WO2018182301A1 - 세포투과성 펩타이드와 ctCTLA4 펩타이드가 융합된 융합단백질을 유효성분으로 하는 염증성 호흡기 질환 예방 또는 치료용 약학 조성물 - Google Patents

세포투과성 펩타이드와 ctCTLA4 펩타이드가 융합된 융합단백질을 유효성분으로 하는 염증성 호흡기 질환 예방 또는 치료용 약학 조성물 Download PDF

Info

Publication number
WO2018182301A1
WO2018182301A1 PCT/KR2018/003622 KR2018003622W WO2018182301A1 WO 2018182301 A1 WO2018182301 A1 WO 2018182301A1 KR 2018003622 W KR2018003622 W KR 2018003622W WO 2018182301 A1 WO2018182301 A1 WO 2018182301A1
Authority
WO
WIPO (PCT)
Prior art keywords
pharmaceutical composition
dnp2
ctctla
fusion protein
experimental
Prior art date
Application number
PCT/KR2018/003622
Other languages
English (en)
French (fr)
Inventor
최제민
임상호
Original Assignee
한양대학교 산학협력단
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 한양대학교 산학협력단 filed Critical 한양대학교 산학협력단
Priority to CN201880011286.XA priority Critical patent/CN110366422A/zh
Priority to EP18778300.6A priority patent/EP3603659A4/en
Priority to US16/485,706 priority patent/US20200023036A1/en
Publication of WO2018182301A1 publication Critical patent/WO2018182301A1/ko

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00—Drugs for disorders of the respiratory system
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/177—Receptors; Cell surface antigens; Cell surface determinants
    • A61K38/1774—Immunoglobulin superfamily (e.g. CD2, CD4, CD8, ICAM molecules, B7 molecules, Fc-receptors, MHC-molecules)
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00—Medicinal preparations characterised by special physical form
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00—Medicinal preparations characterised by special physical form
    • A61K9/0012—Galenical forms characterised by the site of application
    • A61K9/007—Pulmonary tract; Aromatherapy
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00—Medicinal preparations characterised by special physical form
    • A61K9/0012—Galenical forms characterised by the site of application
    • A61K9/007—Pulmonary tract; Aromatherapy
    • A61K9/0073—Sprays or powders for inhalation; Aerolised or nebulised preparations generated by other means than thermal energy
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00—Drugs for disorders of the respiratory system
    • A61P11/02—Nasal agents, e.g. decongestants
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00—Drugs for disorders of the respiratory system
    • A61P11/06—Antiasthmatics
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K19/00—Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide

Definitions

  • the present invention relates to a pharmaceutical composition for preventing or treating inflammatory respiratory diseases comprising a fusion protein in which a cell permeable peptide and a ctCTLA4 peptide are fused. More specifically, cell permeability is improved through fusion of a dNP2 peptide and ctCTLA4.
  • the present invention relates to a pharmaceutical composition capable of enhancing the targeting effect caused by inflammatory respiratory disease, and thus exhibiting an excellent prophylactic or therapeutic effect on inflammatory respiratory disease through the nasal mucosa even without direct administration into the lung or bronchus.
  • Inflammatory respiratory disease is a fatal chronic lung disease resulting from factors such as house dust mites, pollen and cockroaches, and cause serious health problems such as bad breath, shortness of breath, cough, wheezing, chest tightness and pain.
  • German cockroaches are one of the leading causes of allergic disease, which is known to cause sensitive T cell responses, leading to allergic airway inflammatory diseases, and the German cockroach extract (GCE) is an allergic inflammation model. It has been widely used in manufacturing.
  • monoclonal antibodies such as anti-IgE (omalizumab), anti-IL-5 (mepolizumab), anti-IL-13 (anrukinzumab), and anti-TGF- ?? (daclizumab) developed to treat asthma are also systemic.
  • anti-IgE omalizumab
  • anti-IL-5 mepolizumab
  • anti-IL-13 anrukinzumab
  • anti-TGF- ?? anti-TGF- ??
  • the present inventors have completed the present invention as a result of intensive research on the administration of the fusion protein through the nasal cavity rather than the direct administration into the bronchus or systemic administration.
  • Patent Document 1 Republic of Korea Patent Publication No. 10-2008-0066962
  • the present invention has been made in view of the above problems, and unlike the conventional route of administration by administering a fusion protein through the nasal route, the delivery efficiency and target rate for bronchial and lung cells are excellent, and markedly improved cytokine expression inhibition.
  • a pharmaceutical composition having activities such as suppressing airway inflammation, alleviating airway hyperresponsiveness to allergens, and alleviating Th2 inflammation.
  • the present invention provides a pharmaceutical composition for preventing or treating allergic diseases comprising a fusion protein in which a cell permeable peptide consisting of SEQ ID NO: 1 and a ctCTLA4 peptide consisting of SEQ ID NO: 2 is fused.
  • the present invention provides a significantly superior bronchial and lung cell permeation and delivery efficiency, compared to conventional inflammatory respiratory diseases, especially allergic asthma treatment, through a method of administration through the respiratory system, which has not conventionally achieved effective therapeutic and prophylactic effects. It exhibits enhanced cytokine expression suppression, airway inflammation suppression, alleviation of airway hyperresponsiveness to allergens, and Th2 inflammation alleviation, so that a rapid, fast and efficient treatment or prevention effect can be obtained.
  • the present invention can publish topical administration compared to conventional therapeutic agents, side effects are reduced, and local high concentration administration of therapeutic agents is possible, and thus potential new treatments and prescriptions are possible.
  • FIG. 1 is a view showing the experimental conditions (dose time, dose, route of administration for the animal model according to each group) of Experimental Example 1.
  • FIG. 2 shows frozen lung tissue sections (8 ⁇ m) prepared from each control group and the experimental group prepared in Experimental Example 1, followed by staining cell nuclei using Hpechst, and then observing through fluorescent microscopy.
  • Figure 3 was analyzed by flow cytometry the intracellular fluorescence signal in the bronchial and lung lavage fluid of each control and experimental group prepared in Experimental Example 1. The histogram and mean fluorescence intensities (MFI) of red fluorescence are shown.
  • Figure 4 is a view showing the experimental conditions of the Experimental Example 2 (administration time, dose, administration route for the animal model according to each group).
  • FIG. 5 and 6 are the results of the analysis of the hyperactivity response (Methacholine AHR) to each experimental group and control group of Experimental Example 2
  • Figure 5 is a test group and control group of each Experimental Example 2 according to the concentration of methacholine It is shown by measuring airway resistance of.
  • FIG. 6 shows airway elastance of each of the experimental groups and the control group according to the methacholine concentration.
  • N 5 for each group and the results are expressed as ⁇ s.e.m (standard error of mean). ** p ⁇ 0.01, *** p ⁇ 0.001
  • FIG. 7 is a lung tissue observation result for each experimental group and the control group of Experimental Example 3, it is a photograph taken by staining the lung tissue of each experimental group and the control group in Experimental Example 3 with PAS. At this time, the red region is a mucus-secreting goblet cell.
  • FIG. 9 is a lung tissue observation result for each experimental group and the control group of Experimental Example 3, the lung tissue of each experimental group and the control group in Experimental Example 3 was photographed by staining with Mason's trichrome stain (Masson's trichrome stain). The blue areas are collagen deposition and fibrosis.
  • FIG. 11 is a graph showing the total cell number after staining using a hemacolor staining kit after cytocentrifugation of the bronchial and lung lavage fluid recovered from each experimental group and the control group in Experimental Example 4 (a), macrophages of Graph (b) showing the number and graph (c) showing the number of eosinophils.
  • FIG. 12 is a graph showing the expression level of IL-5, IL-13 and IFN- ⁇ in the supernatant of bronchial and pulmonary lavage fluid (BAL) using the ELISA kit (top of FIG. 12) and frozen using the ELISA kit. It is a graph showing the analysis of the expression level of IL-5, IL-13, IL-4 and IFN- ⁇ in the lung tissue (bottom of Figure 12).
  • FIG. 13 is a diagram showing experimental conditions (dose timing, dose, route of administration for animal models according to each group) of Experimental Example 5.
  • FIG. 13 is a diagram showing experimental conditions (dose timing, dose, route of administration for animal models according to each group) of Experimental Example 5.
  • FIG. 14 is a graph showing the expression level of IL-13 and IFN- ⁇ in the supernatant of bronchial and pulmonary lavage fluid (BAL) using the ELISA kit (top of FIG. 14) and the frozen lung tissue using the ELISA kit. It is a graph showing the analysis of the expression level of IL-13, IL-4 and IFN- ⁇ (bottom of Figure 14).
  • FIG. 16 is a graph showing the thickness of airway epithelium in FIG. 15 using ImageJ 1.50i software. The results are expressed as ⁇ s.e.m (standard error of mean). * p ⁇ 0.05, ** p ⁇ 0.01.
  • Figure 17 is a graph analyzing the differentiation of Th2 cells by non-activated, + PBS, + dNP2-EGFP, + dNP2-ctCTLA-4.
  • One aspect of the present invention relates to a pharmaceutical composition for preventing or treating inflammatory respiratory disease comprising a fusion protein in which a cell permeable peptide consisting of SEQ ID NO: 1 and a ctCTLA4 peptide consisting of SEQ ID NO: 2 is fused.
  • fusion protein includes a cell permeable peptide consisting of SEQ ID NO: 1 and a ctCTLA4 peptide consisting of SEQ ID NO: 2 below, and means a covalent complex formed by genetic fusion or chemical bonding thereof.
  • the "genetic fusion” means a linear, covalent linkage formed through the genetic expression of the DNA sequence encoding the protein.
  • CTLA4 is commonly known as Cytotoxic T lymphocyte antigen-4, which is an important immune protein that inhibits T cell activation.
  • CTLA-4 forms binding with co-stimulatory molecules on the surface of cells in which antigens such as CD80 and CD86 are present, much more efficient than CD28, co-stimulatory receptor binding of T cells.
  • Avatacept is a recombinant protein consisting of a CTLA-4 extracellular domain conjugated with an immunoglobulin G constant region, CTLA-4-lg (immunoglobulin G constant region). It has the effect of inhibiting allergic airway inflammatory disease in OVA (Ovalbumin) induced asthma animal models by eosinophil infiltration, Th2 cytokine expression and reduction of serum lgE via intravenous or intraperitoneal injection.
  • OVA Optalbumin
  • DNP2 a recombinant protein composed of the dNP2 peptide and the cytoplasmic domain of CTLA-4, has been developed.
  • -ctCTLA4 was prepared.
  • dNP2-ctCTLA-4 fusion protein is administered through a completely different route (nasal route), and thus has a therapeutic or prophylactic effect on a disease completely different from the conventional method.
  • the dNP2-ctCTLA-4 fusion protein has a therapeutic or prophylactic effect on inflammatory respiratory diseases, preferably inflammatory respiratory diseases, particularly allergic asthma, which have nothing to do with central nervous system diseases.
  • Inhalation of the dNP2-ctCTLA-4 fusion protein in the form of a spray or powder via the nasal route results in the efficient delivery of proteins to lung resident cells. Proteins effectively control Th2 inflammation, thereby exerting a prophylactic or therapeutic effect on inflammatory respiratory diseases.
  • dNP2-ctCTLA-4 fusion protein if other cell-penetrating peptides are used instead of the dNP2 peptide, even if administered by the nasal route, they are not effectively administered in the respiratory tract, bronchus or lung, but also do not penetrate and target lung resident cells. As a result, it was confirmed that there is a problem that does not effectively deliver the protein.
  • the pharmacological effect on allergic asthma was significantly (2-3 times or more) better than that of conventional CTLA-4-lg, and compared with the conventional dNP2-ctCTLA-4. Heterogeneous pharmacological effect was achieved.
  • dNP2-ctCTLA-4 fusion protein was administered in the airways or bronchi via the nasal route, confirming that it efficiently delivers the protein to lung cells.
  • dNP2-ctCTLA-4 fusion protein can be efficiently transmitted to resident cells through the airway epithelial cells.
  • the dNP2-ctCTLA-4 fusion protein according to the present invention when administered through the nasal route, alleviates airway hyperresponsiveness, Th2 inflammation and airway remodeling, and directly inhibits Th2 differentiation to prevent allergic asthma. It can be controlled effectively.
  • the dNP2-ctCTLA-4 fusion protein according to the present invention achieves excellent pharmacological effects two to three times more than the conventional CTLA-4-Ig.
  • the dNP2-ctCTLA-4 fusion protein according to the present invention is administered through a route other than the nasal route, there is a problem in that the pharmacological effect on the inflammatory respiratory disease of the present invention cannot be achieved.
  • the peptide having IL-2 inhibitory activity consisting of the amino acid sequence represented by SEQ ID NO: 2 used in the present invention encodes only a part of exon 4 of the full-length CTLA-4 protein obtained from human or mouse, and the cytoplasm of CTLA-4 protein Sequence derived from a domain.
  • the amino acid sequence of the amino acid sequence of the CTLA-4 protein of human and mouse 100% mutually identical. When applied to the human body is less likely to cause side effects such as immune response.
  • Peptide having IL-2 inhibitory activity consisting of the amino acid sequence represented by SEQ ID NO: 2 is a fragment of CTLA-4 showing IL-2 expression inhibitory activity in CTLA-4 protein, the central nervous system, that is, the brain-vascular barrier or spinal cord It further shows the effect of penetrating the blood vessel barrier with high efficiency, and can be applied to both by using fragments having 100% identical amino acid sequences in humans and non-human animals (mouses).
  • the peptide having the IL-2 inhibitory activity consisting of the amino acid sequence represented by SEQ ID NO: 2 comprises the 188 amino acid residues of the cytotoxic T lymphocyte antigen type 4 (CTLA-4) protein from the 213th amino acid sequence (SEQ ID NO: 1), hereinafter also referred to as 'ctCTLA-4'.
  • CTLA-4 cytotoxic T lymphocyte antigen type 4
  • the polypeptide is a form that is partially deleted at the N-terminus and C terminus to confer permeabilizing activity on the nasal or bronchial mucosa or lung epithelial cells and to prevent or treat an inflammatory respiratory disease.
  • the ctCTLA4 peptide may be extracted or synthesized in nature or prepared by genetic recombination based on DNA sequences.
  • the inflammatory respiratory disease includes asthma, chronic obstructive pulmonary disease (COPD), acute lung injury, empyema, lung abscess, pneumonia, tuberculosis, cough, sputum, bronchitis, sore throat, tonsillitis, sinusitis, rhinitis, obstructive bronchiolitis It may be any one selected from the group consisting of laryngitis.
  • COPD chronic obstructive pulmonary disease
  • asthma examples include bronchial asthma, atopic asthma, atopic bronchial IgE mediated asthma, nonatopic asthma, allergic asthma and nonallergic asthma, examples of the bronchitis, acute bronchitis, chronic bronchitis, bronchiolitis And catarrhal bronchitis.
  • the allergic asthma is allergic asthma due to dust mites, pollen, animal hair or dandruff, cockroaches, food, drugs, cold, tobacco smoke and indoor pollution, air pollution, food additives, exercise, climate change, yellow dust, stress And more preferably allergic asthma due to cockroaches.
  • the pharmaceutical composition of the present invention is preferably injected only through the nasal route, and when administered by other routes of administration, such as intravenous, subcutaneous, intramuscular, intraperitoneal, and transdermal administration, for inflammatory respiratory diseases, particularly allergic asthma. There is a problem that can not achieve the pharmacological effect.
  • composition of the present invention may further comprise suitable carriers, excipients and diluents commonly used in the manufacture of pharmaceutical compositions.
  • the pharmaceutical composition according to the present invention is not particularly limited as long as it is a dosage form which can be administered by the nasal route, but the "administration via the nasal route" used in the present invention is a solution, powder, regardless of the addition of stabilizers or other excipients.
  • the pharmaceutical composition includes all dosage forms that can be administered to the respiratory tract, trachea, bronchial alveoli by allowing administration to the respiratory tract or lungs through the nasal cavity by inhalation of the form or aerosolized or nebulized solution or powder. do.
  • Suitable formulations known in the art are preferably those disclosed in Remington's Pharmaceutical Sciences, Mack Publishing Company, Easton PA.
  • a pressurized nebulizer an ultrasonic nebulizer, an electric fine pump nebulizer, a metered dose inhaler (MDI) and a dry powder inhaler (DPI) using a compressed air / oxygen mixture may be used.
  • Aerosols can be delivered via mechanical ventilation or via an endotracheal tube of a patient into which a tube is inserted.
  • Carriers, excipients and diluents which may be included in the pharmaceutical compositions of the present invention include lactose, dextrose, sucrose, sorbitol, mannitol, xylitol, erythritol, maltitol, starch, acacia rubber, alginate, gelatin, calcium phosphate, calcium silicate, Cellulose, methyl cellulose, microcrystalline cellulose, polyvinyl pyrrolidone, water, methylhydroxybenzoate, propylhydroxybenzoate, talc, magnesium stearate and mineral oil.
  • diluents or excipients such as fillers, extenders, binders, wetting agents, disintegrating agents, and surfactants are usually used.
  • the term "administration" means providing a subject with any of the compositions of the present invention in any suitable manner.
  • compositions of the present invention vary depending on the condition and weight of the individual, the extent of the disease, the form of the drug, the route of administration and the duration, and may be appropriately selected by those skilled in the art.
  • the compositions of the present invention can be administered at 0.001 to 1000 mg / kg per day. Administration may be administered once a day or may be divided several times. The dosage does not limit the scope of the invention in any aspect.
  • Another aspect of the invention relates to a method for preventing or treating central nervous system diseases in animals other than humans by administering the pharmaceutical composition via the nasal route of the individual.
  • In vivo or intracellular infusion of the pharmaceutical composition may be carried out by injecting via nasal, mucosal or inhalation.
  • the method of delivery can be sufficiently extended to not only culture cells but also general in vivo delivery, ie delivery to animal cells, animal tissues and animals.
  • the pharmaceutical composition is non-immunogenic, non-infectious, and is not limited in plasmid size because DNA is not packaged in vector organisms such as retroviruses or adenoviruses. Therefore, it can be used in any practical size recombinant gene expression construct.
  • mice 8 week old BALB / c mice were purchased from Orient Bio (Daejeon, Korea). All mice were bred and stored in a specific sterile facility, and the facility conditions maintained a 12 hour contrast cycle and provided regular food and autoclaved water.
  • GCE German cockroach extract
  • German cockroach extract was prepared through the following process.
  • the dehydrated German cockroach (Blattela germanica) was degreased in 200 ml of ether / ethyl acetate, followed by 6 mM ⁇ -mercaptoethanol and 1 mg / ml 1 under 4 ° C.
  • PBS phosphate buffer
  • thiourea (1-phenyl-3 (2-thiazolyl) -2-thiourea
  • GCE German cockroach extract
  • the mouse reared in the method of 1) was used. Specifically, 120 ⁇ g GCE prepared by the method of PBS (Sham) or 2) was administered into the nasal cavity of 8 week old BALB / c mice twice a week for a total of 3 weeks.
  • dNP2-ctCTLA-4 In order to confirm the therapeutic effect of the fusion protein (dNP2-ctCTLA-4) according to the present invention in a chronic allergic asthma animal model induced by GCE, 10 ⁇ g of dNP2-ctCTLA-4 was used every time GCE was administered to mice.
  • Example 1), dNP2-EGFP (Comparative Example 1), CTLA4-Ig (Comparative Example 2), or PBS (Control) were co-treated with the nasal cavity of mice (see Experimental Example 2).
  • mice 100 ⁇ g of dTomato, Hph-1-dTomato, dNP2-dTomato, or PBS was intranasally administered for 15 minutes on the 21st day to confirm whether the mice were delivered to the lungs. Mice were sacrificed and protein delivery efficiency and lung pathological changes were analyzed (see FIGS. 1 to 3, Experimental Example 1).
  • AHR was placed into a whole body plethysmograph (BUXCO, USA) 4 days after the last inhalation of GCE using the flexi / Vent 5.1 small animal respirator (SCIREQ, Montreal, PQ, Canada). Take 0.4 ml of methacholine solution (3.1, 6.25, 12.5, 25 and 50 mg / ml), put it in aerosol, inhalate for 10 seconds, measure penh 1 minute and 2 minutes after administration, and calculate the average value. Penh (enhanced pause) at the choline dose.
  • BALF bronchoalveolar lavage fluid
  • bronchial and lung lavage fluid tubes were inserted into the mice, and then 1 ml of Hanks' balanced salt solution was injected thereto, the lungs of the mice were washed, and the lavage fluid was taken out. The total cell number of the lavage fluid was calculated through a hemocytometer. Then, the washing solution was centrifuged at 1000 rpm for 3 minutes to discard the supernatant, and a precipitate was prepared to prepare a tissue section. The tissue sections (slides) were stained with a hemacolor staining kit (Merck Millipore, Darmstadt, Germany), and then the cells were totally subjected to standard hemocytologic procedures to calculate the number of macrophages and eosinophils. The counted cells were differentially counted until they reached at least 200.
  • the suspension was prepared by homogenizing the T-PER tissue protein extraction reagent (Thermo Fisher Scientific, MA, US) to the BALF obtained by the method of 5). Next, the suspension was incubated at 4 ° C. for 30 minutes, and the supernatant obtained by centrifugation at 2500 rpm for 10 minutes was filtered through a 0.45 ⁇ m filter to prepare a sample. Cytokine expression levels were analyzed from the samples.
  • Immature CD4 T cells were isolated from 8-week old BALB / c mice using a magnetically active cell sorting kit (MACS, Naive CD4 T cell isolation kit, mouse, Miltenyi, Bergisch Gladbach, Germany). It was.
  • MCS magnetically active cell sorting kit
  • dNP2-EGFP Comparative Example 3
  • 1 ⁇ M of dNP2-ctCTLA-4 Example 2
  • re-stimulation and protein transport inhibitor treatment protein transport inhibitor treatment, anti-mouse IFN- ⁇ -FITC and anti-mouse IL-4-PE FACS antibodies After staining it was analyzed by flow cytometry.
  • Peptides having the amino acid sequence of SEQ ID NO: 1 to 3 were synthesized.
  • the cell permeable peptide consisting of the amino acid sequence of SEQ ID NO: 1 (hereinafter also referred to as 'dNP2'), the peptide having the amino acid sequence of SEQ ID NO: 2 (hereinafter also referred to as 'ctCTLA-4'), the amino acid sequence of SEQ ID NO: 3 It is referred to as the cell-penetrating peptide (hereinafter also referred to as 'Hph-1').
  • the mixture was left at 95 ° C. for 3 minutes to remove secondary or tertiary structures formed (denaturation) at 50 ° C. and The temperature was changed to 72 ° C. to make a double strand of DNA. Restriction enzyme specific sequences other than sense and antisense oligodeoxynucleotides were inserted into 5 'and 3' for insertion into the pRSET-b vector. Escherichia coli BL21 (DE3) Star pLysS was then transformed with pRSET-b plasmids encoding the respective peptides.
  • Colonies were cultured in Luria-Bertani medium containing ampicillin at 37 ° C. and protein expression was induced by 1 mM isopropyl- ⁇ -D-thiogalactopyranoside (IPTG). Proteins were purified by Ni-NTA affinity chromatography (Qiagen) and desalted using a PD-10 column (GE Healthcare). All proteins were stored at -80 ° C.
  • the N-terminal of the ctCTLA-4 peptide is represented by SEQ ID NO: 1
  • dNP2-ctCTLA-4 gene is produced by PCR reaction and inserted into the vector (pRSET-b) to express and purify proteins in E. coli strains, and then transfer efficiency into cells. The experiment was conducted to confirm. The specific experimental procedure is described below.
  • the DNA base sequence encoding the cell permeable peptide consisting of the amino acid sequence of SEQ ID NO: 1 is added to the DNA base sequence encoding a portion of the N-terminus of the ctCTLA-4 peptide having the amino acid sequence of SEQ ID NO: 2 prepared in Preparation Example 1 To prepare a forward primer.
  • Each primer and sequence number and restriction enzyme recognition sites are summarized in Table 1.
  • the primer of SEQ ID NO: 4 was used using a pRSETb vector containing a gene encoding the peptide of SEQ ID NO: 2 as a template.
  • the thermal denaturation reaction of the template at 95 ° C. was performed for 20 seconds, at 50 ° C. for 20 seconds, and at 30 ° C. for 30 seconds as an extension reaction at 72 ° C.
  • One cycle was set to 30 cycles using a PCR reactor (Biorad).
  • the dNP2-ctCTLA-4 forward primer has a very long sequence of dNP2 (KIKKVKKKGRKGSKIKKVKKKGRK) was divided into two PCR.
  • the gene (DNA) fragment prepared in Example 1) of the protein expression vector pRSETb was cut with a restriction enzyme and then inserted into the vector using a ligase. .
  • Example 1 The DNA fragments amplified in 1) of Example 1 were enzymatically reacted with NheI and HindIII (NEB) to make the 5 '/ 3' end of the DNA a sticky end. Meanwhile, pRSETb was enzymatically reacted using the same two restriction enzymes to form a linear pRSETb vector having NheI and HindIII insertion sites. After each enzyme reaction was isolated using a PCR purification kit (Cosmogenetech).
  • the isolated dNP2-ctCTLA-4 fusion double chain DNA fragment and the pRSET-b vector were enzymatically linked to T4 Ligase (NEB) for 2 hours at 25 ° C.
  • the transgenic pRSETb vector into which dNP2-ctCTLA-4 was inserted was transformed into DH5 ⁇ Escherichia coli strains, and cultured in LB plate medium containing 50 ⁇ g / ml of antibiotic ampicillin to select colony-forming E. coli. Selected E. coli colonies were further inoculated in liquid LB medium containing 50 ⁇ g / ml of ampicillin, and then plasmid vectors were isolated using the plasmid Mini Preparation Kit (CosmoGentech).
  • the enzyme was first reacted with NheI and HindIII restriction enzymes, and finally confirmed through DNA sequencing (Bionix). there was.
  • PRSETb vector inserted with dNP2-ctCTLA-4 prepared in Example 2 was transformed into E. coli BL21 (DE3) star pLysS strain, followed by antibiotics chloramphenicol 34 ⁇ g / ml and ampicillin 50 ⁇ g / ml Colonies formed in LB plate medium were inoculated in 50 ml of liquid LB medium and incubated at 37 ° C. for 10 hours, and then inoculated in 500 ml of fresh liquid LB medium.
  • the E. coli-expressing protein contains the 6X-His tag encoded in the front pRSET-b vector. The protein was purified using the following experimental method.
  • the cultures were collected by centrifugation and resuspended in lysis solution (0.5M NaCl, 5mM imidazole, 20mM Tris-HCl, pH 8.0) in native condition. In order to break the cell wall and cell membrane of E. coli, it was left in the lysate for 10 minutes. And the supernatant was separated by crushing the cells and centrifugation using VCX-130 (Sonics & Materials), an ultrasonic cell crusher. The separated supernatant was filtered once using a 0.45 ⁇ m filter (Advantec) and allowed to bind with Ni-NTA agarose (Qiagen) for 1 hour at room temperature.
  • lysis solution 0.5M NaCl, 5mM imidazole, 20mM Tris-HCl, pH 8.0
  • histidine columns His-column, Biorad
  • Histidine columns were used to bind only the protein product bound to Ni-NTA agarose to the column.
  • imidazole solution 20mM, 250mM
  • eluted with 3M imidazole solution was applied to PD-10 desalting column (Amersham Bioscience) to finally purify and purified dNP2-ctCTLA-4 fusion protein.
  • Red fluorescent protein dTomato was used.
  • a primer was prepared to allow EGFP to be linked to the N-terminus of dNP2 to produce dNP2-EGFP gene by PCR reaction.
  • the protein was expressed and purified from the E. coli strain by inserting it into a vector (pRSET-b), and the overall process was performed in the same manner as in Example 1 except for the primer.
  • the primers used are as follows.
  • Avatacept a recombinant protein consisting of CTLA-4 tecracellular domain confugated with the immunohglobulin G constant region (CTLA-4-lg), which is conventionally known as a therapeutic agent for rheumatoid arthritis, was used.
  • CTLA-4-lg immunohglobulin G constant region
  • dNP2 peptides can deliver proteins in activated or memory-like immune cells rather than resting cells, the inflammatory lungs of sham mice in which the dNP2 peptides do not process anything in the present invention. After assuming that the protein can be delivered from inflammatory lung resident cells, the experiment was designed and specific experimental conditions are shown in FIG. 1.
  • Animal models without treatment (8-week old female BALB / c mice) (see method 1 of the experimental method) were administered PBS (120 ⁇ g per dose) twice a week for 3 weeks twice a week via nasal cavity.
  • PBS 120 ⁇ g per dose
  • dTomato Hph-1-dTomato
  • dNP2-dTomato protein
  • dTomato control Hph-1-d Tomato control
  • dNP2-dTomato control dNP2-dTomato control
  • PBS control PBS control
  • mice In order to induce chronic allergic inflammation in the lungs of animal models, 8-week old female BALB / c mice were administered GCE (120 ⁇ g per dose) twice a week for a total of 3 weeks per nasal cavity (3 of the test methods). See how). On day 21, 100 ⁇ g of a vehicle (Phicle; PBS) or protein (dTomato, Hph-1-dTomato, dNP2-dTomato) was administered through the nasal cavity.
  • a vehicle PBS
  • protein dTomato, Hph-1-dTomato, dNP2-dTomato
  • test was divided into dTomato test group, Hph-1-d Tomato test group, dNP2-dTomato test group, or PBS test group.
  • each animal was infused with 1 ml PBS twice to obtain bronchial and lavage fluid (Bronchoalveolar lavage fluid; BALF), after euthanasia, the lung tissues were collected and washed with PBS Then 4% paraformaldehyde was fixed. All collected organizations must be O.C.T. Frozen using compound (WAKO Chemical). Frozen blocks were cut into 8 ⁇ m thick flakes using a Thermo Scientific.
  • FIG. 2 shows frozen lung tissue sections (8 ⁇ m) prepared from each control group and the experimental group prepared in Experimental Example 1, followed by staining cell nuclei using Hpechst, and then observing through fluorescent microscopy.
  • the dNP2 peptide showed excellent protein delivery efficiency to lung resident cells in both long-term PBS-administered sham mice and GCE-induced allergic asthma models.
  • Figure 3 was analyzed by flow cytometry the intracellular fluorescence signal in the bronchial and lung lavage fluid of each control and experimental group prepared in Experimental Example 1. The histogram and mean fluorescence intensities (MFI) of red fluorescence are shown.
  • bronchial and lung lavage fluid BALF was recovered from each animal, and analyzed by flow cytometry.
  • MFI mean fluorescence intensity
  • mice bred in the method of 1) were used. Specifically, 120 ⁇ g GCE prepared by PBS (Sham) or 2) of the above test method was administered twice a week into the nasal cavity of 8-week-old BALB / c mice for a total of 3 weeks. Whenever GCE was administered to the mouse, 10 ⁇ g of dNP2-ctCTLA-4 (Example 1), dNP2-EGFP (Comparative Example 3), CTLA4-Ig (Comparative Example 2), or a blank (Ph) was added to the mice. It was combined into the nasal cavity. On day 21, mice were anesthetized and hypersensitivity to methacholine (MeCh) was measured (see method 4 of the test method).
  • MeCh methacholine
  • mice 8 weeks old female BALB / c mice reared in the method of 1) were administered PBS (120 ⁇ g per time) through the nasal cavity twice a week for a total of 3 weeks. Whenever PBS was administered to mice, 10 ⁇ g of a blank (Phicle) was co-treated into the nasal cavity of the mouse. Marked as sham control.
  • mice bred in the method of 1) were used. Specifically, 120 ⁇ g GCE prepared by the method of 2) in the above experimental method was administered twice a week for a total of 3 weeks into the nasal cavity of 8-week-old BALB / c mice. Whenever GCE was administered to the mice, 10 ⁇ g of dNP2-ctCTLA-4 (Example 2), dNP2-EGFP (Comparative Example 3) or blank (Phicle) were co-treated into the nasal cavity of mice.
  • the dNP2-ctCTLA-4 experimental group, dNP2-EGFP experimental group, PBS test group according to the administered protein or blank test solution is administered.
  • FIG. 5 and 6 are the results of the analysis of the hyperactivity response (Methacholine AHR) to each experimental group and control group of Experimental Example 2
  • Figure 5 is a test group and control group of each Experimental Example 2 according to the concentration of methacholine It is shown by measuring airway resistance of.
  • FIG. 6 shows airway elastance of each of the experimental groups and the control group according to the methacholine concentration.
  • N 5 for each group and the results are expressed as ⁇ s.e.m (standard error of mean). ** p ⁇ 0.01, *** p ⁇ 0.001
  • lung tissues of each experimental group and control group in Experimental Example 2 were observed. Lung tissue observation process was performed according to the 7) method of the experimental method.
  • FIG. 7 is a lung tissue observation result for each experimental group and the control group of Experimental Example 3, it is a photograph taken by staining the lung tissue of each experimental group and the control group in Experimental Example 3 with PAS. At this time, the red region is a mucus-secreting goblet cell. 8 is a result of analyzing the number of mucus-secreting goblet cells in Figure 7 using ImageJ 1.50i software.
  • FIG. 9 is a lung tissue observation result for each experimental group and the control group of Experimental Example 3, the lung tissue of each experimental group and the control group in Experimental Example 3 was photographed by staining with Mason's trichrome stain (Masson's trichrome stain). The blue areas are collagen deposition and fibrosis.
  • each experimental group and the control group were stained with Mason's trichrome stain to measure the fibrotic area, and the experimental group (PBS experimental group) compared to the control group (sham) in the bronchus in the lungs. It can be seen that a large amount of peribronchial fibrosis occurred. However, the dNP2-ctCTLA-4 experimental group in which the dNP2-ctCTLA-4 fusion protein was administered through the nasal cavity was found to have a significant decrease in the fibrosis site around the bronchus.
  • the dNP2-ctCTLA-4 fusion protein according to the present invention significantly improves the progression of fibrosis, including airway inflammation through intranasal administration.
  • Experimental conditions such as Experimental Example 2 were designed, and bronchial and pulmonary lavage fluids were obtained from each experimental group and control group of Experimental Example 2 to confirm the effect of inhibiting eosinophil infiltration and Th2 cytokine production.
  • the specific experimental design is as follows.
  • mice 8 weeks old female BALB / c mice reared in the method of 1) were administered PBS (120 ⁇ g per time) through the nasal cavity twice a week for a total of 3 weeks. Whenever PBS was administered to mice, 10 ⁇ g of a blank (Phicle) was co-treated into the nasal cavity of the mouse. Marked as sham control.
  • mice bred in the method of 1) were used. Specifically, 120 ⁇ g GCE prepared by the method of 2) in the above experimental method was administered twice a week for a total of 3 weeks into the nasal cavity of 8-week-old BALB / c mice. Whenever GCE was administered to the mice, 10 ⁇ g of dNP2-ctCTLA-4 (Example 2), dNP2-EGFP (Comparative Example 3) or blank (Phicle) were co-treated into the nasal cavity of mice.
  • the dNP2-ctCTLA-4 experimental group, dNP2-EGFP experimental group, PBS test group according to the administered protein or blank test solution is administered.
  • FIG. 11 is a graph showing the total cell number after staining using a hemacolor staining kit after cytocentrifugation of the bronchial and lung lavage fluid recovered from each experimental group and the control group in Experimental Example 4 (a), macrophages of Graph (b) showing the number and graph (c) showing the number of eosinophils.
  • the PBS experimental group administered GCE compared to the control group (sham) showed the total cell number (FIG. 11A), macrophages (FIG. 11B) and eosinophils (FIG. 11C) in the bronchial and lung lavage fluids (BAL). It was confirmed that the increase.
  • the dNP2-ctCTLA-4 experimental group in which the dNP2-ctCTLA-4 fusion protein was administered to the GCE-induced allergic asthma animal model through the nasal cavity, such as GCE showed a total cell count in bronchial and pulmonary lavage fluid (BAL) (FIG. 11A), It can be seen that the number of macrophages (FIG. 11B) and eosinophils (FIG. 11C) decreased more than three times. Therefore, the treatment of the dNP2-ctCTLA-4 fusion protein according to the present invention, it can be seen that the GCE-induced allergic asthma model shows a therapeutic effect and preventive effect.
  • BAL bronchial and pulmonary lavage fluid
  • FIG. 12 is a graph showing the expression level of IL-5, IL-13 and IFN- ⁇ in the supernatant of bronchial and pulmonary lavage fluid (BAL) using the ELISA kit (top of FIG. 12) and frozen using the ELISA kit. It is a graph showing the analysis of the expression level of IL-5, IL-13, IL-4 and IFN- ⁇ in the lung tissue (bottom of Figure 12).
  • dNP2-ctCTLA-4 experimental group treated with the dNP2-ctCTLA-4 fusion protein according to the present invention all of the bronchial and pulmonary lavage fluid (BAL) and the lung tissue were treated with IL-5, IL-13, IL-4 and IFN- ⁇ . It can be seen that the expression level is reduced three times or more than two times.
  • IL-5 is an important cytokine for eosinophil activation, and it can be seen that the dNP2-ctCTLA-4 fusion protein according to the present invention inhibits eosinophil activation.
  • Avatacept is a recombinant protein consisting of the extracellular domain of CTLA-4 and the Fc region of immunoglobulins (CTLA4-Ig), and is currently the most widely known immunomodulatory drug.
  • Systemic administration of CTLA4-Ig is known to inhibit T cell activation and airway inflammation in GCE-induced allergic asthma models.
  • the dNP2-ctCTLA-4 fusion protein according to the present invention can achieve remarkably excellent lung cell permeability, airway inflammation treatment, and prevention effect through intranasal administration route, whereas CTLA4-Ig is highly effective due to low tissue penetration efficiency.
  • airway inflammation could not be suppressed. This was confirmed through the following experiment. Experimental conditions are specifically illustrated in FIG. 13.
  • mice 8 weeks old female BALB / c mice reared in the method of 1) were administered PBS (120 ⁇ g per time) through the nasal cavity twice a week for a total of 3 weeks. Whenever PBS was administered to mice, 10 ⁇ g of a blank (Phicle) was co-treated into the nasal cavity of the mouse. Marked as sham control.
  • mice bred in the method of 1) were used. Specifically, 120 ⁇ g GCE prepared by the method of 2) in the above experimental method was administered twice a week for a total of 3 weeks into the nasal cavity of 8-week-old BALB / c mice. Whenever GCE was administered to mice, 10 ⁇ g of dNP2-ctCTLA-4 (Example 2), CTLA4-lg (Comparative Example 4) or blank (Phicle) were co-treated into the nasal cavity of mice.
  • the dNP2-ctCTLA-4 experimental group, CTLA4-lg experimental group, PBS experimental group according to the administered protein or blank test solution.
  • FIG. 14 is a graph showing the expression level of IL-13 and IFN- ⁇ in the supernatant of bronchial and pulmonary lavage fluid (BAL) using the ELISA kit (top of FIG. 14) and the frozen lung tissue using the ELISA kit. It is a graph showing the analysis of the expression level of IL-13, IL-4 and IFN- ⁇ (bottom of Figure 14).
  • Th2 cytokine and IFN- ⁇ levels were measured in bronchial and pulmonary lavage fluid (BAL) and lung tissue (lung).
  • dNP2-ctCTLA-4 fusion protein according to the present invention was administered through the nasal cavity.
  • the dNP2-ctCTLA-4 experimental group was found to significantly reduce the amount of IL-13 and IFN- ⁇ in the bronchial and pulmonary lavage (BAL) and lung tissue (lung).
  • the CTLA4-Ig experimental group administered CTLA4-Ig intranasally measured more than three times higher cytokine production than the control group (sham), which did not effectively inhibit airway inflammation when CTLA4-Ig was administered intranasally. It can be seen that.
  • FIG. 16 is a graph showing the thickness of airway epithelium in FIG. 15 using ImageJ 1.50i software. The results are expressed as ⁇ s.e.m (standard error of mean). * p ⁇ 0.05, ** p ⁇ 0.01.
  • dNP2-ctCTLA-4 experimental group administered dNP2-ctCTLA-4 through the nasal cavity showed physiological characteristics of airway epithelial cells.
  • CTLA4-Ig experimental group is not inhibited epithelial cells and cell infiltration, but thickening (thickening) can be confirmed.
  • the aim of this study was to determine whether dNP2-ctCTLA-4 fusion protein directly inhibits the differentiation of Th2 cells in GCE-induced allergic asthma model. Specific analysis method was performed by 8) method of the experimental method.
  • CD4 + CD62L hi CD44 - immature CD4 T cells isolated from 8-week-old BALB / c mice were used and differentiated into Th2 cells by adding IL-4 during 6-day activation with anti-CD3 / CD28 antibody. .
  • FIG. 17 is a graph analyzing the differentiation of Th2 cells by non-activated, + PBS, + dNP2-EGFP, + dNP2-ctCTLA-4.
  • NA non-activated is a negative control group that was not stimulated with either psychocaine or anti-TcR antibodies.
  • Th2 cells were analyzed to produce IL-4 and IL-13 through flow cytometry. Differentiated Th2 cells are mostly occupied by CD4 T cells producing IL-4 (and / or IL-13), whereas the dNP2-ctCTLA-4 experimental group has a significant decrease in cytokine production. It can be confirmed that it is inhibited by ctCTLA-4.
  • ctCTLA-4 ctCTLA-4
  • the fusion protein fused with the cell permeable peptide and the ctCTLA4 peptide of the present invention has significantly superior bronchial and lung cell permeation and delivery efficiency, and significantly improved cytokine expression suppression and airway inflammation, compared to conventional inflammatory respiratory diseases, especially allergic asthma therapeutics. Inhibition and alleviation of airway hyperresponsiveness to allergens, alleviation of Th2 inflammation, and the like, so that a rapid, fast and efficient treatment or prevention effect can be obtained.

Abstract

본 발명은 세포투과성 펩타이드와 ctCTLA4 펩타이드가 융합된 융합단백질을 유효성분으로 하는 염증성 호흡기 질환 예방 또는 치료용 약학 조성물에 관한 것으로, 본 발명은 종래에는 효과적인 치료 및 예방 효과를 달성할 수 없었던 호흡기를 통한 투여 방식을 통해서, 종래 염증성 호흡기 질환 특히 알레르기성 천식 치료제에 비하여 현저하게 우수한 기관지 및 폐 세포 투과, 전달효율을 가지면서, 현저히 향상된 사이토카인 발현 억제, 기도 염증 억제 및, 알레르겐에 대한 기도의 과민반응 완화, Th2 염증 완화 등의 활성을 나타내므로, 신속하고 빠르며 효율적인 치료 또는 예방 효과를 얻을 수 있다.

Description

세포투과성 펩타이드와 ctCTLA4 펩타이드가 융합된 융합단백질을 유효성분으로 하는 염증성 호흡기 질환 예방 또는 치료용 약학 조성물
본 발명은 세포투과성 펩타이드와 ctCTLA4 펩타이드가 융합된 융합단백질을 유효성분으로 하는 염증성 호흡기 질환 예방 또는 치료용 약학 조성물에 관한 것으로, 보다 상세하게는 dNP2 펩타이드와 ctCTLA4의 융합을 통해, 세포 투과성이 개선되고, 염증성 호흡기 질환에 의한 타겟팅 효과가 증진되어, 폐 또는 기관지 내에 직접 투여하지 않아도 코점막을 통해 염증성 호흡기 질환에 대한 우수한 예방 또는 치료 효과를 나타낼 수 있는 약학 조성물에 관한 것이다.
염증성 호흡기 질환은 치명적인 만성 폐 질환으로, 집먼지 진드기, 꽃가루 및 바퀴벌레 등의 요인들로부터 기인하며, 입냄새, 호흡곤란, 기침, 천명음, 가슴 압박감 및 통증과 같은 심각한 건강상의 문제를 야기한다.
독일 바퀴벌레는 알레르기성 질환의 주요 원인들 중 하나로, 이는 민감한 T 세포반응을 야기하여, 알레르기성 기도(airway) 염증 질환을 유발한다고 알려져 있고, 독일 바퀴벌레 추출물(German cockroach extract;GCE)은 알레르기성 염증 모델 제조에 널리 사용되어 왔다.
이러한 알레르기 반응을 치료하기 위하여 알레르기 반응을 매개로 하는 항체와 같은 다양한 면역 조절 생물학적 분자들이 치료제로 제안되었다. 이들 중에서 T 세포 특이적 면역조절제의 경우, 비강(intranasal) 내 투여와 같은 국소 천식 치료에 적용이 어렵고, 전신 투여만이 가능하다는 문제가 있었다.
한편, 천식 치료를 위해 개발된 anti-IgE(omalizumab), anti-IL-5 (mepolizumab), anti-IL-13(anrukinzumab) 및 anti-TGF-??(daclizumab)와 같은 단일 클론 항체들 역시 전신 투여용으로 사용이 가능하다는 한계점을 가지며, 전신 투여할 경우 부작용을 비롯하여 감염에 대한 잠재적 취약성과, 고비용에 의한 경제적 측면에서 효용성이 매우 낮다는 문제가 존재했다.
또한 항체는 호흡 내피에서의 단단한 결합과 생물학적 크기 한계 때문에 전신 투여만 가능하다는 문제가 있다.
이에 본 발명자들은 오히려 기관지 내로의 직접 투여 또는 전신 투여보다 융합단백질을 비강을 통해 투여하는 것에 대하여, 예의 연구 노력한 결과, 본 발명을 완성하기에 이르렀다.
특허문헌 1 : 대한민국 공개특허공보 제10-2008-0066962호
본 발명은 상기와 같은 문제점을 감안하여 안출된 것으로, 비강 경로를 통해 융합단백질을 투여함으로써 종래 투여 경로와 달리 기관지 및 폐 세포에 대한 전달 효율 및 표적율이 우수함과 동시에, 현저히 향상된 사이토카인 발현 억제, 기도 염증 억제 및, 알레르겐에 대한 기도의 과민반응 완화, Th2 염증 완화 등의 활성을 갖고 있는 약학 조성물을 제공하는 것이다.
본 발명은 상기 목적을 이루기 위하여, 하기 서열번호 1로 이루어진 세포투과성 펩타이드와 하기 서열번호 2로 이루어진 ctCTLA4 펩타이드가 융합된 융합단백질을 유효성분으로 하는 알레르기성 질환 예방 또는 치료용 약학 조성물을 제공한다.
본 발명은 종래에는 효과적인 치료 및 예방 효과를 달성할 수 없었던 호흡기를 통한 투여 방식을 통해서, 종래 염증성 호흡기 질환 특히 알레르기성 천식 치료제에 비하여 현저하게 우수한 기관지 및 폐 세포 투과, 전달효율을 가지면서, 현저히 향상된 사이토카인 발현 억제, 기도 염증 억제 및, 알레르겐에 대한 기도의 과민반응 완화, Th2 염증 완화 등의 활성을 나타내므로, 신속하고 빠르며 효율적인 치료 또는 예방 효과를 얻을 수 있다.
또한 본 발명은 종래 치료제들에 비해 국소적 투여를 간행할 수 있으므로 부작용이 감소되고, 치료제의 국소적 고농도 투여가 가능하므로, 잠재적 새로운 치료 및 처방이 가능하다.
도 1은 실험예 1의 실험조건(각 군에 따른 동물모델에 대한 투여시기, 투여량, 투여경로)을 도시한 도면이다.
도 2는 실험예 1을 통해 제조된 각 대조군과 실험군으로부터 동결된 폐 조직절편(8 ㎛)을 제조한 후, Hpechst를 사용하여 세포 핵을 염색한 다음 형광 마이크로스코피를 통해서 관찰한 결과이다.
도 3은 실험예 1을 통해 제조된 각 대조군과 실험군의 기관지 및 폐 세척액에서 세포내 형광신호를 유세포분석을 통해 분석하였다. 적색형광의 히스토그램과 평균 형광강도(mean fluorescence intensities;MFI)를 도시하였다.
도 4는 실험예 2의 실험조건(각 군에 따른 동물모델에 대한 투여시기, 투여량, 투여경로)을 도시한 도면이다.
도 5 및 도 6은 실험예 2의 각 실험군 및 대조군에 대한 메타콜린에 대한 과민반응(Airway hyper-responsiveness ; AHR) 분석 결과로, 도 5는 메타콜린 농도에 따른 실험예 2의 각 실험군과 대조군의 기도 저항성(airway resistance)을 측정하여 나타낸 것이고. 도 6은 메타콜린 농도에 따른 실험예 2의 각 실험군과 대조군의 기도 탄성도(airway elastance)을 측정하여 나타낸 것이다. 각 군당 n=5이고, 결과는 ± s.e.m(standard error of mean;표준평균오차)으로 나타내었다. **p<0.01, ***p<0.001
도 7은 실험예 3의 각 실험군 및 대조군에 대한 폐 조직 관찰 결과로, 실험예 3에서의 각 실험군 및 대조군의 폐 조직을 PAS로 염색하여 촬영한 사진이다. 이때 적색 영역은 점액분비 배상세포(mucus-secreting goblet cell)이다.
도 8은 도 7에서의 점액분비 배상세포(mucus-secreting goblet cell)의 수를 ImageJ 1.50i software를 사용하여 분석한 결과이다.
도 9는 실험예 3의 각 실험군 및 대조군에 대한 폐 조직 관찰 결과로, 실험예 3에서의 각 실험군 및 대조군의 폐 조직을 메이슨 트리크롬 염색(Masson's trichrome stain)으로 염색하여 촬영한 사진이다. 이때 청색 영역은 콜라겐 증착(collagen deposition)과 섬유증(fibrosis)이다.
도 10은 도 9에서의 섬유증 영역을 ImageJ 1.50i software를 사용하여 분석한 결과이다. 각 그룹(n=5)에서 대표 결과이다. 결과는 ± s.e.m(standard error of mean;표준평균오차)으로 나타내었다. ***p<0.001
도 11은 실험예 4에서 각 실험군 및 대조군으로부터 회수한 기관지 및 폐 세척액을 슬라이드 상에 cytocentrifugation한 후, Hemacolor staining kit을 사용하여 염색한 다음 총 세포수를 계산하여 나타낸 그래프(a), 대식세포의 수를 계산하여 나타낸 그래프(b) 및 호산구(eosinophils)의 수를 계산하여 나타낸 그래프(c)이다.
도 12는 ELISA 키트를 사용하여 기관지 및 폐 세척액(BAL)의 상등액에서 IL-5, IL-13 및 IFN-γ의 발현 정도를 분석하여 나타낸 그래프(도 12의 상단)와 ELISA 키트를 사용하여 동결된 폐 조직에서 IL-5, IL-13, IL-4 및 IFN-γ의 발현 정도를 분석하여 나타낸 그래프(도 12의 하단)이다. IL-5, IL-13, IL-4 및 IFN-γ의 농도를 ELSISA 키트를 통해 분석하였고 상기 수치는 조직의 총 단백질 농도에 대해 정규화(normalized)한 것이다. 상기 단백질 농도는 bradford assay에 의해 정량화하였다. 각 군은 n=5이고, 결과는 ± s.e.m(standard error of mean;표준평균오차)으로 나타내었다. *p<0.05, **p<0.01.
도 13은 실험예 5의 실험조건(각 군에 따른 동물모델에 대한 투여시기, 투여량, 투여경로)을 도시한 도면이다.
도 14는 ELISA 키트를 사용하여 기관지 및 폐 세척액(BAL)의 상등액에서 IL-13 및 IFN-γ의 발현 정도를 분석하여 나타낸 그래프(도 14의 상단)와 ELISA 키트를 사용하여 동결된 폐 조직에서 IL-13, IL-4 및 IFN-γ의 발현 정도를 분석하여 나타낸 그래프(도 14의 하단)이다. IL-5, IL-13, IL-4 및 IFN-γ의 농도를 ELSISA 키트를 통해 분석하였고 상기 수치는 조직의 총 단백질 농도에 대해 정규화(normalized)한 것이다. 상기 단백질 농도는 bradford assay에 의해 정량화하였다. 각 군은 n=5이고, 결과는 ± s.e.m(standard error of mean;표준평균오차)으로 나타내었다. *p<0.05, **p<0.01.
도 15는 실험예 5에서의 각 실험군과 대조군으로부터 회수한 폐 조직을 H&E(hematoxylin eosin)으로 염색하고, 이를 현미경을 통해 촬영한 사진이다. 상기 도면은 각 그룹(n=5)을 대표하는 사진이다.
도 16은 도 15에서의 기도 상피세포(epithelium) 두께를 ImageJ 1.50i software를 사용하여 측정하여 나타낸 그래프이다. 결과는 ± s.e.m(standard error of mean;표준평균오차)으로 나타내었다. *p<0.05, **p<0.01.
도 17은 non-activated, +PBS, +dNP2-EGFP, +dNP2-ctCTLA-4에 의한 Th2 세포의 분화를 분석한 그래프이다.
도 18은 CD4+IL-4+ 분화된 Th2 세포에서 생산된 사이토카인의 퍼센트(%)를 계산하여 나타낸 그래프이다. 결과는 ± s.e.m(standard error of mean;표준평균오차)으로 나타내었다(n=3). **p<0.01. NA(non-activated)는 음성 대조군으로, 사이코카인와 anti-TcR 항체 그 어떤 것으로도 자극하지 않은 그룹이다.
이하에서, 본 발명의 여러 측면 및 다양한 구현예에 대해 더욱 구체적으로 살펴보도록 한다.
본 발명의 일 측면은 하기 서열번호 1로 이루어진 세포투과성 펩타이드와 하기 서열번호 2로 이루어진 ctCTLA4 펩타이드가 융합된 융합단백질을 유효성분으로 하는 염증성 호흡기 질환 예방 또는 치료용 약학 조성물에 관한 것이다.
[서열번호 1]
KIKKVKKKGRKGSKIKKVKKKGRK
[서열번호 2]
KMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
본 발명에서 "융합 단백질"이란 하기 서열번호 1로 이루어진 세포투과성 펩타이드와 하기 서열번호 2로 이루어진 ctCTLA4 펩타이드를 포함하며, 이들의 유전적 융합이나 화학적 결합으로 형성된 공유결합 복합체를 의미한다.
또한, 상기 "유전적 융합"이란 단백질을 코딩하는 DNA 서열의 유전적 발현을 통해서 형성된 선형, 공유결합으로 이루어진 연결을 의미한다.
일반적으로 CTLA4는 Cytotoxic T lymphocyte antigen-4로 알려져 있고, 이는 T 세포 활성화를 억제하는 중요한 면역 단백질이다. CTLA-4는 T 세포의 CD28, 공동 자극 수용체 결합보다 훨씬 효율적인, CD80과 CD86과 같은 항원이 존재하는 세포의 표면에 있는 공동 자극(co-stimulatory) 분자와 결합을 형성한다. 상술한 상호작용은 음성 신호를 야기하여 T 세포를 억제하게 된다. 아바타셉트(abatacept)는 면역 글로불린 G 불변영역인 CTLA-4-lg(immunoglobulin G constant region)이 접합된 CTLA-4 세포외 도메인으로 구성된 재조합 단백질이다. 이는 호산구 침윤, Th2 사이토 카인 발현 및 정맥 내 또는 복강 내 주사를 통한 혈청 lgE의 감소에 의한 OVA(Ovalbumin) 유발 천식 동물모델에서 알레르기성 기도 염증 질환을 억제하는 효과를 갖는다.
최근에는 뇌를 포함하는 다양한 조직의 상주 세포에 접근하기 위하여 혈관을 효율적으로 피할 수 있는 새로운 인간 유래 세포투과성 펩타이드를 개발한 바 있는데, 이러한 dNP2 펩타이드와 CTLA-4의 세포질 도메인으로 구성된 재조합 단백질인 dNP2-ctCTLA4를 제조한 바 있다.
허나 이는 척수에서 Th1과 Th17 세포가 감소된 마우스에서 자가 면역 뇌염을 예방 또는 치료 효과를 확인한 것이다. 본 발명은 dNP2-ctCTLA-4 융합단백질을 종래와는 전혀 다른 경로(비강 경로)를 통해 투여한 결과, 종래의 방법과는 전혀 다른 질환에 대해 치료 또는 예방 효과를 갖게 됨을 발견하여 완성하게 된 것으로, dNP2-ctCTLA-4 융합단백질을 비강경로를 통해 투여할 경우 중추신경계 질환과는 전혀 관련없는 염증성 호흡기 질환, 바람직하게는 염증성 호흡기 질환 구체적으로 알레르기성 천식에 치료 또는 예방효과를 가지게 된다. dNP2-ctCTLA-4 융합단백질을 분무액 또는 분말형으로 비강 경로를 통해 흡입할 경우, 폐 상주세포(lung resident cell)에 단백질을 효율적으로 전달하는 특성을 갖게 되며, 전달된 dNP2-ctCTLA-4 융합단백질은 Th2 염증을 효과적으로 제어함으로써, 염증성 호흡기 질환에 대해 예방 또는 치료효과를 발휘하게 된다.
dNP2-ctCTLA-4 융합단백질에 있어서, dNP2 펩타이드 대신 다른 세포투과성 펩타이드를 사용할 경우, 비강 경로로 투여된다 하더라도 기도 내, 기관지 내 또는 폐 내에 효과적으로 투여되지 못할 뿐만 아니라, 폐 상주세포를 투과 및 표적하지 못하여, 단백질을 효과적으로 전달하지 못하는 문제가 있음을 확인하였다.
즉, dNP2-ctCTLA-4 융합단백질을 비강 경로를 통해 투여함으로써, 종래 CTLA-4-lg보다 알레르기성 천식에 대한 약리효과가 현저히(2~3 배 이상) 우수하였으며, 종래 dNP2-ctCTLA-4와 이질적 약리효과를 달성하였다.
본 발명의 실험예에서 GCE(독일 바퀴벌레 추출물)을 통해 유도된 알레르기성 천식 동물모델에서, dNP2-ctCTLA-4 융합단백질을 투여하였을 때, 면역 조절 효과를 조사한 결과, 염증, 과민반응 및 Th2 반응 억제 효과를 달성하고 있음을 확인하였다.
우리는 바퀴벌레에 기인한 기도의 염증에 대한 dNP2-ctCTLA-4 융합단백질의 억제 효과를 조사하였다. dNP2-ctCTLA-4 융합 단백질은 비강 경로를 통해 기도 내 또는 기관지 내에 투여되어, 단백질을 효율적으로 폐 세포로 전달한다는 것을 확인하였다. 아울러 dNP2-ctCTLA-4 융합단백질은 기도 상피세포를 투과하여 효율적으로 상주세포에 전달될 수 있음을 확인하였다. 다시 말해 본 발명에 따른 dNP2-ctCTLA-4 융합단백질은 비강 경로를 통해 투여될 경우, 기도 과민반응, Th2 염증 및 기도재형성(airway remodeling)을 완화시키고, Th2 분화를 직접 억제하여 알레르기성 천식을 효과적으로 제어할 수 있다. 게다가 종래 CTLA-4-Ig에 비해 본 발명에 따른 dNP2-ctCTLA-4 융합단백질이 2~3 배 이상 우수한 약리효과를 달성하고 있음을 확인하였다.
본 발명에 따른 dNP2-ctCTLA-4 융합단백질을 비강 경로 외에 다른 경로를 통해 투여할 경우 본 발명의 염증성 호흡기 질환에 대한 약리효과를 달성할 수 없다는 문제가 있다.
본 발명에서 사용된 서열번호 2로 표시되는 아미노산 서열로 이루어진 IL-2 억제활성을 갖는 펩타이드는 인간 또는 마우스로부터 얻은 전장 CTLA-4 단백질의 엑손 4 중 일부만을 암호화한 것으로, CTLA-4 단백질 중에서 세포질 도메인으로부터 유래된 서열이다. 인간과 마우스의 CTLA-4 단백질의 아미노산 서열 중에서 서로 100% 일치하는 부분의 아미노산 서열이다. 인체에 적용해서 사용할 때에 면역 반응 등의 부작용을 일으킬 가능성이 낮다.
상기 서열번호 2로 표시되는 아미노산 서열로 이루어진 IL-2 억제활성을 갖는 펩타이드는 CTLA-4 단백질에서 IL-2 발현 억제 활성을 나타내는 CTLA-4의 단편으로, 중추신경계 즉, 뇌-혈관 장벽 또는 척수-혈관 장벽을 고효율로 투과할 수 있는 효과를 더 나타내고 있으며, 인간과 인간을 제외한 동물(마우스)에서 100% 동일한 아미노산 서열을 가지고 있는 단편을 사용함으로써, 이들 모두에 적용할 수 있다.
구체적으로 상기 서열번호 2로 표시되는 아미노산 서열로 이루어진 IL-2 억제활성을 갖는 펩타이드는 세포독성 T 림프구 항원 제4형(CTLA-4) 단백질의 188 번째 아미노산 잔기에서부터 213 번째 아미노산 서열까지를 포함하는(서열번호 1) 것으로, 이하에서 'ctCTLA-4' 라고도 한다. 비강 경로를 통해 투여될 때, 코 점막 또는 기관지 점막 또는 폐 상피세포에 대한 투과활성 및 염증성 호흡기 질환에 대한 예방 또는 치료 효과를 부여하기 위하여 N-말단과 C 말단을 부분적으로 결실된 형태의 폴리펩티드이다.
상기 ctCTLA4 펩타이드는 천연에서 추출하거나 합성하거나 DNA 서열을 기본으로 하는 유전자 재조합 방법에 의해 제조될 수 있다.
상기 염증성 호흡기 질환은 천식, 만성 폐쇄성 폐질환(COPD), 급성 폐손상(acute lung injury), 농흉, 폐농양, 폐렴, 폐결핵, 기침, 가래, 기관지염, 인후염, 편도염, 부비동염, 비염, 폐쇄성 세기관지염 및 후두염으로 구성된 군에서 선택되는 어느 하나일 수 있다.
상기 천식의 예로는, 기관지 천식, 아토피성 천식, 아토피성 기관지 IgE 매개 천식, 비아토피성 천식, 알레르기성 천식 및 비알레르기성 천식 등이 있으며, 상기 기관지염의 예로는, 급성 기관지염, 만성 기관지염, 세기관지염 및 카타르성 기관지염 등이 있다.
상기 알레르기성 천식은 집먼지 진드기, 꽃가루, 동물 털이나 비듬, 바퀴벌레, 식품, 약물, 감기, 담배연기와 실내오염, 대기오염, 식품첨가제, 운동, 기후 변화, 황사, 스트레스에 기인한 알레르기성 천식일 수 있고, 보다 바람직하게는 바퀴벌레에 기인한 알레르기성 천식일 수 있다.
본 발명의 약학적 조성물은 비강 경로를 통해서만 주입되는 것이 바람직하고, 정맥내 주입, 피하 주입, 근육 주입, 복강 주입, 경피 투여와 같은 다른 투여경로로 투여될 경우 염증성 호흡기 질환 특히 알레르기성 천식에 대한 약리효과를 달성할 수 없게 되는 문제가 존재한다.
본 발명의 조성물은 약학적 조성물의 제조에 통상적으로 사용하는 적절한 담체, 부형제 및 희석제를 더 포함할 수 있다. 본 발명에 따른 약학적 조성물은 비강 경로로 투여할 수 있는 제형이라면 특별히 이에 제한되지 않으나, 본 발명에 사용된 "비강 경로를 통한 투여"는 안정제 또는 기타 부형제의 첨가 여부에 관계없이 용액형, 분말형 또는 에어로졸화 또는 분무화 용액형 또는 분말형의 흡입에 의하여 비강을 통해 기도 또는 폐에 투여할 수 있도록 함으로써, 상기 약학적 조성물이 기도, 기관, 기관지 폐포에 투여될 수 있는 모든 투여형을 포함한다.
당해 기술분야에 알려진 적합한 제제는 문헌(Remington's Pharmaceutical Science, Mack Publishing Company, Easton PA)에 개시되어 있는 것을 사용하는 것이 바람직하다.
구체적으로 비강 경로 투여 방법으로는 압축 공기/산소 혼합물을 이용한 가압 분무기, 초음파 분무기, 전기 미세 펌프 분무기, 계량 흡입기(MDI) 및 건조 분말 흡입장치(DPI)를 사용할 수 있다. 에어로졸의 경우 기계식 환기 또는 관이 삽입된 환자의 기관내 튜브를 경유하여 전달 될 수 있다.
본 발명의 약학적 조성물에 포함될 수 있는 담체, 부형제 및 희석제로는 락토오스, 덱스트로오스, 수크로오스, 소르비톨, 만니톨, 자일리톨, 에리스리톨, 말티톨, 전분, 아카시아 고무, 알지네이트, 젤라틴, 칼슘포스페이트, 칼슘 실리케이트, 셀룰로오스, 메틸 셀룰로오스, 미정질 셀룰로오스, 폴리비닐 피롤리돈, 물, 메틸히드록시벤조에이트, 프로필히드록시벤조에이트, 탈크, 마그네슘 스테아레이트 및 광물유를 들 수 있다. 제제화할 경우에는 보통 사용하는 충진제, 증량제, 결합제, 습윤제, 붕해제, 계면활성제 등의 희석제 또는 부형제를 사용하여 조제된다.
본 발명에서 사용되는 용어 "투여"는 임의의 적절한 방법으로 개체에게 소정의 본 발명의 조성물을 제공하는 것을 의미한다.
본 발명의 약학적 조성물의 바람직한 투여량은 개체의 상태 및 체중, 질병의 정도, 약물형태, 투여경로 및 기간에 따라 다르지만, 당업자에 의해 적절하게 선택될 수 있다. 바람직한 효과를 위해서, 본 발명의 조성물은 1 일 0.001 내지 1000 mg/kg으로 투여할 수 있다. 투여는 하루에 한번 투여할 수도 있고, 수회 나누어 투여할 수도 있다. 상기 투여량은 어떠한 면으로든 본 발명의 범위를 한정하는 것은 아니다.
본 발명의 또 다른 측면은 상기 약학 조성물을 개체의 비강 경로를 통해 투여하여, 인간을 제외한 동물의 중추신경계 질환을 예방 또는 치료하는 방법에 관한 것이다.
상기 약학 조성물을 생체 또는 세포 내 주입은 비내(nasal), 점막 내(mucosal), 흡입(inhalation)의 경로로 주입함으로써 수행될 수 있다. 상기 전달 방법은 배양 세포뿐만 아니라 일반적인 생체 내 전달, 즉 동물 세포, 동물 조직 및 동물체로의 전달시에도 충분히 확대 적용될 수 있다.
상기 약학 조성물은 비면역원성, 비감염성이며, 레트로바이러스 또는 아데노 바이러스와 같은 벡터 유기체에 DNA가 패키징되어 있지 않기 때문에 플라스미드 크기에 제한을 받지 않는다. 따라서 어떤 실용적인크기의 재조합 유전자 발현 구조물에도 사용될 수 있다.
이하에서 실시예 등을 통해 본 발명을 더욱 상세히 설명하고자 하며, 다만 이하에 실시예 등에 의해 본 발명의 범위와 내용이 축소되거나 제한되어 해석될 수 없다. 또한, 이하의 실시예를 포함한 본 발명의 개시 내용에 기초한다면, 구체적으로 실험 결과가 제시되지 않은 본 발명을 통상의 기술자가 용이하게 실시할 수 있음은 명백한 것이며, 이러한 변형 및 수정이 첨부된 특허청구범위에 속하는 것도 당연하다.
<실험방법>
1) 마우스
8 주령의 BALB/c 마우스를 Orient Bio(대전, 한국)에서 구입하였다. 모든 마우스는 특정 무균 시설에서 사육 및 보관하였고, 시설 조건은 12 시간의 명암주기를 유지하고, 정기적으로 먹이와 멸균수(autoclaved water)를 제공하였다.
독일 바퀴벌레 추출물(이하, GCE라고 한다)에 의해 유도된 천식동물모델 제조과정은 연세대학교 동물 실험 윤리위원회의 승인을 받았으며, 상기 마우스의 비강(intranasal) 내 단백질 전달 효율 실험은 한양대학교 동물 실험 및 동물 실험위원회에서 승인을 받아 수행하였다.
2) 독일 바퀴벌레 추출물(GCE)
독일 바퀴벌레 추출물은 다음과 같은 과정을 통해 제조하였다. 분쇄 된 독일바퀴벌레(학명 : Blattela germanica)를 에테르/에틸 아세테이트(ether/ethyl acetate) 200 ㎖에 탈지시킨 후, 4 ℃ 조건 하에서 6 mM β-메르캅토에탄올(β-mercaptoethanol)과 1 ㎎/㎖ 1-페닐-3(2-트리아졸)티오우레아(1-phenyl-3(2-thiazolyl)-2-thiourea)를 포함한 인산완충액(PBS)에 서서히 혼합하여준다. 상기 혼합액을 원심분리하여 얻은 상등액을 0.22㎛ 필터로 여과 한 다음 동결 건조하여, 독일 바퀴벌레 추출물(이하, GCE라고 한다)을 얻었다.
3) GCE에 의해 유도된 알레르기성 천식 동물모델
상기 1)의 방법으로 사육된 마우스를 사용하였다. 구체적으로, PBS(Sham) 또는 상기 2)의 방법으로 제조된 120 ㎍ GCE를, 8 주령의 BALB/c 마우스의 비강 내로 일주일에 2회 총 3 주간 투여하였다.
GCE에 의해 유도된 만성적인 알레르기성 천식 동물모델에서 본 발명에 따른 융합단백질(dNP2-ctCTLA-4)의 치료효과를 확인하기 위하여 마우스에 GCE를 투여할 때마다 10 ㎍의 dNP2-ctCTLA-4(실시예 1), dNP2-EGFP(비교예 1), CTLA4-Ig(비교예 2) 또는 PBS(대조군)를 마우스의 비강 내로 병용 처리하였다(실험예 2 참조).
상술한 바와 같이 비강으로 투여함에 따라, 상기 마우스의 폐로 전달되는지 유무를 확인하기 위해 dTomato, Hph-1-dTomato, dNP2-dTomato 또는 PBS 100 ㎍을 21 일째에 15 분간 비강 내 투여 하였다. 마우스를 희생시키고 단백질의 전달 효율 및 폐의 병리학적 변화를 분석 하였다(도 1 내지 도 3, 실험예 1 참조).
4) 메타콜린에 대한 과민반응(Airway hyper-responsiveness ; AHR) 분석
AHR은 flexi/Vent 5.1 소형동물용 호흡기(SCIREQ, 몬트리올, PQ, 캐나다)를 사용하여 마지막으로 GCE를 흡입투여한 날로부터 4 일 후에 마우스를 whole body plethysmograph(BUXCO, USA)에 넣고, 다양한 농도의 메타콜린 용액(3.1, 6.25, 12.5, 25 및 50 ㎎/㎖)을 0.4 ㎖ 취해 에어로졸에 넣고 10 초 동안 흡입투여하고, 투여시점에서부터 각각 1 분, 2 분 뒤에 penh를 측정하여, 평균값을 해당 메타콜린 투여용량에서의 Penh(enhanced pause)값으로 하였다.
5) 기관지 및 폐 세척액(Bronchoalveolar lavage fluid; BALF)에서의 세포수 및 면역세포 분포조사
기관지 및 폐 세척액을 수집하기 위하여, 마우스 내에 튜브를 삽관한 후, 여기에 HBSS 용액(Hank's balanced salt solution) 1 ㎖를 주입하여, 마우스의 폐를 세척하고, 이를 빼내어 세척액을 취하였다. 혈구 계수기(hemocytometer)를 통해 세척액의 총 세포수를 계산하였다. 그런 다음 세척액을 1000 rpm으로 3 분동안 원심분리하여 상층액을 버리고, 침전물을 얻어 조직절편을 준비하였다. 상기 조직절편(슬라이드)은 hemacolor staining kit(Merck Millipore, Darmstadt, Germany)로 염색한 후, 대식세포와 호산구 세포의 수를 계산하기 위하여, 표준 혈구학 절차(standard hemocytologic procedures)를 통해 상기 세포를 총 카운팅된 세포수가 적어도 200에 도달할 때까지 차별적으로 계산하였다.
6) 폐 세척액에서 사이토카인 발현 분석
상기 5)의 방법으로 얻은 세척액(BALF)에 T-PER 조직 단백질 추출 시약(tissue protein extraction reagent)(Thermo Fisher Scientific, MA, US)을 사용하여 균질화(homogenized)하여 현탄액을 제조하였다. 다음 상기 현탁액을 4 ℃에서 30 분 동안 배양한 후, 2500 rpm에서 10 분간 원심분리하여 얻은 상층액을 0.45 ㎛ 필터로 여과하여 시료를 제조하였다. 상기 시료로부터 사이토카인 발현 수준을 분석하였다.
7) 폐 조직의 관찰
집게로 고정한 폐를 떼어내어 10% 포르말린용액에 하루동안 고정한 후, tissue processor를 이용하여 파라핀 침투시킨 조직을 마이크로톰을 이용하여 3-4 ㎛의 두께로 잘라 조직절편을 제조하였다. 제조된 슬라이드를 PAS 염색(periodic acid-Schiff stain) 또는 메이슨 트리크롬 염색(Masson's trichrome stain)으로 염색하고, 커버슬라이드를 덮어 염색된 조직을 현미경 (Olympus BX40)으로 관찰하였다.
8) Th2 분화 분석
미성숙 CD4 T 세포(Mouse naㅿve CD4 T cells)는 자성활성세포 분류키트(MACS, Naive CD4 T 세포 격리 키트, 마우스, Miltenyi, Bergisch Gladbach, Germany)을 사용하여, 8 주령 BALB/c 마우스로부터 분리하였다.
상술한 과정을 통해 분리된 2.5 × 105 개의 세포를 항-CD3/항-CD28 항체(0.1 ㎍/㎖)가 코팅된 96 웰 플레이트에 접종(seed)한 다음, 상기 세포를 항-IFN-γ 중화 항체(5 ㎍/㎖), IL-2(50 U/㎖), IL-4(30 ng/㎖) 및 PBS가 존재하는 조건하에서 배양하였다. 이때, 각 웰에 1 μM의 dNP2-EGFP(비교예 3) 또는 1 μM의 dNP2-ctCTLA-4(실시예 2)를 6 일간 투여한 후, 재자극(re-stimulation), 단백질 수송 억제제 처리(protein transport inhibitor treatment), 항 마우스 IFN-γ-FITC(anti-mouse IFN-γ-FITC) 및 항- 마우스 IL-4-PE FACS 항체(anti-mouse IL-4-PE FACS antibodies) 존재 하에 세포를 염색한 후 유세포 분석기로 분석하였다.
9) 통계 분석
모든 실험은 Prism 6 소프트웨어(GraphPad)를 사용하여 일원 분산 분석(one-way ANOVA)에 의해 통계적으로 분석하였다. 이때, P 수치가 < 0.05인 것은 통계적으로 유의하다고 간주한다.
<제조예 1> dNP2, ctCTLA-4 펩타이드의 합성/분리정제
서열번호 1 내지 3의 아미노산 서열을 가지는 펩타이드를 합성하였다.
이때, 서열번호 1의 아미노산 서열로 이루어진 세포 투과성 펩타이드(이하 'dNP2'라고도 함), 서열번호 2의 아미노산 서열을 가지는 펩타이드(이하, 'ctCTLA-4'라고도 함), 서열번호 3의 아미노산 서열로 이루어진 세포 투과성 펩타이드(이하 'Hph-1'이라고도 함)로 표기하였다.
상기 아미노산 서열에 합당한 센스(sense)와 안티센스(antisense) 올리고테옥시뉴클레오타이드(oligodeoxy nucleotide)를 각각 합성한 후 95 ℃에서 3분 방치하여 형성된 2차 또는 3차 구조를 제거하고(denaturation) 50 ℃ 그리고 72 ℃로 온도를 바꾸어 DNA 2중 가닥을 만들었다. pRSET-b 벡터에 끼워 넣기 위하여 센스와 안티센스 올리고데옥시뉴클레오타이드 이외의 제한효소 특이 서열을 5'과 3'에 넣었다. 이후 Escherichia coli BL21(DE3) Star pLysS를 각각의 펩타이드를 코딩하는 pRSET-b 플라스미드로 각각 형질전환시켰다. 콜로니를 37 ℃에서 암피실린 함유 Luria-Bertani 배지에서 배양하고 단백질 발현을 1mM 이소프로필-β-D-티오갈락토피라노시드(isopropyl-β-D-thiogalactopyranoside;IPTG)에 의해 유도 하였다. 단백질을 Ni-NTA 친화성 크로마토그래피(Qiagen)로 정제하고 PD-10 칼럼 (GE Healthcare)을 사용하여 탈염시켰다. 모든 단백질은 -80 ℃에서 보관하였다.
서열번호 1
KIKKVKKKGRKGSKIKKVKKKGRK
서열번호 2. ctCTLA-4
KMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
서열번호 3. Hph-1
YARVRRRGPRR
<실시예 2> dNP2-ctCTLA-4 융합단백질의 제조.
제조예 1에서 제조된 서열번호 1의 아미노산 서열을 가지는 세포투과성 펩타이드와 서열번호 2의 아미노산 서열을 가지는 ctCTLA-4 펩타이드를 융합하기 위하여, ctCTLA-4 펩타이드의 N-말단에 서열번호 1로 표시되는 세포 투과성 펩타이드가 연결될 수 있도록 하는 프라이머를 제작하여, dNP2-ctCTLA-4 유전자를 PCR 반응을 통해 생산하고 이를 벡터(pRSET-b)에 삽입하여 대장균 균주에서 단백질을 발현, 정제한 후 세포 내에 전달효율을 확인하는 실험을 진행하였다. 구체적인 실험과정에 대해 아래에 서술하였다.
1) 코딩 유전자의 제조
제조예 1에서 제조된 서열번호 2의 아미노산 서열을 가지는 ctCTLA-4 펩타이드의 N-말단의 일부를 코딩하는 DNA 염기서열에 서열번호 1의 아미노산 서열로 이루어진 세포 투과성 펩타이드를 코딩하는 DNA 염기서열을 추가하여 포워드 프라이머를 제작하였다. 각 프라이머와 서열번호 및 제한효소 인식부위를 표 1에 정리하여 나타내었다.
PCR 반응은 서열번호 2의 펩타이드를 코딩하는 유전자가 포함된 pRSETb 벡터를 주형으로 하여 상기 서열번호 4의 프라이머를 이용하였다.
95 ℃에서 3분 동안 초기 열 변성 반응을 한 뒤, 95 ℃에서 주형의 열 변성반응 20초, 50 ℃에서 프라이머와 주형이 결합하는 중합반응 20 초, 72 ℃에서 연장반응으로 30초를 수행하는 것으로 1주기를 설정하여 30주기를 PCR 반응기(Biorad)를 이용하여 수행하였다.
번호 프라이머 염기서열
서열번호 4 dNP2-ctCTLA-4의 1차 포워드 프라이머 AAGATTAAGAAAGTCAAGAAGAAAGGAAGAAAGGAATTCTACCCATACGATGTTCCAGATTACGCTA
서열번호 5 dNP2-ctCTLA-4의 2차 포워드 프라이머 GCTAGCAAGATTAAGAAAGTCAAGAAGAAAGGAAGAAAGGGATCCAAGATTAAGAAAGTCAAGAAGA
한편, 상기 dNP2-ctCTLA-4 포워드 프라이머는 dNP2(KIKKVKKKGRKGSKIKKVKKKGRK)의 서열이 매우 길어 두 번에 나누어 PCR을 수행하였다.
2) 재조합 발현벡터의 제조.
dNP2-ctCTLA-4 융합단백질을 발현시키기 위하여 단백질 발현 벡터인 pRSETb에 상기 실시예 1의 1)에서 제조된 유전자(DNA) 절편을 제한효소로 자른 후 연결효소(ligase)를 이용하여 벡터에 삽입하였다.
실시예 1의 1)에서 증폭된 DNA 절편을 NheI과 HindIII (NEB)를 이용하여 DNA의 5′/ 3′ 말단을 접착성 말단 (sticky end)이 되도록 효소 반응 시켰다. 한편, 같은 두 개의 제한효소를 이용하여 pRSETb를 효소 반응시켜 NheI, HindIII 삽입 부위를 갖는 선형의 pRSETb 벡터를 만들었다. 각각의 효소 반응 이후에는 PCR 정제 키트(코스모진텍)를 이용하여 분리하였다.
분리된 dNP2-ctCTLA-4 융합체 이중사슬 DNA 절편과 pRSET-b 벡터는 25℃에서 두 시간 동안 T4 Ligase (NEB)를 이용하여 연결되도록 효소 반응 시켰다.
이렇게 연결시킨 dNP2-ctCTLA-4가 삽입된 원형의 pRSETb 벡터를 DH5α 대장균 균주에 형질전환 시켜 항생제인 암피실린 50 μg/㎖이 포함된 LB 평판 배지에 배양하여 콜로니를 형성하는 형질전환 대장균을 선별하였다. 선별된 대장균 콜로니는 다시 암피실린 50 μg/㎖을 포함하는 액체 LB 배지에 접종하여 배양했으며 이후 플라스미드 Mini Preparation키트(코스모진텍)를 이용하여 플라스미드 벡터를 분리하였다.
상기 과정을 통해 분리된 플라스미드 벡터가 dNP2-ctCTLA-4가 삽입된 pRSETb 벡터임을 확인하기 위하여 일차적으로 NheI과 HindIII 제한효소를 이용해 효소 반응 시킨 후, DNA 염기서열 분석(바이오닉스)을 통하여 최종적으로 확인할 수 있었다.
3) 단백질의 분리 및 정제
상기 실시예 1의 2)로부터 제조된 dNP2-ctCTLA-4가 삽입된 pRSETb 벡터를 대장균 BL21(DE3)star pLysS 균주에 형질전환 시킨 후 항생제인 클로람페니콜 34 μg/㎖와 암피실린 50 μg/㎖가 포함된 LB 평판배지에서 형성된 콜로니를 액체 LB 배지 50㎖에 접종하여 37℃에서 10시간 배양하여 이를 새로운 액체 LB 배지 500㎖에 접종하였다. 동일한 온도에서 대장균의 양이 분광광도계로 배양액을 측정하였을 때, O.D 값이 0.5가 될 때까지 배양한 후, IPTG (Isopropyl β-D-1-thiogalactopyranoside)의 농도가 1mM이 되도록 첨가하여 온도는 20℃, 회전 속도는 150rpm로 맞춰진 진탕 배양기에서 14시간을 더 배양하였다. 이렇게 대장균주가 발현한 단백질은 앞쪽에 pRSET-b 벡터에 코딩되어 있는 6X-His tag을 포함하고 있다. 이를 이용해 하기의 실험 방법으로 단백질을 정제하였다.
배양액을 원심분리로 모은 후 native condition의 용해용액(0.5M NaCl, 5mM imidazole, 20mM Tris-HCl, pH 8.0)으로 재 부유시켰다. 대장균의 세포벽과 세포막을 깨뜨리기 위해 용해용액에 부유해 있는 상태로 10분간 놓아두었다. 그리고 초음파 세포 파쇄기인 VCX-130(Sonics & Materials)을 사용해 세포를 분쇄하고 원심 분리하여 상층액을 분리하였다. 분리된 상층액은 0.45㎛ 필터(Advantec)를 이용해 한번 거른 뒤 Ni-NTA agarose(Qiagen)와 상온에서 1시간 동안 결합하도록 하였다. 이후에는 히스티딘 칼럼(His-column, Biorad)을 이용해 Ni-NTA agarose와 결합된 단백질 산물만을 column에 결합할 수 있도록 하였다. 20mM, 250mM의 imidazole 용액으로 세척한 뒤, 3 M의 imidazole 용액을 이용해 최종적으로 용출해냈다. 이렇게 용출된 단백질 산물은 PD-10 탈염 칼럼(Amersham Bioscience)에 적용하여 dNP2-ctCTLA-4 융합단백질을 최종적으로 순수 분리 정제하였다.
<비교예 1> dTomato의 합성
적색형광단백질인 dTomato을 사용하였다.
<비교예 2> Hph-1-dTomato의 합성
제조예 1로부터 제조된 서열번호 3의 세포투과성 펩타이드를 적색형광단백질인 dTomato와 융합한 융합단백질을 제조하기 위하여, 이를 ㈜코스모진텍에 의뢰하여 합성한 것을 사용하였다.
<비교예 3> dNP2-EGFP의 합성 및 분리정제
제조예 1로부터 제조된 서열번호 1의 세포 투과성 펩타이드를 녹색 형광 단백질(EGFP)과 융합하기 위하여 dNP2의 N-말단에 EGFP가 연결될 수 있도록 하는 프라이머를 제작하여 dNP2-EGFP 유전자를 PCR 반응을 통해 생산하고 이를 벡터(pRSET-b)에 삽입하여 대장균 균주에서 단백질을 발현, 정제하였고, 전반적인 과정은 프라이머를 제외하고는 실시예 1과 모두 동일하게 수행하였다. 사용된 프라이머는 다음과 같다.
[서열번호 6] 1 차 포워드 프라이머
AAGATTAAGAAAGTCAAGAAGAAAGGAAGAAAGGTGAGCAAGGGCGAGGAGCTGTTCACCG
[서열번호 7] 2차 포워드 프라이머
GCTAGCAAGATTAAGAAAGTCAAGAAGAAAGGAAGAAAGGGATCCAAGATTAAGAAAGTCAAGAAGA
<비교예 4> ctCTLA-4-lg
종래 류마티스 관절염 치료제로 알려진, CTLA-4 tecracellular domain confugated with the immunohglobulin G constant region(CTLA-4-lg)로 이루어진 재조합 단백질인 아바타셉트(abatacept)을 사용하였다.
<실험예 1> 비강 투여에서의 dNP2 펩타이드의 폐 상주세포(lung resident cells)로의 단백질 전달효율(potein delivery efficiency)
1) 실험설계
dNP2 펩타이드는 휴지세포(resting cell)보다 활성화 면역세포 또는 기억 면역세포(memory-like immune cell)에서 단백질을 전달할 수 있으므로, 본 발명에서 dNP2 펩타이드가 아무것도 처리하지 않은 sham 마우스(sham mouse)보다 염증성 폐 상주세포(inflammatory lung resident cell)에서 단백질을 전달할 수 있을 것이라고 가정한 후, 실험을 설계하였고, 구체적인 실험조건은 도 1에 나타내었다.
<대조군>
아무것도 처리하지 않은 동물모델(8주령의 암컷 BALB/c 마우스)(실험방법 중 1)의 방법참조)에 일주일에 2회 총 3주간 PBS(회당 120 ㎍)를 비강을 통해 투여하였다. 투여 21 일째 공시험액(vehicle;PBS) 또는 단백질(dTomato, Hph-1-dTomato, dNP2-dTomato)을 100 ㎍을 비강을 통해 투여하였다.
21일째 투여한 공시험액 또는 단백질의 종류에 따라 dTomato 대조군, Hph-1-d Tomato 대조군, dNP2-dTomato 대조군 또는 PBS 대조군으로 나누어 표기하였다.
<실험군>
동물모델의 폐에 만성적인 알레르기성 염증을 유도하기 위하여, 8주령의 암컷 BALB/c 마우스에 일주일에 2회 총 3주간 GCE(회당 120 ㎍)를 비강을 통해 투여하였다(실험방법 중 3)의 방법참조). 투여 21 일째 공시험액(vehicle;PBS) 또는 단백질(dTomato, Hph-1-dTomato, dNP2-dTomato)을 100 ㎍을 비강을 통해 투여하였다.
21일째 투여한 공시험액 또는 단백질의 종류에 따라 dTomato 실험군, Hph-1-d Tomato 실험군, dNP2-dTomato 실험군 또는 PBS 실험군으로 나누어 표기하였다.
2) 결과
실험이 종료된 시점에서 15 분 후, 각 동물들에 1 ㎖ PBS를 2 차례 주입하여 기관지 및 폐 세척액(Bronchoalveolar lavage fluid; BALF)을 수득하였고, 안락사한 후, 폐 조직을 수거하고, PBS로 세척한 다음, 4% 파라포름알데히드로 고정하였다. 모든 수거된 조직들은 O.C.T. 화합물(WAKO Chemical)을 사용하여 동결시켰다. 동결된 블럭들을 크라이오스탯(Thermo Scientific)을 사용하여 8 μm 두께의 박편들로 절단하였다.
도 2는 실험예 1을 통해 제조된 각 대조군과 실험군으로부터 동결된 폐 조직절편(8 ㎛)을 제조한 후, Hpechst를 사용하여 세포 핵을 염색한 다음 형광 마이크로스코피를 통해서 관찰한 결과이다.
도 2에 나타난 바와 같이 각각의 동물모델(sham mouse, GCE 유발 알레르기성 천식 동물모델)에 21일째 공시험액 또는 단백질을 투여한 후, 15 분이 지난다음, 각각의 동물모델 폐 조직에서의 단백질 신호를 관찰한 결과, 기도 상피(airway epithelium)와 일부 상주 세포(some resident cell)에서 dNP2-dTomato가 확인되었다. 그런데 Hph-1-dTomato 대조군과 dTomato 대조군의 동물의 폐에서는 PBS 대조과 유사한 정도의 수준만이 관찰되었으므로, 아무것도 처리하지 않은 동물모델(sham mouse)에서는 dNP2 펩타이드의 단백질 전달효율이 가장 우수하다는 것을 알 수 있다.
각 실험군의 비교 결과는 앞선 각 대조군의 비교 결과와 거의 유사한 경향을 나타내었다. 다만 염증성 폐 상주세포에서 dTomato 실험군, Hph-1-d Tomato 실험군 및 PBS 실험군에 비해 dNP2-dTomato 실험군이 가장 밝은 신호를 나타내고 있음을 확인하였다.
예상한 바와 같이 dNP2 펩타이드는 PBS를 장기적으로 투여한 sham mouse와 GCE 유발 알레르기성 천식 동물모델 모두에서 폐 상주세포에 대해 우수한 단백질 전달효율을 나타내고 있음을 확인하였다.
도 3은 실험예 1을 통해 제조된 각 대조군과 실험군의 기관지 및 폐 세척액에서 세포내 형광신호를 유세포분석을 통해 분석하였다. 적색형광의 히스토그램과 평균 형광강도(mean fluorescence intensities;MFI)를 도시하였다.
도 3에 도시한 바와 같이, 각 동물에서 기관지 및 폐 세척액(BALF)을 회수하고, 이를 유세포분석법을 통해 분석한 결과, dNP2-dTomato 실험군과 대조군에서의 평균 형광강도(MFI)는 Hph-1-dTomato 실험군 및 대조군보다 10 배 이상 높은 것을 확인하였다. 동물의 비강 투여경로에 있어서, Hph-1 펩타이드에 비해 dNP2 펩타이드가 동물 내에서 폐 세포로 현저히 우수한 단백질 전달 효율을 갖는다는 것을 알 수 있다.
<실험예 2> GCE 유발 알레르기성 천식 동물모델에서 dNP2-ctCTLA-4 융합단백질의 치료효과 분석
1) 실험설계
다음으로, GCE에 의해 유도된 만성적인 알레르기성 천식 동물모델(실험방법 중 3) 방법 참조)에서 본 발명에 따른 융합단백질(dNP2-ctCTLA-4)의 치료효과를 확인하기 위하여, 아래와 같이 실험을 설계하였다. 구체적인 실험조건은 도 4에 나타내었다.
상기 실험방법 중에서 1)의 방법으로 사육된 마우스를 사용하였다. 구체적으로, PBS(Sham) 또는 상기 실험방법 중에서 2)의 방법으로 제조된 120 ㎍ GCE를, 8 주령의 BALB/c 마우스의 비강 내로 일주일에 2회 총 3 주간 투여하였다. 마우스에 GCE를 투여할 때마다 10 ㎍의 dNP2-ctCTLA-4(실시예 1), dNP2-EGFP(비교예 3), CTLA4-Ig(비교예 2) 또는 공시험액(vehicle;PBS)를 마우스의 비강 내로 병용 처리하였다. 21 일째에, 마우스를 마취시키고 메타 콜린(MeCh)에 대한 과민반응을 측정(실험방법 중에서 4) 방법 참고)하였다.
<대조군>
실험방법 중에서 1)의 방법으로 사육된 8주령의 암컷 BALB/c 마우스)에 일주일에 2회 총 3주간 PBS(회당 120 ㎍)를 비강을 통해 투여하였다. 마우스에 PBS를 투여할 때마다 10 ㎍의 공시험액(vehicle;PBS)을 마우스의 비강 내로 병용 처리하였다. sham 대조군으로 표기하였다.
<실험군>
상기 실험방법 중에서 1)의 방법으로 사육된 마우스를 사용하였다. 구체적으로, 상기 실험방법 중에서 2)의 방법으로 제조된 120 ㎍ GCE를, 8 주령의 BALB/c 마우스의 비강 내로 일주일에 2회 총 3 주간 투여하였다. 마우스에 GCE를 투여할 때마다 10 ㎍의 dNP2-ctCTLA-4(실시예 2), dNP2-EGFP(비교예 3) 또는 공시험액(vehicle;PBS)을 마우스의 비강 내로 병용 처리하였다.
이때, 투여한 단백질 또는 공시험액에 따라 dNP2-ctCTLA-4 실험군, dNP2-EGFP 실험군, PBS 실험군으로 나누어 표기하였다.
2) 결과
실험이 종료된 21 일째에, 각 동물들을 마취시키고 메타 콜린(MeCh)에 대한 과민반응을 측정(실험방법 중에서 4) 방법 참고)하였다.
도 5 및 도 6은 실험예 2의 각 실험군 및 대조군에 대한 메타콜린에 대한 과민반응(Airway hyper-responsiveness ; AHR) 분석 결과로, 도 5는 메타콜린 농도에 따른 실험예 2의 각 실험군과 대조군의 기도 저항성(airway resistance)을 측정하여 나타낸 것이고. 도 6은 메타콜린 농도에 따른 실험예 2의 각 실험군과 대조군의 기도 탄성도(airway elastance)을 측정하여 나타낸 것이다. 각 군당 n=5이고, 결과는 ± s.e.m(standard error of mean;표준평균오차)으로 나타내었다. **p<0.01, ***p<0.001
도 5 및 도 6에 나타난 바와 같이, PBS 실험군과 dNP2-EGFP 실험군에서 기도 저항성(airway resistance)과 기도 탄성도(airway elastance)가 크게 증가한 것을 확인하였다. 상기 기도 저항성과 기도 탄성도는 감소된 기도 공간에 의한 기도 과민반응정도를 나타내는 것으로, 10 ㎍ 씩 dNP2-ctCTLA-4 처리된 dNP2-ctCTLA-4 실험군에서는 기도 과민반응성이 현저히 감소되었으며, GCE의 다중 노출에 의해 야기된 기도 민감성이 dNP2-ctCTLA-4의 비강 내 투여를 통해 현저히 완화되고 있음을 알 수 있다. 즉 dNP2-ctCTLA-4는 GCE 유발 알레르기성 천식에 대하여 치료 또는 예방효과를 가지고 있음을 확인하였다.
<실험예 3> GCE 유발 알레르기성 천식 동물모델에서 dNP2-ctCTLA-4 융합단백질의 기도 염증 및 개선효과
병태생리학(pathophysiology)측면에서 dNP2-ctCTLA-4 융합단백질이 GCE 유발 알레르기성 천식 동물모델의 폐에서 억제 효과를 나타내는지 평가하고자, 실험예 2에서의 각 실험군 및 대조군의 폐 조직을 관찰하였다. 폐 조직 관찰과정은 상기 실험방법 중에서 7) 방법을 따라 수행하였다.
도 7은 실험예 3의 각 실험군 및 대조군에 대한 폐 조직 관찰 결과로, 실험예 3에서의 각 실험군 및 대조군의 폐 조직을 PAS로 염색하여 촬영한 사진이다. 이때 적색 영역은 점액분비 배상세포(mucus-secreting goblet cell)이다. 도 8은 도 7에서의 점액분비 배상세포(mucus-secreting goblet cell)의 수를 ImageJ 1.50i software를 사용하여 분석한 결과이다.
도 7 및 도 8에 나타난 바와 같이, GCE를 비강을 통해 투여한 경우, 혈관 주위에 침윤된 단핵세포(mononuclear cell)와 기도 상피조직(airway epithelium)에서 배상세포(goblet cell)의 상피화(metaplasia)가 현저하게 증가되는 것을 확인할 수 있었다. 그런데 동물모델의 비강을 통해 본 발명에 따른 dNP2-ctCTLA-4 융합단백질을 투여할 경우, 폐에서 염증세포와 배상세포의 수를 유의하게 감소시키는 것을 확인하였다.
도 9는 실험예 3의 각 실험군 및 대조군에 대한 폐 조직 관찰 결과로, 실험예 3에서의 각 실험군 및 대조군의 폐 조직을 메이슨 트리크롬 염색(Masson's trichrome stain)으로 염색하여 촬영한 사진이다. 이때 청색 영역은 콜라겐 증착(collagen deposition)과 섬유증(fibrosis)이다.
도 10은 도 9에서의 섬유증 영역을 ImageJ 1.50i software를 사용하여 분석한 결과이다. 각 그룹(n=5)에서 대표 결과이다. 결과는 ± s.e.m(standard error of mean;표준평균오차)으로 나타내었다. ***p<0.001
도 9 및 도 10에서는 상기 각 실험군 및 대조군을 메이슨 트리크롬 염색(Masson's trichrome stain)으로 염색하여, 섬유증 영역(fibrotic area)을 측정하였는데, 실험군(PBS 실험군)이 대조군(sham)에 비해 폐에서 기관지 주변부의 섬유화(peribronchial fibrosis)가 다량 발생한 것을 알 수 있다. 그런데 dNP2-ctCTLA-4 융합단백질이 비강을 통해 투여된 dNP2-ctCTLA-4 실험군은 기관지 주변의 섬유화 부위가 유의하게 감소되었음을 확인하였다.
상술한 결과들을 통해, 본 발명에 따른 dNP2-ctCTLA-4 융합단백질은 비강 내 투여를 통해 기도 염증을 비롯하여 섬유화 진행을 현저히 개선하고 있음을 확인할 수 있다.
<실험예 4> GCE 유발 알레르기성 천식 동물모델에서 dNP2-ctCTLA-4 융합단백질의 호산구 침윤 및 Th2 사이토 카인 생성 억제 효과
1) 실험설계
실험예 2와 같은 실험조건을 설계하고, 상기 실험예 2의 각 실험군과 대조군으로부터 기관지 및 폐 세척액을 얻어 호산구 침윤 및 Th2 사이토 카인 생성 억제 효과를 확인하였다. 구체적인 실험설계는 아래와 같다.
<대조군>
실험방법 중에서 1)의 방법으로 사육된 8주령의 암컷 BALB/c 마우스)에 일주일에 2회 총 3주간 PBS(회당 120 ㎍)를 비강을 통해 투여하였다. 마우스에 PBS를 투여할 때마다 10 ㎍의 공시험액(vehicle;PBS)을 마우스의 비강 내로 병용 처리하였다. sham 대조군으로 표기하였다.
<실험군>
상기 실험방법 중에서 1)의 방법으로 사육된 마우스를 사용하였다. 구체적으로, 상기 실험방법 중에서 2)의 방법으로 제조된 120 ㎍ GCE를, 8 주령의 BALB/c 마우스의 비강 내로 일주일에 2회 총 3 주간 투여하였다. 마우스에 GCE를 투여할 때마다 10 ㎍의 dNP2-ctCTLA-4(실시예 2), dNP2-EGFP(비교예 3) 또는 공시험액(vehicle;PBS)을 마우스의 비강 내로 병용 처리하였다.
이때, 투여한 단백질 또는 공시험액에 따라 dNP2-ctCTLA-4 실험군, dNP2-EGFP 실험군, PBS 실험군으로 나누어 표기하였다.
2) 결과
실험이 종료된 시점에서 15 분 후, 각 동물들에 1 ㎖ PBS를 2 차례 주입하여 기관지 및 폐 세척액(Bronchoalveolar lavage fluid; BALF)을 수득하였다(실험방법 중 5) 방법 참고).
도 11은 실험예 4에서 각 실험군 및 대조군으로부터 회수한 기관지 및 폐 세척액을 슬라이드 상에 cytocentrifugation한 후, Hemacolor staining kit을 사용하여 염색한 다음 총 세포수를 계산하여 나타낸 그래프(a), 대식세포의 수를 계산하여 나타낸 그래프(b) 및 호산구(eosinophils)의 수를 계산하여 나타낸 그래프(c)이다.
도 11에 나타난 바와 같이, 대조군(sham)에 비하여 GCE를 투여한 PBS 실험군이 기관지 및 폐 세척액(BAL)에서 총 세포수(도 11a), 대식세포 (도 11b) 및 호산구(도 11c)의 수가 증가하는 것을 확인할 수 있었다.
이와 대조적으로 GCE 유발 알레르기성 천식 동물모델에 GCE와 같이 비강을 통해 dNP2-ctCTLA-4 융합단백질을 투여한 dNP2-ctCTLA-4 실험군은 기관지 및 폐 세척액(BAL)에서 총 세포수(도 11a), 대식세포 (도 11b) 및 호산구(도 11c)의 수가 3 배 이상 감소하였음을 확인할 수 있다. 따라서 본 발명에 따른 dNP2-ctCTLA-4 융합단백질의 처리에 의해, GCE 유발 알레르기성 천식 동물모델에 대하여 치료효과 및 예방효과를 나타내고 있음을 확인할 수 있다.
도 12는 ELISA 키트를 사용하여 기관지 및 폐 세척액(BAL)의 상등액에서 IL-5, IL-13 및 IFN-γ의 발현 정도를 분석하여 나타낸 그래프(도 12의 상단)와 ELISA 키트를 사용하여 동결된 폐 조직에서 IL-5, IL-13, IL-4 및 IFN-γ의 발현 정도를 분석하여 나타낸 그래프(도 12의 하단)이다. IL-5, IL-13, IL-4 및 IFN-γ의 농도를 ELSISA 키트를 통해 분석하였고 상기 수치는 조직의 총 단백질 농도에 대해 정규화(normalized)한 것이다. 상기 단백질 농도는 bradford assay에 의해 정량화하였다. 각 군은 n=5이고, 결과는 ± s.e.m(standard error of mean;표준평균오차)으로 나타내었다. *p<0.05, **p<0.01.
본 실험에서는 각 실험군과 대조군에서 기관지 및 폐 세척액(BAL)과 폐 조직을 회수하고, 이들 각각의 시료에서 IL-13, IL-4 및 Th2 사이토카인의 발현수준을 비교하고자 하였다.
도 12에 나타난 바와 같이 대조군(sham)에 비하여 GCE를 투여한 PBS 실험군이 기관지 및 폐 세척액(BAL)과 폐 조직(lung)에서 IL-5, IL-13, IL-4 및 IFN-γ의 발현이 크게 증가한 것을 확인하였다.
다만 본 발명에 따른 dNP2-ctCTLA-4 융합단백질을 처리한 dNP2-ctCTLA-4 실험군에서는 기관지 및 폐 세척액(BAL)과 폐 조직에서 모두 IL-5, IL-13, IL-4 및 IFN-γ의 발현 정도가 3 배, 2배이상 감소하였음을 확인할 수 있다. 여기서 IL-5은 호산구 활성화에 중요한 사이토카인으로, 본 발명에 따른 dNP2-ctCTLA-4 융합단백질이 호산구 활성화를 억제하고 있음을 알 수 있다.
.또한 dNP2-ctCTLA-4 융합단백질을 처리한 dNP2-ctCTLA-4 실험군에서 IFN-γ 수치가 감소되는 것을 확인할 수 있는데, 이는 dNP2-ctCTLA-4의 비강 내 투여가 호산구의 증착과 사이토카인 발현과 관련된 Th2 염증을 현저하게 감소시킨다는 것을 의미한다.
<실험예 5> GCE 유발 알레르기성 천식 동물모델에서 dNP2-ctCTLA-4 융합단백질의 기도염증 억제 효과
1) 실험설계
아바타셉트(abatacept)는 CTLA-4의 세포외 도메인과 면역 글로불린의 Fc 부위(CTLA4-Ig)로 구성된 재조합 단백질로, 현재 가장 널리 알려진 면역조절약물이다. CTLA4-Ig를 전신에 투여할 경우, GCE 유발 알레르기성 천식 동물모델에서 T 세포 활성화와 기도염증(airway inflammation)을 억제 할 수있다고 알려져 있다.
그러나 본 발명에 따른 dNP2-ctCTLA-4 융합단백질은 비강 내 투여경로를 통해, 현저히 우수한 폐 세포 투과성과 기도 염증 치료, 예방 효과를 달성할 수 있는데 반해, CTLA4-Ig는 낮은 조직 침투 효율로 인하여 비강 내 투여경로로 주입될 경우 기도 염증을 억제 할 수 없었다. 이를 다음 실험을 통해 확인하였다. 실험조건은 도 13에 구체적으로 도시하였다.
<대조군>
실험방법 중에서 1)의 방법으로 사육된 8주령의 암컷 BALB/c 마우스)에 일주일에 2회 총 3주간 PBS(회당 120 ㎍)를 비강을 통해 투여하였다. 마우스에 PBS를 투여할 때마다 10 ㎍의 공시험액(vehicle;PBS)을 마우스의 비강 내로 병용 처리하였다. sham 대조군으로 표기하였다.
<실험군>
상기 실험방법 중에서 1)의 방법으로 사육된 마우스를 사용하였다. 구체적으로, 상기 실험방법 중에서 2)의 방법으로 제조된 120 ㎍ GCE를, 8 주령의 BALB/c 마우스의 비강 내로 일주일에 2회 총 3 주간 투여하였다. 마우스에 GCE를 투여할 때마다 10 ㎍의 dNP2-ctCTLA-4(실시예 2), CTLA4-lg(비교예 4) 또는 공시험액(vehicle;PBS)을 마우스의 비강 내로 병용 처리하였다.
이때, 투여한 단백질 또는 공시험액에 따라 dNP2-ctCTLA-4 실험군, CTLA4-lg 실험군, PBS 실험군으로 나누어 표기하였다.
2) 결과
실험이 종료된 시점에서 15 분 후, 각 동물들에 1 ㎖ PBS를 2 차례 주입하여 기관지 및 폐 세척액(Bronchoalveolar lavage fluid; BALF)을 수득하였다(실험방법 중 5) 방법 참고).
도 14는 ELISA 키트를 사용하여 기관지 및 폐 세척액(BAL)의 상등액에서 IL-13 및 IFN-γ의 발현 정도를 분석하여 나타낸 그래프(도 14의 상단)와 ELISA 키트를 사용하여 동결된 폐 조직에서 IL-13, IL-4 및 IFN-γ의 발현 정도를 분석하여 나타낸 그래프(도 14의 하단)이다. IL-5, IL-13, IL-4 및 IFN-γ의 농도를 ELSISA 키트를 통해 분석하였고 상기 수치는 조직의 총 단백질 농도에 대해 정규화(normalized)한 것이다. 상기 단백질 농도는 bradford assay에 의해 정량화하였다. 각 군은 n=5이고, 결과는 ± s.e.m(standard error of mean;표준평균오차)으로 나타내었다. *p<0.05, **p<0.01.
도 14에 나타난 바와 같이 기관지 및 폐 세척액(BAL) 및 폐 조직(lung)에서 Th2 사이토카인 및 IFN-γ 수준을 측정한 결과, 본 발명에 따른 dNP2-ctCTLA-4 융합단백질을 비강을 통해 투여한 dNP2-ctCTLA-4 실험군은 기관지 및 폐 세척액(BAL) 및 폐 조직(lung)에서 IL-13과 IFN-γ의 양이 현저히 감소되는 것을 확인할 수 있다. 그러나, CTLA4-Ig를 비강을 통해 투여한 CTLA4-Ig 실험군은 사이토카인 생성이 대조군(sham)에 비해 3 배이상 높게 측정되었고, 이는 CTLA4-Ig이 비강을 통해 투여될 경우 효과적으로 기도 염증을 억제하지 못한다는 것을 알 수 있다.
도 15는 실험예 5에서의 각 실험군과 대조군으로부터 회수한 폐 조직을 H&E(hematoxylin eosin)으로 염색하고, 이를 현미경을 통해 촬영한 사진이다. 상기 도면은 각 그룹(n=5)을 대표하는 사진이다. 도 16은 도 15에서의 기도 상피세포(epithelium) 두께를 ImageJ 1.50i software를 사용하여 측정하여 나타낸 그래프이다. 결과는 ± s.e.m(standard error of mean;표준평균오차)으로 나타내었다. *p<0.05, **p<0.01.
각 실험군과 대조군으로부터 얻은 폐 조직을 hematoxylin eosin(H&E)으로 염색한 도 15 및 도 16을 살펴보면 dNP2-ctCTLA-4를 비강을 통해 투여한 dNP2-ctCTLA-4 실험군은 기도 상피세포의 생리학적 특징이 개선되고 있음을 확인할 수 있는데 반해, CTLA4-Ig 실험군은 상피세포와 세포침윤(cell infiltration)이 억제되지 않고, 두꺼워(thickening)지고 있음을 확인할 수 있다. 이러한 결과를 통해 GCE 유발 알레르기성 천식 동물모델에 서 비강으로 투여되는 본 발명에 따른 dNP2-ctCTLA-4 융합단백질은 종래 CTLA4-Ig보다 약리효과가 2~3 배이상 현저히 우수함을 확인할 수 있다.
<실험예 6> GCE 유발 알레르기성 천식 동물모델에서 dNP2-ctCTLA-4 융합단백질의 Th2 세포 분화를 억제 효과
GCE 유발 알레르기성 천식 동물모델에서 dNP2-ctCTLA-4 융합단백질이 Th2 세포의 분화를 직접 억제할 수 있는지 여부를 확인하고자 하였다. 구체적인 분석 방법은 실험방법 중에서 8) 방법으로 수행하였다.
8 주령의 BALB/c 마우스로부터 분리한 MACS-sorted CD4+ CD62LhiCD44- 미성숙 CD4 T 세포를 이용하였고, anti-CD3/CD28 항체로 6 일간 활성화하는 동안 IL-4를 첨가하여 Th2 세포로 분화시켰다.
도 17은 non-activated, +PBS, +dNP2-EGFP, +dNP2-ctCTLA-4에 의한 Th2 세포의 분화를 분석한 그래프이다. 도 18은 CD4+IL-4+ 분화된 Th2 세포에서 생산된 사이토카인의 퍼센트(%)를 계산하여 나타낸 그래프이다. 결과는 ± s.e.m(standard error of mean;표준평균오차)으로 나타내었다(n=3). **p<0.01. NA(non-activated)는 음성 대조군으로, 사이코카인와 anti-TcR 항체 그 어떤 것으로도 자극하지 않은 그룹이다.
도 17, 18에 나타난 바와 같이, Th2 세포는 유세포분석을 통해 IL-4와 IL-13를 생산하는 것으로 분석되었다. 분화된 Th2 세포는 IL-4(및/또는 IL-13)을 생성하는 CD4 T 세포가 대부분 차지하고 있는데 반해, dNP2-ctCTLA-4 실험군은 사이토카인 생성이 상당히 감소되어, Th2 세포의 분화가 dNP2-ctCTLA-4에 의해 억제됨을 확인할 수 있다. 이러한 결과를 통해 본 발명에 따른 dNP2-ctCTLA-4 융합단백질은 비강 투여를 통해, 직접적으로 Th2 세포의 분화를 억제하고 있음을 확인할 수 있고, 이를 통해 GCE에 의해 유도된 동물모델의 폐에서 Th2 염증을 억제하는 효과를 나타내고 있음을 알 수 있다.
본 발명의 세포투과성 펩타이드와 ctCTLA4 펩타이드가 융합된 융합단백질은 종래 염증성 호흡기 질환 특히 알레르기성 천식 치료제에 비하여 현저하게 우수한 기관지 및 폐 세포 투과, 전달효율을 가지면서, 현저히 향상된 사이토카인 발현 억제, 기도 염증 억제 및, 알레르겐에 대한 기도의 과민반응 완화, Th2 염증 완화 등의 활성을 나타내므로, 신속하고 빠르며 효율적인 치료 또는 예방 효과를 얻을 수 있다.

Claims (8)

  1. 하기 서열번호 1로 이루어진 세포투과성 펩타이드와 하기 서열번호 2로 이루어진 ctCTLA4 펩타이드가 융합된 융합단백질을 유효성분으로 하는 염증성 호흡기 질환 예방 또는 치료용 약학 조성물.
    [서열번호 1]
    KIKKVKKKGRKGSKIKKVKKKGRK
    [서열번호 2]
    KMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
  2. 제1항에 있어서,
    상기 약학 조성물은 비강 경로를 통해 기도 내, 기관지 내 또는 폐 내에 투여되는 것을 특징으로 하는 약학 조성물.
  3. 제1항에 있어서,
    상기 약학 조성물은 분무액 또는 분말형을 흡입함으로써 투여되는 것을 특징으로 하는 약학 조성물.
  4. 제1항에 있어서,
    상기 약학 조성물은 코 점막 또는 기관지 점막 또는 폐 상피세포 투과활성을 갖는 것을 특징으로 하는 약학 조성물.
  5. 제1항에 있어서,
    상기 염증성 호흡기 질환은 천식, 만성 폐쇄성 폐질환(COPD), 급성 폐손상(acute lung injury), 농흉, 폐농양, 폐렴, 폐결핵, 기침, 가래, 기관지염, 인후염, 편도염, 부비동염, 비염, 폐쇄성 세기관지염 및 후두염으로 구성된 군에서 선택되는 어느 하나인 것을 특징으로 하는 약학 조성물.
  6. 제5항에 있어서,
    상기 천식은 집먼지 진드기, 꽃가루, 동물 털이나 비듬, 바퀴벌레, 식품, 약물, 감기, 담배연기와 실내오염, 대기오염, 식품첨가제, 운동, 기후 변화, 황사, 스트레스에 기인한 알레르기성 천식임을 특징으로 하는 약학 조성물.
  7. 제5항에 있어서,
    상기 천식은 바퀴벌레에 기인한 알레르기성 천식임을 특징으로 하는 약학 조성물.
  8. 제1항에 따른 약학 조성물을 개체의 비강 경로를 통해 투여하여, 인간을 제외한 동물의 염증성 호흡기 질환을 예방 또는 치료하는 방법.
PCT/KR2018/003622 2017-03-27 2018-03-27 세포투과성 펩타이드와 ctCTLA4 펩타이드가 융합된 융합단백질을 유효성분으로 하는 염증성 호흡기 질환 예방 또는 치료용 약학 조성물 WO2018182301A1 (ko)

Priority Applications (3)

Application Number Priority Date Filing Date Title
CN201880011286.XA CN110366422A (zh) 2017-03-27 2018-03-27 包含其中细胞穿透肽与ctctla4肽融合的融合蛋白作为活性成分的用于预防或治疗炎性呼吸系统疾病的药物组合物
EP18778300.6A EP3603659A4 (en) 2017-03-27 2018-03-27 PHARMACEUTICAL COMPOSITION FOR PREVENTION OR TREATMENT OF INFLAMMATORY RESPIRATORY DISEASE, BASED ON CELL PERMEABLE PEPTIDE FUSION PROTEIN AND CTCTLA4 PEPTIDE, CONTAINED AS ACTIVE INGREDIENT IN THIS COMPOSITION
US16/485,706 US20200023036A1 (en) 2017-03-27 2018-03-27 Pharmaceutical composition for preventing or treating inflammatory respiratory disease containing fusion protein in which cell-penetrating peptide and ctctla4 peptide are fused as active ingredient

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR10-2017-0038612 2017-03-27
KR1020170038612A KR20180109272A (ko) 2017-03-27 2017-03-27 세포투과성 펩타이드와 ctCTLA4 펩타이드가 융합된 융합단백질을 유효성분으로 하는 염증성 호흡기 질환 예방 또는 치료용 약학 조성물

Publications (1)

Publication Number Publication Date
WO2018182301A1 true WO2018182301A1 (ko) 2018-10-04

Family

ID=63676361

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2018/003622 WO2018182301A1 (ko) 2017-03-27 2018-03-27 세포투과성 펩타이드와 ctCTLA4 펩타이드가 융합된 융합단백질을 유효성분으로 하는 염증성 호흡기 질환 예방 또는 치료용 약학 조성물

Country Status (5)

Country Link
US (1) US20200023036A1 (ko)
EP (1) EP3603659A4 (ko)
KR (1) KR20180109272A (ko)
CN (1) CN110366422A (ko)
WO (1) WO2018182301A1 (ko)

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN112587650A (zh) * 2021-01-19 2021-04-02 中日友好医院(中日友好临床医学研究所) 一种短肽及其铜离子螯合物的医药用途

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20080066962A (ko) 2005-10-24 2008-07-17 도만티스 리미티드 호흡기 질병을 치료하기 위한 폐 조직 내의 표적에결합하는 작용제
KR20080084937A (ko) * 2005-11-04 2008-09-22 포휴먼텍(주) 융합 폴리펩타이드를 세포로 전달하는 방법
US20140322183A1 (en) * 2013-03-15 2014-10-30 The Trustees Of The University Of Pennsylvania Targeting cytotoxic cells with chimeric receptors for adoptive immunotherapy
KR20170022943A (ko) * 2015-08-21 2017-03-02 한양대학교 산학협력단 중추신경계 질환에 대한 예방 또는 치료효과를 갖는 펩타이드 및 이를 유효성분으로 하는 중추신경계 질환 예방 및 치료용 약학적 조성물

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2017034244A1 (ko) * 2015-08-21 2017-03-02 한양대학교 산학협력단 중추신경계 질환에 대한 예방 또는 치료효과를 갖는 펩타이드 및 이를 유효성분으로 하는 중추신경계 질환 예방 및 치료용 약학적 조성물

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20080066962A (ko) 2005-10-24 2008-07-17 도만티스 리미티드 호흡기 질병을 치료하기 위한 폐 조직 내의 표적에결합하는 작용제
KR20080084937A (ko) * 2005-11-04 2008-09-22 포휴먼텍(주) 융합 폴리펩타이드를 세포로 전달하는 방법
US20140322183A1 (en) * 2013-03-15 2014-10-30 The Trustees Of The University Of Pennsylvania Targeting cytotoxic cells with chimeric receptors for adoptive immunotherapy
KR20170022943A (ko) * 2015-08-21 2017-03-02 한양대학교 산학협력단 중추신경계 질환에 대한 예방 또는 치료효과를 갖는 펩타이드 및 이를 유효성분으로 하는 중추신경계 질환 예방 및 치료용 약학적 조성물

Non-Patent Citations (5)

* Cited by examiner, † Cited by third party
Title
"Remington's Pharmaceutical Sciences", MACK PUBLISHING COMPANY
LIM, S. ET AL.: "dNP2 Is a Blood-brain Barrier-permeable Peptide Enabling ctCTLA-4 Protein Delivery to Ameliorate Experimental Autoimmune Encephalomyelitis", NATURE COMMUNICATIONS, vol. 6, 15 September 2015 (2015-09-15), pages 1 - 13, XP055368583 *
LIM, S. ET AL.: "dNP2-ctCTLA-4 Inhibits German Cockroach Extract-induced Allergic Airway Inflammation and Hyper-responsiveness via Inhibition of Th2 Responses", EXPERIMENTAL & MOLECULAR MEDICINE, vol. 49, no. 8, 4 August 2017 (2017-08-04), pages e362, XP055559867 *
NIE, W. ET AL.: "Cytotoxic T-lymphocyte Associated Antigen 4 Polymorphisms and Asthma Risk: a Meta-analysis", PLOS ONE, vol. 7, no. 7, 26 July 2012 (2012-07-26), pages e42062, XP055559865 *
See also references of EP3603659A4

Also Published As

Publication number Publication date
EP3603659A4 (en) 2020-11-04
EP3603659A1 (en) 2020-02-05
CN110366422A (zh) 2019-10-22
KR20180109272A (ko) 2018-10-08
US20200023036A1 (en) 2020-01-23

Similar Documents

Publication Publication Date Title
WO2013169077A1 (ko) 악액질 예방 또는 치료용 조성물
EP4143207A1 (en) Vaccine composition for preventing or treating infection of sars-cov-2
WO2018092955A1 (ko) 전복에서 유래한 항균 펩타이드 유사체 및 이를 포함하는 항균용 약학 조성물
WO2013129739A1 (ko) 봉독-ｐｌａ2를 포함하는 이상 조절 ｔ 세포 활성 저하 관련 질환의 치료 또는 예방용 약학적 조성물
WO2012050402A2 (ko) 세포투과성 parkin 재조합 단백질 및 이를 함유하는 퇴행성 뇌질환 치료용 약학적 조성물
WO2021096275A1 (ko) 변형된 인터루킨-7 및 tgf 베타 수용체 ii를 포함하는 융합단백질 및 이의 용도
WO2021251673A1 (ko) 치주질환 또는 탈구성 외상 치아의 예방 또는 치료용 약학 조성물
WO2011052883A2 (ko) Ｓｏｃｓ２ 유전자의 발현을 조절하여 자연 살해 세포를 활성화시키는 방법
WO2018182301A1 (ko) 세포투과성 펩타이드와 ctCTLA4 펩타이드가 융합된 융합단백질을 유효성분으로 하는 염증성 호흡기 질환 예방 또는 치료용 약학 조성물
WO2017034244A1 (ko) 중추신경계 질환에 대한 예방 또는 치료효과를 갖는 펩타이드 및 이를 유효성분으로 하는 중추신경계 질환 예방 및 치료용 약학적 조성물
WO2013176469A1 (ko) 파골세포분화를 억제할 수 있는 항체
WO2021235876A1 (ko) 신규한 폴리펩타이드, 융합 폴리펩타이드, 및 이를 포함하는 그람음성균에 대한 항생제
WO2022005174A1 (ko) 항-lag-3 항체 및 il-2를 포함하는 융합단백질 및 이의 용도
WO2013100718A2 (ko) 라저스트로에미아 오바리폴리아 추출물 또는 이의 분획물을 유효성분으로 포함하는 염증성 질환 또는 천식의 예방 또는 치료용 약학적 조성물
WO2022030730A1 (ko) 메소텔린에 특이적으로 결합하는 항-메소텔린 키메릭 항원 수용체
WO2020226438A1 (ko) 염증성 장질환의 예방 또는 치료용 펩타이드
WO2016027990A1 (ko) Ｄｕｓｐ５를 유효성분으로 모두 포함하는 골대사성 질환의 예방 또는 치료용 약학적 조성물
WO2022119380A1 (ko) 신규한 ace2 변이체 및 그의 이용
WO2020032324A1 (ko) 폐렴구균의 독소-항독소 체계를 표적으로 하는 항생 펩타이드 및 이의 용도
KR20200033828A (ko) 세포투과성 펩타이드와 ctCTLA4 펩타이드가 융합된 융합단백질을 유효성분으로 하는 염증성 호흡기 질환 예방 또는 치료용 약학 조성물
WO2021107635A1 (ko) Il-2 단백질 및 cd80 단백질을 포함하는 융합단백질 및 nk 세포를 포함하는 항암 치료용 조성물
WO2022050520A1 (ko) 코로나바이러스 유래 수용체 결합 도메인 및 뉴클레오캡시드 단백질을 포함하는 융합단백질 및 이의 용도
WO2019151771A1 (ko) Pd-l1 결합력이 증대된 pd-1 변이체
WO2023075421A1 (ko) 수지상 세포를 표적하는 신규한 펩타이드, 및 이를 포함하는 암 치료용 조성물
WO2023239213A1 (ko) 염증세포에서 특이적으로 작동하는 융합단백질

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 18778300

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2018778300

Country of ref document: EP

Effective date: 20191028