WO2021235876A1 - 신규한 폴리펩타이드, 융합 폴리펩타이드, 및 이를 포함하는 그람음성균에 대한 항생제 - Google Patents

신규한 폴리펩타이드, 융합 폴리펩타이드, 및 이를 포함하는 그람음성균에 대한 항생제 Download PDF

Info

Publication number
WO2021235876A1
WO2021235876A1 PCT/KR2021/006302 KR2021006302W WO2021235876A1 WO 2021235876 A1 WO2021235876 A1 WO 2021235876A1 KR 2021006302 W KR2021006302 W KR 2021006302W WO 2021235876 A1 WO2021235876 A1 WO 2021235876A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
bacteria
polypeptide
genus
antibiotic
Prior art date
Application number
PCT/KR2021/006302
Other languages
English (en)
French (fr)
Inventor
명희준
김민수
홍혜원
편지원
장재연
Original Assignee
주식회사 라이센텍
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from KR1020200061906A external-priority patent/KR102224897B1/ko
Priority claimed from KR1020200108498A external-priority patent/KR102228999B1/ko
Priority claimed from KR1020210019108A external-priority patent/KR102286544B1/ko
Application filed by 주식회사 라이센텍 filed Critical 주식회사 라이센텍
Priority to EP21809334.2A priority Critical patent/EP4074831A4/en
Priority to JP2022570284A priority patent/JP2023526388A/ja
Priority to CN202180018132.5A priority patent/CN115397994B/zh
Priority to CA3184447A priority patent/CA3184447A1/en
Publication of WO2021235876A1 publication Critical patent/WO2021235876A1/ko
Priority to US17/853,027 priority patent/US11807881B2/en

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14—Hydrolases (3)
    • C12N9/24—Hydrolases (3) acting on glycosyl compounds (3.2)
    • C12N9/2402—Hydrolases (3) acting on glycosyl compounds (3.2) hydrolysing O- and S- glycosyl compounds (3.2.1)
    • C12N9/2462—Lysozyme (3.2.1.17)
    • A—HUMAN NECESSITIES
    • A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01N—PRESERVATION OF BODIES OF HUMANS OR ANIMALS OR PLANTS OR PARTS THEREOF; BIOCIDES, e.g. AS DISINFECTANTS, AS PESTICIDES OR AS HERBICIDES; PEST REPELLANTS OR ATTRACTANTS; PLANT GROWTH REGULATORS
    • A01N65/00—Biocides, pest repellants or attractants, or plant growth regulators containing material from algae, lichens, bryophyta, multi-cellular fungi or plants, or extracts thereof
    • A01N65/40—Liliopsida [monocotyledons]
    • A—HUMAN NECESSITIES
    • A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01P—BIOCIDAL, PEST REPELLANT, PEST ATTRACTANT OR PLANT GROWTH REGULATORY ACTIVITY OF CHEMICAL COMPOUNDS OR PREPARATIONS
    • A01P1/00—Disinfectants; Antimicrobial compounds or mixtures thereof
    • A—HUMAN NECESSITIES
    • A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23K—FODDER
    • A23K20/00—Accessory food factors for animal feeding-stuffs
    • A23K20/10—Organic substances
    • A23K20/195—Antibiotics
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00—Medicinal preparations containing organic active ingredients
    • A61K31/70—Carbohydrates; Sugars; Derivatives thereof
    • A61K31/7088—Compounds having three or more nucleosides or nucleotides
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/04—Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
    • A61K38/12—Cyclic peptides, e.g. bacitracins; Polymyxins; Gramicidins S, C; Tyrocidins A, B or C
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/43—Enzymes; Proenzymes; Derivatives thereof
    • A61K38/46—Hydrolases (3)
    • A61K38/47—Hydrolases (3) acting on glycosyl compounds (3.2), e.g. cellulases, lactases
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04—Antibacterial agents
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/43504—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates
    • C07K14/43563—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates from insects
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/62—DNA sequences coding for fusion proteins
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N7/00—Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14—Hydrolases (3)
    • C12N9/24—Hydrolases (3) acting on glycosyl compounds (3.2)
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12Y—ENZYMES
    • C12Y302/00—Hydrolases acting on glycosyl compounds, i.e. glycosylases (3.2)
    • C12Y302/01—Glycosidases, i.e. enzymes hydrolysing O- and S-glycosyl compounds (3.2.1)
    • C12Y302/01017—Lysozyme (3.2.1.17)
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12R—INDEXING SCHEME ASSOCIATED WITH SUBCLASSES C12C - C12Q, RELATING TO MICROORGANISMS
    • C12R2001/00—Microorganisms ; Processes using microorganisms
    • C12R2001/01—Bacteria or Actinomycetales ; using bacteria or Actinomycetales
    • C12R2001/38—Pseudomonas
    • Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Definitions

  • novel polypeptides derived from a bacteriophage, a fusion polypeptide comprising the polypeptide and cecropin A, and an antibiotic against Gram-negative bacteria comprising the polypeptide and/or the fusion protein are provided.
  • Bacteriophage refers to a bacterium-specific virus that infects a specific bacterium and inhibits and inhibits the growth of the infected bacterium. Bacteriophages proliferate inside bacterial cells after infection with their host bacteria, and when progeny bacteriophages come out of the bacteria after proliferation, they use endolysin, a protein of the bacteriophage, to destroy the cell wall of the host bacteria. has the ability to destroy Therefore, a substance having an endolysin activity of a bacteriophage can be usefully applied as an antibiotic candidate.
  • the polypeptide may include the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO: 6.
  • the polypeptide may be derived from a bacteriophage or a variant thereof.
  • the polypeptide may have endolysin activity.
  • polynucleotide encoding the polypeptide.
  • the polynucleotide may include the nucleic acid sequence of SEQ ID NO: 2 or SEQ ID NO: 7.
  • Another example provides a recombinant vector comprising the polynucleotide.
  • the recombinant vector may be used as an expression vector.
  • Another example provides a recombinant cell comprising the polynucleotide or a recombinant vector comprising the same.
  • the recombinant cell may be for expression of the polynucleotide.
  • Another example provides a bacteriophage comprising the polypeptide of SEQ ID NO: 1, a polynucleotide encoding the same (eg, SEQ ID NO: 2), or a combination thereof.
  • the genome of the bacteriophage may include the nucleic acid sequence of SEQ ID NO: 5.
  • the fusion polypeptide may include cecropin A and endolysin.
  • the cecropin A (Cecropin A) may be, for example, represented by the amino acid sequence of SEQ ID NO: 8.
  • the endolysin may be derived from a bacteriophage or a variant thereof, for example, may be one represented by the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO: 6.
  • the cecropin A e.g., SEQ ID NO: 8
  • endolysin eg, SEQ ID NO: 1 or SEQ ID NO: 6
  • the fusion polypeptide may be represented by the amino acid sequence of SEQ ID NO: 10 or SEQ ID NO: 13.
  • polynucleotide encoding the fusion polypeptide.
  • the polynucleotide may include the nucleic acid sequence of SEQ ID NO: 11 or SEQ ID NO: 14.
  • Another example provides a recombinant vector comprising the polynucleotide.
  • the recombinant vector may be used as an expression vector.
  • Another example provides a recombinant cell comprising the polynucleotide or a recombinant vector comprising the same.
  • the recombinant cell may be for expression of the polynucleotide.
  • Another example is
  • a fusion polypeptide comprising the polypeptide and cecropin A (eg, SEQ ID NO: 10 or SEQ ID NO: 13), or a combination thereof,
  • a recombinant vector comprising the (3) polynucleotide, the (4) polynucleotide, or a combination thereof;
  • a recombinant cell comprising the (3) polynucleotide, the (4) polynucleotide, or a combination thereof, or a recombinant vector comprising the polynucleotide, and
  • Bacteriophage comprising the polypeptide of SEQ ID NO: 1, a polynucleotide encoding it, or a combination thereof
  • the antibiotic may have an antibiotic effect against Gram-negative bacteria.
  • the antibiotic (first antibiotic) provided herein is used in combination with other antibiotics (second antibiotic), thereby having a synergistic effect due to its own antibiotic effect and the advantage of exhibiting excellent antibiotic effects even with a low concentration of the second antibiotic. have Due to this, it is possible to reduce side effects such as toxicity (eg, renal toxicity, liver toxicity, etc.) due to the use of high concentrations of antibiotics. In addition, it is possible to suppress the emergence of antibiotic-resistant bacteria through the combination of antibiotics of different mechanisms.
  • antibiotics eg, polymyxin-based antibiotics such as polymyxin B and/or colistin
  • Another example provides a pharmaceutical composition for preventing and/or treating Pseudomonas bacterium infection or disease caused by Pseudomonas genus bacteria comprising the antibiotic or combination antibiotic as an active ingredient.
  • Another example includes administering a pharmaceutically effective amount of the antibiotic or combination antibiotic to a subject in need of prevention and/or treatment of a disease caused by infection of Pseudomonas bacteria or Pseudomonas bacteria of the genus Pseudomonas.
  • Provided is a method for preventing or treating an infection or a disease caused by Pseudomonas genus bacteria.
  • Another example provides a feed additive comprising the antibiotic or combination antibiotic as an active ingredient.
  • Another example provides a disinfectant comprising the antibiotic or combination antibiotic as an active ingredient.
  • Another example provides a disinfection method comprising the step of applying the antibiotic or combination antibiotic to a subject in need of disinfection.
  • Another example provides a cleaning agent comprising the antibiotic or combination antibiotic as an active ingredient.
  • Another example provides a washing method comprising the step of applying the antibiotic or combination antibiotic to a subject in need of washing.
  • bacteriophages that can be used as a natural antibiotic by proliferating the bacteria into the host penetrates the bacteria and finishes multiplying inside, the completed phage particles are released to the outside of the bacteria.
  • the enzyme that creates the pathway is endolysin. All bacteriophages have this endolysin gene in their genome, and use the endolysin protein expressed during proliferation. Bacteriophages that propagate bacteria as hosts and endolysin derived from bacteriophages having the property of decomposing cell walls can be used as natural antibiotics.
  • cecropin A is a peptide having an antibacterial activity having the action of dissolving the bacterial membrane.
  • a novel polypeptide or a fusion polypeptide in which cecropin A is fused to a novel polypeptide demonstrates superior antibiotic effect than existing endolysin, a polypeptide having endolysin activity, and its antibiotic and / or related uses.
  • a polynucleotide which may be used interchangeably with “gene” or a polypeptide (which may be used interchangeably with “protein”) is “comprising a specific nucleic acid sequence or amino acid sequence” or “to a specific nucleic acid sequence or amino acid sequence” “Consists of” may mean that the polynucleotide or polypeptide essentially contains the specific nucleic acid sequence or amino acid sequence, and in the range that maintains the original function and/or desired function of the polynucleotide or polypeptide. It can be construed as including “substantially equivalent sequences” in which mutations (deletions, substitutions, modifications, and/or additions) have been made to the specific nucleic acid sequence or amino acid sequence (or not excluding the mutation).
  • reference to a polynucleotide or polypeptide “comprising a specific nucleic acid sequence or amino acid sequence” or “consisting of or represented by a specific nucleic acid sequence or amino acid sequence means that the polynucleotide or polypeptide (i) the specific nucleic acid sequence or amino acid sequence comprises essentially a sequence or amino acid sequence, or (ii) at least 96%, at least 96.5%, at least 97%, at least 97.5%, at least 98%, at least 98.5%, at least 99% of the specific nucleic acid sequence or amino acid sequence; 99.5% or more, or 99.9% or more homology (identity) consisting of or essentially comprising an amino acid sequence, and may mean maintaining the original function and / or desired function.
  • the original function is an endolysin enzyme function (eg, peptidoglycan hydrolytic activity), cecropin A activity (eg, cell membrane lytic activity), and/or an antibiotic activity (in the case of an amino acid sequence). ), or an endolysin enzyme function, a cecropin A activity, and/or a function (in the case of a nucleic acid sequence) encoding a protein having an antibiotic action, wherein the desired function is a Gram-negative bacteria, such as a bacterium of the genus Pseudomonas, such as Pseudomonas It may mean antibiotic activity against aeruginosa.
  • endolysin enzyme function eg, peptidoglycan hydrolytic activity
  • cecropin A activity eg, cell membrane lytic activity
  • an antibiotic activity in the case of an amino acid sequence
  • an endolysin enzyme function eg, peptidoglycan hydrolytic activity
  • cecropin A activity eg, cell membrane lytic activity
  • the term “identity” refers to the degree of correspondence with a given nucleic acid sequence or amino acid sequence and may be expressed as a percentage (%).
  • the algorithm BLAST according to the literature (Karlin and Altschul, Pro. Natl. Acad. Sci. USA, 90, 5873, 1993) or FASTA by Pearson (see Methods Enzymol) ., 183, 63, 1990) can be used. Based on such an algorithm BLAST, a program called BLASTN or BLASTX has been developed (refer to http://www.ncbi.nlm.nih.gov).
  • the protein or polypeptide provided herein may be isolated and/or purified from nature, or synthesized recombinantly or chemically.
  • the amino acid sequence of a protein or polypeptide provided herein comprises a methionine (Met, M) or Met-Ala-Ser (MAS) sequence as the first amino acid residue from the N-terminus
  • the protein or polypeptide is recombinant
  • the methionine at the first amino acid position from the N-terminus may be encoded by the start codon. Accordingly, when the amino acid sequence of a protein or polypeptide provided herein contains methionine by recombinant production at the N-terminus, the protein or polypeptide is obtained by other methods (eg, chemically synthesized or isolated from nature).
  • amino acid sequence starting from the second amino acid residue except for methionine at the first N-terminal position or the amino acid sequence starting from the amino acid residue following the MAS sequence (eg, the fourth amino acid residue) can be interpreted as
  • the polypeptide may include the amino acid sequence of SEQ ID NO: 1.
  • the polypeptide may be derived from a bacteriophage.
  • the polypeptide may have an endolysin activity derived from a bacteriophage.
  • the polypeptide may have a molecular weight of about 28 kDa (28 kDa ⁇ 2).
  • the polypeptide may include the amino acid sequence of SEQ ID NO: 6.
  • the polypeptide may be a variant of endolysin derived from bacteriophage, and may have superior endolysin activity and/or antibiotic activity compared to endolysin derived from bacteriophage.
  • the polypeptide may have a molecular weight of about 28 kDa (28 kDa ⁇ 2).
  • the polypeptide may be produced recombinantly or synthetically (eg, chemically synthesized).
  • polynucleotide encoding the polypeptide.
  • the polynucleotide may include the nucleic acid sequence of SEQ ID NO: 2 or SEQ ID NO: 7.
  • Endolysin refers to a peptidoglycan hydrolase encoded by bacteriophages. Endolysin is synthesized during late gene expression in the lytic cycle of bacteriophage proliferation and mediates the release of progeny virions from infected cells through degradation of bacterial peptidoglycan. In terms of enzymatic activity, endolysin is usually glucosaminidase, muramidase (a type of lysozyme), transglycosylase, amidase, endopeptidase ( endopeptidase) and the like may have one or more activities selected from the group consisting of.
  • a polypeptide having endolysin activity as a 'comprising the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO: 6' or 'consisting of the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO: 6' Is,
  • polypeptide consisting of or consisting essentially of the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO: 6, and/or
  • amino acid sequence having homology e.g., having at least 99.3%, at least 99.4%, at least 99.5%, at least 99.6%, at least 99.7%, at least 99.8%, or at least 99.9% homology with the amino acid sequence of SEQ ID NO: 1) Having 96% or more, 96.5% or more, 97% or more, 97.5% or more, 98% or more, 98.5% or more, 99% or more, 99.5% or more, or 99.9% or more homology with the amino acid sequence or the amino acid sequence of SEQ ID NO: 6 amino acid sequence) and having (maintaining) endolysin enzyme function (eg, peptidoglycan hydrolytic activity) and/or antibiotic
  • a polynucleotide encoding a polypeptide 'comprising the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO: 6' or 'consisting of the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO: 6'
  • amino acid sequence having homology e.g., having at least 99.3%, at least 99.4%, at least 99.5%, at least 99.6%, at least 99.7%, at least 99.8%, or at least 99.9% homology with the amino acid sequence of SEQ ID NO: 1) Having 96% or more, 96.5% or more, 97% or more, 97.5% or more, 98% or more, 98.5% or more, 99% or more, 99.5% or more, or 99.9% or more homology with the amino acid sequence or the amino acid sequence of SEQ ID NO: 6 amino acid sequence) and having (maintaining) endolysin enzyme function (e.g., peptidoglycan hydrolytic activity)
  • endolysin enzyme function e.g., peptidoglycan hydrolytic activity
  • nucleic acid sequence having homology eg, a nucleic acid sequence having at least 99.7%, at least 99.8%, or at least 99.9% homology with the nucleic acid sequence of SEQ ID NO: 2 or at least 96%, 96.5% with the nucleic acid sequence of SEQ ID NO: 7) or more, 97% or more, 97.5% or more, 98% or more, 98.5% or more, 99% or more, 99.5% or more, or a nucleic acid sequence having at least 99.9% homology), (eg, peptidoglycan hydrolytic activity) and/or polynucleotide encoding a polypeptide having (maintaining) antibiotic activity against
  • the fusion polypeptide may include cecropin A and endolysin.
  • the cecropin A may be derived from the moth (Hyalophora cecropia ), for example, may be one represented by the amino acid sequence of SEQ ID NO: 8.
  • the endolysin may be derived from a bacteriophage or a variant thereof, for example, may be one represented by the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO: 6.
  • the cecropin A eg, SEQ ID NO: 8
  • endolysin eg, SEQ ID NO: 1 or SEQ ID NO: 6
  • the cecropin A and endolysin may be linked from the N-terminus in the order of cecropin A and endolysin or in the order of endolysin and cecropin A, for example, It may be connected in the order of cecropin A and endolysin.
  • Cecropin A eg, SEQ ID NO: 8
  • endolysin eg, SEQ ID NO: 1 or SEQ ID NO: 6
  • Cecropin A eg, SEQ ID NO: 8
  • endolysin eg, SEQ ID NO: 1 or SEQ ID NO: 6
  • the fusion polypeptide may be represented by the amino acid sequence of SEQ ID NO: 10 or SEQ ID NO: 13.
  • the fusion polypeptide may have superior antibiotic activity and/or superior outer membrane permeabilization activity against Gram-negative bacteria, compared to endolysin or cecropin A.
  • the fusion polypeptide may have a molecular weight of about 34 kDa (eg, 34 kDa ⁇ 3).
  • the fusion polypeptide or endolysin and cecropin A may be recombinantly or synthetically (eg, chemically synthesized).
  • polynucleotide encoding the fusion polypeptide.
  • the polynucleotide may include the nucleic acid sequence of SEQ ID NO: 11 or SEQ ID NO: 14.
  • Endolysin refers to a peptidoglycan hydrolase encoded by bacteriophages. Endolysin is synthesized during late gene expression in the lytic cycle of bacteriophage proliferation and mediates the release of progeny virions from infected cells through degradation of bacterial peptidoglycan.
  • endolysin is usually glucosaminidase, muramidase (a type of lysozyme), transglycosylase, amidase, endopeptidase ( endopeptidase) and the like may have one or more activities selected from the group consisting of.
  • the fusion polypeptide comprises:
  • SEQ ID NO: 8 or the amino acid sequence of SEQ ID NO: 8 and 96% or more, 96.5% or more, 97% or more, 97.5% or more, 98% or more, 98.5% or more, 99% or more, 99.5% or more, or 99.9% or more a polypeptide consisting essentially of or consisting of an amino acid sequence having homology and having (maintaining) cecropin A activity; and
  • An amino acid sequence having at least % homology eg, at least 99.3%, at least 99.4%, at least 99.5%, at least 99.6%, at least 99.7%, at least 99.8%, or at least 99.9% homology with the amino acid sequence of SEQ ID NO: 1) 96% or more, 96.5% or more, 97% or more, 97.5% or more, 98% or more, 98.5% or more, 99% or more, 99.5% or more, or 99.9% or more homology with the amino acid sequence or SEQ ID NO: 6 having a
  • the fusion polypeptide comprises:
  • a polynucleotide encoding a polypeptide comprising the amino acid sequence of SEQ ID NO: 10 is,
  • a polynucleotide comprising the nucleic acid sequence of SEQ ID NO: 11 or SEQ ID NO: 14 is
  • nucleic acid sequence of SEQ ID NO: 11 or SEQ ID NO: 14 A polynucleotide comprising or consisting essentially of a nucleic acid sequence having homology and encoding a polypeptide having (maintaining) antibiotic activity against Gram-negative bacteria
  • cecropin A and endolysin may be linked through a peptide linker or directly linked without a peptide linker.
  • the peptide linker may be a polypeptide consisting of 1 to 100, 2 to 50, 1 to 30, 2 to 20, or 2 to 10 arbitrary amino acids, and the type of amino acids included is not limited.
  • the peptide linker may include, for example, at least one amino acid residue selected from the group consisting of Gly, Ser, Leu, Gin, Asn, Thr and Ala, respectively. Suitable amino acid sequences for peptide linkers are known in the art.
  • the length of the linker may be variously determined within a limit that does not affect the structure and/or function of the fusion protein.
  • the peptide linker may include a total of 1 to 100, 2 to 50, 1 to 30, 2 to 20, or at least one selected from the group consisting of Gly, Ser, Leu, Gin, Asn, Thr and Ala. It may be made by including 2 to 10 pieces.
  • the peptide linker is GSGSGS (SEQ ID NO: 12), (G) 4-10 (eg, GGGGGG, GGGGGGGG, etc.), (GGGGS) 1-5 (eg, (GGGGS)1, etc.), (EAAAK ) 1-5 (eg, (EAAAK) 3 , (EAAAK) 5 , etc.), (EAAAK) 4 (GGGGS) 1 , etc., but is not limited thereto.
  • Another example comprises a polynucleotide encoding a polypeptide as described above (a polypeptide comprising the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO: 6) or a fusion polypeptide as described above (e.g., SEQ ID NO: 10 or SEQ ID NO: 13)
  • Recombinant vectors are provided.
  • the recombinant vector may be used as an expression vector.
  • Another example provides a method for producing the polypeptide or the fusion polypeptide, comprising the step of expressing the polypeptide or the fusion polypeptide in an appropriate host cell.
  • the step of expressing the polypeptide or the fusion polypeptide in an appropriate host cell may be performed by culturing a recombinant cell containing the polynucleotide or a recombinant vector containing the same.
  • the method for producing endolysin may further include, after the step of expressing, isolating and/or purifying the expressed endolysin.
  • transformation refers to introducing a vector including a polynucleotide encoding the polypeptide into a host cell so that the polypeptide encoded by the polynucleotide can be expressed in the host cell.
  • Transformed polynucleotides may include both, whether inserted or located in the chromosome of the host cell or located extrachromosomally, as long as they can be expressed in the host cell. As long as the polynucleotide can be introduced and expressed into a host cell, the form in which it is introduced is not limited.
  • the polynucleotide may be introduced into a host cell in the form of an expression cassette, which is a gene construct including all elements necessary for self-expression.
  • the expression cassette may include expression control elements such as a promoter, a transcription termination signal, a ribosome binding site and/or a translation termination signal, which are operably linked to the polynucleotide in general.
  • the expression cassette may be in the form of an expression vector capable of self-replication.
  • the polynucleotide may be introduced into a host cell in its own form and operably linked to a sequence required for expression in the host cell.
  • operably linked may mean that an expression control element (eg, a promoter) and a polynucleotide are functionally linked to perform transcriptional control (eg, transcription initiation) of the polynucleotide.
  • Operable ligation can be accomplished using genetic recombination techniques known in the art.
  • the method of transforming the polynucleotide into a host cell can be performed by any method of introducing a nucleic acid into a cell (microorganism), and can be performed by appropriately selecting a transformation technique known in the art according to the host cell.
  • the known transformation methods include electroporation, calcium phosphate (CaPO 4 ) precipitation, calcium chloride (CaCl 2 ) precipitation, microinjection, polyethylene glycol-mediated uptake. ), DEAE-dextran method, cationic liposome method, lipofection, lithium acetate-DMSO method and the like may be exemplified, but is not limited thereto.
  • the term "vector” refers to a DNA construct containing a nucleotide sequence of a polynucleotide operably linked to a suitable regulatory sequence so that a target protein can be expressed in a suitable host.
  • the regulatory sequence may include a promoter capable of initiating transcription, an optional operator sequence for regulating transcription, a sequence encoding a suitable mRNA ribosome binding site, and/or a sequence regulating the termination of transcription and/or translation. have.
  • the vector After transformation into an appropriate host cell, the vector may be expressed independently of the genome (genome) of the host cell, or may be integrated into the genome of the host cell.
  • the vector usable in the present specification is not particularly limited as long as it is capable of replication in a host cell, and may be selected from all commonly used vectors.
  • commonly used vectors include natural or recombinant plasmids, cosmids, viruses, bacteriophages, and the like.
  • pWE15, M13, MBL3, MBL4, IXII, ASHII, APII, t10, t11, Charon4A, and Charon21A may be used as a phage vector or a cosmid vector, and pBR-based, pUC as a plasmid vector.
  • pDZ pACYC177, pACYC184, pCL, pECCG117, pUC19, pBR322, pMW118, pCC1BAC vectors and the like may be exemplified, but is not limited thereto.
  • the vector may further include a selection marker for confirming whether or not it is inserted into the chromosome.
  • the selection marker is used to select cells transformed with the vector, that is, to determine whether the polynucleotide is inserted, and selectable phenotypes such as drug resistance, auxotrophicity, resistance to cytotoxic agents or expression of surface proteins It can be selected from among genes that confer In an environment treated with a selective agent, only the cells expressing the selectable marker survive or exhibit other expression traits, so that the transformed cells can be selected.
  • polypeptides provided herein may not be of natural origin, and may be recombinantly or chemically synthesized. When the polypeptide is recombinantly produced, it may be in a form in which a conventional signal peptide, a cleavage site, a tag, etc. are bound for purification. Accordingly, in a non-limiting example, the polypeptide provided herein is a signal peptide, a cleavage site, a tag (eg, His tag, GST (glutathione-s-transferase) tag) that is commonly used in the process of recombinant production of a protein. , MBP (maltose binding protein) tag, etc.) may be in a form further comprising one or more selected from the group consisting of, or a purified form in which these are removed.
  • a tag eg, His tag, GST (glutathione-s-transferase) tag
  • Another example is
  • a fusion polypeptide comprising the polypeptide and cecropin A (eg, SEQ ID NO: 10), or a combination thereof,
  • a recombinant vector comprising the (3) polynucleotide, the (4) polynucleotide, or a combination thereof;
  • a recombinant cell comprising the (3) polynucleotide, the (4) polynucleotide, or a combination thereof, or a recombinant vector comprising the polynucleotide, and
  • Bacteriophage comprising the polypeptide of SEQ ID NO: 1, a polynucleotide encoding it, or a combination thereof
  • the antibiotic may have an antibiotic effect against Gram-negative bacteria.
  • the Gram-negative bacteria is at least one selected from the group consisting of Pseudomonas genus bacteria, Acinetobacter genus bacteria, Escherichia genus bacteria, Enterobacter genus bacteria, Klebsiella genus bacteria, etc. (eg, 1 type, 2 types, 3 types) , 4, or 5).
  • the bacteria of the genus Pseudomonas may be Pseudomonas aeruginosa
  • the bacteria of the genus Acinetobacter may be Acinetobacter baumannii
  • the bacterium of the genus Escherichia coli Escherichia coli
  • the Enterobacter genus bacteria may be Enterobacter aerogenes
  • the Klebsiella genus bacteria may be Klebsiella pneumoniae , but is limited thereto no.
  • Antibiotics provided herein include the aforementioned polypeptide (a polypeptide comprising the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO: 6) or the fusion polypeptide, a polynucleotide encoding the polypeptide or the fusion polypeptide, the poly
  • a recombinant vector comprising a nucleotide and a recombinant cell comprising the polynucleotide or a recombinant vector comprising the same (hereinafter, first antibiotic)
  • second antibiotic another antibiotic (second antibiotic) is further added may include.
  • the second antibiotic may be one or more selected from commonly used antibiotics, for example, antibiotics having antibiotic activity against Gram-negative bacteria.
  • the second antibiotic may be a polymyxin-based antibiotic, for example, polymyxin B, colistin, or a combination thereof, but is not limited thereto.
  • antibiotics eg, polymyxin-based antibiotics such as polymyxin B, colistin, or a combination thereof
  • antibiotic encompasses all forms of preparations having growth inhibitory and / or killing ability against Gram-negative bacteria, and unless otherwise specified, may be used interchangeably with antibacterial agents, preservatives, bactericides, and the like.
  • Another example provides a pharmaceutical composition for preventing and/or treating a disease caused by infection of gram-negative bacteria or gram-negative bacteria comprising the antibiotic or combination antibiotic as an active ingredient.
  • Another example includes administering a pharmaceutically effective amount of the antibiotic or combination antibiotic to a subject in need of prevention and/or treatment of a disease caused by infection of Gram-negative bacteria or Gram-negative bacteria infection or Gram-negative bacteria
  • a method for preventing or treating diseases caused by negative bacteria is provided.
  • the prophylactic or therapeutic method may further include, before the administering step, identifying a subject in need of prevention or treatment of a gram-negative bacteria infection or a disease caused by a gram-negative bacteria.
  • the gram-negative bacteria are the same as described above.
  • the disease caused by the Gram-negative bacteria may be selected from all diseases caused by the Gram-negative bacteria infection, for example, skin infection, pressure sores, pneumonia, bacteremia, sepsis, endocarditis, meningitis, otitis externa, otitis media, keratitis, osteomyelitis.
  • diseases caused by bacteria of the genus Pseudomonas such as enteritis, peritonitis, cystic fibrosis
  • diseases caused by bacteria of the genus Acinetobacter such as skin infections, pneumonia, bacteremia, and sepsis
  • It may be selected from the group consisting of diseases caused by bacteria of the genus Escherichia such as enteritis, Crohn's disease, ulcerative colitis, bacterial dysentery, urinary tract infection, skin infection, bacteremia, sepsis, and the like, but is not limited thereto.
  • a pharmaceutically effective amount means the content or dosage of an active ingredient that can obtain a desired effect.
  • the content or dosage of the active ingredient in the pharmaceutical composition depends on factors such as formulation method, administration method, patient's age, weight, sex, medical condition, food, administration time, administration interval, administration route, excretion rate, and response sensitivity. can be prescribed in a variety of ways.
  • one dose is 0.001 to 1000 mg/kg, 0.01 to 100 mg/kg, 0.01 to 50 mg/kg, 0.01 to 20 mg/kg, 0.01 to 10 mg/kg, 0.01 to 5 mg/kg, 0.1 to 100 mg/kg, 0.1 to 50 mg/kg, 0.1 to 20 mg/kg, 0.1 to 10 mg/kg, 0.1 to 5 mg/kg, 1 to 100 mg/kg, 1 to 50 mg/kg kg, 1 to 20 mg/kg, 1 to 10 mg/kg, or 1 to 5 mg/kg, but is not limited thereto.
  • the content of the active ingredient in the pharmaceutical composition based on the total weight of the pharmaceutical composition, 0.01% to 99.9% by weight, 0.01% to 90% by weight, 0.01% to 80% by weight, 0.01% to 70% by weight %, 0.01% to 60% by weight, 0.01% to 50% by weight, 0.01% to 40% by weight, 0.01% to 30% by weight, 1% to 99.9% by weight, 1% to 90% by weight, 1% to 80% by weight, 1% to 70% by weight, 1% to 60% by weight, 1% to 50% by weight, 1% to 40% by weight, 1% to 30% by weight, 5% by weight % to 99.9 wt%, 5 wt% to 90 wt%, 5 wt% to 80 wt%, 5 wt% to 70 wt%, 5 wt% to 60 wt%, 5 wt% to 50 wt%, 5 wt% to 40% by weight, 5% to 30% by weight, 10% to 99.9% by weight, 10%
  • the pharmaceutical composition may further include a pharmaceutically acceptable carrier in addition to the active ingredient.
  • a pharmaceutically acceptable carrier is commonly used in the formulation of a drug containing a protein, nucleic acid, or cell, and does not stimulate an organism and may mean a carrier that does not inhibit the biological activity and/or properties of the active ingredient. have.
  • the carrier is lactose, dextrose, sucrose, sorbitol, mannitol, starch, gum acacia, calcium phosphate, alginate, gelatin, calcium silicate, microcrystalline cellulose, polyvinylpyrrolidone, cellulose, water, It may be at least one selected from the group consisting of syrup, methyl cellulose, methyl hydroxybenzoate, propyl hydroxybenzoate, talc, magnesium stearate, mineral oil, and the like, but is not limited thereto.
  • the pharmaceutical composition may further include one or more selected from the group consisting of diluents, excipients, lubricants, wetting agents, sweeteners, flavoring agents, emulsifiers, suspending agents, preservatives, and the like, which are commonly used in the manufacture of pharmaceutical compositions.
  • the administration target of the pharmaceutical composition is human, primates such as monkeys, rodents such as mice and rats, dogs, cats, pigs, cattle, horses, sheep, goats, etc. livestock, chickens, ducks, geese, pheasants, quails, turkeys It may be one or more selected from mammals, including poultry and the like, or cells, tissues, or cultures thereof derived therefrom.
  • the pharmaceutical composition may be administered by oral or parenteral administration, or administered by contacting cells, tissues, or body fluids.
  • parenteral administration may be administered by subcutaneous injection, intramuscular injection, intravenous injection, intraperitoneal injection, endothelial administration, topical administration, intranasal administration, intrapulmonary administration, rectal administration, and the like.
  • the protein or peptide is digestible, so oral compositions should be formulated to coat the active agent or to protect it from degradation in the stomach.
  • the pharmaceutical composition may be diluted and administered through a nasal spray to be absorbed into the nasal cavity through a nebulizer or a spray system. .
  • the pharmaceutical composition can be formulated in the form of solutions, injections, suspensions, syrups, emulsions, coatings, patches, extracts, powders, powders, granules, tablets, capsules, aerosols, etc. in oil or aqueous medium. and may additionally include a dispersing agent or a stabilizer for formulation.
  • Another example provides a feed additive comprising the antibiotic or combination antibiotic as an active ingredient.
  • Another example provides a feed comprising the composition for adding the feed.
  • the feed can be prepared by separately preparing the antibiotic or the combined antibiotic in the form of a feed additive and mixing it with the feed, or directly adding the antibiotic or antibiotic in the form of a feed additive.
  • the antibiotic or combination antibiotic in the feed may be in a liquid or dry state, for example, in a dried powder form.
  • the antibiotic is 0.005 to 10% by weight, 0.05 to 10% by weight, 0.1 to 10% by weight, 0.005 to 5% by weight, 0.05 to 5% by weight, 0.1 to 5% by weight of the total feed weight, 0.005 to 2% by weight, 0.05 to 2% by weight, or may be included in an amount of 0.1 to 2% by weight, but is not limited thereto.
  • the feed may further include conventional additives that can improve the preservation of the feed in addition to the antibiotic or combination antibiotic.
  • the feed to which the antibiotic or combination antibiotic can be added is a commercially available feed, or cereals, root fruits, food processing by-products, algae, fibers, pharmaceutical by-products, oils and fats, starches, gourds, grain by-products. It may be selected from the group consisting of logistics, proteins, inorganic logistics, oils and fats, minerals, single-cell proteins, zooplankton, leftover food, and the like, but is not limited thereto.
  • Another example provides a food additive or drinking water additive comprising the antibiotic or combination antibiotic as an active ingredient.
  • a food additive or drinking water additive comprising the antibiotic or combination antibiotic as an active ingredient.
  • Another example provides a disinfectant comprising the antibiotic or combination antibiotic as an active ingredient.
  • Another example provides a disinfection method comprising the step of applying the antibiotic or combination antibiotic to a subject in need of disinfection.
  • the disinfectant is a generic term for agents to prevent pathogen infection, and is a general living disinfectant, disinfectant for food and cooking places and facilities, buildings such as poultry farms and livestock, livestock, drinking water, litter, egg seats, transport vehicles, various growth of tableware, etc. It can be used for disinfection of equipment, etc.
  • Another example provides a cleaning agent comprising the antibiotic or combination antibiotic as an active ingredient.
  • Another example provides a washing method comprising the step of applying the antibiotic or combination antibiotic to a subject in need of washing. Since the antibiotic has an antibiotic effect against gram-negative bacteria, it can be applied for washing (cleaning) the skin surface or body parts of individuals exposed or likely to be exposed to gram-negative bacteria. The gram-negative bacteria are the same as described above.
  • novel polypeptides, variants of the polypeptides, or novel fusion polypeptides provided herein exhibit excellent extracellular membrane permeability and killing ability against various Gram-negative bacteria, and can be usefully used as antibiotics against Gram-negative bacteria. .
  • 1 is a cleavage map of the expression vector expressing the endolysin (LNT101) gene of the bacteriophage PBPA90 that infects Pseudomonas aeruginosa.
  • Figure 2 shows the purification process of the bacteriophage PBPA90-derived endolysin (LNT101).
  • Figure 3 is a graph showing the antibiotic effect on Pseudomonas aeruginosa in vitro of the bacteriophage PBPA90-derived endolysin (LNT101).
  • Figure 4 is a graph showing the antibiotic effect of the bacteriophage PBPA90-derived endolysin (LNT101) against Pseudomonas aeruginosa in vivo.
  • LNT102 endolysine
  • LNT101 endolysine
  • FIG. 6 is a cleavage map of the expression vector pBT7-LNT102 for endolysine (LNT102) expression.
  • Figure 7 shows the SDS-PAGE result of the reaction product obtained during the purification process of endolysine (LNT102).
  • LNT102 endolysin
  • LNT101 endolysin
  • 9 and 10 are graphs showing the ability to kill Gram-negative bacteria according to the concentration and treatment time of endolysin (LNT102).
  • FIG. 11 is a schematic diagram of a fusion polypeptide (LNT103) according to an embodiment.
  • FIG. 12 is an image showing the SDS-PAGE result of the reaction product obtained during the purification process of the fusion polypeptide (LNT103) according to an embodiment.
  • LNT101 endolysine
  • LNT102 endolysine variant
  • LNT103 fusion polypeptide
  • LNT101 endolysine
  • LNT102 endolysine variant
  • LNT103 fusion polypeptide
  • 15 is a graph showing the killing ability of the fusion polypeptides LNT103 and CecA-LNT101 against various Gram-negative bacteria.
  • 16 is a graph showing a comparison of the fusion polypeptide (LNT103) according to an embodiment and the ability of cecropin A to kill Gram-negative bacteria.
  • 17 is a graph showing the ability to kill Gram-negative bacteria according to the concentration and treatment time of the fusion polypeptide (LNT103) according to an embodiment.
  • FIGS. 18 and 19 are graphs showing the evaluation results of cytotoxicity and hemolysis assay of the fusion polypeptide (LNT103) according to an embodiment.
  • FIG. 20 is a graph showing the survival rate when treated with the fusion polypeptide LNT103 in a mouse model of Acinetobacter baumani systemic infection compared with that when treated with colistin.
  • novel endolysin and / or bacteriophage expressing the same provided herein exhibit excellent growth inhibitory ability and apoptosis against Pseudomonas genus bacteria, such as Pseudomonas aeruginosa, Pseudomonas genus bacteria, such as Pseudomonas aeruginosa. It can be usefully used as an antibiotic.
  • Pseudomonas aeruginosa (PR01957) was used as a host, and cultured with shaking at 37° C. in LB (Luria-Bertani) medium.
  • samples were collected from the Gwacheon Sewage Treatment Plant in Gwacheon-si, Gyeonggi-do, Republic of Korea.
  • the collected sample and Pseudomonas aeruginosa were cultured with shaking at 37° C. for 3 hours, and then centrifuged at 500 rpm for 20 minutes to recover the supernatant. Then, the supernatant was filtered through a 0.45 ⁇ m filter, and then a double agar layer plaque assay was performed.
  • the culture solution of the host bacterium Pseudomonas aeruginosa and bacteriophage was mixed with 0.1 M.O.I. in 5 ml of the upper agar layer, poured into an agar plate, and cultured at 37° C. for 24 hours to obtain plaques. It was possible to secure purified pure bacteriophage through the repetition of the above process, and this bacteriophage was named bacteriophage PBPA90.
  • the finally analyzed bacteriophage PBPA90 genome has a total nucleic acid sequence length of 304,052 bp and a 44% GC content.
  • the full-length nucleic acid sequence of the bacteriophage PBPA90 genome is shown in SEQ ID NO: 5. Based on the genomic nucleic acid sequence information, using BLAST on the Web, the homology (Similarity) with the previously known bacteriophage genome sequence was investigated.
  • the genomic sequence of the bacteriophage PBPA90 was confirmed to have low sequence homology with the Pseudomonas bacteriophage KTN4 (GenBank accession No.: KU521356.1) (query coverage: 4%, identity: 97.34%). Based on this fact, the bacteriophage PBPA90 was confirmed to be a new bacteriophage previously unknown.
  • Primer (F: 5'-aaggatccatgggtactgtactcaaacgtggc-3' (SEQ ID NO: 3), R: 5'-aactcgagtgcccgatgtttcgaaactttatctttc-3' (SEQ ID NO: 4)) by performing PCR (polymerase chain reaction) on the genome of the bacteriophage PBPA90
  • the LNT101 gene (a nucleic acid sequence with a length of 780 bp at positions 180,029 - 180,806 in SEQ ID NO: 5) was obtained.
  • the amino acid sequence of LNT101 endolysine encoded by the LNT101 gene is shown in SEQ ID NO: 1 (259 aa).
  • the PCR was performed under the following conditions: step 1: 94°C, 5 minutes; step 2: 94°C, 30 seconds; step 3: 52° C., 45 seconds; step 4: 72°C, 1 min; step 5: repeat steps 2-4 30 times; step 6: 72°C, 10 min.
  • the obtained PCR product was cloned into the BamHI/XhoI site of pET-21a vector (Novagen) with N-terminal 6X His-tag to prepare an expression vector (pET-LNT101 plasmid) for LNT101 endolysin expression.
  • the expression vector pET-LNT101 is schematically shown in FIG. 1 .
  • lysis buffer 50 mM NaH 2 PO 4 , 300 mM NaCl, 10 mM imidazole
  • 1 mM PMSF and 1 mg/ml lysozyme were added, and left on ice for 30 minutes.
  • Cells were lysed by sonication and centrifuged at 13,000 rpm for 40 minutes to obtain a supernatant. This was passed through a column packed with Ni-NTA agarose resin (Qiagen).
  • the purity of LNT101 protein was confirmed by 15% SDS-PAGE, and the concentration of LNT101 protein was measured by Bradford assay. The results of confirming each reactant obtained during the purification process through SDS-PAGE are shown in FIG. 2 .
  • the molecular weight of the purified LNT101 protein confirmed by SDS-PAGE was about 28 kDa.
  • the amino acid sequence of the LNT101 protein is shown in SEQ ID NO: 1.
  • Example 1.3 in order to investigate the target bacterial spectrum of the bacteriophage PBPA90 and the endolysin LNT101 isolated and purified in Example 1.3 in Examples 1.1 and 1.2, Pseudomonas aeruginosa ATCC13388, ATCC9027, ATCC10145, ATCC15692, ATCC15522, ATCC25619, ATCC27853, CCARM2134, CCARM2200, CCARM2029, CCARM2144, CCARM2298, CCARM2326, PR01957, Escherichia coli ATCC8739, Enterobacter cloace CCARM0252, Klebsiella pneumoniae KCTC9492261, Klebsiella aeruginus KCARM16006, Klebsiella aeruginus KCCARM16006 , The antibacterial activity against Gram-negative bacteria such as Salmonella typhimurium ATCC14028 and Salmonella enteritidis ATCC13076 was tested.
  • the target bacterial spectrum of bacteriophage PBPA90 and endolysin LNT101 was confirmed by a spot test.
  • spot test 1x10 11 CFU/200 ⁇ l of sterilized bacteria was added to 4 ml of top agar (1% Tryptone, 0.5% Yeast extract, 0.5% NaCl, 0.7% agar) and poured onto an LB plate. After the top agar was hardened, 10 ⁇ l of bacteriophage PBPA90 (1 x 10 8 PFU/ml) or 10 ⁇ l of LNT101 (2 mg/ml) was spotted and incubated at 37° C. for 18 hours.
  • endolysin LNT101 was used in all Gram-negative bacteria tested, that is, Pseudomonas aeruginosa, E. coli, Enterobacter cloase, Klebsi.
  • a halo zone was formed in E. pneumoniae, Campylobacter, Chronobacter, and Salmonella strains.
  • Example 1.4 the bacteriophage PBPA90 and endolysin LNT101 in Example 1.4 were tested for the bacterial killing ability of endolysin LNT101 against Pseudomonas aeruginosa (ATCC 13388) confirmed to have antibacterial activity.
  • endolysin LNT101 was confirmed to have a killing ability against Pseudomonas aeruginosa at all treatment doses and times tested, and this Pseudomonas aeruginosa killing ability was shown to be treatment time and dose-dependent.
  • Galleria mellonella was used as an animal model for the in vivo efficacy evaluation.
  • the Galleria mellonella model is a healthy group (non-infected group), Pseudomonas aeruginosa infection group (drug non-administration group), two LNT101 administration groups in which LNT101 is administered to an infection model, a colistin administration group in which colistin is administered to a Pseudomonas aeruginosa infection model, In the Pseudomonas aeruginosa infection model, LNT101 and colistin were administered in combination, and the experiment was conducted, and 10 Galleria mellonella were used in each group.
  • the Pseudomonas aeruginosa infection model was prepared by infecting Pseudomonas aeruginosa PAO1 at an LD80 concentration of 50 CFU/larva, and LNT101 was prepared with 0.6 ⁇ g/larva (3 mg/Kg) and 6 ⁇ g/larva (30 mg/Kg), respectively. administered.
  • Colistin 0.5 ⁇ g/larva (2.5 mg/Kg) was administered, and colistin 0.5 ⁇ g/larva (2.5 mg/Kg) and LNT101 6 ⁇ g/larva (30 mg/Kg) were administered.
  • the survival rate of Galleria mellonella is shown in FIG. 4 . As shown in FIG.
  • Polymyxin B Polymyxin B + LNT101 Colistin Colistin + LNT101 MIC of antibiotics 4 ⁇ g/ml 2.7 ⁇ g/ml 8 ⁇ g/ml 4 ⁇ g/ml
  • Endolysin LNT101 (SEQ ID NO: 1) separated and purified in Example 1.3 is composed of a PG_binding_1 domain (10-65 amino acid) and a transglycosylase SLT domain (95-179 amino acid).
  • the glycoside hydrolase family 25 (accession no. YP_006546280.1) of Thermoanaerobacterium phage THSA-485A, a gene with a similar amino acid sequence, peptidoglycan binding protein of Serratia phage phiMAM1 (accession no. YP_007349105) .1), Serratia phage 2050H1 peptidoglycan binding protein (accession no. ASZ78903.1), Serratia phage vB_SmaA_3M putative peptidoglycan binding protein (accession no.
  • Enwinia phage vB_EamM-Bue1 putative peptidoglycan binding protein accession no. AVO22912.1
  • putative peptidoglycan binding protein of Pseudomonas phage Noxifer accession no. YP_009609055.1
  • endolysin of Salmonella phage mutine accession no. AUG88272.1
  • peptidoglycan binding protein of Salmonella phage bering accession no. QIQ61961.1
  • the amino acid sequence of the LNT101 endolysine transglycosylase SLT domain was analyzed by BLASTp analysis, and the tail fiber protein of Pseudomonas phage Noxifer (accession no. YP_009609112.1), the hypothetical protein SL2_199 of Pseudomonas phage SL2 (accession no. YP_00961973) ), putative endolysin from Pseudomonas phage KTN4 (accession no. ANM44938.1), PHIKZ144 from Pseudomonas phage phiKZ (accession no.
  • tail fiberPa protein from Pseudomonas phage Psa21 (accession v.B_QBJ02724.1)
  • amino acid sequences of hypothetical protein (accession no. QEM41943.1) of LNT101 endolysine and other amino acid sites, 4 amino acids were substituted with the dominant amino acid sequence of the comparative protein.
  • LNT101 The 15 substituted amino acid sequence portions were changed in consideration of codon usage in the LNT101 gene sequence portion (SEQ ID NO: 7), and this was named LNT102 (SEQ ID NO: 6).
  • a sequence comparison of LNT101 and LNT102 is shown in FIG. 5 .
  • LNT102 was cloned into gene synthesis and pBT7-C-His vector (Bioneer) attached with C-terminal 6 X histidine tag.
  • the LNT102 expression vector pBT7-LNT102 prepared in this way is schematically shown in FIG. 6 .
  • lysis buffer 50 mM NaH 2 PO 4 , 300 mM NaCl, 10 mM imidazole
  • 1 mM PMSF and 1 mg/ml lysozyme were added, and left on ice for 30 minutes.
  • Cells were lysed by sonication and centrifuged at 13,000 rpm for 40 minutes to obtain a supernatant. This was passed through a column packed with Ni-NTA agarose resin (Qiagen).
  • LNT102 protein (6xHis tag included) was purified.
  • the purity of LNT102 protein was confirmed by 15% SDS-PAGE, and the concentration of LNT102 protein was measured by Bradford assay. The results of confirming each reactant obtained during the purification process through SDS-PAGE are shown in FIG. 7 .
  • the molecular weight of the purified LNT102 protein confirmed by SDS-PAGE was about 28 kDa.
  • Example 2 the bacterial killing ability and target bacterial spectrum of the endolysin LNT102 purified in Example 2.2 were confirmed for various Gram-negative bacteria.
  • endolysin LNT101 and LNT102 at a concentration of 2 ⁇ M, and Pseudomonas aeruginosa (PAO1; ATCC 15692), Acinetobacter baumani (ATCC 17978), Escherichia coli (ATCC 8739), Klebsiella pneumoniae (ATCC 13883), Enterobacter aerogenus (CCARM 16006), and Salmonella enteritidis (ATCC 13076) 1 X 10 6 CFU, respectively, in reaction buffer (20 mM Tris-Cl, pH 7.5) so that the final volume is 200 ⁇ l and left still at 37°C for 2 hours. After 2 hours, the number of colonies of each Gram-negative bacteria was confirmed, and the results are shown in FIG.
  • Pseudomonas aeruginosa PAO1; ATCC 15692), Acinetobacter baumani (ATCC 17978), Escherichia coli (ATCC 8739), Klebsiella pneumoniae (ATCC 13883
  • PA90 represents endolysin LNT101
  • mtPA90 represents endolysin LNT102, respectively.
  • both endolysin LNT101 and LNT102 were confirmed to have superior killing ability compared to the control for all tested Gram-negative bacteria, and in particular, LNT102, compared to LNT101, superior ability to kill Gram-negative bacteria at the same dose was shown.
  • Example 2.2 A synergistic effect was confirmed by the combined treatment of polymyxin-based antibiotics having a mechanism of action on bacterial cell membranes and endolysin LNT102 purified in Example 2.2.
  • Polymyxin B was treated with 4 ⁇ g/ml in row A of a 96 well microplate, and serial dilution was carried out by 1/2 in rows B - G.
  • Polymyxin was not treated in row H.
  • Colistin was treated with 8 ⁇ g/ml in row A of a 96-well microplate, and serial dilution was carried out by 1/2 in rows B - G.
  • Polymyxin was not treated in row H.
  • a combination treatment group further treated with 1 ⁇ M of LNT102 endolysin, and a PBS treatment group with the same amount were prepared. All wells were treated with Pseudomonas aeruginosa, and Escherichia coli in an amount of 1 x 10 5 CFU/ml, total 100 ⁇ l, respectively. Then, incubated at 37°C for 18 hours.
  • MIC Minimum Inhibitory Concentration
  • polymyxin B concentrations of polymyxin-based antibiotics
  • LNT102 endolysin concentrations of polymyxin-based antibiotics
  • Polymyxin B + PBS Polymyxin B + LNT102 Colistin + PBS Colistin + LNT102 P. aeruginosa (ATCC 27853) 0.5 ⁇ g/ml ⁇ 0.06 ⁇ g/ml 2 ⁇ g/ml 0.5 ⁇ g/ml A. baumannii (ATCC 19606) 0.5 ⁇ g/ml 0.03 ⁇ g/ml 2 ⁇ g/ml 0.25 ⁇ g/ml E. coli (ATCC 8739) 0.5 ⁇ g/ml 0.06 ⁇ g/ml 2 ⁇ g/ml 1 ⁇ g/ml
  • Endolysin LNT101 (SEQ ID NO: 1) consists of a PG_binding_1 domain (10-65 amino acid) and a transglycosylase SLT domain (95-179 amino acid). By adding 15 amino acid mutations to the endolysine LNT101 (SEQ ID NO: 1), an endolysine LNT101 variant of SEQ ID NO: 6 (hereinafter referred to as endolysin LNT102) was prepared.
  • the endolysin LNT102 coding gene (SEQ ID NO: 7) was inserted into the pBT7 plasmid to prepare a pBT7-LNT102 plasmid for endolysin LNT102 expression.
  • SEQ ID NO: 7 The endolysin LNT102 coding gene (SEQ ID NO: 7) was inserted into the pBT7 plasmid to prepare a pBT7-LNT102 plasmid for endolysin LNT102 expression.
  • E. coli BL21-Star(DE3) strain Invitrogen
  • LB broth 1% Tryptone, 0.5%(w/v) Yeast extract, 0.5%(w/v) NaCl
  • OD 600 0.5.
  • 1 mM IPTG Isopropyl ⁇ -d-1-thiogalactopyanosid
  • lysis buffer 50 mM NaH 2 PO 4 , 300 mM NaCl, 10 mM imidazole
  • 1 mM PMSF and 1 mg/ml lysozyme were added, and left on ice for 30 minutes.
  • Cells were lysed by sonication and centrifuged at 13,000 rpm for 40 minutes to obtain a supernatant. This was passed through a column packed with Ni-NTA agarose resin (Qiagen).
  • the purity of LNT102 protein was confirmed by 15% SDS-PAGE, and the concentration of LNT102 protein was measured by Bradford assay. As a result of confirming each reaction product obtained during the purification process through SDS-PAGE, the molecular weight of the purified LNT102 protein was about 31 kDa.
  • a fusion polypeptide in which cecropin A was fused to the prepared LNT102 protein was prepared. Specifically, in order from the N-terminus, [Cecropin A (SEQ ID NO: 8)]-[Linker (GSGSGS) (SEQ ID NO: 12)]-[Endolysine (named LNT102) (SEQ ID NO: 6)] containing A plasmid pET-LNT103 for LNT103 expression was prepared by inserting a polynucleotide (SEQ ID NO: 11) encoding a fusion polypeptide (named LNT103) (SEQ ID NO: 10) into pET 21a (Novagen) plasmid.
  • IPTG isopropyl ⁇ -D-1-thiogalactopyranoside
  • lysis buffer 50 mM NaH 2 PO 4 , 300 mM NaCl, 10 mM imidazole
  • PMSF phenylmethylsulfonyl fluoride
  • 1 mg/ml lysozyme were added thereto, followed by standing on ice for 30 minutes. Cells were lysed by sonication and centrifuged at 13,000 rpm for 40 minutes to obtain a supernatant.
  • the obtained supernatant was passed through a column packed with Ni-NTA agarose resin (Qiagen). After washing with a wash buffer (50 mM NaH 2 PO 4 , 300 mM NaCl, 30 mM imidazole), elution was performed with an elution buffer (50 mM NaH 2 PO 4 , 300 mM NaCl, 300 mM imidazole). Purification/confirmation by 15% SDS-PAGE and concentration was measured by Bradford assay.
  • CecA-LNT101 SEQ ID NO: 13
  • SEQ ID NO: 1 a fusion polypeptide in which cecropin A is fused to endolysin LNT101 (SEQ ID NO: 1) was prepared.
  • SDS-PAGE was performed on the prepared CecA-LNT101 by the method described above, and it was confirmed that the molecular weight of CecA-LNT101 was 34 kDa.
  • the first amino acid M of the purified fusion polypeptides LNT103 (SEQ ID NO: 10) and CecA-LNT101 (SEQ ID NO: 13) is substituted with MAS (Met-Ala-Ser), and at the C terminus
  • the extra sequence and His tag were prepared in the form (SEQ ID NO: 15 or SEQ ID NO: 16), and SEQ ID NO: 15 was used as the fusion polypeptide LNT103 and SEQ ID NO: 16 as CecA-LNT101 in the following tests, respectively.
  • NPN uptake assay was performed to evaluate the outer membrane permeabilization activity of Gram-negative bacteria of the fusion polypeptide prepared in Example 3.2. Pseudomonas aeruginosa and Acinetobacter baumani were tested as representative Gram-negative bacteria.
  • the fusion polypeptide LNT103 had higher outer membrane permeabilization activity of Gram-negative bacteria than the polypeptides LNT101 and LNT102 at the same concentration, and higher than the positive controls cecropin A, EDTA, and polymyxin B. confirmed that.
  • LNT103 was 0.29 ⁇ M, 0.88 ⁇ M , or (2.65 ⁇ M), cecropin A and polymyxin B were treated with 2 ⁇ M, and EDTA was treated with 1 mM.
  • the obtained results are shown in C and D of FIG. 13 as fold change over control for the obtained results.
  • LNT103 has superior outer membrane permeabilization activity against Gram-negative bacteria compared to LNT101, LNT102, cecropin A and polymyxin B, and the concentration-dependent increase in outer membrane permeabilization activity against Gram-negative bacteria was confirmed.
  • CFU reduction evaluation was performed for various Gram-negative bacteria.
  • 2 ⁇ M of each of LNT101, LNT102, and LNT103 prepared in Example 3 Pseudomonas aeruginosa (PAO1; ATCC 15692), Acinetobacter baumani (ATCC 19606, ATCC 17978), Escherichia coli ( ATCC 8739), Klebsiella pneumoniae (ATCC 2208), and Enterobacter aerogenus (CCARM 16006) each 1 x 10 6 CFU in reaction buffer (20 mM Tris-Cl, pH7.5) to a final volume of 200 ⁇ l , and allowed to stand at 37° C.
  • Pseudomonas aeruginosa PAO1; ATCC 15692
  • Acinetobacter baumani ATCC 19606, ATCC 17978
  • Escherichia coli ATCC 8739
  • Klebsiella pneumoniae ATCC 2208
  • Enterobacter aerogenus CCARM 16006
  • a PBS-treated group (PBS treated with the same volume as the fusion polypeptide) was used.
  • FIG. 14 The obtained results are shown in FIG. 14 .
  • the fusion polypeptide LNT103 exhibited a CFU reduction effect of 1.5 to 5.5 log CFU/ml compared to LNT101 and LNT102.
  • the CFU Counting result log CFU / ml
  • Acinetobacter baumani ATCC 19606, ATCC 17978
  • Escherichia coli ATCC 8739
  • Klebsiella pneumoniae ATCC 2208
  • the same test was performed using the fusion polypeptide LNT103 and CecA-LNT101 at a concentration of 2 ⁇ M, and the results are shown in FIG. 15 .
  • the same test was performed for the group treated with LNT102 or PBS. 15, the fusion polypeptide LNT103, and the group treated with CecA-LNT101 were all superior to the group treated with LNT102 or PBS, and in particular, LNT103, and CecA-LNT101 in an amount of 2 ⁇ M, respectively.
  • the counting result log CFU/ml
  • the killing ability against Gram-negative bacteria according to the concentration and/or treatment time of the fusion polypeptide LNT103 was tested. Specifically, 1 x 10 6 CFU of the fusion polypeptide LNT103 and Pseudomonas aeruginosa (PAO1; ATCC 15692) or Acinetobacter baumania cinetobacter baumani (ATCC 19606) at a concentration of 0.1, 0.3, 0.9, or 2.7 ⁇ M Put in reaction buffer (20 mM Tris-Cl, pH7.5) so that the final volume becomes 200 ⁇ l, and after standing at 37° C. for 2 hours, the number of colonies was checked, and the result is shown in A of FIG. 17 .
  • the fusion polypeptide LNT103 had the ability to kill Gram-negative bacteria in a concentration- and time-dependent manner (the bar graphs are not shown in A, B, and C of FIG. 17).
  • the non-part is that the log CFU/ml value is 0, meaning that all treated bacteria are killed).
  • the MIC and MBC are performed by broth microdilution technique according to the standard test method of CLSI (Clinical and Laboratory Standards Institute), but in the test method, MH broth (Casein acid hydrolysate 17.5 g/L, Beef extract 3.0 g/L, Starch 1.5) g/L. pH 7.3) instead of CAA media (Casamino acid 5 g/L, K2HPO4 5.2 mM, MgSO4 1 mM) (Clinical and Laboratory Standards Institute.
  • C A and C B are the respective concentrations of the co-treated substances (polymyxin E and LNT103), MIC A and MIC B are the MICs of the single drug,
  • FIC value synergy effect ⁇ 0.5; antagonism >4; additive 0.5-4)
  • the FIC index value was 0.375, confirming that there is a synergy effect between the two substances.
  • the in vitro toxicity of the fusion polypeptide LNT103 was evaluated by a cell cytotoxicity assay (WST assay) using a Huh-7 cell line and a hemolysis assay using sheep blood (MB cells).
  • WST assay cell cytotoxicity assay
  • MB cells sheep blood
  • the cell cytotoxicity assay procedure is as follows. Huh-7 cell culture solution was prepared and dispensed in an amount of 1 x 10 9 cells/well per well in a 96 well plate, and cultured in a CO 2 incubator for 24 hours. And PBS as a negative control, 1% (w / v) triton X-100 as a positive control, and after treatment with the fusion polypeptide LNT103 as an experimental group at a concentration of 0.25, 0.5, or 1 mg / ml, CO 2 incubator incubated for 24 and 48 hours. Thereafter, cell viability was measured using D-Plus TM CCK cell viability assay kit (Dongin LS), and the results are shown in FIG. 18 . As shown in FIG.
  • the process of hemolysis assay is as follows. After mixing 3 ml sheep blood and 14 ml PBS (pH 7.2), the supernatant was removed by centrifugation at 1000 g, 4°C for 5 minutes. After that, PBS was refilled as much as the removed volume, and the above wash steps were performed a total of 4 times. The hemoglobin lysed through the wash was removed, and 400 ⁇ l of red blood cells (RBC) that had subsided after the last centrifugation was dissolved in 9.6 ml PBS to make a 4% (v/v) blood solution. After mixing 50 ⁇ l sample and 50 ⁇ l 4% (v/v) blood solution in a 96 well microplate, the mixture was reacted at 37° C.
  • RBC red blood cells
  • the experimental group was treated with the fusion polypeptide LNT103 in a 2-fold dilution range from 128 ⁇ g/ml to 2 ⁇ g/ml (PBS, pH 7.2), the positive control group was 0.1% (w/v) Triton X-100, and the negative control group was PBS was treated.
  • the microplate was centrifuged at 1000 g, 4°C for 5 minutes, and 50 ⁇ l of the supernatant was transferred to a new microplate and absorbance was measured at 570 nm (Infinite M200 Pro, TECAN). The obtained results are shown in FIG. 19 .
  • FIG. 19 it was confirmed that the fusion polypeptide LNT103 did not show hemolytic activity at all concentrations tested.
  • the MHC (minimal hemolytic concentration) of LNT103 was >128 ⁇ g/ml.
  • mice were used when ICR male 4 weeks old mice were purchased and after a one-week adaptation period, 5-6 weeks old, weighing 20-21 g.
  • Acinetobaumani bacteria were mixed with 10% mucin at a 1:1 ratio, and 0.5 ml of 2 x 10 8 CFU/ml (5% mucin) of the bacterial solution was inoculated into the abdominal cavity of the mouse.
  • LNT103 20 mpk, LNT103 100 mpk and colistin 20 mpk were administered to the control group through subcutaneous injection, respectively. Thereafter, the survival rate was checked for 96 hours, and the results are shown in FIG. 20 .
  • the group administered with LNT103 to the systemic infection mouse model showed a higher survival rate than the non-administered group (control) and the control group (colistin-administered group), and LNT103 showed a concentration-dependent high survival rate, It was confirmed that the effect was effective in the corresponding mouse model.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Organic Chemistry (AREA)
  • Zoology (AREA)
  • General Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Wood Science & Technology (AREA)
  • Medicinal Chemistry (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • General Engineering & Computer Science (AREA)
  • Biotechnology (AREA)
  • Biomedical Technology (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Microbiology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Epidemiology (AREA)
  • Immunology (AREA)
  • Biophysics (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Plant Pathology (AREA)
  • Communicable Diseases (AREA)
  • Oncology (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Toxicology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Insects & Arthropods (AREA)
  • Environmental Sciences (AREA)
  • Polymers & Plastics (AREA)
  • Virology (AREA)
  • Pest Control & Pesticides (AREA)
  • Physics & Mathematics (AREA)

Abstract

신규한 폴리펩타이드, 및 상기 폴리펩타이드 를 포함하는 융합 폴리펩타이드 및 이들의 항생제로서의 용도가 제공된다. 보다 구체적으로, 박테리오파지로부터 유래하는 신규한 폴리펩타이드, 세크로핀 A를 포함하는 신규한 융합 폴리펩타이드, 및 상기 폴리펩타이드 및/또는 융합 폴리펩타이드를 포함하는 그람음성균에 대한 항생제가 제공된다.

Description

신규한 폴리펩타이드, 융합 폴리펩타이드, 및 이를 포함하는 그람음성균에 대한 항생제
본 명세서에서 신규한 폴리펩타이드, 상기 폴리펩타이드를 포함하는 융합 폴리펩타이드, 및 이들의 항생제로서의 용도가 제공된다. 보다 구체적으로, 박테리오파지로부터 유래하는 신규한 폴리펩타이드 상기 폴리펩타이드 및 세크로핀 A를 포함하는 융합 폴리펩타이드, 및 상기 폴리펩타이드 및/또는 융합 단백질을 포함하는 그람음성균에 대한 항생제가 제공된다.
박테리오파지(bacteriophage)는 특정 세균을 감염시켜 감염된 세균의 성장을 억제하고 저해하는 세균 특이적 바이러스를 의미한다. 박테리오파지는 자신의 숙주 박테리아에 감염(infection)한 후 세균 세포 내부에서 증식을 하고, 증식 후 자손 박테리오파지들이 박테리아 밖으로 나올 때 박테리오파지의 단백질인 엔도라이신을 이용하여 숙주인 세균의 세포벽을 파괴하는 방식으로 세균을 사멸시키는 능력을 갖는다. 따라서, 박테리오파지의 엔도라이신 활성을 가지는 물질은 항생제 후보물질로서 유용하게 적용될 수 있다.
근래 항생제 내성세균이 급속히 증가하고 있고, 어떤 항생제로도 치료가 되지 않는 다제내성세균도 늘어나고 있다. 특히, 그람음성균 중 하나인 슈도모나스 에루기노사(Pseudomonas aeruginosa)는 전 세계적으로 새로운 치료수단의 개발이 시급한 ESKAPE(Enterococcus faecium, Staphylococcus aureus, Klebsiella pneumoniae, Acinetobacter baumannii, Pseudomonas aeruginosa, and Enterobacter species) bacteria 중 하나이며, 대장균(Escherichia coli)은 다양한 감염증에 관여하는 bacteria이다. 따라서 기존의 항생제와는 차별화되는 치료수단의 개발이 요구된다.
일 예는 신규한 폴리펩타이드를 제공한다. 상기 폴리펩타이드는 서열번호 1 또는 서열번호 6의 아미노산 서열을 포함하는 것일 수 있다. 상기 폴리펩타이드는 박테리오파지로부터 유래한 것 또는 이의 변이체일 수 있다. 상기 폴리펩타이드는 엔도라이신 활성을 갖는 것일 수 있다.
다른 예는 상기 폴리펩타이드를 암호화하는 폴리뉴클레오타이드를 제공한다. 상기 폴리뉴클레오타이드는 서열번호 2 또는 서열번호 7의 핵산 서열을 포함하는 것일 수 있다.
다른 예는 상기 폴리뉴클레오타이드를 포함하는 재조합 벡터를 제공한다. 상기 재조합 벡터는 발현 벡터로 사용될 수 있다.
다른 예는 상기 폴리뉴클레오타이드 또는 이를 포함하는 재조합 벡터를 포함하는 재조합 세포를 제공한다. 상기 재조합 세포는 상기 폴리뉴클레오타이드의 발현을 위한 것일 수 있다.
다른 예는 상기 서열번호 1의 폴리펩타이드, 이를 암호화하는 폴리뉴클레오타이드 (예컨대, 서열번호 2), 또는 이들의 조합을 포함하는 박테리오파지를 제공한다. 상기 박테리오파지의 유전체는 서열번호 5의 핵산 서열을 포함하는 것일 수 있다.
다른 예는 신규한 융합 폴리펩타이드를 제공한다. 상기 융합 폴리펩타이드는 세크로핀 A(Cecropin A) 및 엔도라이신을 포함하는 것일 수 있다. 상기 세크로핀 A(Cecropin A)은, 예컨대, 서열번호 8의 아미노산 서열로 표시되는 것일 수 있다. 상기 엔도라이신은 박테리오파지로부터 유래한 것 또는 이의 변이체일 수 있으며, 예컨대, 서열번호 1 또는 서열번호 6의 아미노산 서열로 표시되는 것일 수 있다. 상기 융합 폴리펩타이드에서, 상기 세크로핀 A (e.g., 서열번호 8) 및 엔도라이신 (예컨대, 서열번호 1 또는 서열번호 6)은 순서에 무관하게 링커를 통하여 연결되거나 링커 없이 직접 연결된 것일 수 있다. 일 예에서, 상기 융합 폴리펩타이드는 서열번호 10 또는 서열번호 13의 아미노산 서열로 표시되는 것일 수 있다.
다른 예는 상기 융합 폴리펩타이드를 암호화하는 폴리뉴클레오타이드를 제공한다. 상기 폴리뉴클레오타이드는 서열번호 11 또는 서열번호 14의 핵산 서열을 포함하는 것일 수 있다.
다른 예는 상기 폴리뉴클레오타이드를 포함하는 재조합 벡터를 제공한다. 상기 재조합 벡터는 발현 벡터로 사용될 수 있다.
다른 예는 상기 폴리뉴클레오타이드 또는 이를 포함하는 재조합 벡터를 포함하는 재조합 세포를 제공한다. 상기 재조합 세포는 상기 폴리뉴클레오타이드의 발현을 위한 것일 수 있다.
다른 예는,
(1) 서열번호 1 및 서열번호 6 중에서 선택된 하나 이상의 폴리펩타이드,
(2) 상기 폴리펩타이드 및 세크로핀 A를 포함하는 융합 폴리펩타이드 (예컨대, 서열번호 10 또는 서열번호 13), 또는 이들의 조합,
(3) 상기 (1) 폴리펩타이드를 암호화하는 폴리뉴클레오타이드,
(4) 상기 (2) 융합 폴리펩타이드를 암호화하는 폴리뉴클레오타이드,
(5) 상기 (3) 폴리뉴클레오타이드, 상기 (4) 폴리뉴클레오타이드, 또는 이들의 조합을 포함하는 재조합 벡터,
(6) 상기 (3) 폴리뉴클레오타이드, 상기 (4) 폴리뉴클레오타이드, 또는 이들의 조합 또는 상기 폴리뉴클레오타이드를 포함하는 재조합 벡터를 포함하는 재조합 세포, 및
(7) 서열번호 1의 폴리펩타이드, 이를 암호화하는 폴리뉴클레오타이드, 또는 이들의 조합을 포함하는 박테리오파지
로 이루어진 군에서 선택된 1종 이상을 포함하는, 항생제를 제공한다.
상기 항생제는 그람음성균에 대하여 항생 효과를 갖는 것일 수 있다.
본 명세서에서 제공되는 항생제 (제1 항생제)는 다른 항생제 (제2 항생제)와 병용됨으로써, 자체의 항생 효과에 의한 상승 효과 및 낮은 농도의 제2 항생제로도 우수한 항생 효과를 발휘할 수 있도록 하는 이점을 갖는다. 이로 인하여, 높은 농도의 항생제 사용에 의한 독성 (예컨대, 신장 독성, 간 독성 등) 등의 부작용을 감소시킬 수 있다. 또한, 다른 기전의 항생제 병용을 통한 항생제 내성균의 출현을 억제할 수 있다.
이에, 일 예는,
(a) (1) 서열번호 1 및 서열번호 6 중에서 선택된 하나 이상의 폴리펩타이드, (2) 상기 폴리펩타이드 및 세크로핀 A를 포함하는 융합 폴리펩타이드 (예컨대, 서열번호 10 또는 서열번호 13), 또는 이들의 조합, (3) 상기 (1) 폴리펩타이드를 암호화하는 폴리뉴클레오타이드, (4) 상기 (2) 융합 폴리펩타이드를 암호화하는 폴리뉴클레오타이드, (5) 상기 (3) 폴리뉴클레오타이드, (4) 폴리뉴클레오타이드, 또는 이들의 조합을 포함하는 재조합 벡터, (6) 상기 (3) 폴리뉴클레오타이드, 상기 (4) 폴리뉴클레오타이드, 또는 이들의 조합 또는 상기 폴리뉴클레오타이드를 포함하는 재조합 벡터를 포함하는 재조합 세포, 및 (7) 서열번호 1의 폴리펩타이드, 이를 암호화하는 폴리뉴클레오타이드, 또는 이들의 조합을 포함하는 박테리오파지로 이루어진 군에서 선택된 1종 이상; 및
(b) 항생제 (예컨대, 폴리믹신 B(polymyxin B) 및/또는 콜리스틴 (Colistin) 등의 polymyxin 계열 항생제 등)
를 포함하는 병용 항생제를 제공한다.
다른 예는 상기 항생제 또는 병용 항생제를 유효성분으로 포함하는 슈도모나스 속 세균의 감염 또는 슈도모나스 속 세균에 의하여 유발되는 질병의 예방 및/또는 치료용 약학 조성물을 제공한다. 다른 예는 상기 항생제 또는 병용 항생제의 약학적 유효량을 슈도모나스 속 세균의 감염 또는 슈도모나스 속 세균에 의하여 유발되는 질병의 예방 및/또는 치료를 필요로 하는 대상에게 투여하는 단계를 포함하는, 슈도모나스 속 세균의 감염 또는 슈도모나스 속 세균에 의하여 유발되는 질병의 예방 또는 치료 방법을 제공한다.
다른 예는 상기 항생제 또는 병용 항생제를 유효성분으로 포함하는 사료 첨가제를 제공한다.
다른 예는 상기 항생제 또는 병용 항생제를 유효성분으로 포함하는 소독제를 제공한다.
다른 예는 상기 항생제 또는 병용 항생제를 소독이 필요한 대상에 적용하는 단계를 포함하는, 소독 방법을 제공한다.
다른 예는 상기 항생제 또는 병용 항생제를 유효성분으로 포함하는 세척제를 제공한다.
다른 예는 상기 항생제 또는 병용 항생제를 세척이 필요한 대상에 적용하는 단계를 포함하는, 세척 방법을 제공한다.
세균을 숙주로 증식하여 천연의 항생제로 사용될 수 있는 박테리오파지가 세균에 침투하여 내부에서 증식을 마치면 완성된 파지입자들이 세균 외부로 방출되며, 이 때, 세균의 세포벽을 공격하여 분해하여 외부로 방출될 통로를 만들어 주는 효소가 엔도라이신이다. 모든 박테리오파지는 유전체(genome) 내에 이러한 엔도라이신 유전자를 가지고, 증식 시에 발현된 엔도라이신 단백질을 이용한다. 세균을 숙주로 증식하는 박테리오파지와 세포벽을 분해하는 특성을 가지는 박테리오파지 유래의 엔도라이신은 천연의 항생제로 이용될 수 있다.
그람 양성세균의 경우에는 가장 외벽에 세포벽이 위치하므로, 외부에서 엔도라이신을 첨가하면 세포벽이 바로 공격당하여 분해된다. 반면에, 그람 음성세균의 경우에는 가장 외부에 외세포막이 존재하고, 그 내부에 세포벽이 위치하므로, 외부에서 엔도라이신을 첨가하더라도 먼저 외세포막을 통과하여야 세포벽을 만나게 된다. 따라서, 기본적으로 엔도라이신은 그람 음성세균에는 효과가 없다고 알려져 왔다. 본 명세서에서 제공되는 엔도라이신 활성을 가지는 폴리펩타이드는 그람음성균을 사멸시키는 효과를 갖는 것을 특징으로 한다.
한편, 상기 세크로핀 A (Cecropin A)는 세균막을 용해하는 작용을 갖는 항균 활성을 가지는 펩타이드이다.
본 명세서에서는 신규한 폴리펩타이드 또는 신규한 폴리펩타이드에 세크로핀 A를 융합시킨 융합 폴리펩타이드가 기존 엔도라이신보다 뛰어난 항생 효과를 입증하여, 엔도라이신 활성을 가지는 폴리펩타이드, 및 이의 항생제 및/또는 이와 관련된 용도를 제공한다.
이하, 본 발명을 보다 상세히 설명한다:
용어의 정의
본 명세서에서, 폴리뉴클레오타이드("유전자"와 혼용될 수 있음) 또는 폴리펩타이드("단백질"과 혼용될 수 있음)가 "특정 핵산 서열 또는 아미노산 서열을 포함한다" 또는 "특정 핵산 서열 또는 아미노산 서열로 이루어진다" 함은 상기 폴리뉴클레오타이드 또는 폴리펩타이드가 상기 특정 핵산 서열 또는 아미노산 서열을 필수적으로 포함하는 것을 의미할 수 있으며, 상기 폴리뉴클레오타이드 또는 폴리펩타이드의 본래의 기능 및/또는 목적하는 기능을 유지하는 범위에서 상기 특정 핵산 서열 또는 아미노산 서열에 변이(결실, 치환, 변형, 및/또는 부가)가 가해진 "실질적으로 동등한 서열"을 포함하는 것(또는 상기 변이를 배제하지 않는 것)으로 해석될 수 있다.
일 예에서, 폴리뉴클레오타이드 또는 폴리펩타이드가 "특정 핵산 서열 또는 아미노산 서열을 포함한다" 또는 "특정 핵산 서열 또는 아미노산 서열로 이루어진다 또는 표시된다" 함은 상기 폴리뉴클레오타이드 또는 폴리펩타이드가 (i) 상기 특정 핵산 서열 또는 아미노산 서열을 필수적으로 포함하거나, 또는 (ii) 상기 특정 핵산 서열 또는 아미노산 서열과 96% 이상, 96.5% 이상, 97% 이상, 97.5% 이상, 98% 이상, 98.5% 이상, 99% 이상, 99.5% 이상, 또는 99.9% 이상의 상동성(identity)을 갖는 아미노산 서열로 이루어지거나 이를 필수적으로 포함하고 본래의 기능 및/또는 목적하는 기능을 유지하는 것을 의미할 수 있다. 본 명세서에서, 상기 본래의 기능은, 엔도라이신 효소 기능 (예컨대, 펩티도글리칸 가수분해 활성), 세크로핀 A 활성 (예컨대, 세포막 용해 활성), 및/또는 항생 작용이거나 (아미노산 서열의 경우), 또는 엔도라이신 효소 기능, 세크로핀 A 활성, 및/또는 항생 작용을 가지는 단백질 암호화하는 기능 (핵산 서열의 경우)일 수 있고, 상기 목적하는 기능은 그람음성균, 예컨대 슈도모나스 속 세균, 예컨대 슈도모나스 에루기노사에 대한 항생 활성을 의미할 수 있다.
본 명세서에서, 용어 "상동성(identity)"은 주어진 핵산 서열 또는 아미노산 서열과 일치하는 정도를 의미하며 백분율(%)로 표시될 수 있다. 핵산 서열에 대한 상동성의 경우, 예를 들면, 문헌에 의한 알고리즘 BLAST(참조: Karlin 및 Altschul, Pro. Natl. Acad. Sci. USA, 90, 5873, 1993)나 Pearson에 의한 FASTA(참조: Methods Enzymol., 183, 63, 1990)를 사용하여 결정할 수 있다. 이러한 알고리즘 BLAST에 기초하여, BLASTN이나 BLASTX라고 불리는 프로그램이 개발되어 있다(참조: http://www.ncbi.nlm.nih.gov).
본 명세서에서 제공되는 단백질 또는 폴리펩타이드는 천연에서 분리 및/또는 정제되거나, 재조합적 또는 화학적으로 합성된 것일 수 있다. 본 명세서에서 제공되는 단백질 또는 폴리펩타이드의 아미노산 서열이 N-말단으로부터 첫 번째 아미노산 잔기로서 메티오닌(Met, M) 또는 Met-Ala-Ser(MAS) 서열을 포함하는 경우, 상기 단백질 또는 폴리펩타이드가 재조합적으로 생산된 것일 수 있고, 상기 N-말단으로부터 첫 번째 아미노산 위치의 메티오닌은 개시코돈에 의하여 코딩된 것일 수 있다. 따라서, 본 명세서에서 제공되는 단백질 또는 폴리펩타이드의 아미노산 서열이 N-말단에 재조합적 생산에 의한 메티오닌을 포함하는 경우, 상기 단백질 또는 폴리펩타이드가 다른 방법 (예컨대, 화학적 합성 또는 천연에서 분리)으로 얻어지는 경우에는 상기 재조합적 생산에 의한 N-말단 첫 번째 위치의 메티오닌을 제외한 두 번째 아미노산 잔기로부터 시작되는 아미노산 서열 또는 MAS 서열 다음의 아미노산 잔기 (예컨대, 4번째 아미노산 잔기)부터 시작되는 아미노산 서열을 포함하는 것으로 해석될 수 있다.
신규한 폴리펩타이드 및 이를 암호화하는 폴리뉴클레오타이드
일 예는 신규한 폴리펩타이드를 제공한다. 상기 폴리펩타이드는 서열번호 1의 아미노산 서열을 포함하는 것일 수 있다. 상기 폴리펩타이드는 박테리오파지로부터 유래한 것일 수 있다. 상기 폴리펩타이드는 박테리오파지로부터 유래한 엔도라이신 활성을 갖는 것일 수 있다. 상기 폴리펩타이드는 분자량이 약 28 kDa (28 kDa±2)인 것일 수 있다.
다른 예에서, 상기 폴리펩타이드는 서열번호 6의 아미노산 서열을 포함하는 것일 수 있다. 상기 폴리펩타이드는 박테리오파지로부터 유래한 엔도라이신으 변이체일 수 있으며, 박테리오파지로부터 유래한 엔도라이신과 비교하여 우수한 엔도라이신 활성 및/또는 항생 활성을 갖는 것일 수 있다. 상기 폴리펩타이드는 분자량이 약 28 kDa (28 kDa±2)인 것일 수 있다. 상기 폴리펩타이드는 재조합적 또는 합성적(예컨대, 화학적 합성)으로 제조된 것일 수 있다.
다른 예는 상기 폴리펩타이드를 암호화하는 폴리뉴클레오타이드를 제공한다. 상기 폴리뉴클레오타이드는 서열번호 2 또는 서열번호 7의 핵산 서열을 포함하는 것일 수 있다.
엔도라이신은 박테리오파지가 암호화하는 펩티도글리칸 가수분해효소를 의미한다. 엔도라이신은 박테리오파지 증식의 용해 회로에서 후기 유전자 발현 동안 합성되고 박테리아성 펩티도글리칸의 분해를 통해 감염된 세포로부터 자손 비리온의 방출을 매개한다. 효소적 활성의 측면에서, 엔도라이신은 통상적으로 글루코사미니다아제 (Glucosaminidase), 무라미다아제 (muramidase) (lysozyme의 일종), 트랜스글리코실라아제 (transglycosylase), 아미다아제 (amidase), 엔도펩티다아제 (endopeptidase) 등으로 이루어진 군에서 선택된 하나 이상의 활성을 갖는 것일 수 있다.
본 명세서에서, 다르게 기재되지 않는 한, '서열번호 1 또는 서열번호 6의 아미노산 서열을 포함하는' 또는 '서열번호 1 또는 서열번호 6의 아미노산 서열로 이루어지는' 폴리펩타이드로서 엔도라이신 활성을 갖는 폴리펩타이드는,
(1) 서열번호 1 또는 서열번호 6의 아미노산 서열로 이루어지거나 또는 이를 필수적으로 포함하는 폴리펩타이드, 및/또는
(2) 서열번호 1 또는 서열번호 6의 아미노산 서열과 96% 이상, 96.5% 이상, 97% 이상, 97.5% 이상, 98% 이상, 98.5% 이상, 99% 이상, 99.5% 이상, 또는 99.9% 이상의 상동성을 갖는 아미노산 서열(예를 들어, 서열번호 1의 아미노산 서열과 99.3% 이상, 99.4% 이상, 99.5% 이상, 99.6% 이상, 99.7% 이상, 99.8% 이상, 또는 99.9% 이상의 상동성을 갖는 아미노산 서열 또는 서열번호 6의 아미노산 서열과 96% 이상, 96.5% 이상, 97% 이상, 97.5% 이상, 98% 이상, 98.5% 이상, 99% 이상, 99.5% 이상, 또는 99.9% 이상의 상동성을 갖는 아미노산 서열)로 이루어지거나, 이를 필수적으로 포함하고, 엔도라이신 효소 기능 (예컨대, 펩티도글리칸 가수분해 활성) 및/또는 슈도모나스 속 세균, 예컨대, 슈도모나스 에루기노사에 대한 항생 활성을 갖는 (유지하는) 폴리펩타이드
를 의미하는 것일 수 있다.
또한, 본 명세서에서, 다르게 기재되지 않는 한, '서열번호 1 또는 서열번호 6의 아미노산 서열을 포함하는' 또는 '서열번호 1 또는 서열번호 6의 아미노산 서열로 이루어지는' 폴리펩타이드를 암호화하는 폴리뉴클레오타이드는,
(a) 서열번호 1 또는 서열번호 6의 아미노산 서열로 이루어지거나 또는 이를 필수적으로 포함하는 폴리펩타이드를 암호화하는 폴리뉴클레오타이드, 및/또는
(b) 서열번호 1 또는 서열번호 6의 아미노산 서열과 96% 이상, 96.5% 이상, 97% 이상, 97.5% 이상, 98% 이상, 98.5% 이상, 99% 이상, 99.5% 이상, 또는 99.9% 이상의 상동성을 갖는 아미노산 서열(예를 들어, 서열번호 1의 아미노산 서열과 99.3% 이상, 99.4% 이상, 99.5% 이상, 99.6% 이상, 99.7% 이상, 99.8% 이상, 또는 99.9% 이상의 상동성을 갖는 아미노산 서열 또는 서열번호 6의 아미노산 서열과 96% 이상, 96.5% 이상, 97% 이상, 97.5% 이상, 98% 이상, 98.5% 이상, 99% 이상, 99.5% 이상, 또는 99.9% 이상의 상동성을 갖는 아미노산 서열)로 이루어지거나 이를 필수적으로 포함하고 엔도라이신 효소 기능 (예컨대, 펩티도글리칸 가수분해 활성) 및/또는 슈도모나스 속 세균, 예컨대, 슈도모나스 에루기노사에 대한 항생 활성을 갖는 (유지하는) 폴리펩타이드를 암호화하는 폴리뉴클레오타이드, 및/또는
(c) '서열번호 2 또는 서열번호 7의 핵산 서열을 포함하는' 또는 '서열번호 2 또는 서열번호 7의 핵산 서열로 이루어지는' 폴리뉴클레오타이드
를 의미할 수 있고,
'서열번호 2 또는 서열번호 7의 핵산 서열을 포함하는' 또는 '서열번호 2 또는 서열번호 7의 핵산 서열로 이루어지는' 폴리뉴클레오타이드는
(d) 서열번호 2 또는 서열번호 7의 핵산 서열로 이루어지거나 또는 이를 필수적으로 포함하는 폴리뉴클레오타이드, 또는
(e) 서열번호 2 또는 서열번호 7의 핵산 서열과 96% 이상, 96.5% 이상, 97% 이상, 97.5% 이상, 98% 이상, 98.5% 이상, 99% 이상, 99.5% 이상, 또는 99.9% 이상의 상동성을 갖는 핵산 서열(예를 들어, 서열번호 2의 핵산 서열과 99.7% 이상, 99.8% 이상, 또는 99.9% 이상의 상동성을 갖는 핵산 서열 또는 서열번호 7의 핵산 서열과 96% 이상, 96.5% 이상, 97% 이상, 97.5% 이상, 98% 이상, 98.5% 이상, 99% 이상, 99.5% 이상, 또는 99.9% 이상의 상동성을 갖는 핵산 서열)로 이루어지거나 이를 필수적으로 포함하고, 엔도라이신 효소 기능 (예컨대, 펩티도글리칸 가수분해 활성) 및/또는 그람음성균에 대한 항생 활성을 갖는 (유지하는) 폴리펩타이드를 암호화하는 폴리뉴클레오타이드
를 의미하는 것일 수 있다.
융합 폴리펩타이드 및 이를 암호화하는 폴리뉴클레오타이드
다른 예는 신규한 융합 폴리펩타이드를 제공한다. 상기 융합 폴리펩타이드는 세크로핀 A 및 엔도라이신을 포함하는 것일 수 있다.
상기 세크로핀 A (Cecropin A)는 나방(Hyalophora cecropia)에서 유래한 것일 수 있으며, 예컨대, 서열번호 8의 아미노산 서열로 표시되는 것일 수 있다. 상기 엔도라이신은 박테리오파지로부터 유래한 것 또는 이의 변이체일 수 있으며, 예컨대, 서열번호 1 또는 서열번호 6의 아미노산 서열로 표시되는 것일 수 있다.
상기 융합 폴리펩타이드에서, 상기 세크로핀 A (예컨대, 서열번호 8) 및 엔도라이신 (예컨대, 서열번호 1 또는 서열번호 6)은 순서에 무관하게 연결된 것일 수 있다. 즉, 상기 융합 폴리펩타이드에서, 상기 세크로핀 A과 엔도라이신은, N-말단부터, 세크로핀 A 및 엔도라이신의 순서 또는 엔도라이신 및 세크로핀 A의 순서로 연결된 것일 수 있으며, 예컨대, 세크로핀 A 및 엔도라이신의 순서로 연결된 것일 수 있다.
또한, 상기 세크로핀 A (Cecropin A) (예컨대, 서열번호 8) 및 엔도라이신 (예컨대, 서열번호 1 또는 서열번호 6)은 펩타이드 링커를 통하여 연결되거나 링커 없이 직접 연결된 것일 수 있다.
일 예에서, 상기 융합 폴리펩타이드는 서열번호 10 또는 서열번호 13의 아미노산 서열로 표시되는 것일 수 있다.
상기 융합 폴리펩타이드는, 엔도라이신 또는 세크로핀 A과 비교하여, 그람음성균에 대하여 우수한 항생 활성 및/또는 우수한 세포외막 투과 (outer membrane permeabilization) 활성을 갖는 것일 수 있다. 상기 융합 폴리펩타이드는 분자량이 약 34kDa (예컨대, 34kDa±3)인 것일 수 있다. 상기 융합 폴리펩타이드 또는 엔도라이신 및 세크로핀 A은 재조합적 또는 합성적(예컨대, 화학적 합성)으로 제조된 것일 수 있다.
다른 예는 상기 융합 폴리펩타이드를 암호화하는 폴리뉴클레오타이드를 제공한다. 상기 폴리뉴클레오타이드는 서열번호 11 또는 서열번호 14의 핵산 서열을 포함하는 것일 수 있다.
본 명세서에서 제공되는 신규한 폴리펩타이드 (예컨대, 서열번호 1 또는 서열번호 6)는 엔도라이신 활성을 가진다. 엔도라이신은 박테리오파지가 암호화하는 펩티도글리칸 가수분해효소를 의미한다. 엔도라이신은 박테리오파지 증식의 용해 회로에서 후기 유전자 발현 동안 합성되고 박테리아성 펩티도글리칸의 분해를 통해 감염된 세포로부터 자손 비리온의 방출을 매개한다. 효소적 활성의 측면에서, 엔도라이신은 통상적으로 글루코사미니다아제 (Glucosaminidase), 무라미다아제 (muramidase) (lysozyme의 일종), 트랜스글리코실라아제 (transglycosylase), 아미다아제 (amidase), 엔도펩티다아제 (endopeptidase) 등으로 이루어진 군에서 선택된 하나 이상의 활성을 갖는 것일 수 있다.
본 명세서에서, 다르게 기재되지 않는 한, 상기 융합 폴리펩타이드는,
(1) 서열번호 8 또는 서열번호 8의 아미노산 서열과 96% 이상, 96.5% 이상, 97% 이상, 97.5% 이상, 98% 이상, 98.5% 이상, 99% 이상, 99.5% 이상, 또는 99.9% 이상의 상동성을 갖는 아미노산 서열로 이루어지거나 이를 필수적으로 포함하고 세크로핀 A 활성을 갖는 (유지하는) 폴리펩타이드; 및
(2) 서열번호 1, 서열번호 6, 또는 이들 아미노산 서열과 96% 이상, 96.5% 이상, 97% 이상, 97.5% 이상, 98% 이상, 98.5% 이상, 99% 이상, 99.5% 이상, 또는 99.9% 이상의 상동성을 갖는 아미노산 서열(예를 들어, 서열번호 1의 아미노산 서열과 99.3% 이상, 99.4% 이상, 99.5% 이상, 99.6% 이상, 99.7% 이상, 99.8% 이상, 또는 99.9% 이상의 상동성을 갖는 아미노산 서열 또는 서열번호 6의 아미노산 서열과 96% 이상, 96.5% 이상, 97% 이상, 97.5% 이상, 98% 이상, 98.5% 이상, 99% 이상, 99.5% 이상, 또는 99.9% 이상의 상동성을 갖는 아미노산 서열)로 이루어지거나 이를 필수적으로 포함하고 엔도라이신 활성을 갖는 (유지하는) 폴리펩타이드
를 순서와 무관하게 (예컨대, N-말단으로부터 순서대로) 포함하는 것일 수 있다.
일 예에서, 상기 융합 폴리펩타이드는,
서열번호 10 또는 서열번호 13의 아미노산 서열을 필수적으로 포함하는 폴리펩타이드, 및/또는
서열번호 10 또는 서열번호 13의 아미노산 서열과 96% 이상, 96.5% 이상, 97% 이상, 97.5% 이상, 98% 이상, 98.5% 이상, 99% 이상, 99.5% 이상, 또는 99.9% 이상의 상동성을 갖는 아미노산 서열로 이루어지거나 이를 필수적으로 포함하고, 그람음성균에 대한 항생 활성을 갖는 (유지하는) 폴리펩타이드
를 의미하는 것일 수 있다.
또한, 본 명세서에서, 다르게 기재되지 않는 한, 서열번호 10의 아미노산 서열을 포함하는 폴리펩타이드를 암호화하는 폴리뉴클레오타이드는,
(a) 서열번호 10 또는 서열번호 13의 아미노산 서열로 이루어지거나 또는 이를 필수적으로 포함하는 폴리펩타이드를 암호화하는 폴리뉴클레오타이드, 및/또는
(b) 서열번호 10 또는 서열번호 13의 아미노산 서열과 96% 이상, 96.5% 이상, 97% 이상, 97.5% 이상, 98% 이상, 98.5% 이상, 99% 이상, 99.5% 이상, 또는 99.9% 이상의 상동성을 갖는 아미노산 서열로 이루어지거나 이를 필수적으로 포함하고 그람음성균에 대한 항생 활성을 갖는 (유지하는) 폴리펩타이드를 암호화하는 폴리뉴클레오타이드, 및/또는
(c) 서열번호 11 또는 서열번호 14의 핵산 서열을 포함하는 폴리뉴클레오타이드
를 의미할 수 있고,
서열번호 11 또는 서열번호 14의 핵산 서열을 포함하는 폴리뉴클레오타이드는
(d) 서열번호 11 또는 서열번호 14의 핵산 서열로 이루어지거나 또는 이를 필수적으로 포함하는 폴리뉴클레오타이드, 및/또는
(e) 서열번호 11 또는 서열번호 14의 핵산 서열과 96% 이상, 96.5% 이상, 97% 이상, 97.5% 이상, 98% 이상, 98.5% 이상, 99% 이상, 99.5% 이상, 또는 99.9% 이상의 상동성을 갖는 핵산 서열로 이루어지거나 이를 필수적으로 포함하고, 그람음성균에 대한 항생 활성을 갖는 (유지하는) 폴리펩타이드를 암호화하는 폴리뉴클레오타이드
를 의미하는 것일 수 있다.
본 명세서에서 제공되는 융합 폴리펩타이드에 있어서, 세크로핀 A와 엔도라이신은 펩타이드 링커를 통하여 연결되거나 펩타이드 링커 없이 직접 연결된 것일 수 있다. 상기 펩타이드 링커는 1 내지 100개, 2 내지 50개, 1 내지 30개, 2 내지 20개, 또는 2 내지 10개의 임의의 아미노산으로 이루어진 폴리펩타이드일 수 있으며, 그 포함된 아미노산 종류는 제한이 없다. 상기 펩타이드 링커는, 예컨대, Gly, Ser, Leu, Gln, Asn, Thr 및 Ala로 이루어진 군에서 선택된 1종 이상의 아미노산 잔기를 각각 하나 이상 포함할 수 있다. 펩타이드 링커에 적합한 아미노산 서열은 당 업계에 공지되어 있다. 한편, 상기 링커는 상기 융합 단백질의 구조 및/또는 기능에 영향을 미치지 않는 한도 내에서, 그 길이를 다양하게 결정할 수 있다. 예컨대, 상기 펩타이드 링커는 Gly, Ser, Leu, Gln, Asn, Thr 및 Ala로 이루어진 군에서 선택된 1종 이상을 총 1 내지 100개, 2 내지 50개, 1 내지 30개, 2 내지 20개, 또는 2 내지 10개를 포함하여 이루어진 것일 수 있다. 일 예에서, 상기 펩타이드 링커는 GSGSGS (서열번호 12), (G)4~10 (예, GGGGGG, GGGGGGGG, 등), (GGGGS)1~5 (예, (GGGGS)1, 등), (EAAAK)1-5 (예, (EAAAK)3, (EAAAK)5, 등), (EAAAK)4(GGGGS)1 등으로 표시되는 것일 수 있으나 이에 제한되는 것은 아니다.
재조합 벡터, 및 재조합 세포
다른 예는, 앞서 설명한 폴리펩타이드(서열번호 1 또는 서열번호 6의 아미노산 서열을 포함하는 폴리펩타이드) 또는 앞서 설명한 융합 폴리펩타이드(예컨대, 서열번호 10 또는 서열번호 13)를 암호화하는 폴리뉴클레오타이드를 포함하는 재조합 벡터를 제공한다. 상기 재조합 벡터는 발현 벡터로 사용될 수 있다.
다른 예는 상기 폴리펩타이드 또는 융합 폴리펩타이드를 적절한 숙주세포에서 발현시키는 단계를 포함하는, 상기 폴리펩타이드 또는 상기 융합 폴리펩타이드의 제조 방법을 제공한다. 상기 폴리펩타이드 또는 상기 융합 폴리펩타이드를 적절한 숙주세포에서 발현시키는 단계는 상기 폴리뉴클레오타이드 또는 이를 포함하는 재조합 벡터를 포함하는 재조합 세포를 배양하는 것에 의하여 수행될 수 있다. 상기 엔도라이신의 제조 방법은, 상기 발현시키는 단계 이후에, 발현된 엔도라이신을 분리 및/또는 정제하는 단계를 추가로 포함할 수 있다.
상기 폴리뉴클레오타이드 또는 벡터의 숙주세포로의 도입은 공지된 형질전환 방법을 당업자가 적절히 선택하여 수행될 수 있다. 본 명세서에서, 용어 "형질전환"은 상기 폴리펩타이드을 암호화하는 폴리뉴클레오타이드를 포함하는 벡터를 숙주 세포 내에 도입하여 숙주세포 내에서 상기 폴리뉴클레오타이드가 암호화하는 폴리펩타이드가 발현될 수 있도록 하는 것을 의미한다. 형질전환된 폴리뉴클레오타이드는 숙주 세포 내에서 발현될 수 있기만 한다면, 숙주 세포의 염색체 내에 삽입되어 위치하거나 염색체 외에 위치하거나 상관없이 이들 모두를 포함할 수 있다. 상기 폴리뉴클레오타이드는 숙주 세포 내로 도입되어 발현될 수 있는 것이면, 그 도입되는 형태는 제한이 없다. 예를 들면, 상기 폴리뉴클레오타이드는 자체적으로 발현되는데 필요한 모든 요소를 포함하는 유전자 구조체인 발현 카세트 (expression cassette)의 형태로 숙주 세포에 도입될 수 있다. 상기 발현 카세트는 통상 상기 폴리뉴클레오타이드에 작동 가능하게 연결되어 있는 프로모터 (promoter), 전사 종결신호, 리보좀 결합부위 및/또는 번역 종결신호 등의 발현 조절 요소를 포함할 수 있다. 상기 발현 카세트는 자체 복제가 가능한 발현 벡터 형태일 수 있다. 또한, 상기 폴리뉴클레오타이드는 그 자체의 형태로 숙주세포에 도입되어 숙주세포에서 발현에 필요한 서열과 작동 가능하게 연결되어 있는 것일 수도 있다. 상기에서 용어 "작동 가능하게 연결"된 것이란 상기 폴리뉴클레오타이드의 전사 조절 (예, 전사 개시)를 수행할 수 있도록 발현조절 요소 (예, 프로모터)와 폴리뉴클레오타이드가 기능적으로 연결되어 있는 것을 의미할 수 있다. 작동 가능한 연결은 당업계의 공지된 유전자 재조합 기술을 이용하여 수행할 수 있다.
상기 폴리뉴클레오타이드를 숙주 세포에 형질전환 하는 방법은 핵산을 세포(미생물) 내로 도입하는 어떠한 방법으로도 수행 가능하며, 숙주 세포에 따라 당 분야에서 공지된 형질전환 기술을 적절히 선택하여 수행할 수 있다. 상기 공지된 형질전환 방법으로 전기천공법 (electroporation), 인산칼슘 (CaPO4) 침전법, 염화칼슘 (CaCl2) 침전법, 미세주입법 (microinjection), 폴리에틸렌글리콜 (PEG) 침전법(polyethylene glycol-mediated uptake), DEAE-덱스트란법, 양이온 리포좀법, 리포펙션(lipofection), 초산 리튬-DMSO법 등이 예시될 수 있으나, 이에 제한되는 것은 아니다.
본 명세서에서, 용어 "벡터"는 적합한 숙주 내에서 목적 단백질을 발현시킬 수 있도록 적합한 조절 서열에 작동 가능하게 연결된 폴리뉴클레오타이드의 염기서열을 함유하는 DNA 구조체를 의미한다. 상기 조절 서열은 전사를 개시할 수 있는 프로모터, 전사를 조절하기 위한 임의의 오퍼레이터 서열, 적합한 mRNA 리보좀 결합부위를 암호화하는 서열, 및/또는 전사 및/또는 해독의 종결을 조절하는 서열을 포함할 수 있다. 벡터는 적당한 숙주 세포 내로 형질전환된 후, 숙주 세포의 게놈(유전체)과 무관하게 발현되거나, 숙주 세포의 게놈 내에 통합될 수 있다.
본 명세서에서 사용가능한 벡터는 숙주 세포 내에서 복제 가능한 것이면 특별히 한정되지 않으며, 통상 사용되는 모든 벡터들 중에서 선택될 수 있다. 통상 사용되는 벡터의 예로는 천연 상태이거나 재조합된 상태의 플라스미드, 코스미드, 바이러스, 박테리오파지 등을 들 수 있다. 예를 들어, 상기 벡터로서, 파지 벡터 또는 코스미드 벡터로서 pWE15, M13, MBL3, MBL4, IXII, ASHII, APII, t10, t11, Charon4A, 및 Charon21A 등을 사용할 수 있으며, 플라스미드 벡터로서 pBR계, pUC계, pBluescriptII계, pGEM계, pTZ계, pCL계 및 pET계 등을 사용할 수 있다. 구체적으로는　pDZ, pACYC177, pACYC184, pCL, pECCG117, pUC19, pBR322, pMW118, pCC1BAC 벡터 등을 예시할 수 있으나, 이에 제한되지 않는다.
상기 벡터는 상기 염색체 내 삽입 여부를 확인하기 위한 선별 마커(selection marker)를 추가로 포함할 수 있다. 상기 선별 마커는 벡터로 형질전환된 세포를 선별, 즉, 상기 폴리뉴클레오타이드의 삽입 여부를 확인하기 위한 것으로, 약물 내성, 영양 요구성, 세포 독성제에 대한 내성 또는 표면 단백질의 발현과 같은 선택가능 표현형을 부여하는 유전자들 중에서 선택되어 사용될 수 있다. 선택제(selective agent)가 처리된 환경에서는 선별 마커를 발현하는 세포만 생존하거나 다른 표현 형질을 나타내므로, 형질전환된 세포를 선별할 수 있다.
본 명세서에서 제공되는 폴리펩타이드는 천연 유래의 것이 아닐 수 있으며, 재조합적 또는 화학적으로 합성된 것일 수 있다. 상기 폴리펩타이드가 재조합적으로 생산되는 경우, 정제를 위하여 통상의 시그날 펩타이드, 절단부위, tag 등이 결합된 형태일 수 있다. 따라서, 비제한적인 일 예에서, 본 명세서에서 제공되는 폴리펩타이드는 단백질의 재조합적 생산 과정에 통상적으로 사용 가능한 시그날 펩타이드, 절단부위, tag (예컨대, His tag, GST (glutathione-s-transferase) tag, MBP (maltose binding protein) tag 등) 등으로 이루어진 군에서 선택된 하나 이상을 추가로 포함하는 형태이거나, 이들이 제거된 정제된 형태일 수 있다.
항생제
다른 예는,
(1) 서열번호 1 및 서열번호 6 중에서 선택된 하나 이상의 폴리펩타이드,
(2) 상기 폴리펩타이드 및 세크로핀 A를 포함하는 융합 폴리펩타이드 (예컨대, 서열번호 10), 또는 이들의 조합,
(3) 상기 (1) 폴리펩타이드를 암호화하는 폴리뉴클레오타이드,
(4) 상기 (2) 융합 폴리펩타이드를 암호화하는 폴리뉴클레오타이드,
(5) 상기 (3) 폴리뉴클레오타이드, 상기 (4) 폴리뉴클레오타이드, 또는 이들의 조합을 포함하는 재조합 벡터,
(6) 상기 (3) 폴리뉴클레오타이드, 상기 (4) 폴리뉴클레오타이드, 또는 이들의 조합 또는 상기 폴리뉴클레오타이드를 포함하는 재조합 벡터를 포함하는 재조합 세포, 및
(7) 서열번호 1의 폴리펩타이드, 이를 암호화하는 폴리뉴클레오타이드, 또는 이들의 조합을 포함하는 박테리오파지
로 이루어진 군에서 선택된 1종 이상을 포함하는, 항생제를 제공한다.
상기 항생제는 그람음성균에 대하여 항생효과를 갖는 것일 수 있다. 상기 그람음성균은 슈도모나스 속 세균, 아시네토박터 속 세균, 에스케리챠 속 세균, 엔테로박터 속 세균, 클렙시엘라 속 세균 등으로 이루어진 군에서 선택된 1종 이상 (예컨대, 1종, 2종, 3종, 4종, 또는 5종)일 수 있다. 예를 들어, 상기 슈도모나스 속 세균은 슈도모나스 에루기노사(Pseudomonas aeruginosa) 일 수 있고, 상기 아시네토박터 속 세균은 아시네토박터 바우마니(Acinetobacter baumannii)일 수 있고, 상기 에스케리챠 속 세균은 대장균(Escherichia coli)일 수 있고, 상기 엔테로박터 속 세균은 엔테로박터 에어로지너스(Enterobacter aerogenes)일 수 있고, 상기 클렙시엘라 속 세균은 클렙시엘라 뉴모니아(Klebsiella pneumoniae)일 수 있으나, 이에 제한되는 것은 아니다.
본 명세서에서 제공되는 항생제는 앞서 설명한 폴리펩타이드(서열번호 1 또는 서열번호 6의 아미노산 서열을 포함하는 폴리펩타이드) 또는 상기 융합 폴리펩타이드, 상기 폴리펩타이드 또는 상기 융합 폴리펩타이드를 암호화하는 폴리뉴클레오타이드, 상기 폴리뉴클레오타이드를 포함하는 재조합 벡터, 및 상기 폴리뉴클레오타이드 또는 이를 포함하는 재조합 벡터를 포함하는 재조합 세포로 이루어진 군에서 선택된 1종 이상 (이하, 제1 항생제)에 더하여, 다른 항생제 (제2 항생제)를 추가로 포함하는 것일 수 있다.
상기 제2 항생제는 통상적으로 사용되는 항생제, 예를 들어 그람음성균에 대하여 항생 활성을 갖는 항생제 중에서 선택된 1종 이상일 수 있다. 일 구체예에서, 상기 제2 항생제는 폴리믹신 (polymyxin) 계열 항생제일 수 있으며, 예컨대, 폴리믹신 B(polymyxin B), 콜리스틴 (Colistin), 또는 이의 조합일 수 있으나, 이에 제한되는 것은 아니다.
이와 같이, 항생제 (제1 항생제)를 다른 항생제 (제2 항생제)와 함께 병용함으로써, 제1 항생제 자체의 항생 효과에 의한 상승 효과 및 낮은 농도의 제2 항생제로도 우수한 항생 효과를 발휘할 수 있도록 하는 이점을 갖는다. 이로 인하여, 높은 농도의 항생제 사용에 의한 독성 (예컨대, 신장 독성, 간 독성 등) 등의 부작용을 감소시킬 수 있다. 또한, 다른 기전의 항생제 병용을 통한 항생제 내성균의 출현을 억제할 수 있다.
이에, 일 예는,
(a) (1) 서열번호 1 및 서열번호 6 중에서 선택된 하나 이상의 폴리펩타이드, (2) 상기 폴리펩타이드 및 세크로핀 A를 포함하는 융합 폴리펩타이드 (예컨대, 서열번호 10), 또는 이들의 조합, (3) 상기 (1) 폴리펩타이드를 암호화하는 폴리뉴클레오타이드, (4) 상기 (2) 융합 폴리펩타이드를 암호화하는 폴리뉴클레오타이드, (5) 상기 (3) 폴리뉴클레오타이드, 상기 (4) 폴리뉴클레오타이드, 또는 이들의 조합을 포함하는 재조합 벡터, (6) 상기 (3) 폴리뉴클레오타이드, 상기 (4) 폴리뉴클레오타이드, 또는 이들의 조합 또는 상기 폴리뉴클레오타이드를 포함하는 재조합 벡터를 포함하는 재조합 세포, 및 (7) 서열번호 1의 폴리펩타이드, 이를 암호화하는 폴리뉴클레오타이드, 또는 이들의 조합을 포함하는 박테리오파지로 이루어진 군에서 선택된 1종 이상; 및
(b) 항생제 (예컨대, 폴리믹신 B(polymyxin B), 콜리스틴 (Colistin), 또는 이의 조합 등의 polymyxin 계열 항생제 등)
를 포함하는 병용 항생제를 제공한다.
본 명세서에서, 용어 "항생제"는 그람음성균에 대하여 성장 저해능 및/또는 사멸능을 갖는 모든 형태의 제제를 포괄하는 것으로, 특별한 언급이 없는 한, 항균제, 방부제, 살균제 등과 호환적으로 사용될 수 있다.
약학 조성물
다른 예는 상기 항생제 또는 병용 항생제를 유효성분으로 포함하는 그람음성균의 감염 또는 그람음성균에 의하여 유발되는 질병의 예방 및/또는 치료용 약학 조성물을 제공한다.
다른 예는 상기 항생제 또는 병용 항생제의 약학적 유효량을 그람음성균의 감염 또는 그람음성균에 의하여 유발되는 질병의 예방 및/또는 치료를 필요로 하는 대상에게 투여하는 단계를 포함하는, 그람음성균의 감염 또는 그람음성균에 의하여 유발되는 질병의 예방 또는 치료 방법을 제공한다. 상기 예방 또는 치료 방법은, 상기 투여하는 단계 이전에, 그람음성균의 감염 또는 그람음성균에 의하여 유발되는 질병의 예방 또는 치료를 필요로 하는 대상을 확인하는 단계를 추가로 포함할 수 있다. 상기 그람음성균은 앞서 설명한 바와 같다.
상기 그람음성균에 의하여 유발되는 질병은 그람음성균의 감염이 원인이 되는 모든 질병들 중에서 선택될 수 있으며, 예컨대, 피부감염, 욕창, 폐렴, 균혈증, 패혈증, 심내막염, 수막염, 외이도염, 중이염, 각막염, 골수염, 장염, 복막염, 낭포성섬유증 등과 같은 슈도모나스 속 세균에 의하여 유발되는 질병; 피부감염, 폐렴, 균혈증, 패혈증 등과 같은 아시네토박터 속 세균에 의하여 유발되는 질병; 장염, 크론병, 궤양성 대장염, 세균성이질, 요로감염증, 피부감염, 균혈증, 패혈증 등과 같은 에스케리챠 속 세균에 의하여 유발되는 질병 등으로 이루어진 군에서 선택될 수 있으나, 이에 제한되는 것은 아니다.
본 명세서에서 사용된 바로서, 약학적 유효량은 소망하는 효과를 얻을 수 있는 유효성분의 함유량 또는 투여량을 의미한다. 상기 약학 조성물 내의 유효 성분의 함유량 또는 투여량은 제제화 방법, 투여 방식, 환자의 연령, 체중, 성, 병적 상태, 음식, 투여 시간, 투여 간격, 투여 경로, 배설 속도 및 반응 감응성과 같은 요인들에 의해 다양하게 처방될 수 있다. 예컨대, 상기 유효성분이 폴리펩타이드인 경우, 1회 투여량은 0.001 내지 1000 mg/kg, 0.01 내지 100 mg/kg, 0.01 내지 50 mg/kg, 0.01 내지 20 mg/kg, 0.01 내지 10mg/kg, 0.01 내지 5mg/kg, 0.1 내지 100 mg/kg, 0.1 내지 50 mg/kg, 0.1 내지 20 mg/kg, 0.1 내지 10mg/kg, 0.1 내지 5mg/kg, 1 내지 100 mg/kg, 1 내지 50 mg/kg, 1 내지 20 mg/kg, 1 내지 10mg/kg, 또는 1 내지 5mg/kg 범위일 수 있으나, 이에 제한되는 것은 아니다.
다른 예에서, 약학 조성물 내 유효 성분의 함량은, 전체 약학 조성물 중량 기준으로, 0.01중량% 내지 99.9중량%, 0.01중량% 내지 90중량%, 0.01중량% 내지 80중량%, 0.01중량% 내지 70중량%, 0.01중량% 내지 60중량%, 0.01중량% 내지 50중량%, 0.01중량% 내지 40중량%, 0.01중량% 내지 30중량%, 1중량% 내지 99.9중량%, 1중량% 내지 90중량%, 1중량% 내지 80중량%, 1중량% 내지 70중량%, 1중량% 내지 60중량%, 1중량% 내지 50중량%, 1중량% 내지 40중량%, 1중량% 내지 30중량%, 5중량% 내지 99.9중량%, 5중량% 내지 90중량%, 5중량% 내지 80중량%, 5중량% 내지 70중량%, 5중량% 내지 60중량%, 5중량% 내지 50중량%, 5중량% 내지 40중량%, 5중량% 내지 30중량%, 10중량% 내지 99.9중량%, 10중량% 내지 90중량%, 10중량% 내지 80중량%, 10중량% 내지 70중량%, 10중량% 내지 60중량%, 10중량% 내지 50중량%, 10중량% 내지 40중량%, 또는 10중량% 내지 30중량%일 수 있으나, 이에 제한되는 것은 아니다.
또한, 상기 약학 조성물은, 상기 유효 성분 이외에, 약학적으로 허용 가능한 담체를 추가로 포함할 수 있다. 상기 약학적으로 허용 가능한 담체는 단백질, 핵산, 또는 세포를 포함하는 약물의 제제화에 통상적으로 이용되는 것으로서, 생물체를 자극하지 않고 유효성분의 생물학적 활성 및/또는 특성을 저해하지 않는 담체를 의미할 수 있다. 일 예에서, 상기 담체는 락토스, 덱스트로스, 수크로스, 솔비톨, 만니톨, 전분, 아카시아 고무, 인산 칼슘, 알기네이트, 젤라틴, 규산 칼슘, 미세결정성 셀룰로스, 폴리비닐피롤리돈, 셀룰로스, 물, 시럽, 메틸 셀룰로스, 메틸히드록시벤조에이트, 프로필히드록시벤조에이트, 활석, 스테아르산 마그네슘, 미네랄 오일 등으로 이루어진 군에서 선택된 1종 이상일 수 있으나, 이에 한정되는 것은 아니다. 상기 약학 조성물은 또한 약학 조성물 제조에 통상적으로 사용되는 희석제, 부형제, 윤활제, 습윤제, 감미제, 향미제, 유화제, 현탁제, 보존제 등으로 이루어진 군에서 선택된 1종 이상을 추가로 포함할 수 있다.
상기 약학 조성물의 투여 대상은 인간, 원숭이 등의 영장류, 마우스, 래트 등의 설치류, 개, 고양이, 돼지, 소, 말, 양, 염소, 등의 가축류, 닭, 오리, 거위, 꿩, 메추리, 칠면조 등의 가금류　등을 포함하는 포유류에서 선택된 1종 이상, 또는 이들로부터 유래하는 세포, 조직, 또는 이들의 배양물일 수 있다.
상기 약학 조성물은 경구 투여 또는 비경구적 투여에 의하여 투여되거나, 세포, 조직, 또는 체액에 접촉시킴으로써 투여되는 것일 수 있다. 구체적으로, 비경구 투여인 경우에는 피하 주입, 근육 주입, 정맥내 주입, 복강 주입, 내피 투여, 국소 투여, 비내 투여, 폐내 투여 및 직장내 투여 등으로 투여할 수 있다. 경구 투여시, 단백질 또는 펩타이드는 소화가 되기 때문에 경구용 조성물은 활성 약제를 코팅하거나 위에서의 분해로부터 보호되도록 제형화 되어야 한다. 비내 투여시, 상기 약학 조성물을 희석하여 분무기나 분무 시스템을 통해 비강으로 흡수되도록 하는 비강 분무를 통하여 투여될 수 있으며, 상기 비강 분무를 위한 비강 분무제 또는 호흡기용 제형으로는 에어로졸제 등을 들 수 있다.
또한 상기 약학 조성물은 오일 또는 수성 매질중의 용액, 주사제, 현탁액, 시럽제, 유화액 형태, 도포제, 패치, 엑스제, 산제, 분말제, 과립제, 정제, 캅셀제, 에어로졸제 등의 형태로 제형화될 수 있으며, 제형화를 위하여 분산제 또는 안정화제를 추가적으로 포함할 수 있다.
다른 예는 상기 항생제 또는 병용 항생제를 유효성분으로 포함하는 사료 첨가제를 제공한다.
다른 예는 상기 사료 첨가용 조성물을 포함하는 사료를 제공한다.
상기 사료는　상기 항생제 또는 병용 항생제를 사료 첨가제 형태로 따로 제조하여 사료에 혼합하거나, 사료 제조 시 직접 첨가하여 제조할 수 있다.
상기 사료 내　항생제 또는 병용 항생제는 액상 또는 건조 상태일 수 있으며, 예컨대, 건조된 분말형태일 수 있다. 상기 항생제는 전체 사료 중량의 0.005 내지 10 중량%, 0.05 내지 10 중량%, 0.1 내지 10 중량%, 0.005 내지 5 중량%, 0.05 내지 5 중량%, 0.1 내지 5 중량%, 0.005 내지 2 중량%, 0.05 내지 2 중량%, 또는 0.1 내지 2 중량%의 양으로 포함될 수 있으나, 이에 제한되는 것은 아니다. 또한, 상기 사료는 상기 항생제 또는 병용 항생제　외에 사료의 보존성을 높일 수 있는 통상의 첨가제들을 추가로 포함할 수 있다.
본 명세서에서, 상기 항생제 또는 병용 항생제가 첨가될 수 있는 사료는 시판되는 사료, 또는 곡물류, 근과류, 식품가공 부산물류, 조류, 섬유질류, 제약 부산물류, 유지류, 전분류, 박류, 곡물부산물류, 단백질류, 무기물류, 유지류, 광물성류, 단세포 단백질, 동물성 플랑크톤류, 남은 음식물 등으로 이루어진 군에서 선택될 수 있으나, 이에 제한되는 것은 아니다.
다른 예는 상기 항생제 또는 병용 항생제를 유효성분으로 포함하는 식품 첨가제 또는 음용수 첨가제를 제공한다. 상기 항생제 또는 병용 항생제를 음용수에 혼합하여 공급함으로써, 음용수 내의 그람음성균의 숫자를 감소시킬 수 있다. 상기 그람음성균은 앞서 설명한 바와 같다.
다른 예는 상기 항생제 또는 병용 항생제를 유효성분으로 포함하는 소독제를 제공한다. 다른 예는 상기 항생제 또는 병용 항생제를 소독이 필요한 대상에 적용하는 단계를 포함하는, 소독 방법을 제공한다. 상기 소독제는 병원균 감염을 막기 위한 제제를 총칭하는 것으로, 일반 생활 소독제, 식품 및 조리 장소 및 설비의 소독제, 양계장, 축사 등의 건물, 축체, 음수, 깔짚, 난좌, 운반차량, 식기 등의 각종 생육 용품의 소독 등에 사용될 수 있다.
다른 예는 상기 항생제 또는 병용 항생제를 유효성분으로 포함하는 세척제를 제공한다. 다른 예는 상기 항생제 또는 병용 항생제를 세척이 필요한 대상에 적용하는 단계를 포함하는, 세척 방법을 제공한다. 상기 항생제가 그람음성균에 대하여 항생 효과를 가지므로, 그람음성균에 노출되었거나 노출될 가능성이 있는 개체의 피부 표면 또는 신체 각 부위 등을 세척(세정)하는 용도로 적용될 수 있다. 상기 그람음성균은 앞서 설명한 바와 같다.
본 명세서에서 제공되는 신규한 폴리펩타이드, 상기 폴리펩타이드의 변이체, 또는 신규한 융합 폴리펩타이드는 다양한 그람음성균에 대하여 우수한 세포외막 투과능 및 사멸능을 나타내어, 그람음성균에 대한 항생제로서 유용하게 사용될 수 있다.
도 1은 슈도모나스 에루기노사를 감염하는 박테리오파지 PBPA90의 엔도라이신(LNT101) 유전자를 발현하는 발현벡터의 개열지도이다.
도 2는 박테리오파지 PBPA90 유래의 엔도라이신(LNT101)의 정제과정을 보여준다.
도 3은 박테리오파지 PBPA90 유래의 엔도라이신(LNT101)의 시험관 내 슈도모나스 에루기노사에 대한 항생 효과를 보여주는 그래프이다.
도 4는 박테리오파지 PBPA90 유래의 엔도라이신(LNT101)의 생체내 슈도모나스 에루기노사에 대한 항생 효과를 보여주는 그래프이다.
도 5는 일 실시예에 따른 엔도라이신(LNT102) (서열번호 6)과 엔도라이신(LNT101) (서열번호 1)의 아미노산 서열을 비교하여 보여준다.
도 6은 엔도라이신(LNT102) 발현을 위한 발현벡터 pBT7-LNT102의 개열지도이다.
도 7은 엔도라이신(LNT102)의 정제과정 중 얻어진 반응물의 SDS-PAGE 결과를 보여준다.
도 8은 엔도라이신(LNT102) 및 엔도라이신(LNT101)의 다양한 그람음성균에 대한 사멸능을 보여주는 그래프이다.
도 9 및 10은 엔도라이신(LNT102)의 농도 및 처리 시간에 따른 그람음성균 사멸능을 보여주는 그래프이다.
도 11은 일 실시예에 따른 융합 폴리펩타이드 (LNT103)의 모식도이다.
도 12는 일 실시예에 따른 융합 폴리펩타이드 (LNT103)의 정제과정 중 얻어진 반응물의 SDS-PAGE 결과를 보여주는 이미지이다.
도 13은 엔도라이신(LNT101), 엔도라이신 변이체(LNT102), 및 융합 폴리펩타이드 (LNT103)의 다양한 그람음성균에 대한 outerm membrane permeabilization 활성을 보여주는 그래프이다.
도 14는 엔도라이신(LNT101), 엔도라이신 변이체(LNT102), 및 융합 폴리펩타이드 (LNT103)의 다양한 그람음성균에 대한 사멸능을 보여주는 그래프이다.
도 15는 융합 폴리펩타이드 LNT103 및 CecA-LNT101의 다양한 그람음성균에 대한 사멸능을 보여주는 그래프이다.
도 16는 일 실시예에 따른 융합 폴리펩타이드 (LNT103)과 세크로핀 A의 그람음성균 사멸능을 비교하여 보여주는 그래프이다.
도 17은 일 실시예에 따른 융합 폴리펩타이드 (LNT103)의 농도 및 처리 시간에 따른 그람음성균 사멸능을 보여주는 그래프이다.
도 18 및 19는 일 실시예에 따른 융합 폴리펩타이드 (LNT103)의 독성 (cytotoxicity and hemolysis assay) 평가 결과를 보여주는 그래프이다.
도 20은 아시네토박터 바우마니 전신감염 마우스 모델에서 융합 폴리펩타이드 LNT103 처리시의 생존률을 colistin 처리시와 비교하여 보여주는 그래프이다.
본 명세서에서 제공되는 신규한 엔도라이신 및/또는 이를 발현하는 박테리오파지는 슈도모나스 속 세균, 예컨대, 슈도모나스 에루기노사에 대하여 우수한 성장 억제능 및 사멸능을 나타내어, 슈도모나스 속 세균, 예컨대, 슈도모나스 에루기노사에 대한 항생제로서 유용하게 사용될 수 있다.
실시예 1: LNT101 엔도라이신의 제조 및 항생 활성 시험
1.1. 슈도모나스 에루기노사 균을 사멸시킬 수 있는 박테리오파지의 분리
1.1.1. 균주의 배양조건
슈도모나스 에루기노사(PR01957)을 숙주로 사용하였으며, LB(Luria-Bertani) 배지에서 37℃ 조건으로 진탕배양 하였다.
1.1.2. 박테리오파지의 분리
슈도모나스 에루기노사에 감염하는 박테리오파지를 선별하기 위하여, 대한민국 경기도 과천시 과천하수처리장에서 샘플을 채취하였다. 상기 채취한 샘플과 슈도모나스 에루기노사를 37℃에서 3시간 진탕배양 한 후, 500 rpm으로 20분간 원심분리하여 상등액을 회수하였다. 이어 상등액을 0.45㎛ 필터로 여과한 후, 이중 아가층 플라크 분석법(double agar layer plaque assay)을 수행하였다.
상기 분석법을 간략히 설명하면, 상층(top) 아가 5 ml에 상기 숙주 박테리아 슈도모나스 에루기노사와 박테리오파지의 배양액을 0.1 M.O.I.로 섞어 아가플레이트에 붓고 37℃에서 24시간 동안 배양하여 플라크를 수득하였다. 상기 과정의 반복수행을 통하여 정제된 순수 박테리오파지를 확보할 수 있었고, 이 박테리오파지를 박테리오파지 PBPA90으로 명명하였다.
1.2: 박테리오파지 PBPA90의 유전체 분리 및 분석
상기 실시예 1.1에서 확보된 박테리오파지 PBPA90의 유전체에 대한 서열분석을 실시하였다. 200 ml의 LB 배지에 슈도모나스 에루기노사를 OD600=0.5까지 배양한 후, 여기에 여과한 박테리오파지 109 pfu/ml 또는 0.1 M.O.I.로 감염시켜 용균하였다.　 이후 여기에 염화나트륨을 최종농도 1 M이 되도록 추가한 후 4℃에 1시간 방치하였다.　 이어 11,000 x g에서 10분간 원심분리 한 후, 침전물에 PEG(Polyethylene glycol 8000)를 10%(w/v)로 넣고, 4℃에 1시간 두었다.　 이어, 11,000 x g에서 10분간 원심분리 한 후, 상층액을 제거하고, 침전물을 SM 완충액[100 mM NaCl, 10 mM MgSO4(heptahydrate), 50 mM Tris-HCl, pH 7.5]으로 현탁하였다.　 여기에 클로로포름을 1:1의 비율로 넣고 볼텍스한 후 3,000 x g으로 15분간 원심분리하여 상층액을 얻었다.　
폴리카보네이트 시험관에 40%(w/v) 글리세롤 3 ml을 넣고, 이어 5%(w/v) 글리세롤 4 ml을 섞이지 않게 넣었다.　 여기에 상기 준비한 상층액을 넣고 4℃에서 11,000 x g로 1시간 원심분리하였다. 이어 상등액을 제거한 후 침전물을 SM 완충액으로 재현탁하여 박테리오파지 유전체 DNA를 얻었다. 박테리오파지 유전체 DNA는 phage DNA isolation kit (Norgen biotek corp.)를 제조사 매뉴얼에 따라 사용하여 분리하였다. 상기와 같이 분리된 유전체 시료를 이용하여 유전체에 대한 염기서열을 분석하였다(엘에이에스, Illumina MiSeq platform).
최종적으로 분석된 박테리오파지 PBPA90 유전체는 전체 핵산 서열 길이가 304,052bp이며, 44% GC content를 가진다. 상기 박테리오파지 PBPA90 유전체의 전장 핵산 서열을 서열번호 5에 나타내었다. 상기 유전체 핵산 서열 정보를 기반으로 Web 상의 BLAST를 이용하여 기존에 알려진 박테리오파지 유전체 서열과의 상동성(Similarity)을 조사하였다. BLAST 조사 결과, 박테리오파지 PBPA90의 유전체 서열은 슈도모나스 박테리오파지 KTN4 (GenBank accession No.: KU521356.1)와 낮은 서열 상동성을 가진 것으로 확인되었다(query coverage: 4%, identity: 97.34%). 이러한 사실에 근거하여 박테리오파지 PBPA90은 기존에 알려지지 않은 새로운 박테리오파지임을 확인하였다.
1.3: LNT101 엔도라이신의 클로닝 및 정제
상기 분석된 박테리오파지 PBPA90의 유전체 서열(서열번호 5)에 대한 ORF search를 통해 180,029 - 180,806 위치의 780 bp(서열번호 2)의 ORF가 엔도라이신 유전자일 것으로 추정하고, 상기 박테리오파지 PBPA90 유래의 엔도라이신 및 이를 암호화하는 유전자를 각각 LNT101 엔도라이신 및 LNT101 유전자로 명명하였다.
Primer (F: 5'-aaggatccatgggtactgtactcaaacgtggc-3'(서열번호 3), R: 5'-aactcgagtgcccgatgtttcgaaactttatcttc-3' (서열번호 4))를 이용하여 박테리오파지 PBPA90의 유전체에 대하여 PCR(polymerase chain reaction)을 수행하여 LNT101 유전자(서열번호 5 내의 180,029 - 180,806 위치의 780 bp길이의 핵산 서열)를 얻었다. 상기 LNT101 유전자에 의하여 암호화되는 LNT101 엔도라이신의 아미노산 서열을 서열번호 1 (259 aa)에 나타내었다. 상기 PCR은 다음 조건에서 수행하였다: step 1: 94℃, 5분; step 2: 94℃, 30초; step 3: 52℃, 45초; step 4: 72℃, 1분; step 5: step2-4를 30회 반복; step 6: 72℃, 10분. 상기 얻어진 PCR 산물을 N-terminal 6X His-tag를 가진 pET-21a vector(Novagen)의 BamHI/XhoI site로 cloning 하여, LNT101 엔도라이신 발현을 위한 발현 벡터(pET-LNT101 plasmid)를 준비하였다, 상기 준비된 발현벡터 pET-LNT101를 도 1에 모식적으로 나타내었다.
상기 준비된 pET-LNT101 plasmid를 대장균 BL21-pLysS strain(Novagen)에 transformation 한 후, LB broth (1% Tryptone, 0.5%(w/v) Yeast extract, 0.5%(w/v) NaCl)에서 OD600=0.5까지 배양하였다. 이후 1 mM IPTG (Isopropyl β-d-1-thiogalactopyranosid)를 첨가한 후 37℃에서 4 시간 동안 진탕배양하였다. Cell harvest 후, lysis buffer (50 mM NaH2PO4, 300 mM NaCl, 10 mM imidazole)로 재현탁하고, 1 mM PMSF 및 1 mg/ml lysozyme을 넣고 얼음에서 30 분간 정치하였다. Sonication으로 세포를 용해하고, 13,000 rpm에서 40분 원심분리하여 상층액을 얻었다. 이를 Ni-NTA 아가로오스 레진 (Qiagen)이 packing된 column에 통과시켰다. 이후 wash buffer (50 mM NaH2PO4, 300 mM NaCl, 30 mM imidazole)로 wash 후, elution buffer (50 mM NaH2PO4, 300 mM NaCl, 300 mM imidazole)로 elution하여, LNT101단백질 (6xHis tag 포함)을 정제하였다.
15% SDS-PAGE로 LNT101단백질의 순도를 확인하고 Bradford assay로 LNT101단백질의 농도를 측정하였다. 상기 정제과정 중에 얻어진 각각의 반응물을 SDS-PAGE를 통해 확인한 결과를 도 2에 나타내었다. SDS-PAGE를 통해 확인한 상기 정제한 LNT101 단백질의 분자량은 약 28kDa이었다. 상기 LNT101 단백질의 아미노산 서열을 서열번호 1에 나타내었다.
1.4. 박테리오파지 PBPA90 및 그 유래 엔도라이신 LNT101의 타겟 박테리아 스펙트럼 조사
본 실시예에서는 상기 실시예 1.1 및 1.2에서 선별된 박테리오파지 PBPA90 및 실시예 1.3에서 분리정제된 엔도라이신 LNT101의 표적 박테리아 스펙트럼 조사하기 위하여, 슈도모나스 에루기노사 ATCC13388, ATCC9027, ATCC10145, ATCC15692, ATCC15522, ATCC25619, ATCC27853, CCARM2134, CCARM2200, CCARM2029, CCARM2144, CCARM2298, CCARM2326, PR01957, 대장균 ATCC8739, 엔테로박터 클로아세 CCARM0252, 클렙시엘라 뉴모니아 KCTC2261, 클렙시엘라 에어루지너스 CCARM16006, 캠필로박터 제주니 KCTC5327, 크로노박터 사카자키 KCTC2949, 살모넬라 티피뮤리움 ATCC14028, 살모넬라 엔테리티디스 ATCC13076와 같은 그람음성균에 대한 항균활성을 시험하였다.　
　박테리오파지 PBPA90과 엔도라이신 LNT101의 타겟 박테리아 스펙트럼은 spot test로 확인하였다. Spot test는 4 ml의 top agar (1% Tryptone, 0.5% Yeast extract, 0.5% NaCl, 0.7% agar)에 멸균한 박테리아를 1x1011 CFU/200㎕ 넣어 LB plate에 부었다. top agar가 굳은 후 박테리오파지 PBPA90 10㎕ (1 x 108 PFU/ml) 또는 LNT101 10㎕ (2 mg/ml)을 spotting 하고 37℃, 18시간 incubation(배양) 하였다.
상기 배양 결과 형성된 halo zone의 생성 여부를 확인하여, 그 결과를 하기의 표 1에 나타내었다:
Host LNT101
P. aeruginosa ATCC 13388 ○
ATCC 9027 ○
ATCC 10145 ○
ATCC 15692 ○
ATCC 15522 ○
ATCC 25619 ○
ATCC 27853 ○
CCARM 2134 ○
CCARM 2200 ○
PR1957 ○
CCARM 2029 ○
CCARM 2144 ○
CCARM 2298 ○
CCARM 2326 ○
E. coli ATCC 8739 ○
E. cloacae CCARM 0252 ○
K. pneumoniae KCTC 2261 ○
K. aerugenes CCARM 16006 ○
C. jejuni KCTC 5327 ○
C. sakazakii KCTC 2949 ○
S. typhimurium ATCC 14028 ○
S. enteritidis ATCC 13076 ○
(상기 표 1에서, '○'는 halo zone 생성을 의미함) 표 1에 나타난 바와 같이, 엔도라이신 LNT101은 시험된 모든 그람음성균, 즉, 슈도모나스 에루기노사, 대장균, 엔테로박터 클로아세, 클렙시엘라 뉴모니아, 캠필로박터, 크로노박터, 및 살모넬라 균주에서 halo zone을 형성하였다. 이러한 결과는 엔도라이신 LNT101이 상기한 바와 같은 다양한 그람음성 세균의 peptidoglycan에 대한 분해능을 가지고, 넓은 타겟박테리아 스펙트럼을 가짐을 보여준다.
1.5. 엔도라이신 LNT101의 슈도모나스 에루기노사에 대한 사멸능 조사
본 실시예에서는 상기 실시예 1.4에서 박테리오파지 PBPA90과 엔도라이신 LNT101이 항균활성을 갖는 것으로 확인된 슈도모나스 에루기노사(ATCC 13388)를 대상으로 엔도라이신 LNT101의 박테리아 사멸능을 시험하였다.
In vitro 시험
이를 위하여, 0.1, 0.5, 1.0 μM 농도의 엔도라이신 LNT101과 슈도모나스 에루기노사(ATCC 13388) 1 X 106CFU를 reaction buffer (20 mM Tris-Cl, pH 7.5)에 최종 부피가 200 ㎕가 되도록 넣고, 37℃에서 1 시간 동안 정치하였다. 30분, 1시간 및 2시간 후, 슈도모나스 에루기노사의 콜로니 수를 확인하여, 그 결과를 도 3에 나타내었다. 도 3에 나타난 바와 같이, 엔도라이신 LNT101은 시험된 모든 처리 용량 및 시간에서 슈도모나스 에루기노사에 대한 사멸능을 가짐을 확인되었고, 이러한 슈도모나스 에루기노사 사멸능은 처리 시간 및 용량 의존적인 것으로 나타났다.
또한 LNT101 엔도라이신은 다양한 그람 음성균에서 항균능이 있음을 CFU reduction test로 확인하여, 그 결과를 하기의 표 2에 나타내었다.
Host LNT101
P. aeruginosa ATCC 13388 ○
ATCC 15522 ○
CCARM 2092 ○
CCARM 2134 ○
CCARM 2144 ○
CCARM 2326 ○
F141 ○
PAO1 ○
A. baumannii ATCC 2508 ○
F4 ○
F15 ○
E. cloacae CCARM 0252 ○
K. aerugenes CCARM 16006 ○
(상기, 표 2에서, '○'는 CFU reduction assay를 통해 0.5 log CFU 이상의 감소를 의미함)표 2에 나타난 바와 같이, 항생제 내성균을 포함한 슈도모나스 에루기노사 8 종, 아시네토박터 바우마니 3종, 엔테로박터 클로아세 1종, 클렙시엘라 에어루지너스 1종의 시험된 모든 그람음성균에서 용량 의존적으로 세균 사멸 효과를 가짐을 확인하였다.
In vivo 시험
엔도라이신 LNT101의 슈도모나스 에루기노사 사멸능을 in vivo에서도 확인하였다. 상기 in vivo유효성 평가를 위한 동물모델로서 Galleria mellonella를 사용하였다. 상기 Galleria mellonella 모델은 건강군(비감염군), 슈도모나스 에루기노사 감염군(약물 비투여군), 감염모델에 LNT101를 투여한 2개의 LNT101 투여군, 슈도모나스 에루기노사 감염모델에 colistin을 투여한 colistin 투여군, 슈도모나스 에루기노사 감염모델에 LNT101과 colistin을 병용투여한 병용투여군으로 나누어 실험을 진행하였으며, 각 군당 10마리의 Galleria mellonella를 사용하였다.
슈도모나스 에루기노사 감염모델은 슈도모나스 에루기노사 PAO1을 LD80 농도인 50 CFU/larva 감염하여 준비하였고, LNT101은 0.6 μg/larva (3 mg/Kg), 6 μg/larva (30 mg/Kg)를 각각 투여하였다. Colistin은 0.5 μg/larva (2.5 mg/Kg)를 투여하였고 병용투여는 Colistin 0.5 μg/larva (2.5 mg/Kg)과 LNT101 6 μg/larva (30 mg/Kg)를 투여하였다. 72시간 관찰 결과 Galleria mellonella의 생존률을 도 4에 나타내었다. 도 4에 나타난 바와 같이, 감염군은 100% 사망하였지만 LNT101 및 colistin 투여군에서는 생존율이 증가함을 확인하였다. 특히 LNT101 6 μg/larva (30 mg/Kg) 투여군에서는 30%의 생존율을 확인하였다.
1.6. 엔도라이신 LTN101과 polymyxin 항생제와의 슈도모나스 에루기노사 사멸능 상승 효과
세균의 세포막에 작용하는 기전을 갖는 polymyxin 계열 항생제와 엔도라이신 LNT101의 병용 처리에 의한 상승효과를 확인하였다. 구체적으로, Microplate에 polymyxin B (32 μg/ml - 0.03 μg/ml)와 colistin (128 μg/ml - 0.1 μg/ml)을 1/2씩 well당 희석을 한 후, LNT101 엔도라이신을 1 μM 병용 처리군 및 동량의 PBS 처리군을 만들었다. 모든 well에 p. aeruginosa 1 x 105 CFU/ml을 total 100 ㎕로 처리하였다. 이후 18 시간, 37℃에서 배양하였다. MIC (Minimum Inhibitory Concentration)는 균이 자라지 않은 well의 최소 polymyxin 계열 항생제의 농도값을 의미하며, MIC 시험은 broth microdilution technique으로 수행하였다.
다양한 농도의 polymyxin 계열 항생제 (polymyxin B, Colistin)와 LNT101 엔도라이신의 병용 처리에 의한 polymyxin 계열 항생제의 MIC 변화를 확인하여, 하기의 표 3에 나타내었다.
Polymyxin B Polymyxin B + LNT101 Colistin Colistin + LNT101
MIC of antibiotics 4 μg/ml 2.7 μg/ml 8 μg/ml 4 μg/ml
표 3에 나타난 바와 같이, LNT101엔도라이신 병용 시, polymyxin 계열 항생제인 polymyxin B 및 Colistin의 MIC가 50% 감소하는 것을 확인하였다.
실시예 2. LNT102 엔도라이신의 제작 및 항생 활성 시험
2.1. 엔도라이신 활성을 갖는 신규한 폴리펩타이드의 발굴
실시예 1.3에서 분리정제된 엔도라이신 LNT101 (서열번호 1)은 PG_binding_1 domain(10-65 amino acid)과 transglycosylase SLT domain(95-179 amino acid)으로 구성되어 있다.
엔도라이신 LNT101 PG_binding_1 domain의 아미노산 서열을 BLASTp 분석으로 유사 아미노산 서열을 가진 유전자인 Thermoanaerobacterium phage THSA-485A의 glycoside hydrolase family 25 (accession no. YP_006546280.1), Serratia phage phiMAM1의 peptidoglycan binding protein (accession no. YP_007349105.1), Serratia phage 2050H1 peptidoglycan binding protein (accession no. ASZ78903.1), Serratia phage vB_SmaA_3M의 putative peptidoglycan binding protein (accession no. AYP28388.1), Enwinia phage vB_EamM-Bue1의 putative peptidoglycan binding protein (accession no. AVO22912.1), Pseudomonas phage Noxifer의 putative peptidoglycan binding protein (accession no. YP_009609055.1), Salmonella phage Mutine의 endolysin (accession no. AUG88272.1) 및 Salmonella phage bering의 peptidoglycan binding protein (accession no. QIQ61961.1)의 아미노산 서열을 비교하여 LNT101 엔도라이신과 다른 아미노산 부위를 비교 단백질의 우점 아미노산 서열로 11개 아미노산을 치환하였다.
LNT101 엔도라이신 transglycosylase SLT domain의 아미노산 서열을 BLASTp 분석으로 유사 아미노산 서열을 가진 유전자인 Pseudomonas phage Noxifer의 tail fiber protein (accession no. YP_009609112.1), Pseudomonas phage SL2의 hypothetical protein SL2_199 (accession no. YP_009619739.1), Pseudomonas phage KTN4의 putative endolysin (accession no. ANM44938.1), Pseudomonas phage phiKZ의 PHIKZ144 (accession no. NP_803710.1), Pseudomonas phage Psa21의 tail fiber protein (accession no. QBJ02724.1) 및 Pseudomonas phage vB_PaeM_PS119XW의 hypothetical protein (accession no. QEM41943.1)의 아미노산 서열을 비교하여 LNT101 엔도라이신과 다른 아미노산 부위를 비교 단백질의 우점 아미노산 서열로 4개의 아미노산을 치환하였다.
15개의 치환된 아미노산 서열 부분은 LNT101 유전자 서열 부분에서 codon usage를 고려하여 변경하였고(서열번호 7), 이를 LNT102 (서열번호 6)로 명명하였다. LNT101과 LNT102의 서열 비교는 도 5에 나타내었다. LNT102는 유전자 합성 및 C-terminal 6 X histidine tag이 부착된 pBT7-C-His vector(바이오니아)에 cloning 하였다. 이와 같이 준비된 LNT102의 발현벡터 pBT7-LNT102를 도 6에 모식적으로 나타내었다.
상기 기재된 LNT102 및 LNT101의 서열을 아래의 표 4에 정리하였다:
아미노산 서열 (N→C) 또는 핵산 서열 (5'→3') 서열번호
Endolysin LNT102 MGTVLKRGDRGSAVEDLQMKLNVAGYNLSADGIFGGDTEKAVRDVQAGAGLVVDGKVGPKTLYAIAKSATVPAKWEAIPFPTANKSRSAAMPTLNAVGAMTGVDSRLLATFASIESAFDYTVKAKTSSATGWFQFLDATWDDMIKAYGSKYGIPKDPTRALRKDPRANALMGAEFIKGNAAVLRPVINREPSDTDLYLAHFLGAGGAKKFLSADQKTLGEVLFPKPAKANPSIFSNKGVPRTLAEIYKLFEDKVSKHRA 6
Endolysin LNT102 coding gene ATGGGTACTGTACTCAAACGTGGCGACCGCGGCTCTGCTGTGGAAGATCTACAAATGAAACTTAACGTCGCAGGATACAACCTGAGCGCTGACGGAATCTTCGGTGGAGATACAGAGAAAGCTGTTCGTGATGTGCAAGCTGGCGCGGGCTTGGTGGTTGACGGAAAAGTTGGACCTAAAACTCTATATGCGATTGCCAAATCCGCTACTGTTCCTGCTAAATGGGAAGCTATCCCTTTCCCAACAGCTAATAAATCTCGGTCGGCTGCAATGCCCACTCTGAATGCGGTTGGAGCAATGACTGGTGTGGATTCTCGGTTACTCGCTACATTCGCTTCCATTGAGTCTGCTTTTGATTACACTGTCAAAGCAAAAACATCTTCGGCTACTGGTTGGTTCCAGTTCCTTGATGCTACATGGGATGACATGATCAAAGCATATGGTTCCAAATACGGGATACCTAAAGATCCCACTAGGGCACTCCGTAAAGACCCACGTGCAAATGCATTAATGGGTGCAGAATTCATTAAAGGAAATGCAGCTGTATTACGTCCAGTAATCAATCGCGAACCGAGTGATACAGACTTGTATTTGGCACATTTCCTTGGTGCTGGCGGCGCTAAGAAATTCCTATCCGCAGATCAGAAAACTCTCGGTGAAGTTCTATTCCCGAAACCTGCTAAAGCAAACCCGTCGATCTTTAGCAATAAAGGTGTACCACGTACCCTTGCAGAGATCTACAAGCTGTTCGAAGATAAAGTTTCGAAACATCGGGCA 7
Endolysin LNT101 MGTVLKRGDRGSAVEDLQMKLRVAGYAVSADGIFGGDTEKAVRDFQASKALVVDGKVGPATLAELAKSATVPAKWEAIPFPTANKSRSAAMPTLNAVGAMTGTDSRLLATFASIESAFDYTVKASTSSATGWFQFLDATWDDMIKAHGSKYGIPKDPTRALRKDPRANALMGAEFLKGNAAVLRPVINREPSDTDLYLAHFLGAGGAKKFLSADQKTLGEVLFPKPAKANPSIFSNKGVPRTLAEIYKLFEDKVSKHRA 1
2.2. LNT102 엔도라이신의 정제
상기 준비된 pBT7-LNT102 plasmid를 대장균 BL21-Star(DE3) strain (Invitrogen)에 transformation 한 후, LB broth (1% Tryptone, 0.5%(w/v) Yeast extract, 0.5%(w/v) NaCl)에서 OD600=0.5까지 배양하였다. 이후 1 mM IPTG (Isopropyl β-d-1-thiogalactopyranosid)를 첨가한 후 37℃에서 4 시간 동안 진탕배양하였다. Cell harvest 후, lysis buffer (50 mM NaH2PO4, 300 mM NaCl, 10 mM imidazole)로 재현탁하고, 1 mM PMSF 및 1 mg/ml lysozyme을 넣고 얼음에서 30 분간 정치하였다. Sonication으로 세포를 용해하고, 13,000 rpm에서 40분 원심분리하여 상층액을 얻었다. 이를 Ni-NTA 아가로오스 레진 (Qiagen)이 packing된 column에 통과시켰다. 이후 wash buffer (50 mM NaH2PO4, 300 mM NaCl, 30 mM imidazole)로 wash 후, elution buffer (50 mM NaH2PO4, 300 mM NaCl, 300 mM imidazole)로 elution하여, LNT102 단백질 (6xHis tag 포함)을 정제하였다.
15% SDS-PAGE로 LNT102 단백질의 순도를 확인하고 Bradford assay로 LNT102단백질의 농도를 측정하였다. 상기 정제과정 중에 얻어진 각각의 반응물을 SDS-PAGE를 통해 확인한 결과를 도 7에 나타내었다. SDS-PAGE를 통해 확인한 상기 정제한 LNT102 단백질의 분자량은 약 28kDa이었다.
2.3. 엔도라이신 LNT102의 그람음성균에 대한 사멸능 조사
본 실시예에서는 다양한 그람음성균을 대상으로 실시예 2.2에서 정제된 엔도라이신 LNT102의 박테리아 사멸능 및 타겟 박테리아 스펙트럼을 확인하였다.
In vitro 시험
이를 위하여, 2 μM 농도의 엔도라이신 LNT101과 LNT102, 및 슈도모나스 에루기노사(PAO1; ATCC 15692), 아시네토박터 바우마니(ATCC 17978), 에스케리챠 콜라이(ATCC 8739), 클렙시엘라 뉴모니아(ATCC 13883), 엔테로박터 에어로지너스(CCARM 16006), 및 살모넬라 엔테리티디스(ATCC 13076) 각각 1 X 106 CFU를 reaction buffer (20 mM Tris-Cl, pH 7.5)에 최종 부피가 200 ㎕가 되도록 넣고, 37℃에서 2 시간 동안 정치하였다. 2시간 후, 각 그람음성균의 콜로니 수를 확인하여, 그 결과를 도 8에 나타내었다 (도 8에서 PA90은 엔도라이신 LNT101을, mtPA90은 엔도라이신 LNT102를 각각 나타냄). 도 8에 나타난 바와 같이, 엔도라이신 LNT101과 LNT102는 모두 시험된 모든 그람음성균에 대해 대조군 대비 우수한 사멸능을 가짐을 확인되었고, 특히 LNT102는, LNT101과 비교하여, 동일 용량에서 보다 우수한 그람음성균 사멸능을 나타내었다.
0.1, 0.5, 2.5 μM 농도의 엔도라이신 LNT102 및 슈도모나스 에루기노사, 아시네토박터 바우마니, 및 에스케리챠 콜라이 각각 1 X 106 CFU를 reaction buffer (20 mM Tris-Cl, pH 7.5)에 최종 부피가 200 ㎕가 되도록 넣고, 37℃에서 2 시간 동안 정치하였다. 30 분, 1 시간, 및 2 시간 후, 각 그람음성균의 콜로니 수를 확인하여, 그 결과를 도 9 및 10에 나타내었다. 도 9 및 10에 나타난 바와 같이, 엔도라이신 LNT102는 시험된 모든 처리 용량 및 시간에서 그람음성균에 대하여 사멸능을 가짐을 확인하였고, 이러한 그람음성균 사멸능은 처리 시간 및 용량 의존적인 것으로 나타났다.
2.4. 엔도라이신 LTN102 및 항생제 병용시의 그람음성균 사멸능 상승 효과
세균의 세포막에 작용하는 기전을 갖는 polymyxin 계열 항생제와 실시예 2.2에서 정제된 엔도라이신 LNT102의 병용 처리에 의한 상승효과를 확인하였다. 구체적으로, Polymyxin B를 96 well microplate A 행에 4 μg/ml 처리 후, B - G 행으로 1/2씩 serial dilution 하였다. H 행에는 polymyxin을 처리하지 않았다. Colistin을 96 well microplate A 행에 8 μg/ml 처리 후, B - G 행으로 1/2씩 serial dilution 하였다. H 행에는 polymyxin을 처리하지 않았다. 그 후, LNT102 엔도라이신 1 μM을 추가로 처리한 병용 처리군, 및 동량의 PBS 처리군을 만들었다. 모든 well에 슈도모나스 에루기노사, 및 에스케리챠 콜라이를 각각 1 x 105 CFU/ml, total 100 ㎕의 양으로 처리하였다. 이후 18 시간, 37℃에서 배양하였다. MIC (Minimum Inhibitory Concentration)는 균이 자라지 않은 well의 최소 polymyxin 계열 항생제의 농도값을 의미하며, MIC 시험은 CLSI (Clinical and Laboratory Standards Institute)의 표준 시험법을 따라 broth microdilution technique으로 수행하였다 (Clinical and Laboratory Standards Institute. Methods for dilution antimicrobial susceptibility tests for bacteria that grow aerobically; approved standard. 11th ed. Document M07. Wayne, PA: CLSI; 2018).
다양한 농도의 polymyxin 계열 항생제 (polymyxin B, Colistin)와 LNT102 엔도라이신의 병용 처리에 의한 polymyxin 계열 항생제의 MIC 변화를 측정하여, 하기의 표 5에 나타내었다.
Polymyxin B + PBS Polymyxin B + LNT102 Colistin + PBS Colistin + LNT102
P. aeruginosa(ATCC 27853) 0.5 μg/ml < 0.06 μg/ml 2 μg/ml 0.5 μg/ml
A. baumannii(ATCC 19606) 0.5 μg/ml 0.03 μg/ml 2 μg/ml 0.25 μg/ml
E. coli(ATCC 8739) 0.5 μg/ml 0.06 μg/ml 2 μg/ml 1 μg/ml
표 5에 나타난 바와 같이, LNT102 엔도라이신 병용 시, polymyxin 계열 항생제인 polymyxin B 및 Colistin의 MIC가 최대 1/16배로 감소하는 것을 확인하였다. 이러한 결과는 기존의 항생제, 예컨대 polymyxin 계열 항생제와 LNT102 엔도라이신을 병용처리시 현저히 상승된 항생효과를 얻을 수 있음을 보여준다.
실시예 3: 융합 폴리펩타이드의 제조
3.1. 폴리펩타이드 (LNT101 및 LNT102 엔도라이신)의 준비
엔도라이신 LNT101 (서열번호 1)은 PG_binding_1 domain(10-65 amino acid)과 transglycosylase SLT domain(95-179 amino acid)으로 구성되어 있다. 상기 엔도라이신 LNT101 (서열번호 1)에서 15개 아미노산 변이를 가하여 서열번호 6의 엔도라이신 LNT101 변이체 (이하, 엔도라이신 LNT102로 명명)을 준비하였다.
상기 엔도라이신 LNT102의 코딩 유전자 (서열번호 7)를 pBT7 플라스미드에 삽입하여 엔도라이신 LNT102 발현을 위한 pBT7-LNT102 plasmid를 준비하였다. 상기 준비된 pBT7-LNT102 plasmid를 대장균 BL21-Star(DE3) strain (Invitrogen)에 transformation 한 후, LB broth (1% Tryptone, 0.5%(w/v) Yeast extract, 0.5%(w/v) NaCl)에서 OD600=0.5까지 배양하였다. 이후 1 mM IPTG (Isopropyl β-d-1-thiogalactopyranosid)를 첨가한 후 37℃에서 4 시간 동안 진탕배양하였다. Cell harvest 후, lysis buffer (50 mM NaH2PO4, 300 mM NaCl, 10 mM imidazole)로 재현탁하고, 1 mM PMSF 및 1 mg/ml lysozyme을 넣고 얼음에서 30 분간 정치하였다. Sonication으로 세포를 용해하고, 13,000 rpm에서 40분 원심분리하여 상층액을 얻었다. 이를 Ni-NTA 아가로오스 레진 (Qiagen)이 packing된 column에 통과시켰다. 이후 wash buffer (50 mM NaH2PO4, 300 mM NaCl, 30 mM imidazole)로 wash 후, elution buffer (50 mM NaH2PO4, 300 mM NaCl, 300 mM imidazole)로 elution하여, LNT102단백질 (6xHis tag 포함)을 정제하였다.
15% SDS-PAGE로 LNT102단백질의 순도를 확인하고 Bradford assay로 LNT102단백질의 농도를 측정하였다. 상기 정제과정 중에 얻어진 각각의 반응물을 SDS-PAGE를 통해 확인한 결과, 상기 정제한 LNT102 단백질의 분자량은 약 31kDa이었다.
3.2. 융합 폴리펩타이드의 제조
상기 준비된 LNT102 단백질에 세크로핀 A가 융합된 융합 폴리펩타이드를 준비하였다. 구체적으로, N-말단부터 순서대로 [세크로핀 A(서열번호 8)]-[링커(GSGSGS)(서열번호 12)]-[엔도라이신(LNT102로 명명)(서열번호 6)]을 포함하는 융합 폴리펩타이드 (LNT103으로 명명)(서열번호 10)를 암호화하는 폴리뉴클레오타이드 (서열번호 11)을 pET 21a (Novagen) 플라스미드에 삽입하여 LNT103 발현을 위한 플라스미드 pET-LNT103를 준비하였다. 상기 준비된 pET-LNT103 plasmid를 대장균 BL21-Star(DE3) strain(Invitrogen)에 transformation 한 후, LB broth (1%(w/v) Tryptone, 0.5%(w/v) Yeast extract, 0.5%(w/v) NaCl)에 OD600=0.5까지 배양하였다.
이후 1 mM IPTG (isopropyl β-D-1-thiogalactopyranoside) 첨가 후 25℃에서 6 시간 진탕배양하였다. Cell harvest 후, lysis buffer (50 mM NaH2PO4, 300 mM NaCl, 10 mM imidazole)로 재현탁하고, 1 mM PMSF (phenylmethylsulfonyl fluoride) 및 1 mg/ml lysozyme을 넣고 ice에서 30 분간 정치하였다. Sonication으로 cell을 lysis하고, 13,000 rpm에서 40분 원심분리하여 상층액을 얻었다. 상기 얻어진 상층액을 Ni-NTA agarose resin (Qiagen)이 packing된 column에 통과시켰다. 이후 wash buffer (50 mM NaH2PO4, 300 mM NaCl, 30 mM imidazole)로 wash 후, elution buffer (50 mM NaH2PO4, 300 mM NaCl, 300 mM imidazole)로 elution하였다. 15% SDS-PAGE로 정제/확인 및 Bradford assay로 농도를 측정하였다.
상기 얻어진 SDS-PAGE결과를 도 12에 나타내었다. 도 12에서 확인되는 바와 같이, 정제된 융합 폴리펩타이드 LNT103(서열번호 10)은 분자량이 34 KDa임을 확인하였다.
또한, 상기한 방법과 동일한 방법으로, 엔도라이신 LNT101 (서열번호 1)에 세크로핀 A가 융합된 융합 폴리펩타이드 (CecA-LNT101; 서열번호 13)를 제작하였다. 상기 제작된 CecA-LNT101에 대하여 앞서 설명한 방법으로 SDS-PAGE를 수행하여, CecA-LNT101의 분자량이 34kDa임을 확인하였다.
한편, 시험의 편의를 위하여, 상기 정제된 융합 폴리펩타이드 LNT103 (서열번호 10) 및 CecA-LNT101(서열번호 13)의 1번째 아미노산 M을 MAS(Met-Ala-Ser)로 치환하고, C 말단에 extra sequence와 His 택을 추가한 형태 (서열번호 15 또는 서열번호 16)로 제작하여, 하기 시험에서 서열번호 15는 융합 폴리펩타이드 LNT103로서, 서열번호 16은 CecA-LNT101로서 각각 사용하였다.
본 실시예에 기재된 폴리펩타이드 및 이의 코딩 유전자의 아미노산 서열 및 핵산 서열을 아래의 표 6에 정리하였다:
아미노산 서열 (N→C) 또는 핵산 서열 (5'→3') 서열번호
Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK 8
Cecropin A coding gene AAATGGAAACTGTTTAAAAAAATTGAAAAAGTGGGCCAGAACATTCGCGATGGCATTATTAAAGCGGGCCCGGCGGTGGCGGTGGTGGGCCAGGCGACCCAGATTGCGAAA 9
linker GSGSGS 12
Endolysin LNT102 MGTVLKRGDRGSAVEDLQMKLNVAGYNLSADGIFGGDTEKAVRDVQAGAGLVVDGKVGPKTLYAIAKSATVPAKWEAIPFPTANKSRSAAMPTLNAVGAMTGVDSRLLATFASIESAFDYTVKAKTSSATGWFQFLDATWDDMIKAYGSKYGIPKDPTRALRKDPRANALMGAEFIKGNAAVLRPVINREPSDTDLYLAHFLGAGGAKKFLSADQKTLGEVLFPKPAKANPSIFSNKGVPRTLAEIYKLFEDKVSKHRA 6
Endolysin LNT102 coding gene ATGGGTACTGTACTCAAACGTGGCGACCGCGGCTCTGCTGTGGAAGATCTACAAATGAAACTTAACGTCGCAGGATACAACCTGAGCGCTGACGGAATCTTCGGTGGAGATACAGAGAAAGCTGTTCGTGATGTGCAAGCTGGCGCGGGCTTGGTGGTTGACGGAAAAGTTGGACCTAAAACTCTATATGCGATTGCCAAATCCGCTACTGTTCCTGCTAAATGGGAAGCTATCCCTTTCCCAACAGCTAATAAATCTCGGTCGGCTGCAATGCCCACTCTGAATGCGGTTGGAGCAATGACTGGTGTGGATTCTCGGTTACTCGCTACATTCGCTTCCATTGAGTCTGCTTTTGATTACACTGTCAAAGCAAAAACATCTTCGGCTACTGGTTGGTTCCAGTTCCTTGATGCTACATGGGATGACATGATCAAAGCATATGGTTCCAAATACGGGATACCTAAAGATCCCACTAGGGCACTCCGTAAAGACCCACGTGCAAATGCATTAATGGGTGCAGAATTCATTAAAGGAAATGCAGCTGTATTACGTCCAGTAATCAATCGCGAACCGAGTGATACAGACTTGTATTTGGCACATTTCCTTGGTGCTGGCGGCGCTAAGAAATTCCTATCCGCAGATCAGAAAACTCTCGGTGAAGTTCTATTCCCGAAACCTGCTAAAGCAAACCCGTCGATCTTTAGCAATAAAGGTGTACCACGTACCCTTGCAGAGATCTACAAGCTGTTCGAAGATAAAGTTTCGAAACATCGGGCATAG 7
Fusion Polypeptide LNT103 MKWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAKGSGSGSMGTVLKRGDRGSAVEDLQMKLNVAGYNLSADGIFGGDTEKAVRDVQAGAGLVVDGKVGPKTLYAIAKSATVPAKWEAIPFPTANKSRSAAMPTLNAVGAMTGVDSRLLATFASIESAFDYTVKAKTSSATGWFQFLDATWDDMIKAYGSKYGIPKDPTRALRKDPRANALMGAEFIKGNAAVLRPVINREPSDTDLYLAHFLGAGGAKKFLSADQKTLGEVLFPKPAKANPSIFSNKGVPRTLAEIYKLFEDKVSKHRA 10
Fusion Polypeptide LNT103 coding gene ATGAAATGGAAACTGTTTAAAAAAATTGAAAAAGTGGGCCAGAACATTCGCGATGGCATTATTAAAGCGGGCCCGGCGGTGGCGGTGGTGGGCCAGGCGACCCAGATTGCGAAAGGCAGCGGCTCGGGTAGTATGGGTACTGTACTCAAACGTGGCGACCGCGGCTCTGCTGTGGAAGATCTACAAATGAAACTTAACGTCGCAGGATACAACCTGAGCGCTGACGGAATCTTCGGTGGAGATACAGAGAAAGCTGTTCGTGATGTGCAAGCTGGCGCGGGCTTGGTGGTTGACGGAAAAGTTGGACCTAAAACTCTATATGCGATTGCCAAATCCGCTACTGTTCCTGCTAAATGGGAAGCTATCCCTTTCCCAACAGCTAATAAATCTCGGTCGGCTGCAATGCCCACTCTGAATGCGGTTGGAGCAATGACTGGTGTGGATTCTCGGTTACTCGCTACATTCGCTTCCATTGAGTCTGCTTTTGATTACACTGTCAAAGCAAAAACATCTTCGGCTACTGGTTGGTTCCAGTTCCTTGATGCTACATGGGATGACATGATCAAAGCATATGGTTCCAAATACGGGATACCTAAAGATCCCACTAGGGCACTCCGTAAAGACCCACGTGCAAATGCATTAATGGGTGCAGAATTCATTAAAGGAAATGCAGCTGTATTACGTCCAGTAATCAATCGCGAACCGAGTGATACAGACTTGTATTTGGCACATTTCCTTGGTGCTGGCGGCGCTAAGAAATTCCTATCCGCAGATCAGAAAACTCTCGGTGAAGTTCTATTCCCGAAACCTGCTAAAGCAAACCCGTCGATCTTTAGCAATAAAGGTGTACCACGTACCCTTGCAGAGATCTACAAGCTGTTCGAAGATAAAGTTTCGAAACATCGGGCATAG 11
Endolysin LNT101 MGTVLKRGDRGSAVEDLQMKLRVAGYAVSADGIFGGDTEKAVRDFQASKALVVDGKVGPATLAELAKSATVPAKWEAIPFPTANKSRSAAMPTLNAVGAMTGTDSRLLATFASIESAFDYTVKASTSSATGWFQFLDATWDDMIKAHGSKYGIPKDPTRALRKDPRANALMGAEFLKGNAAVLRPVINREPSDTDLYLAHFLGAGGAKKFLSADQKTLGEVLFPKPAKANPSIFSNKGVPRTLAEIYKLFEDKVSKHRA 1
Endolysin LNT101 coding gene ATGGGTACTGTACTCAAACGTGGCGACCGCGGCTCTGCTGTGGAAGATCTACAAATGAAACTTCGAGTCGCAGGATACGCAGTTAGCGCTGACGGAATCTTCGGTGGAGATACAGAGAAAGCTGTTCGTGATTTCCAAGCTTCTAAAGCTTTGGTGGTTGACGGAAAAGTTGGACCTGCTACTCTAGCTGAACTAGCCAAATCCGCTACTGTTCCTGCTAAATGGGAAGCTATCCCTTTCCCAACAGCTAATAAATCTCGGTCGGCTGCAATGCCCACTCTGAATGCGGTTGGAGCAATGACTGGTACCGATTCTCGGTTACTCGCTACATTCGCTTCCATTGAGTCTGCTTTTGATTACACTGTCAAAGCATCCACATCTTCGGCTACTGGTTGGTTCCAGTTCCTTGATGCTACATGGGATGACATGATCAAAGCACATGGTTCCAAATACGGGATACCTAAAGATCCCACTAGGGCACTCCGTAAAGACCCACGTGCAAATGCATTAATGGGTGCAGAATTCCTTAAAGGAAATGCAGCTGTATTACGTCCAGTAATCAATCGCGAACCGAGTGATACAGACTTGTATTTGGCACATTTCCTTGGTGCTGGCGGCGCTAAGAAATTCCTATCCGCAGATCAGAAAACTCTCGGTGAAGTTCTATTCCCGAAACCTGCTAAAGCAAACCCGTCGATCTTTAGCAATAAAGGTGTACCACGTACCCTTGCAGAGATCTACAAGCTGTTCGAAGATAAAGTTTCGAAACATCGGGCATAG 2
Fusion Polypeptide CecA-LNT101 MKWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAKGSGSGSMGTVLKRGDRGSAVEDLQMKLRVAGYAVSADGIFGGDTEKAVRDFQASKALVVDGKVGPATLAELAKSATVPAKWEAIPFPTANKSRSAAMPTLNAVGAMTGTDSRLLATFASIESAFDYTVKASTSSATGWFQFLDATWDDMIKAHGSKYGIPKDPTRALRKDPRANALMGAEFLKGNAAVLRPVINREPSDTDLYLAHFLGAGGAKKFLSADQKTLGEVLFPKPAKANPSIFSNKGVPRTLAEIYKLFEDKVSKHRA 13
Fusion Polypeptide CecA-LNT101 coding gene ATGAAATGGAAACTGTTTAAAAAAATTGAAAAAGTGGGCCAGAACATTCGCGATGGCATTATTAAAGCGGGCCCGGCGGTGGCGGTGGTGGGCCAGGCGACCCAGATTGCGAAAGGCAGCGGCTCGGGTAGTATGGGTACTGTACTCAAACGTGGCGACCGCGGCTCTGCTGTGGAAGATCTACAAATGAAACTTCGAGTCGCAGGATACGCAGTTAGCGCTGACGGAATCTTCGGTGGAGATACAGAGAAAGCTGTTCGTGATTTCCAAGCTTCTAAAGCTTTGGTGGTTGACGGAAAAGTTGGACCTGCTACTCTAGCTGAACTAGCCAAATCCGCTACTGTTCCTGCTAAATGGGAAGCTATCCCTTTCCCAACAGCTAATAAATCTCGGTCGGCTGCAATGCCCACTCTGAATGCGGTTGGAGCAATGACTGGTACCGATTCTCGGTTACTCGCTACATTCGCTTCCATTGAGTCTGCTTTTGATTACACTGTCAAAGCATCCACATCTTCGGCTACTGGTTGGTTCCAGTTCCTTGATGCTACATGGGATGACATGATCAAAGCACATGGTTCCAAATACGGGATACCTAAAGATCCCACTAGGGCACTCCGTAAAGACCCACGTGCAAATGCATTAATGGGTGCAGAATTCCTTAAAGGAAATGCAGCTGTATTACGTCCAGTAATCAATCGCGAACCGAGTGATACAGACTTGTATTTGGCACATTTCCTTGGTGCTGGCGGCGCTAAGAAATTCCTATCCGCAGATCAGAAAACTCTCGGTGAAGTTCTATTCCCGAAACCTGCTAAAGCAAACCCGTCGATCTTTAGCAATAAAGGTGTACCACGTACCCTTGCAGAGATCTACAAGCTGTTCGAAGATAAAGTTTCGAAACATCGGGCATAG 14
Fusion Polypeptide LNT103 with MAS, His tag, and extra sequence MASKWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAKGSGSGSMGTVLKRGDRGSAVEDLQMKLNVAGYNLSADGIFGGDTEKAVRDVQAGAGLVVDGKVGPKTLYAIAKSATVPAKWEAIPFPTANKSRSAAMPTLNAVGAMTGVDSRLLATFASIESAFDYTVKAKTSSATGWFQFLDATWDDMIKAYGSKYGIPKDPTRALRKDPRANALMGAEFIKGNAAVLRPVINREPSDTDLYLAHFLGAGGAKKFLSADQKTLGEVLFPKPAKANPSIFSNKGVPRTLAEIYKLFEDKVSKHRALEHHHHHH 15
Fusion Polypeptide CecA-LNT101 with MAS, His tag, and extra sequence MASKWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAKGSGSGSMGTVLKRGDRGSAVEDLQMKLRVAGYAVSADGIFGGDTEKAVRDFQASKALVVDGKVGPATLAELAKSATVPAKWEAIPFPTANKSRSAAMPTLNAVGAMTGTDSRLLATFASIESAFDYTVKASTSSATGWFQFLDATWDDMIKAHGSKYGIPKDPTRALRKDPRANALMGAEFLKGNAAVLRPVINREPSDTDLYLAHFLGAGGAKKFLSADQKTLGEVLFPKPAKANPSIFSNKGVPRTLAEIYKLFEDKVSKHRALEHHHHHH 16
3.3. 융합 폴리펩타이드 LNT103의 외막투과(outer membrane permeabilization) 활성 평가
상기 실시예 3.2에서 준비된 융합 폴리펩타이드의 그람음성균의 외막투과(outer membrane permeabilization) 활성 평가를 위해 NPN uptake assay를 수행하였다. 대표적인 그람음성균으로 슈도모나스 에루기노사와 아시네토박터 바우마니를 사용하여 시험하였다.
슈도모나스 에루기노사(PAO1; ATCC 15692) 또는 아시네토박터 바우마니(ATCC 19606)를 OD600=0.3까지 배양하여 1,000 g에서 10분간 원심분리 후, 1/2 volume 만큼의 5mM HEPES (Hydroxyethyl piperazine Ethane Sulfonic acid) (pH 7.2)로 재현탁하였다. Microplate에 40 μM NPN (1-N-phenylnaphthylamine) 용액 (40 μM NPN in 5 mM HEPES, pH7.2) 50 μl, 시험물질 (LNT101, LNT102 또는 LNT103) 50 μl, 및 균주 현탁액 100 μl (total 200 μl)를 넣고 37℃에서 1시간 동안 반응하였다. 이후, microplate reader (Infinite M200 Pro, TECAN)로 excitation 350 nm, enussion 420 nm 조건에서 형광측정하였다. 양성 대조군으로는 세크로핀 A(Cecropin A; 서열번호 8), EDTA, 또는 polymyxin B를 사용하고, 음성 대조군으로는 10 μM NPN 용액을 사용하였다. 모든 실험은 3 set 로 수행하였다.
상기 얻어진 결과를 도 13에 나타내었다.　그람음성균 (슈도모나스 에루기노사(PAO1; ATCC 15692) 및 아시네토박터 바우마니(ATCC 19606))에 대한 LNT101, LNT102 및 LNT103의 outer membrane permeability활성을 비교하기 위해 동일한 농도인 2 μM의 농도를 처리하였고, cecropin A 와 polymyxin B 는 2 μM, EDTA 는 1 mM를 처리하였다. 상기 얻어진 결과를 음성 대조군에 대한 배수값(fold change over control)으로 도 13의 A와 B에 나타내었다. 도 13의 A와 B에 나타난 바와 같이, 융합 폴리펩타이드 LNT103는 동일 농도에서 폴리펩타이드 LNT101 및 LNT102 보다 그람음성균의 outer membrane permeabilization 활성이 높은 것을 확인하였고, 양성 대조군인 cecropin A, EDTA, polymyxin B 보다도 높은 것을 확인하였다.
한편, LNT103의 농도에 따른 그람음성균 (슈도모나스 에루기노사(PAO1; ATCC 15692) 및 아시네토박터 바우마니(ATCC 19606))에 대한 outer membrane permeabilization 활성 차이를 확인하기 위해, LNT103를 0.29 μM, 0.88 μM, 또는 (2.65 μM)의 양으로 처리하고, cecropin A 와 polymyxin B 는 2 μM, EDTA 는 1 mM를 처리하였다. 상기 얻어진 결과를 상기 얻어진 결과를 음성 대조군에 대한 배수값(fold change over control)으로 도 13의 C와 D에 나타내었다. 도 13의 C와 D에 나타난 바와 같이, LNT103이 LNT101, LNT102, cecropin A 및 polymyxin B와 비교하여 그람음성균에 대한 outer membrane permeabilization 활성이 우수하고, 농도 의존적으로 그람음성균에 대한 outer membrane permeabilization 활성이 증가함을 확인하였다.
3.4. 융합 폴리펩타이드 LNT103의 그람음성균에 대한 사멸능 조사
실시예 3.2에서 준비된 융합 폴리펩타이드 LNT103의 그람음성균에 대한 사멸능을 확인하기 위하여, 다양한 그람음성균에 대하여 CFU reduction 평가를 수행하였다. 상기 CFU reduction 평가는 수행하기 위하여, 실시예 3에서 준비된 LNT101, LNT102, 및 LNT103 각각 2μM과, 슈도모나스 에루기노사(PAO1; ATCC 15692), 아시네토박터 바우마니(ATCC 19606, ATCC 17978), 대장균(ATCC 8739), 클렙시엘라 뉴모니아(ATCC 2208), 및 엔테로박터 에어로지너스(CCARM 16006) 각각 1 x 106 CFU를 reaction buffer (20 mM Tris-Cl, pH7.5)에 최종 부피가 200 ㎕가 되도록 넣고, 37℃에서 2 시간 동안 정치하였다. 그 후, 각 그람음성균의 콜로니 수를 확인하여 각 폴리펩타이드의 항생효과를 비교 평가하였다. 대조군으로 PBS 처리군 (PBS를 융합 폴리펩타이드와 동일부피로 처리)을 사용하였다.
상기 얻어진 결과를 도 14에 나타내었다. 도 4에 나타난 바와 같이, 융합 폴리펩타이드 LNT103은 LNT101 및 LNT102에 비해 1.5 ~ 5.5 log CFU/ml의 CFU 감소 효과가 나타남을 확인하였다. 특히, 융합 폴리펩타이드 LNT103의 아시네토박터 바우마니(ATCC 19606, ATCC 17978), 대장균(ATCC 8739), 클렙시엘라 뉴모니아(ATCC 2208)에 대한 CFU Counting 결과(log CFU/ml)는 0으로 처리된 모든 균을 사멸시켰다.
또한, 융합 폴리펩타이드 LNT103, 및 CecA-LNT101를 2μM의 농도로 사용하여 동일한 시험을 수행하여, 그 결과를 도 15에 나타내었다. 비교를 위하여, LNT102 또는 PBS를 처리한 군에 대하여 동일한 시험을 수행하였다. 도 15에 나타난 바와 같이, 융합 폴리펩타이드 LNT103, 및 CecA-LNT101를 처리한 군은 모두 LNT102 또는 PBS를 처리한 군보다 항생활성이 우수하였으며, 특히, LNT103, 및 CecA-LNT101를 각각 2μM의 양으로 처리한 경우에 시험된 모든 세균에 대한 Counting 결과(log CFU/ml)가 0으로 나타나 모든 균을 사멸시키는 것으로 확인되었다.
　한편, Cecropin A에 엔도라이신 (LNT102 또는 LNT101) 이외의 단백질이 융합된 경우와 항균 활성을 비교하기 위하여, 융합 폴리펩타이드 LNT103, 및 cecropin A-EGFP 융합 단백질 (LNT103에서 LNT102을 대체하여 엔도라이신 활성을 가지지 않는 EGFP(GenBank Accession No. AAB02572.1) 가 융합된 단백질)의 그람음성균 사멸능을 평가하였다. 이를 위해, 상기 단백질들을 각각 0.2 μM 또는 2 μM의 양으로 처리하여 CFU reduction test를 수행하였다. 상기 얻어진 결과를 도 16에 나타내었다. 도 16에 나타난 바와 같이, Cecropin A-EGFP 융합 단백질은 항균 활성이 없는 반면, 융합 폴리펩타이드 LNT103는 우수한 항균 활성을 가지는 것으로 확인되었다. 특히, LNT103 2 μM 처리시에는 시험된 모든 그람음성균에 대한 CFU Counting 결과(log CFU/ml)는 0으로 처리된 모든 균을 사멸시킨 것을 확인할 수 있다.
또한, 융합 폴리펩타이드 LNT103의 농도 및/또는 처리 시간에 따른 그람음성균에 대한 사멸능을 시험하였다. 구체적으로,　0.1, 0.3, 0.9, 또는 2.7 μM 농도의 융합 폴리펩타이드 LNT103 및 슈도모나스 에루기노사(PAO1; ATCC 15692) 또는 아시네토박터 바우마니아시네토박터 바우마니(ATCC 19606) 1 x 106 CFU를 reaction buffer (20 mM Tris-Cl, pH7.5)에 최종 부피가 200 ㎕가 되도록 넣고, 37℃에서 2 시간 동안 정치한 후 콜로니 수를 확인하여, 그 결과를 도 17의 A에 나타내었다.
또한, 2 μM 농도의 융합 폴리펩타이드 LNT103과 슈도모나스 에루기노사(PAO1; ATCC 15692) 1 x 106 CFU를 reaction buffer (20 mM Tris-Cl, pH7.5)에 최종 부피가 200 ㎕가 되도록 넣고, 37℃에서 0, 20 분, 40 분 및 60분 후, 콜로니 수를 확인하여, 그 결과를 도 17의 B에 나타내었다.
또한, 1 μM 농도의 융합 폴리펩타이드 LNT103과 아시네토박터 바우마니(ATCC 19606) 1 x 106 CFU를 reaction buffer (20 mM Tris-Cl, pH7.5)에 최종 부피가 200 ㎕가 되도록 넣고, 37℃에서 0, 1 분, 3 분, 5 분 및 10분 후, 콜로니 수를 확인하여, 그 결과를 도 17의 C에 나타내었다.
도 17의 A, B 및 C에 나타난 바와 같이, 융합 폴리펩타이드 LNT103은 농도 및 시간 의존적으로 그람음성균에 대하여 사멸능을 가짐을 확인하였다 (도 17의 A, B, 및 C에서 막대그래프가 표시되지 않은 부분은 log CFU/ml 값이 0인 것으로, 처리된 모든 균을 사멸시킴을 의미함).
또한, 융합 폴리펩타이드 LNT103의 MIC (Minimal Inhibitory Concentration) 및 MBC (Minimal Bactericidal Concentration)를 측정하였다. 상기 MIC 및 MBC는 CLSI (Clinical and Laboratory Standards Institute)의 표준 시험법을 따라 broth microdilution technique으로 수행하되, 해당 시험법에서 MH broth (Casein acid hydrolysate 17.5 g/L, Beef extract 3.0 g/L, Starch 1.5 g/L. pH 7.3) 대신 CAA media (Casamino acid 5 g/L, K2HPO4 5.2 mM, MgSO4 1 mM)를 사용하여 수행하였다 (Clinical and Laboratory Standards Institute. Methods for dilution antimicrobial susceptibility tests for bacteria that grow aerobically; approved standard. 11th ed. Document M07. Wayne, PA: CLSI; 2018). 구체적으로, 96 well microplate A 행에 LNT103을 64 μg/ml의 농도로 처리하고, B-G 행으로 1/2씩 serial dilution 된 농도로 LNT103을 처리하였다. H 행에는 LNT103을 처리하지 않았다. 그 후 모든 well에 해당 bacteria strain (type or QC, CCARM 및 임상분리 균주; 표 2-4 참조)을 5 x 105 CFU/ml, total 100 ㎕의 양으로 처리하였다. 이후 18 시간, 37℃에서 배양하였다. MIC는 균이 자라지 않은 최저 농도로 판단하며, MBC는 각 well에서 콜로니 수를 확인하여 콜로니가 확인되지 않는 최저 농도로 판단하였다. 상기 얻어진 결과를 아래의 표 7 내지 표 9에 나타내었다:
Species Strain MIC (μg/ml) MBC (μg/ml)
A. baumannii ATCC 17978 8 8
ATCT 19606 8 8
KACC 13090 8 8
KACC 14233 8 8
CCARM 12001 8 8
CCARM 12015 16 16
CCARM 12026 8 8
CCARM 12035 8 8
CCARM 12202 8 8
F4 16 16
F15 8 8
F65 4 4
F66 4 4
F67 8 8
F68 4 4
F69 8 8
F70 16 16
F71 8 8
3680(경상대) 8 8
643(경북대) 8 16
Species Strain MIC (μg/ml) MBC (μg/ml)
P. aeruginosa ATCT 13388 8 16
ATCC 9027 16 16
ATCC 10145 16 32
PAO1(ATCC 15692) 8 16
ATCC 15522 16 16
CCARM 2134 8 16
CCARM 2144 32 32
F102 8 8
F141 8 8
F341 8 8
F388 8 8
F265 16 16
Species Strain MIC (μg/ml) MBC (μg/ml)
E. coli ATCC 8739 8 8
CCARM 1460 4 4
CCARM 1A746 8 8
CCARM 1B684 4 8
CCARM 1G448 4 4
FORC81 4 4
F340 16 16
F481 8 8
F485 4 8
F524 16 16
F716 16 32
F852 16 32
F859 32 32
F862 4 4
UPEC 3042 32 32
UPEC 3181 8 8
3.5. 융합 폴리펩타이드 LNT103와 polymyxin 항생제의 병용에 따른 그람음성균 사멸능 상승효과
세균의 세포막에 작용하는 기전을 갖는 polymyxin 계열 항생제와 융합 폴리펩타이드 LNT103의 병용 처리에 의한 그람음성균 사멸능의 상승효과를 확인하였다. 구체적으로, colistin(polymyxin E)을 96 well microplate 1 열에 16 ㎕/ml 처리하고, 2-11 열으로 1/2씩 serial dilution 된 농도로 처리하였다. LNT103은 A 행에 16 μg/ml 처리하고, B-G 행으로 1/2씩 serial dilution 된 농도로 처리하였다. 그 후 모든 well에 아시네토박터 바우마니 (ATCC 19606)를 5 x 105 CFU/ml, total 100 ㎕의 양으로 처리하였다. 이후, 37℃에서 18시간 동안 배양하고, FIC (Fractional Inhibitory Concentration) index value를 다음의 수식으로 산출하였다:
FIC index = FICA + FICB = (CA/MICA)+ (CB/MICB)
(CA 및 CB는 병용처리된 물질 (polymyxin E 및 LNT103)의 각각의 농도, MICA and MICB는 단독 약물의 MIC,
FIC value: synergy effect <0.5; antagonism >4; additive 0.5-4)
시험 결과, FIC index value는 0.375로 나타나서, 두 물질간의 synergy effect가 있음을 확인하였다.
3.6. 융합 폴리펩타이드 LNT103의 in vitro 독성평가
융합 폴리펩타이드 LNT103의 in vitro 독성은 Huh-7 세포주를 이용한 cell cytotoxicity assay (WST assay) 및 sheep blood(MB cell)를 이용한 hemolysis assay로 평가하였다.　
Cell cytotoxicity assay 진행 과정은 다음과 같다. Huh-7 세포 배양액을 준비하여 96 well plate에 well당 1 x 109 cells/well의 양으로 분주하고, CO2 incubator에서 24시간 동안 배양하였다. 그리고 negative control로 PBS, positive control로 1%(w/v) triton X-100을 처리하고, 실험군으로 융합 폴리펩타이드 LNT103을 0.25, 0.5, 또는 1 mg/ml의 농도로 처리한 후, CO2 incubator에서 24시간과 48시간 동안 정치하였다. 이후 D-PlusTM CCK cell viability assay kit (동인LS)을 사용하여 cell viability를 측정하여, 그 결과를 도 18에 나타내었다. 도 18에 나타난 바와 같이, 융합 폴리펩타이드 LNT103을 0.25 mg/ml, 0.5 mg/ml, 또는 1 mg/ml의 농도로 24시간 동안 처리하였을 때, negative control(PBS)과 비교하여 각각 93%, 90%, 78%의 cell viability를 보였으며, 48시간 동안 처리하였을 때, negative control과 비교하여 각각 108%, 105%, 86%의 cell viability를 보였다. 즉, 융합 폴리펩타이드 LNT103 처리시 대조군(PBS) 대비 약 80% 이상의 cell viability를 보이는 것으로 확인되어, 세포 독성이 비교적 낮음을 확인할 수 있다. 이 결과로 LNT103의 IC50는 >1 mg/ml로 확인되었다.
　Hemolysis assay 진행 과정은 다음과 같다. 3 ml sheep blood와 14 ml PBS (pH 7.2)를 섞어준 후, 1000 g, 4℃에서 5 분간 원심분리 하여 상층액을 제거하였다. 이 후, 제거해준 volume 만큼 PBS를 다시 채워주고 위의 wash 단계를 총 4번 진행하였다. Wash를 통해 lysis 된 hemoglobin을 제거하고, 마지막 원심분리 후 가라앉은 RBC(red blood cell) 400 μl를 9.6 ml PBS에 풀어주어 4%(v/v) blood solution을 만들었다. 96 well microplate에 50 μl 시료와 50 μl 4%(v/v) blood solution을 섞어준 후 37℃에서 1시간 동안 반응시켰다. 실험군은 융합 폴리펩타이드 LNT103를 128 μg/ml부터 2 μg/ml까지 2-fold dilution range로 처리하였고(PBS, pH 7.2), 양성 대조군은 0.1%(w/v) Triton X-100, 음성 대조군은 PBS를 처리하였다. 1시간 반응 후 microplate를 1000 g, 4℃에서 5 분간 원심분리하고 상층액 50 μl를 취하여 새로운 microplate 에 옮겨 570 nm에서 흡광도를 측정하였다(Infinite M200 Pro, TECAN). 상기 얻어진 결과를 도 19 에 나타내었다, 도 19에 나타난 바와 같이, 융합 폴리펩타이드 LNT103는 시험된 모든 농도에서 hemolytic activity를 보이지 않는 것을 확인하였다. 이 결과로 LNT103의 MHC (Minimal hemolytic concentration)은 >128 μg/ml로 확인되었다.
3.7. 융합 폴리펩타이드 LNT103의 in vivo 유효성 평가
융합 폴리펩타이드 LNT103의 in vivo 유효성 평가를 위하여, 아시네토박터 바우마니 ATCC 19606 전신감염 마우스 모델에서 생존율을 확인하였다.
동물실험 진행과정은 다음과 같다. 마우스는 ICR male 4 주령 마우스를 구입하여 1 주일 적응기간을 거친 후, 5~6주령 중량 20~21 g일 때 사용하였다. 아시네토바우마니 균은 10% mucin과 1:1로 혼합하여, 0.5 ml의 2 x 108 CFU/ml (5% mucin)의 균액을 마우스의 복강으로 접종하였다. 감염 1 시간 및 4 시간 후 피하주사를 통해 LNT103 20 mpk, LNT103 100 mpk 및 비교군으로 colistin 20 mpk를 각각 투여하였다. 이후 96 시간 동안 생존율을 확인하여 그 결과를 도 20에 나타내었다. 도 20에서 확인되는 바와 같이, 전신감염 마우스 모델에 LNT103을 투여한 군에서 비투여군(control) 및 비교군 (colistin 투여군)에 비해 높은 생존율을 보였고, LNT103은 농도 의존적으로 높은 생존율을 보이는 것으로 나타나, 해당 마우스 모델에서 효과가 있음을 확인하였다.
이상의 설명으로부터, 본 출원이 속하는 기술분야의 당업자는 본 출원이 그 기술적 사상이나 필수적 특징을 변경하지 않고서 다른 구체적인 형태로 실시될 수 있다는 것을 이해할 수 있을 것이다. 이와 관련하여, 이상에서 기술한 실시예들은 모든 면에서 예시적인 것이며 한정적인 것이 아닌 것으로 이해해야만 한다. 본 출원의 범위는 상기 상세한 설명보다는 후술하는 특허 청구범위의 의미 및 범위 그리고 그 등가 개념으로부터 도출되는 모든 변경 또는 변형된 형태가 본 출원의 범위에 포함되는 것으로 해석되어야 한다.

Claims (33)

  1. 서열번호 1 또는 서열번호 6의 아미노산을 포함하는, 폴리펩타이드.
  2. 제1항에 있어서, 상기 폴리펩타이드는 엔도라이신 활성을 갖는 것인, 폴리펩타이드.
  3. 제1항의 폴리펩타이드를 암호화하는, 폴리뉴클레오타이드.
  4. 제3항에 있어서, 서열번호 2 또는 서열번호 7의 핵산 서열을 포함하는, 폴리뉴클레오타이드.
  5. 제3항의 폴리뉴클레오타이드를 포함하는, 재조합 벡터.
  6. 제3항의 폴리뉴클레오타이드 또는 이를 포함하는 재조합 벡터를 포함하는, 재조합 세포.
  7. 서열번호 1의 아미노산 서열을 포함하는 폴리펩타이드를 암호화하는 폴리뉴클레오타이드를 포함하는, 박테리오파지.
  8. 제7항에 있어서, 서열번호 1의 아미노산 서열을 포함하는 폴리펩타이드를 암호화하는 폴리뉴클레오타이드는 서열번호 2의 핵산 서열을 포함하는 것인, 박테리오파지.
  9. 제7항 또는 제8항 중 어느 한 항에 있어서, 상기 박테리오파지는 슈도모나스 속 세균에 대하여 항생 활성을 갖는 것인, 박테리오파지.
  10. 세크로핀 A (Cecropin A) 및
    서열번호 1 또는 서열번호 6의 폴리펩타이드를 포함하는, 융합 폴리펩타이드.
  11. 제10항에 있어서, 세크로핀 A는 서열번호 8의 아미노산 서열로 표시되는 것인, 융합 폴리펩타이드.
  12. 제10항에 있어서, 상기 세크로핀 A 및 서열번호 1 또는 서열번호 6의 폴리펩타이드는 N-말단으로부터 순서대로 연결된 것인, 융합 폴리펩타이드.
  13. 제10항에 있어서, 상기 세크로핀 A 및 서열번호 1 또는 서열번호 6의 폴리펩타이드는 펩타이드 링커에 의하여 연결된 것인, 융합 폴리펩타이드.
  14. 제10항에 있어서, 서열번호 10 또는 서열번호 13의 아미노산 서열로 표시되는, 융합 폴리펩타이드.
  15. 제10항 내지 제14항 중 어느 한 항의 융합 폴리펩타이드를 암호화하는 폴리뉴클레오타이드.
  16. 제15항에 있어서, 서열번호 11 또는 서열번호 14의 핵산 서열로 표시되는, 폴리뉴클레오타이드.
  17. 제15항의 폴리뉴클레오타이드를 포함하는, 재조합 벡터.
  18. 제15항의 폴리뉴클레오타이드 또는 이를 포함하는 재조합 벡터를 포함하는, 재조합 세포.
  19. 제1항의 폴리펩타이드
    제10항 내지 제14항 중 어느 한 항의 융합 폴리펩타이드
    상기 폴리펩타이드를 암호화하는 폴리뉴클레오타이드,
    상기 융합 폴리펩타이드를 암호화하는 폴리뉴클레오타이드;
    상기 폴리펩타이드를 암호화하는 폴리뉴클레오타이드를 포함하는 재조합 벡터,
    상기 융합 폴리펩타이드를 암호화하는 폴리뉴클레오타이드를 포함하는 재조합 벡터; 및
    상기 폴리뉴클레오타이드 또는 재조합 벡터를 포함하는 재조합 세포
    로 이루어진 군에서 선택된 1종 이상을 포함하는, 항생제.
  20. 제19항에 있어서, 폴리믹신 계열 항생제를 추가로 포함하는, 항생제.
  21. 제20항에 있어서, 상기 폴리믹신 계열 항생제는 폴리믹신 B, 콜리스틴, 또는 이들의 조합인, 항생제.
  22. 제19항에 있어서, 그람음성균에 대하여 항생 활성을 갖는, 항생제.
  23. 제22항에 있어서, 상기 그람음성균은 슈도모나스 속 세균, 아시네토박터 속 세균, 에스케리챠 속 세균, 엔테로박터 속 세균, 및 클렙시엘라 속 세균으로 이루어진 군에서 선택된 1종 이상인, 항생제.
  24. 제23항에 있어서, 상기 슈도모나스 속 세균은 슈도모나스 에루기노사(Pseudomonas aeruginosa)이고, 상기 아시네토박터 속 세균은 아시네토박터 바우마니(Acinetobacter baumannii)이고, 상기 에스케리챠 속 세균은 대장균(Escherichia coli)이고, 상기 엔테로박터 속 세균은 엔테로박터 에어로지너스(Enterobacter aerogenes)이고, 상기 클렙시엘라 속 세균은 클렙시엘라 뉴모니아(Klebsiella pneumoniae)인, 항생제.
  25. 제1항의 폴리펩타이드
    제10항 내지 제14항 중 어느 한 항의 융합 폴리펩타이드
    상기 폴리펩타이드를 암호화하는 폴리뉴클레오타이드,
    상기 융합 폴리펩타이드를 암호화하는 폴리뉴클레오타이드;
    상기 폴리펩타이드를 암호화하는 폴리뉴클레오타이드를 포함하는 재조합 벡터,
    상기 융합 폴리펩타이드를 암호화하는 폴리뉴클레오타이드를 포함하는 재조합 벡터; 및
    상기 폴리뉴클레오타이드 또는 재조합 벡터를 포함하는 재조합 세포
    로 이루어진 군에서 선택된 1종 이상을 포함하는, 그람음성균의 감염 또는 그람음성균에 의하여 유발되는 질병의 예방 또는 치료용 약학 조성물.
  26. 제25항에 있어서, 상기 그람음성균은 슈도모나스 속 세균, 아시네토박터 속 세균, 에스케리챠 속 세균, 엔테로박터 속 세균, 및 클렙시엘라 속 세균으로 이루어진 군에서 선택된 1종 이상인, 약학 조성물.
  27. 제26항에 있어서, 상기 슈도모나스 속 세균은 슈도모나스 에루기노사(Pseudomonas aeruginosa)이고, 상기 아시네토박터 속 세균은 아시네토박터 바우마니(Acinetobacter baumannii)이고, 상기 에스케리챠 속 세균은 대장균(Escherichia coli)이고, 상기 엔테로박터 속 세균은 엔테로박터 에어로지너스(Enterobacter aerogenes)이고, 상기 클렙시엘라 속 세균은 클렙시엘라 뉴모니아(Klebsiella pneumoniae)인, 약학 조성물.
  28. 제26항에 있어서, 상기 그람음성균은 슈도모나스 속 세균이고, 슈도모나스 속 세균에 의하여 유발되는 질병은 피부감염, 욕창, 폐렴, 균혈증, 패혈증, 심내막염, 수막염, 외이도염, 중이염, 각막염, 골수염, 장염, 복막염, 또는 낭포성섬유증인, 약학 조성물.
  29. 제26항에 있어서, 상기 그람음성균은 아시네토박터 속 세균이고, 아시네토박터 속 세균에 의하여 유발되는 질병은 피부감염, 폐렴, 균혈증, 또는 패혈증인, 약학 조성물.
  30. 제26항에 있어서, 상기 그람음성균은 에스케리챠 속 세균이고, 에스케리챠 속 세균에 의하여 유발되는 질병은 장염, 크론병, 궤양성 대장염, 세균성이질, 요로감염증, 피부감염, 균혈증, 또는 패혈증인, 약학 조성물.
  31. 제19항의 항생제를 포함하는, 사료 첨가제.
  32. 제19항의 항생제를 포함하는, 소독제.
  33. 제19항의 항생제를 포함하는, 세척제.
PCT/KR2021/006302 2020-05-22 2021-05-20 신규한 폴리펩타이드, 융합 폴리펩타이드, 및 이를 포함하는 그람음성균에 대한 항생제 WO2021235876A1 (ko)

Priority Applications (5)

Application Number Priority Date Filing Date Title
EP21809334.2A EP4074831A4 (en) 2020-05-22 2021-05-20 NEW POLYPEPTIDE, FUSION POLYPEPTIDE AND ANTIBIOTIC AGAINST GRAM-NEGATIVE BACTERIA INCLUDING THEM
JP2022570284A JP2023526388A (ja) 2020-05-22 2021-05-20 新規なポリペプチド、融合ポリペプチド、およびこれを含むグラム陰性菌に対する抗生物質
CN202180018132.5A CN115397994B (zh) 2020-05-22 2021-05-20 新型多肽、融合多肽和包含其的抗革兰氏阴性菌的抗生素
CA3184447A CA3184447A1 (en) 2020-05-22 2021-05-20 Novel polypeptide, fusion polypeptide, and antibiotic against gram-negative bacteria comprising same
US17/853,027 US11807881B2 (en) 2020-05-22 2022-06-29 Polypeptide, fusion polypeptide, and antibiotic against gram-negative bacteria comprising same

Applications Claiming Priority (6)

Application Number Priority Date Filing Date Title
KR1020200061906A KR102224897B1 (ko) 2020-05-22 2020-05-22 신규한 폴리펩타이드 및 이를 포함하는 그람음성균에 대한 항생제
KR10-2020-0061906 2020-05-22
KR10-2020-0108498 2020-08-27
KR1020200108498A KR102228999B1 (ko) 2020-08-27 2020-08-27 폴리펩타이드 변이체 및 이를 포함하는 그람음성균에 대한 항생제
KR1020210019108A KR102286544B1 (ko) 2021-02-10 2021-02-10 융합 폴리펩타이드 및 이를 포함하는 그람음성균에 대한 항생제
KR10-2021-0019108 2021-02-10

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US17/853,027 Continuation US11807881B2 (en) 2020-05-22 2022-06-29 Polypeptide, fusion polypeptide, and antibiotic against gram-negative bacteria comprising same

Publications (1)

Publication Number Publication Date
WO2021235876A1 true WO2021235876A1 (ko) 2021-11-25

Family

ID=78708698

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2021/006302 WO2021235876A1 (ko) 2020-05-22 2021-05-20 신규한 폴리펩타이드, 융합 폴리펩타이드, 및 이를 포함하는 그람음성균에 대한 항생제

Country Status (6)

Country Link
US (1) US11807881B2 (ko)
EP (1) EP4074831A4 (ko)
JP (1) JP2023526388A (ko)
CN (1) CN115397994B (ko)
CA (1) CA3184447A1 (ko)
WO (1) WO2021235876A1 (ko)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN115975048A (zh) * 2022-10-28 2023-04-18 山东龙昌动物保健品有限公司 一种含有杜仲叶提取物的抗菌复合制剂及其在食物防腐保鲜中的应用
CN116715736A (zh) * 2023-08-07 2023-09-08 山东省农业科学院畜牧兽医研究所 噬菌体尾部纤维蛋白在o2抗原血清型的禽致病性大肠杆菌鉴定中的应用

Citations (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20120095345A (ko) * 2009-06-26 2012-08-28 뤼산도 홀딩 아게 항균제
KR20180064417A (ko) * 2015-09-17 2018-06-14 콘트라펙트 코포레이션 그람 음성균에 대해 활성인 라이신 폴리펩티드
KR20190085549A (ko) * 2016-11-30 2019-07-18 사시나파스 컴퍼니 리미티드 변성 펩티드
KR20190110094A (ko) * 2016-12-16 2019-09-27 유니베르시다데 도 미노 신규한 엔돌리신
JP2020500935A (ja) * 2016-12-05 2020-01-16 テクノファージ インヴェスティガサォン エ デセンヴォルヴィメント エム ビオテクノロジア エスィアーＴｅｃｈｎｏｐｈａｇｅ， Ｉｎｖｅｓｔｉｇａｃａｏ Ｅ Ｄｅｓｅｎｖｏｌｖｉｍｅｎｔｏ Ｅｍ Ｂｉｏｔｅｃｎｏｌｏｇｉａ， Ｓａ 呼吸器抗菌性ファージを含むバクテリオファージ組成物、およびその使用法
KR102224897B1 (ko) * 2020-05-22 2021-03-08 주식회사 라이센텍 신규한 폴리펩타이드 및 이를 포함하는 그람음성균에 대한 항생제
KR102228999B1 (ko) * 2020-08-27 2021-03-18 주식회사 라이센텍 폴리펩타이드 변이체 및 이를 포함하는 그람음성균에 대한 항생제

Family Cites Families (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
PL3789031T3 (pl) 2010-09-17 2024-01-15 Technophage, Investigação E Desenvolvimento Em Biotecnologia, Sa Antybakteryjny fag, peptydy fagowe i sposoby ich zastosowania
EP2468856A1 (en) * 2010-12-23 2012-06-27 Lysando Aktiengesellschaft Antimicrobial Agents
KR101571835B1 (ko) 2013-01-18 2015-11-25 서울대학교산학협력단 박테리오파지 spn1s 유래의 신규 엔도라이신 및 이를 포함하는 세균 사멸용 조성물
KR101824778B1 (ko) 2015-11-26 2018-02-01 연세대학교 산학협력단 항생제 내성을 갖는 슈도모나스속 균을 용균하는 박테리오파지
WO2018185634A1 (en) 2017-04-03 2018-10-11 Sasinapas Co., Ltd. Engineered gram-negative endolysins
AU2019276253A1 (en) * 2018-05-30 2020-11-26 Lysando Ag Novel antimicrobial proteins

Patent Citations (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20120095345A (ko) * 2009-06-26 2012-08-28 뤼산도 홀딩 아게 항균제
KR20180064417A (ko) * 2015-09-17 2018-06-14 콘트라펙트 코포레이션 그람 음성균에 대해 활성인 라이신 폴리펩티드
KR20190085549A (ko) * 2016-11-30 2019-07-18 사시나파스 컴퍼니 리미티드 변성 펩티드
JP2020500935A (ja) * 2016-12-05 2020-01-16 テクノファージ インヴェスティガサォン エ デセンヴォルヴィメント エム ビオテクノロジア エスィアーＴｅｃｈｎｏｐｈａｇｅ， Ｉｎｖｅｓｔｉｇａｃａｏ Ｅ Ｄｅｓｅｎｖｏｌｖｉｍｅｎｔｏ Ｅｍ Ｂｉｏｔｅｃｎｏｌｏｇｉａ， Ｓａ 呼吸器抗菌性ファージを含むバクテリオファージ組成物、およびその使用法
KR20190110094A (ko) * 2016-12-16 2019-09-27 유니베르시다데 도 미노 신규한 엔돌리신
KR102224897B1 (ko) * 2020-05-22 2021-03-08 주식회사 라이센텍 신규한 폴리펩타이드 및 이를 포함하는 그람음성균에 대한 항생제
KR102228999B1 (ko) * 2020-08-27 2021-03-18 주식회사 라이센텍 폴리펩타이드 변이체 및 이를 포함하는 그람음성균에 대한 항생제

Non-Patent Citations (5)

* Cited by examiner, † Cited by third party
Title
DATABASE PROTEIN 10 April 2019 (2019-04-10), ANONYMOUS : "putative endolysin [Pseudomonas phage PA1C] ", XP055869489, retrieved from NCBI Database accession no. QBX32324 *
HANG YANG, WANG MENGYUE, YU JUNPING, WEI HONGPING: "Antibacterial Activity of a Novel Peptide-Modified Lysin Against Acinetobacter baumannii and Pseudomonas aeruginosa", FRONTIERS IN MICROBIOLOGY, vol. 6, no. 1471, 22 December 2015 (2015-12-22), pages 1 - 9, XP055657170, DOI: 10.3389/fmicb.2015.01471 *
KARLINALTSCHUL, PRO. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 5873
L. SILVESTRO, J. N. WEISER, P. H. AXELSEN: "Antibacterial and Antimembrane Activities of Cecropin A in Escherichia coli", ANTIMICROBIAL AGENTS AND CHEMOTHERAPY, AMERICAN SOCIETY FOR MICROBIOLOGY, US, vol. 44, no. 3, 1 March 2000 (2000-03-01), US , pages 602 - 607, XP055295012, ISSN: 0066-4804, DOI: 10.1128/AAC.44.3.602-607.2000 *
METHODS ENZYMOL., vol. 183, 1990, pages 63

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN115975048A (zh) * 2022-10-28 2023-04-18 山东龙昌动物保健品有限公司 一种含有杜仲叶提取物的抗菌复合制剂及其在食物防腐保鲜中的应用
CN116715736A (zh) * 2023-08-07 2023-09-08 山东省农业科学院畜牧兽医研究所 噬菌体尾部纤维蛋白在o2抗原血清型的禽致病性大肠杆菌鉴定中的应用
CN116715736B (zh) * 2023-08-07 2023-11-14 山东省农业科学院畜牧兽医研究所 噬菌体尾部纤维蛋白在o2抗原血清型的禽致病性大肠杆菌鉴定中的应用

Also Published As

Publication number Publication date
CN115397994A (zh) 2022-11-25
CN115397994B (zh) 2023-03-28
EP4074831A4 (en) 2023-08-09
JP2023526388A (ja) 2023-06-21
CA3184447A1 (en) 2021-11-25
EP4074831A1 (en) 2022-10-19
US20220348895A1 (en) 2022-11-03
US11807881B2 (en) 2023-11-07

Similar Documents

Publication Publication Date Title
WO2021235876A1 (ko) 신규한 폴리펩타이드, 융합 폴리펩타이드, 및 이를 포함하는 그람음성균에 대한 항생제
WO2020256392A1 (ko) 라이신 치환을 포함하는 romo1 유래 항균 펩타이드 및 그 변이체
WO2013169077A1 (ko) 악액질 예방 또는 치료용 조성물
WO2015156649A1 (ko) 섬유증 억제 활성을 가지는 펩티드 및 이를 포함하는 조성물
WO2017078440A1 (ko) 신경세포 손실 예방 및 재생 효능을 가지는 펩티드 및 이를 포함하는 조성물
WO2017034335A1 (en) Improved cell-permeable (icp)-socs3 recombinant protein and uses thereof
WO2018092955A1 (ko) 전복에서 유래한 항균 펩타이드 유사체 및 이를 포함하는 항균용 약학 조성물
WO2012050402A2 (ko) 세포투과성 parkin 재조합 단백질 및 이를 함유하는 퇴행성 뇌질환 치료용 약학적 조성물
WO2014035179A1 (ko) 미토콘드리아 타겟팅 펩타이드
WO2017018787A1 (en) Improved cell-permeable (icp) parkin recombinant protein and use thereof
WO2017030323A1 (en) Cell-permeable (cp)-δsocs3 recombinant protein and uses thereof
WO2022114728A2 (ko) Shmt 억제제 또는 mthfr 억제제를 포함하는 박테리아 감염 치료용 조성물
KR102286544B1 (ko) 융합 폴리펩타이드 및 이를 포함하는 그람음성균에 대한 항생제
KR102228999B1 (ko) 폴리펩타이드 변이체 및 이를 포함하는 그람음성균에 대한 항생제
WO2017034244A1 (ko) 중추신경계 질환에 대한 예방 또는 치료효과를 갖는 펩타이드 및 이를 유효성분으로 하는 중추신경계 질환 예방 및 치료용 약학적 조성물
WO2020130652A2 (ko) 세균을 용균하는 신규한 박테리오파지
WO2018080146A2 (ko) 단백질 탈 인산화 효소 1 억제 펩타이드를 포함하는 혈관 질환 치료용 조성물
WO2023022546A1 (en) Novel polypeptides and antibiotics against gram-negative bacterium comprising the same
WO2020032324A1 (ko) 폐렴구균의 독소-항독소 체계를 표적으로 하는 항생 펩타이드 및 이의 용도
WO2014182078A1 (ko) 장 면역활성 조절용 조성물 및 이의 용도
WO2019022469A1 (ko) 니코틴아마이드 아데닌 다이뉴클레오타이드 인산(nadph) 또는 이의 유도체의 베타 락타메이즈 저해제로서의 용도
WO2020013527A1 (ko) 항균 활성, 용혈 안정성 및 혈청 내 안정성이 증진된 항균 펩타이드 유도체
WO2018182301A1 (ko) 세포투과성 펩타이드와 ctCTLA4 펩타이드가 융합된 융합단백질을 유효성분으로 하는 염증성 호흡기 질환 예방 또는 치료용 약학 조성물
WO2021201570A1 (ko) 신규한 항균 펩타이드 및 이의 용도
WO2015182798A1 (ko) 골수-유래 억제세포(myeloid-derived suppressor cells, mdscs) 저해용 조성물

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21809334

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 21 809 334.2

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2021809334

Country of ref document: EP

Effective date: 20220714

ENP Entry into the national phase

Ref document number: 2022570284

Country of ref document: JP

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 3184447

Country of ref document: CA

NENP Non-entry into the national phase

Ref country code: DE