및 cd80 단백질을 포함하는 융합단백질 및 nk 세포를 포함하는 항암 치료용 조성물 | |
WO2023048530A1 (ko) | 종양 연관 항원으로부터 유래된 펩타이드 및 리포펩타이드와 면역활성물질로 구성되는 아쥬번트를 포함하는 항암 백신 조성물 및 이의 용도 | |
WO2024147503A1 (ko) | Trop2 면역원성 펩타이드 | |
WO2023003380A1 (ko) | 신규 세포 투과성 펩타이드 및 이의 용도 | |
WO2018182301A1 (ko) | 세포투과성 펩타이드와 ctCTLA4 펩타이드가 융합된 융합단백질을 유효성분으로 하는 염증성 호흡기 질환 예방 또는 치료용 약학 조성물 | |
WO2022050520A1 (ko) | 코로나바이러스 유래 수용체 결합 도메인 및 뉴클레오캡시드 단백질을 포함하는 융합단백질 및 이의 용도 | |
WO2021167418A2 (ko) | 신규한 종양-관련 항원 단백질 olfm4 및 이의 용도 | |
WO2020032780A1 (ko) | 암항원 특이적 세포독성 t세포 | |
Rafiee et al. | Induction of systemic antitumor immunity by gene transfer of mammalian heat shock protein 70.1 into tumors in situ | |
WO2023128378A1 (ko) | K-ras 특이적 활성화 t 세포를 포함하는 대장암의 예방 및 치료용 약제학적 조성물 및 이의 제조방법 | |
WO2023048532A1 (ko) | 레오바이러스 기반 신규한 백신플랫폼 및 이의 용도 | |
WO2022131700A1 (ko) | 펩타이드를 이용하는 줄기세포 유래 고순도 세포외 소포체의 대량 생산 방법 | |
WO2023128381A1 (ko) | K-ras 특이적 활성화 t 세포를 포함하는 흑색종의 예방 및 치료용 약제학적 조성물 및 이의 제조방법 | |
WO2023128377A1 (ko) | K-ras 특이적 활성화 t 세포를 포함하는 폐 유두상 선암종의 예방 및 치료용 약제학적 조성물 및 이의 제조방법 | |
WO2023128380A1 (ko) | K-ras 특이적 활성화 t 세포를 포함하는 폐 선암종의 예방 및 치료용 약제학적 조성물 및 이의 제조방법 |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22887617 Country of ref document: EP Kind code of ref document: A1 |
|
WWE | Wipo information: entry into national phase |
Ref document number: 18555988 Country of ref document: US |
|
WWE | Wipo information: entry into national phase |
Ref document number: 202280046109.1 Country of ref document: CN |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2022887617 Country of ref document: EP |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
ENP | Entry into the national phase |
Ref document number: 2022887617 Country of ref document: EP Effective date: 20240528 |