Classifications

• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K38/00—Medicinal preparations containing peptides
  • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
  • A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
  • A61K38/19—Cytokines; Lymphokines; Interferons
  • A61K38/20—Interleukins [IL]
  • A61K38/2013—IL-2
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K39/00—Medicinal preparations containing antigens or antibodies
  • A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
  • A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
  • A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
  • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
  • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
  • A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
  • A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
  • A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
  • A61K47/6811—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
  • A61K47/6813—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin the drug being a peptidic cytokine, e.g. an interleukin or interferon
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P35/00—Antineoplastic agents
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
  • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
  • C07K14/52—Cytokines; Lymphokines; Interferons
  • C07K14/54—Interleukins [IL]
  • C07K14/55—IL-2
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
  • C07K16/46—Hybrid immunoglobulins
• • C—CHEMISTRY; METALLURGY
  • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
  • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
  • C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
  • C12N5/06—Animal cells or tissues; Human cells or tissues
  • C12N5/0602—Vertebrate cells
  • C12N5/0634—Cells from the blood or the immune system
  • C12N5/0636—T lymphocytes
• • C—CHEMISTRY; METALLURGY
  • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
  • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
  • C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
  • C12N5/06—Animal cells or tissues; Human cells or tissues
  • C12N5/0602—Vertebrate cells
  • C12N5/0681—Cells of the genital tract; Non-germinal cells from gonads
  • C12N5/0682—Cells of the female genital tract, e.g. endometrium; Non-germinal cells from ovaries, e.g. ovarian follicle cells
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K39/00—Medicinal preparations containing antigens or antibodies
  • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
  • C07K16/08—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
  • C07K16/10—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from RNA viruses
  • C07K16/1027—Paramyxoviridae, e.g. respiratory syncytial virus
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2317/00—Immunoglobulins specific features
  • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
  • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2317/00—Immunoglobulins specific features
  • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
  • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
  • C07K2317/565—Complementarity determining region [CDR]
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2317/00—Immunoglobulins specific features
  • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
  • C07K2317/74—Inducing cell proliferation
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2317/00—Immunoglobulins specific features
  • C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2317/00—Immunoglobulins specific features
  • C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
  • C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2319/00—Fusion polypeptide
  • C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2319/00—Fusion polypeptide
  • C07K2319/31—Fusion polypeptide fusions, other than Fc, for prolonged plasma life, e.g. albumin

Definitions

• the present invention relates to antibody-cytokine engrafted proteins that bind the interleukin-2 (IL2) low affinity receptor, and methods of cancer treatment.
• IL2 interleukin-2
• IL2 was first cloned in 1983 (Taniguchi et al, Nature 1983, 302:305-310,
• the IL2 protein has a length of 153 amino acids with a signal peptide from amino acids 1-20 and folds into a structure of 4 anti-parallel, amphipathic alpha-helices (Smith K.A., Science 1988, 240:1169-1176).
• IL2 mediates its biological effect by signalling through a high affinity or low affinity receptor (Kreig et al, PNAS 2010, 107(26)11906-11911).
• the high affinity receptor is trimeric, consisting of IL2-Ra (CD25) IL2-R (CD122) and IL2-Ry (CD132).
• the low affinity receptor is dimeric, consisting only of the IL2-R (CD122) and IL2-Ry(CD132) chains.
• the low affinity receptor binds IL2, but with 10-100 times less affinity than the trimeric, high affinity receptor, indicating that IL2-Ra (CD25) is important for increase in affinity, but is not a signalling component (Kreig et al., supra).
• the expression of the IL2 receptors is also distinct.
• the high affinity IL2 receptor is expressed on activated T cells and CD4+/Foxp3+ T regulatory cells (Treg).
• the low affinity IL2 receptor is found on CD8+ T effector cells and natural killer cells (NK).
• rhIL2 Recombinant IL2
• Proleukin® (Aldesleukin) is a modified IL2 that is aglycosylated, lacks an N-terminal alanine and has a serine substituted for cysteine at amino acid 125. Proleukin® was initially indicated as a therapy for malignant melanoma and renal cell carcinoma, but has been used for other cancer types such as colorectal, breast, lung and mesothelioma (Coventry, supra). A study spanning 259 renal cell carcinoma patients from 1986 to 2006, found that 23 patients has a complete response and 30 had a partial response (Klapper et al., Cancer 2008 113(2):293-301). This accounted for an overall objective response rate of 20%, with complete tumor regression in 7% of the patients with renal cell cancer (Klapper et al., supra).
• IL2 treatment of cancer was not without adverse effects.
• the 259 patient study noted capillary/vascular leakage, vasodilation and oliguria.
• Grade 3 and Grade 4 infections both of catheters and general infection, attributed to neutrophil dysfunction (Klapper et al., supra).
• autoimmune diseases and inflammatory disorders such as Crohn's Disease, scleroderma, thyroiditis, inflammatory arthritis, diabetes mellitus, oculo-bulbar myasthenia gravis, crescentic IgA glomerulonephritis, cholecystitis, cerebral vasculitis, Stevens-Johnson syndrome and bullous pemphigoid.
• the present disclosure provides for IL2 engrafted into the CDR sequences of an antibody having preferred therapeutic profiles over molecules known and used in the clinic.
• the provided antibody cytokine engrafted protein compositions increase or maintain CD8+ T effector cells while reducing the activity of Treg cells.
• provided compositions convey improved half-life, stability and produceability over recombinant human IL2 formulations such as Proleukin®.
• the present disclosure thus provides antibody cytokine engrafted proteins that bind to and promote preferred signalling through the IL2 low affinity receptor, with reduced binding to the IL2 high affinity receptor.
• antibody-cytokine engrafted proteins comprising (i) an immunoglobulin heavy chain sequence comprising a heavy chain variable region (VH) and (ii) an immunoglobulin light chain sequence comprising a light chain variable region (VL), and wherein an IL2 molecule is engrafted into a complementarity determining region (CDR) of the VH or the VL of the antibody.
• VH heavy chain variable region
• VL light chain variable region
• CDR complementarity determining region
• Embodiments of the present disclosure provide antibody cytokine engrafted proteins comprising:
• VH heavy chain variable region
• CDR Regions
• VL light chain variable region
• IL2 Interleukin 2
• the antibody cytokine engrafted protein comprising an IL2 molecule engrafted into a heavy chain CDR.
• the antibody cytokine engrafted protein wherein the IL2 molecule is engrafted into a region selected from complementarity determining region 1 (HCDR1), complementarity determining region 2 (HCDR2) or complementarity determining region 3 (HCDR3).
• HCDR1 complementarity determining region 1
• HCDR2 complementarity determining region 2
• HCDR3 complementarity determining region 3
• the antibody cytokine engrafted protein comprising an IL2 molecule engrafted into HCDR1.
• the antibody cytokine engrafted protein comprising an IL2 molecule engrafted into a light chain CDR.
• the antibody cytokine engrafted protein wherein the IL2 molecule is engrafted into a region selected from complementarity determining region 1 (LCDR1), complementarity determining region 2 (LCDR2) or complementarity determining region 3 (LCDR3).
• LCDR1 complementarity determining region 1
• LCDR2 complementarity determining region 2
• LCDR3 complementarity determining region 3
• the antibody cytokine engrafted protein comprising an IL2 molecule containing a mutation that reduces the affinity of the IL2 molecule to the high affinity IL2 receptor.
• the antibody cytokine engrafted protein where the antibody cytokine engrafted protein stimulates CD8 T cell effector proliferation greater than recombinant IL2 or Proleukin®.
• the antibody cytokine engrafted protein where the antibody cytokine engrafted protein stimulates Treg cell proliferation less than recombinant IL2 or Proleukin®.
• the antibody cytokine engrafted protein wherein the antibody cytokine engrafted protein stimulates NK cell proliferation greater than recombinant IL2 or
• the antibody cytokine engrafted protein where the antibody cytokine engrafted protein has a longer half-life than recombinant IL2 or Proleukin®.
• the antibody cytokine engrafted protein, wherein the IL2 molecule consists of
• the antibody cytokine engrafted protein comprising an IgG class antibody heavy chain.
• I g Gl IgG2, or IgG4.
• CDRs to a target is reduced by 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100%, by the engrafted IL2 molecule.
• CDRs to a target is retained by 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100%, in the presence of the engrafted IL2 molecule.
• CDRs is distinct from the binding specificity of the IL2 molecule.
• CDRs is to a non-human target.
• the antibody cytokine engrafted protein, wherein the non-human antigen is a virus.
• the antibody cytokine engrafted protein wherein the virus is respiratory syncytial virus (RSV).
• RSV respiratory syncytial virus
• the antibody cytokine engrafted protein wherein the antibody scaffold portion of the antibody cytokine engrafted protein is humanized or human.
• Embodiments of the present disclosure provide antibody cytokine engrafted proteins comprising: (i) a heavy chain variable region that comprises (a) a HCDRl of SEQ ID NO: 13, (b) a HCDR2 of SEQ ID NO: 14, (c) a HCDR3 of SEQ ID NO: 15 and a light chain variable region that comprises: (d) a LCDR1 of SEQ ID NO:29, (e) a LCDR2 of SEQ ID NO:30, and (f) a LCDR3 of SEQ ID NO:31 ; or (ii) a heavy chain variable region that comprises (a) a HCDRl of SEQ ID NO:45, (b) a HCDR2 of SEQ ID NO:46, (c) a HCDR3 of SEQ ID NO:47; and a light chain variable region that comprises: (d) a LCDR1 of SEQ ID NO:61, (e) a LCDR2 of SEQ ID NO:62, and (f)
• Embodiments of the present disclosure provide antibody cytokine engrafted proteins comprising: (i) a heavy chain variable region (VH) that comprises SEQ ID NO: 19, and a light chain variable region (VL) that comprises SEQ ID NO: 35; or (ii) a heavy chain variable region (VH) that comprises SEQ ID NO: 51, and a light chain variable region (VL) that comprises SEQ ID NO: 67.
• the antibody cytokine engrafted protein wherein the antibody comprises a modified Fc region corresponding with reduced effector function.
• the antibody cytokine engrafted protein wherein the modified Fc region comprises a mutation selected from one or more of D265A, P329A, P329G, N297A, L234A, and L235A.
• the antibody cytokine engrafted protein wherein the modified Fc region comprises a combination of mutations selected from one or more of D265A/P329A, D265A/N297A, L234/L235A, P329A/L234A/L235A, and P329G/L234A/L235A.
• Embodiments of the present disclosure provide antibody cytokine engrafted proteins comprising a HCDRl of SEQ ID NO: 13, a HCDR2 of SEQ ID NO: 14, a HCDR3 of SEQ ID NO:15, a LCDR1 of SEQ ID NO:29, a LCDR2 of SEQ ID NO:30, a LCDR3 of SEQ ID NO:31, a modified Fc region containing the mutation D265A/P329A, wherein the antibody cytokine engrafted protein stimulates less activation of Treg cells when compared to recombinant IL2 or Proleukin®.
• Embodiments of the present disclosure provide antibody cytokine engrafted proteins comprising a HCDRl of SEQ ID NO: 45, a HCDR2 of SEQ ID NO:46, a HCDR3 of SEQ ID NO:47, a LCDRl of SEQ ID NO:61, a LCDR2 of SEQ ID NO:62, a LCDR3 of SEQ ID NO:63, a modified Fc region containing the mutation D265A/P329A, wherein the antibody cytokine engrafted protein stimulates less activation of Treg cells when compared to recombinant IL2 or Proleukin®.
• Embodiments of the present disclosure provide isolated nucleic acids encoding an antibody cytokine engrafted protein comprising: (i) a heavy chain of SEQ ID NO:22 and/or a light chain of SEQ ID NO:38; or (ii) a heavy chain of SEQ ID NO:54 and/or a light chain of SEQ ID NO:70.
• Embodiments of the present disclosure provide recombinant host cells suitable for the production of an antibody cytokine engrafted protein, comprising the nucleic acids disclosed herein encoding the heavy and light chain polypeptides of the protein, and optionally, a secretion signal.
• the recombinant host cell which is a mammalian cell line.
• the recombinant host cell wherein the mammalian cell line is a CHO cell line.
• Embodiments of the present disclosure provide pharmaceutical compositions comprising the antibody cytokine engrafted protein disclosed herein and one or more pharmaceutically acceptable carrier.
• Embodiments of the present disclosure provide methods of treating cancer in an individual in need thereof, comprising administering to the individual a therapeutically effective amount of the antibody cytokine engrafted protein or the pharmaceutical composition disclosed herein.
• the method of treating cancer wherein the cancer is selected from the group consisting of: melanoma, lung cancer, colorectal cancer, prostate cancer, breast cancer and lymphoma.
• the method of treating cancer, wherein the therapeutic agent is an immune checkpoint inhibitor.
• the immune checkpoint is selected from the group consisting of: PD-1, PD-L1, PD-L2, TIM3, CTLA-4, LAG-3, CEACAM-1, CEACAM-5, VISTA, BTLA, TIGIT, LAIRl, CD160, 2B4 and TGFR.
• Embodiments of the present disclosure provide methods of expanding CD8 T effector cells in a patient in need thereof, comprising administering the antibody cytokine engrafted protein or the pharmaceutical composition disclosed herein to the patient.
• CD 8 T effector cells wherein CD 8 T effectors are expanded and NK cells are not expanded.
• the method of expanding CD 8 T effector cells wherein the immune checkpoint is selected from the group consisting of: PD-1, PD-L1, PD-L2, TIM3, CTLA-4, LAG-3, CEACAM-1, CEACAM-5, VISTA, BTLA, TIGIT, LAIRl, CD160, 2B4 and TGFR.
• the immune checkpoint is selected from the group consisting of: PD-1, PD-L1, PD-L2, TIM3, CTLA-4, LAG-3, CEACAM-1, CEACAM-5, VISTA, BTLA, TIGIT, LAIRl, CD160, 2B4 and TGFR.
• Embodiments of the present disclosure provide uses of an antibody cytokine engrafted protein in the treatment of cancer comprising: (i) a heavy chain variable region that comprises (a) a HCDR1 of SEQ ID NO: 13, (b) a HCDR2 of SEQ ID NO: 14, (c) a HCDR3 of SEQ ID NO: 15 and a light chain variable region that comprises: (d) a LCDR1 of SEQ ID NO:29, (e) a LCDR2 of SEQ ID NO:30, and (f) a LCDR3 of SEQ ID NO:31; and (ii) a heavy chain variable region that comprises (a) a HCDR1 of SEQ ID NO:45, (b) a HCDR2 of SEQ ID NO:46, (c) a HCDR3 of SEQ ID NO:47; and a light chain variable region that comprises: (d) a LCDR1 of SEQ ID NO:61, (e) a LCDR2 of SEQ ID NO:
• the antagonist of the immune checkpoint inhibitor is selected from the group consisting of: PD-1, PD-L1, PD-L2, TIM3, CTLA-4, LAG-3, CEACAM-1, CEACAM-5, VISTA, BTLA, TIGIT, LAIRl, CD160, 2B4 and TGFR.
• the antibody cytokine engrafted protein comprises an
• the immunoglobulin is selected from IgGl, IgG2, or IgG4 subclass Fc region.
• the antibody, antibody fragment, or antigen binding molecule optionally contains at least one modification that modulates (i.e., increases or decreases) binding of the antibody or antibody fragment to an Fc receptor.
• the immunoglobulin heavy chain may optionally comprise a modification conferring modified effector function.
• the immunoglobulin heavy chain may comprise a mutation conferring reduced effector function selected from any of D265A, P329A, P329G, N297A, D265A/P329A, D265A/N297A, L234/L235A, P329A/L234A/L235A, and
• the antibody cytokine engrafted protein also comprises variations in the IL2 portion of the molecule.
• the variations can be single amino acid changes, single amino acid deletions, multiple amino acid changes and multiple amino acid deletions. These changes in the IL2 cytokine portion of the molecule can decrease the affinity of the antibody cytokine engrafted protein for the high-affinity IL2 receptor.
• the disclosure provides polynucleotides encoding at least a heavy chain and/or a light chain protein of an antibody cytokine engrafted protein as described herein.
• host cells are provided that are suitable for the production of an antibody cytokine engrafted protein as described herein.
• host cells comprise nucleic acids encoding a light chain and/or heavy chain polypeptide of the antibody cytokine engrafted protein.
• methods for producing antibody cytokine engrafted proteins comprising culturing provided host cells as described herein under conditions suitable for expression, formation, and secretion of the antibody cytokine engrafted protein and recovering the antibody cytokine engrafted protein from the culture.
• the disclosure further provides kits comprising an antibody cytokine engrafted protein, as described herein.
• compositions comprising an antibody cytokine engrafted protein, as described herein, and a
• the disclosure provides pharmaceutical compositions comprising an antibody cytokine engrafted protein for administering to an individual.
• methods of treating cancer in an individual in need thereof comprising administering to the individual a therapeutically effective amount of an antibody cytokine engrafted protein, as described herein.
• an antibody cytokine engrafted protein for use in treatment or prophylaxis of cancer in an individual is provided.
• the patient has a cell proliferation disorder or cancer, for example, melanoma, lung cancer, colorectal cancer, prostate cancer, breast cancer and lymphoma.
• a cell proliferation disorder or cancer for example, melanoma, lung cancer, colorectal cancer, prostate cancer, breast cancer and lymphoma.
• an "antibody” refers to a molecule of the immunoglobulin family comprising a tetrameric structural unit. Each tetramer is composed of two identical pairs of polypeptide chains, each pair having one "light” chain (about 25 kD) and one "heavy” chain (about 50-70 kD), connected through a disulfide bond. Recognized immunoglobulin genes include the ⁇ , ⁇ , ⁇ , ⁇ , ⁇ , and ⁇ constant region genes, as well as the myriad immunoglobulin variable region genes. Light chains are classified as either ⁇ or ⁇ .
• Heavy chains are classified as ⁇ , ⁇ , ⁇ , ⁇ , or ⁇ , which in turn define the immunoglobulin classes, IgG, IgM, IgA, IgD, and IgE, respectively.
• Antibodies can be of any isotype/class (e.g., IgG, IgM, IgA, IgD, and IgE), or any subclass (e.g., IgGl, IgG2, IgG3, IgG4, IgAl, IgA2).
• Both the light and heavy chains are divided into regions of structural and functional homology.
• the terms "constant” and “variable” are used structurally and functionally.
• the N-terminus of each chain defines a variable (V) region or domain of about 100 to 110 or more amino acids primarily responsible for antigen recognition.
• VL variable light chain
• VH variable heavy chain
• the pairing of a VH and VL together forms a single antigen- binding site.
• both heavy chains and light chains contain a constant (C) region or domain.
• a secreted form of a immunoglobulin C region is made up of three C domains, CHI, CH2, CH3, optionally CH4 ( ⁇ ), and a hinge region.
• a membrane-bound form of an immunoglobulin C region also has membrane and intracellular domains.
• Each light chain has a VL at the N-terminus followed by a constant domain (C) at its other end.
• the constant domains of the light chain (CL) and the heavy chain (CHI, CH2 or CH3) confer important biological properties such as secretion, transplacental mobility, Fc receptor binding, complement binding, and the like.
• the N-terminus is a variable region and at the C-terminus is a constant region; the CH3 and CL domains actually comprise the carboxy-terminal domains of the heavy and light chain, respectively.
• the VL is aligned with the VH and the CL is aligned with the first constant domain of the heavy chain.
• antibody cytokine engrafted proteins encompasses conventional antibody structures and variations of antibodies.
• full length antibodies encompasses conventional antibody structures and variations of antibodies.
• chimeric antibodies encompasses conventional antibody structures and variations of antibodies.
• humanized antibodies encompasses conventional antibody structures and variations of antibodies.
• antibody fragments thereof encompasses conventional antibody structures and variations of antibodies.
• Antibodies exist as intact immunoglobulin chains or as a number of well- characterized antibody fragments produced by digestion with various peptidases.
• the term "antibody fragment,” as used herein, refers to one or more portions of an antibody that retains six CDRs.
• pepsin digests an antibody below the disulfide linkages in the hinge region to produce F(ab)' 2, a dimer of Fab' which itself is a light chain joined to VH-CH1 by a disulfide bond.
• the F(ab) '2 may be reduced under mild conditions to break the disulfide linkage in the hinge region, thereby converting the F(ab)'2 dimer into an Fab' monomer.
• the Fab' monomer is essentially a Fab with a portion of the hinge region (Paul, Fundamental Immunology 3d ed. (1993)). While various antibody fragments are defined in terms of the digestion of an intact antibody, one of skill will appreciate that such fragments may be synthesized de novo either chemically or by using recombinant DNA methodology. As used herein, an "antibody fragment” refers to one or more portions of an antibody, either produced by the modification of whole antibodies, or those synthesized de novo using recombinant DNA methodologies, that retain binding specificity and functional activity.
• antibody fragments include Fv fragments, single chain antibodies (ScFv), Fab, Fab', Fd (Vh and CHI domains), dAb (Vh and an isolated CDR); and multimeric versions of these fragments ⁇ e.g. , F(ab')2,) with the same binding specificity.
• Antibody cytokine engrafted proteins can also comprise antibody fragments necessary to achieve the desired binding specificity and activity.
• a "Fab” domain as used in the context comprises a heavy chain variable domain, a constant region CHI domain, a light chain variable domain, and a light chain constant region CL domain. The interaction of the domains is stabilized by a disulfide bond between the CHI and CL domains.
• the heavy chain domains of the Fab are in the order, from N-terminus to C-terminus, VH-CH and the light chain domains of a Fab are in the order, from N-terminus to C-terminus, VL-CL.
• the heavy chain domains of the Fab are in the order, from N-terminus to C-terminus, CH-VH and the light chain domains of the Fab are in the order CL-VL.
• Fab fragment-specific Fab
• Fab fragment-specific Fab
• CDRS complementarity-determining domains
• CDRs complementary-determining regions
• CDRS are the target protein-binding site of antibody chains that harbor specificity for such target protein.
• CDRl-3 three CDRs (CDRl-3, numbered sequentially from the N-terminus) in each human VL or VH, constituting about 15-20% of the variable domains.
• CDRs are structurally complementary to the epitope of the target protein and are thus directly responsible for the binding specificity.
• the remaining stretches of the VL or VH, the so-called framework regions (FR) exhibit less variation in amino acid sequence (Kuby, Immunology, 4th ed., Chapter 4. W.H. Freeman & Co., New York, 2000).
• Positions of CDRs and framework regions can be determined using various well known definitions in the art, e.g., Kabat, Chothia, and AbM (see, e.g., Kabat et al. 1991 Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242, Johnson et al , Nucleic Acids Res., 29:205-206 (2001); Chothia and Lesk, J. Mol. Biol., 196:901-917 (1987); Chothia et al. , Nature, 342:877-883 (1989); Chothia et al, J. Mol.
• HCDR1 HCDR1
• HCDR2 CDR amino acid residues in the V L
• LCDR3 CDR amino acid residues in the V H
• HCDR1 CDR amino acids in the V H
• HCDR2 CDR amino acids in the V H
• HCDR3 CDR amino acids in the V H
• LCDR1 CDR amino acids in the V H
• HCDR2 CDR amino acids in the V H
• HCDR2 amino acids in the V H
• HCDR2 amino acids in the V H
• HCDR2 amino acid residues in V L
• LCDR3 amino acid residues in V L
• the CDRs consist of amino acid residues 26-35 (HCDR1), 50-65 (HCDR2), and 95-102 (HCDR3) in human VH and amino acid residues 24-34 (LCDR1), 50-56 (LCDR2), and 89- 97 (LCDR3) in human VL.
• an "antibody variable light chain” or an “antibody variable heavy chain” as used herein refers to a polypeptide comprising the VL or VH, respectively.
• the endogenous VL is encoded by the gene segments V (variable) and J (junctional), and the endogenous VH by V, D (diversity), and J.
• Each of VL or VH includes the CDRs as well as the framework regions (FR).
• the term "variable region” or "V-region” interchangeably refer to a heavy or light chain comprising FR 1 -CDR 1 -FR2-CDR2-FR3 -CDR3 -FR4.
• a V-region can be naturally occurring, recombinant or synthetic.
• antibody light chains and/or antibody heavy chains may, from time to time, be collectively referred to as “antibody chains.”
• an “antibody variable light chain” or an “antibody variable heavy chain” and/or a “variable region” and/or an “antibody chain” optionally comprises a cytokine polypeptide sequence incorporated into a CDR.
• An "Fc region” as used herein refers to the constant region of an antibody excluding the first constant region (CHI) immunoglobulin domain.
• Fc refers to the last two constant region immunoglobulin domains of IgA, IgD, and IgG, and the last three constant region immunoglobulin domains of IgE and IgM, and the flexible hinge N-terminal to these domains.
• IgA and IgM Fc may include the J chain.
• Fc comprises immunoglobulin domains Cy2 and Cy3 and the hinge between Cyl and Cy.
• Fc region may refer to this region in isolation or this region in the context of an antibody or antibody fragment.
• Fc region includes naturally occurring allelic variants of the Fc region, e.g., in the CH2 and CH3 region, including, e.g., modifications that modulate effector function. Fc regions also include variants that don't result in alterations to biological function.
• one or more amino acids are deleted from the N-terminus or C- terminus of the Fc region of an immunoglobulin without substantial loss of biological function.
• a C-terminal lysine is modified replaced or removed.
• one or more C-terminal residues in the Fc region is altered or removed.
• one or more C-terminal residues in the Fc e.g., a terminal lysine
• one or more C-terminal residues in the Fc is substituted with an alternate amino acid (e.g., a terminal lysine is replaced).
• the Fc domain is the portion of the immunoglobulin (Ig) recognized by cell receptors, such as the FcR, and to which the complement-activating protein, CI q, binds.
• the lower hinge region which is encoded in the 5' portion of the CH2 exon, provides flexibility within the antibody for binding to FcR receptors.
• a "chimeric antibody” is an antibody molecule in which (a) the constant region, or a portion thereof, is altered, replaced or exchanged so that the antigen binding site (variable region) is linked to a constant region of a different or altered class, effector function and/or species, or an entirely different molecule which confers new properties to the chimeric antibody, e.g. , an enzyme, toxin, hormone, growth factor, and drug; or (b) the variable region, or a portion thereof, is altered, replaced or exchanged with a variable region having a different or altered antigen specificity.
• a "humanized” antibody is an antibody that retains the reactivity (e.g., binding specificity, activity) of a non-human antibody while being less immunogenic in humans. This can be achieved, for instance, by retaining non-human CDR regions and replacing remaining parts of an antibody with human counterparts. See, e.g. , Morrison et al , Proc. Natl. Acad. Sci. USA, 81 :6851-6855 (1984); Morrison and Oi, Adv. Immunol, 44:65-92 (1988); Verhoeyen et al, Science, 239:1534-1536 (1988); Padlan, Molec. Immun. , 28:489- 498 (1991); Padlan, Molec. Immun., 31(3):169-217 (1994).
• a "human antibody” includes antibodies having variable regions in which both the framework and CDR regions are derived from sequences of human origin.
• an antibody contains a constant region
• the constant region also is derived from such human sequences, e.g. , human germline sequences, or mutated versions of human germline sequences or antibody containing consensus framework sequences derived from human framework sequences analysis, for example, as described in Knappik et al, J. Mol. Biol. 296:57-86, 2000).
• Human antibodies may include amino acid residues not encoded by human sequences ⁇ e.g. , mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo, or a conservative substitution to promote stability or manufacturing).
• corresponding human germline sequence refers to a nucleic acid sequence encoding a human variable region amino acid sequence or subsequence that shares the highest determined amino acid sequence identity with a reference variable region amino acid sequence or subsequence in comparison to all other all other known variable region amino acid sequences encoded by human germline immunoglobulin variable region sequences.
• a corresponding human germline sequence can also refer to the human variable region amino acid sequence or subsequence with the highest amino acid sequence identity with a reference variable region amino acid sequence or subsequence in comparison to all other evaluated variable region amino acid sequences.
• a corresponding human germline sequence can be framework regions only, complementary determining regions only, framework and complementary determining regions, a variable segment (as defined above), or other combinations of sequences or sub-sequences that comprise a variable region.
• Sequence identity can be determined using the methods described herein, for example, aligning two sequences using BLAST, ALIGN, or another alignment algorithm known in the art.
• the corresponding human germline nucleic acid or amino acid sequence can have at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity with the reference variable region nucleic acid or amino acid sequence.
• valency refers to the number of potential target binding sites in a polypeptide. Each target binding site specifically binds one target molecule or a specific site on a target molecule. When a polypeptide comprises more than one target binding site, each target binding site may specifically bind the same or different molecules (e.g., may bind to different molecules, e.g., different antigens, or different epitopes on the same molecule).
• a conventional antibody for example, has two binding sites and is bivalent; "trivalent” and "tetravalent” refer to the presence of three binding sites and four binding sites, respectively, in an antibody molecule.
• the antibody cytokine engrafted proteins can be monovalent (i.e. , bind one target molecule), bivalent, or multivalent (i.e., bind more than one target molecule).
• a biological sample e.g. , a blood, serum, plasma or tissue sample.
• an antibody cytokine engrafted protein with a particular binding specificity bind to a particular antigen at least ten (10) times the background and do not substantially bind in a significant amount to other targets present in the sample.
• Specific binding to an antibody cytokine engrafted protein under such conditions can require an antibody cytokine engrafted protein to have been selected for its specificity for a particular target protein.
• specific binding includes antibody cytokine engrafted proteins that selectively bind to human IL2 low affinity receptor and do not include antibody cytokine engrafted proteins that cross-react with, e.g. , other cytokine receptor superfamily members.
• antibody cytokine engrafted proteins are selected that selectively bind to human IL2 low affinity receptor and cross-react with non- human primate IL2R (e.g., cynomolgus IL2R). In some embodiments, antibody engrafted proteins are selected that selectively bind to human IL2 low affinity receptor and react with an additional target.
• a variety of formats may be used to select antibody cytokine engrafted proteins that are specifically reactive with a particular target protein. For example, solid- phase ELISA immunoassays are routinely used to select antibodies specifically
• a specific or selective binding reaction will produce a signal at least twice over the background signal and more typically at least than 10 to 100 times over the background.
• Equilibrium dissociation constant refers to the dissociation rate constant (kd, time 1 ) divided by the association rate constant (k a , time 1 , M 1 ). Equilibrium dissociation constants can be measured using any known method in the art.
• the antibody cytokine engrafted proteins generally will have an equilibrium dissociation constant of less than about 10 "7 or 10 "8 M, for example, less than about 10 "9 M or 10 "10 M, in some embodiments, less than about 10 "11 M, 10 "12 M or 10 "13 M.
• epitopope or “binding region” refers to a domain in the antigen protein that is responsible for the specific binding between the antibody CDRs and the antigen protein.
• the term "receptor-cytokine binding region” refers to a domain in the engrafted cytokine portion of the antibody cytokine engrafted protein that is responsible for the specific binding between the engrafted cytokine and its receptor (e.g. the IL2 low affinity receptor). There is at least one such receptor-cytokine binding region present in each antibody cytokine engrafted protein, and each of the binding regions may be identical or different from the others.
• agonist interchangeably refers to an antibody capable of activating a receptor to induce a full or partial receptor-mediated response.
• an agonist of the IL2 low affinity receptor binds to the IL2 low affinity receptor and induces IL2-mediated intracellular signaling, cell activation and/or proliferation of CD8+ T effector cells and NK cells.
• the antibody cytokine engrafted protein agonist stimulates signaling through the IL low affinity receptor similarly in some respects to the native IL2 ligand.
• the binding of IL2 to IL2 low affinity receptor induces Jakl and Jak2 activation which results in STAT5 phosphorylation.
• an antibody cytokine engrafted protein agonist can be identified by its ability to bind IL2 low affinity receptor and induce STAT5
• IL2 or "interleukin 2” or “interleukin-2” or “IL-2”,
• IL2 refers to an alpha helical cytokine family member wherein the native protein functions in the regulation and maintenance of inflammatory processes.
• a property of IL2 is that the N and C-termini are close to each other in space, which make the IL2 cytokine protein suitable for antibody grafting.
• IL2 comprising residues 21-153 of full length native human is utilized in the context of the agonist antibody cytokine engrafted proteins.
• the human IL2 as disclosed herein has over its full length at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity with the amino acid SEQ ID NO:2, and retains preferential agonist activity of the antibody cytokine engrafted proteins as described herein and has been published as GenBank Accession No: NP_000577.
• SEQ ID NO: l is the human IL2 cDNA sequence.
• the human IL2 nucleic acid encoding for the IL2 protein as disclosed herein has over its full length at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity with the nucleic acid sequence of SEQ ID NO:l, and was published under GenBank Accession No: NM_000586.
• antibody cytokine engrafted protein or "antibody cytokine graft” or “engrafted” means that at least one cytokine is incorporated directly within a CDR of the antibody, interrupting the sequence of the CDR.
• the cytokine can be incorporated within HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 or LCDR3.
• the cytokine can be incorporated within HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 or LCDR3 and incorporated toward the N-terminal sequence of the CDR or toward the C-terminal sequence of the CDR.
• cytokine incorporated within a CDR can disrupt the specific binding of the antibody portion to the original target protein or the antibody cytokine engrafted protein can retain its specific binding to its target protein.
• cytokines include, but are not limited to; IL-la, IL- 1 ⁇ , IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-12, IFN-a, IFN- ⁇ , IFN- ⁇ , GM-CSF, MIP-la, ⁇ - ⁇ , TGF- ⁇ , TNF-a, and TNF- ⁇ .
• engraft a cytokine into a specific CDR of one "arm” of the antibody and to engraft another, different cytokine into a CDR of the other "arm” of the antibody.
• engrafting IL2 into the HCDR1 of one "arm” of the antibody and engrafting IL-7 into the LCDR1 of the other "arm” of the antibody cytokine engrafted protein can create a dual function antibody cytokine engrafted protein.
• nucleic acid or protein when applied to a nucleic acid or protein, denotes that the nucleic acid or protein is essentially free of other cellular components with which it is associated in the natural state. It is preferably in a homogeneous state. It can be in either a dry or aqueous solution. Purity and homogeneity are typically determined using analytical chemistry techniques such as polyacrylamide gel electrophoresis or high performance liquid chromatography. A protein that is the predominant species present in a preparation is substantially purified. In particular, an isolated gene is separated from open reading frames that flank the gene and encode a protein other than the gene of interest. The term “purified” denotes that a nucleic acid or protein gives rise to essentially one band in an electrophoretic gel. Particularly, it means that the nucleic acid or protein is at least 85% pure, more preferably at least 95% pure, and most preferably at least 99% pure.
• nucleic acid or “polynucleotide” refers to deoxyribonucleic acids
• DNA DNA
• RNA ribonucleic acids
• DNA DNA
• RNA ribonucleic acids
• the term encompasses nucleic acids containing known analogues of natural nucleotides that have similar binding properties as the reference nucleic acid and are metabolized in a manner similar to naturally occurring nucleotides.
• a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g., degenerate codon substitutions), alleles, orthologs, SNPs, and complementary sequences as well as the sequence explicitly indicated.
• degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed- base and/or deoxyinosine residues (Batzer et al., Nucleic Acid Res. 19:5081 (1991); Ohtsuka et al, J. Biol. Chem. 260:2605-2608 (1985); and Rossolini et al, Mol. Cell. Probes 8:91-98 (1994)).
• polypeptide As used interchangeably herein to refer to a polymer of amino acid residues. The terms apply to amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non-naturally occurring amino acid polymer.
• amino acid refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids.
• Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, ⁇ - carboxyglutamate, and O-phosphoserine.
• Amino acid analogs refer to compounds that have the same basic chemical structure as a naturally occurring amino acid, i.e. , an a-carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g.
• amino acid mimetics refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that functions in a manner similar to a naturally occurring amino acid.
• Constantly modified variants applies to both amino acid and nucleic acid sequences. With respect to particular nucleic acid sequences, conservatively modified variants refers to those nucleic acids which encode identical or essentially identical amino acid sequences, or where the nucleic acid does not encode an amino acid sequence, to essentially identical sequences. Because of the degeneracy of the genetic code, a large number of functionally identical nucleic acids encode any given protein. For instance, the codons GCA, GCC, GCG, and GCU all encode the amino acid alanine. Thus, at every position where an alanine is specified by a codon, the codon can be altered to any of the corresponding codons described without altering the encoded polypeptide.
• nucleic acid variations are "silent variations," which are one species of conservatively modified variations. Every nucleic acid sequence herein which encodes a polypeptide also describes every possible silent variation of the nucleic acid.
• each codon in a nucleic acid except AUG, which is ordinarily the only codon for methionine, and TGG, which is ordinarily the only codon for tryptophan
• TGG which is ordinarily the only codon for tryptophan
• amino acid sequences one of skill will recognize that individual substitutions, deletions or additions to a nucleic acid, peptide, polypeptide, or protein sequence which alters, adds or deletes a single amino acid or a small percentage of amino acids in the encoded sequence is a "conservatively modified variant" where the alteration results in the substitution of an amino acid with a chemically similar amino acid.
• Conservative substitution tables providing functionally similar amino acids are well known in the art. Such conservatively modified variants are in addition to and do not exclude polymorphic variants, interspecies homologs, and alleles.
• the following eight groups each contain amino acids that are conservative substitutions for one another: 1) Alanine (A), Glycine (G); 2) Aspartic acid (D), Glutamic acid (E); 3) Asparagine (N), Glutamine (Q); 4) Arginine (R), Lysine (K); 5) Isoleucine (I), Leucine (L), Methionine (M), Valine (V); 6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W); 7) Serine (S), Threonine (T); and 8) Cysteine (C), Methionine (M) (see, e.g., Creighton, Proteins (1984)).
• Percentage of sequence identity is determined by comparing two optimally aligned sequences over a comparison window, wherein the portion of the polynucleotide sequence in the comparison window may comprise additions or deletions (i.e. , gaps) as compared to the reference sequence (e.g. , a polypeptide), which does not comprise additions or deletions, for optimal alignment of the two sequences.
• the percentage is calculated by determining the number of positions at which the identical nucleic acid base or amino acid residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison and multiplying the result by 100 to yield the percentage of sequence identity.
• nucleic acids or polypeptide sequences refer to two or more sequences or subsequences that are the same sequences.
• Two sequences are “substantially identical” if two sequences have a specified percentage of amino acid residues or nucleotides that are the same (i.e., at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity over a specified region, or, when not specified, over the entire sequence of a reference sequence), when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using one of the following sequence comparison algorithms or by manual alignment and visual inspection.
• polypeptides or polynucleotides that are substantially identical to the polypeptides or polynucleotides, respectively, exemplified herein (e.g. , the variable regions exemplified in any one of SEQ ID NO: 19, SEQ ID NO:35, SEQ ID NO:51, or SEQ ID NO:67.
• the identity exists over a region that is at least about 15, 25 or 50 nucleotides in length, or more preferably over a region that is 100 to 500 or 1000 or more nucleotides in length, or over the full length of the reference sequence.
• identity or substantial identity can exist over a region that is at least 5, 10, 15 or 20 amino acids in length, optionally at least about 25, 30, 35, 40, 50, 75 or 100 amino acids in length, optionally at least about 150, 200 or 250 amino acids in length, or over the full length of the reference sequence.
• shorter amino acid sequences e.g., amino acid sequences of 20 or fewer amino acids
• substantial identity exists when one or two amino acid residues are conservatively substituted, according to the conservative substitutions defined herein.
• sequence comparison typically one sequence acts as a reference sequence, to which test sequences are compared.
• test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated.
• sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters.
• a “comparison window,” as used herein, includes reference to a segment of any one of the number of contiguous positions selected from the group consisting of from 20 to 600, usually about 50 to about 200, more usually about 100 to about 150 in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned.
• Methods of alignment of sequences for comparison are well known in the art. Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith and Waterman (1970) Adv. Appl. Math. 2:482c, by the homology alignment algorithm of Needleman and Wunsch (1970) /. Mol. Biol.
• HSPs high scoring sequence pairs
• Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always > 0) and N (penalty score for mismatching residues; always ⁇ 0).
• M forward score for a pair of matching residues; always > 0
• N penalty score for mismatching residues; always ⁇ 0.
• a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached.
• the BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment.
• W wordlength
• E expectation
• the BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g. , Karlin and Altschul (1993) Proc. Natl. Acad. Sci. USA 90:5873-5787).
• One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance.
• P(N) the smallest sum probability
• a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.2, more preferably less than about 0.01, and most preferably less than about 0.001.
• nucleic acid sequences or polypeptides are substantially identical is that the polypeptide encoded by the first nucleic acid is immunologically cross reactive with the antibodies raised against the polypeptide encoded by the second nucleic acid, as described below.
• a polypeptide is typically substantially identical to a second polypeptide, for example, where the two peptides differ only by conservative substitutions.
• Another indication that two nucleic acid sequences are substantially identical is that the two molecules or their complements hybridize to each other under stringent conditions, as described below.
• Yet another indication that two nucleic acid sequences are substantially identical is that the same primers can be used to amplify the sequence.
• link when used in the context of describing how the binding regions are connected within an antibody cytokine engrafted protein of this invention, encompasses all possible means for physically joining the regions.
• the multitude of binding regions are frequently joined by chemical bonds such as a covalent bond (e.g. , a peptide bond or a disulfide bond) or a non-covalent bond, which can be either a direct bond (i.e. , without a linker between two binding regions) or indirect bond (i.e. , with the aid of at least one linker molecule between two or more binding regions).
• the terms "subject,” “patient,” and “individual” interchangeably refer to a mammal, for example, a human or a non-human primate mammal.
• the mammal can also be a laboratory mammal, e.g. , mouse, rat, rabbit, hamster.
• the mammal can be an agricultural mammal (e.g., equine, ovine, bovine, porcine, camelid) or domestic mammal (e.g., canine, feline).
• the terms “treat,” “treating,” or “treatment” of any disease or disorder refer in one embodiment, to ameliorating the disease or disorder (i.e. , slowing or arresting or reducing the development of the disease or at least one of the clinical symptoms thereof).
• “treat,” “treating,” or “treatment” refers to alleviating or ameliorating at least one physical parameter including those which may not be discernible by the patient.
• “treat,” “treating,” or “treatment” refers to modulating the disease or disorder, either physically, (e.g. , stabilization of a discernible symptom), physiologically, (e.g. , stabilization of a physical parameter), or both.
• “treat,” “treating,” or “treatment” refers to preventing or delaying the onset or development or progression of a disease or disorder.
• a therapeutically acceptable amount or “therapeutically effective dose” interchangeably refer to an amount sufficient to effect the desired result (i.e. , a reduction in inflammation, inhibition of pain, prevention of inflammation, inhibition or prevention of inflammatory response). In some embodiments, a therapeutically acceptable amount does not induce or cause undesirable side effects.
• a therapeutically acceptable amount can be determined by first administering a low dose, and then incrementally increasing that dose until the desired effect is achieved.
• a “prophylactically effective dosage,” and a “therapeutically effective dosage,” of an IL2 antibody cytokine engrafted protein can prevent the onset of, or result in a decrease in severity of, respectively, disease symptoms, including symptoms associated with cancer and cancer treatment.
• co-administer refers to the simultaneous presence of two (or more) active agents in an individual. Active agents that are co-administered can be concurrently or sequentially delivered.
• the phrase “consisting essentially of” refers to the genera or species of active pharmaceutical agents included in a method or composition, as well as any inactive carrier or excipients for the intended purpose of the methods or compositions. In some embodiments, the phrase “consisting essentially of expressly excludes the inclusion of one or more additional active agents other than an IL2 antibody cytokine engrafted protein. In some embodiments, the phrase “consisting essentially of expressly excludes the inclusion of more additional active agents other than an IL2 antibody cytokine engrafted protein and a second co-administered agent.
• Figure 1 is a table summarizing exemplary the IL2 antibody cytokine engrafted proteins and their activities on CD8 T effector cells.
• Figure 2 shows that IgG.IL2R67A.Hl has a greater half-life than that of
• Proleukin®. IgG.IL2R67A.Hl has a half-life of 12-14 hours as shown in the graph, while Proleukin® has a Tl/2 of less than 4 hours and cannot be shown on the graph.
• Figures 3A-3C demonstrate that IgG.IL2R67A.Hl expands CD8+ T effector cells more effectively and with less toxicity than Proleukin® or an IL2-Fc fusion molecule in C57BL/6 mice at a lOC ⁇ g equivalent dose, at day 4, day 8 and day 11 time points.
• Figures 3D-3F demonstrate that IgG.IL2R67A.Hl expands CD8+ T effector cells more effectively and with less toxicity than Proleukin® or an IL2-Fc fusion molecule in C57BL/6 mice at a 50C ⁇ g equivalent dose at day 4, day 8 and day 11 time points.
• Figure 4A shows that IgG.IL2R67A.Hl selectively expands CD 8 T effectors and is better tolerated than Proleukin® in NOD mice.
• Figure 4B shows a table depicting the increased activity of IgG.IL2R67A.Hl and IgG.IL2F71A.Hl on CD 8 T effectors in NOD mice.
• Figure 5 shows a graph of single agent efficacy of IgG.IL2R67A.Hl in a
• FIG. 6 presents the data of IgG.IL2R67A.Hl either as a single agent or in combination with an antibody in a B 16 melanoma mouse model.
• the graph shows that IgG.IL2R67A.Hl in combination with TA99, an anti-TRPl antibody, is more efficacious than TA99 alone, an IL2-Fc fusion molecule alone, TA99 plus an IL2-Fc fusion. Synergy was seen with TA99 and IgG.IL2R67A.Hl at the 100 and 500 ⁇ g doses.
• Figure 7 shows a graph with values monitoring pSTAT5 activity in a panel of human cells comparing IgG.IL2R67A.Hl and IgG.IL2F71A.Hl with Proleukin®.
• Figure 8 shows a graph of ELISA data showing that when IL2 is engrafted into CDRH1 of an anti-RSV antibody (IgG.IL2R67A.Hl), RSV binding is maintained. However, binding to RSV is reduced when IL2 is engrafted into CDRL3 or CDRH3. When IL2 is engrafted into a different antibody backbone (Xolair), there is no binding to RSV.
• an anti-RSV antibody IgG.IL2R67A.Hl
• antibody cytokine engrafted proteins of the present disclosure show suitable properties to be used in human patients, for example, they retain immunostimulatory activity similar to that of native or recombinant human IL2. However, the negative effects are diminished. For example, there is less stimulation of Treg cells. Other activities and characteristics are also demonstrated throughout the specification.
• antibody cytokine engrafted proteins having an improved therapeutic profile over previously known IL2 and modified IL2 therapeutic agents such as Proleukin®, and methods of use of the provided antibody cytokine engrafted proteins in cancer treatment.
• the present disclosure provides antibody cytokine engrafted proteins that are agonists of the IL2 low affinity receptor, with selective activity profiles.
• Provided antibody cytokine engrafted proteins comprise an immunoglobulin heavy chain sequence and an immunoglobulin light chain sequence.
• Each immunoglobulin heavy chain sequence comprises a heavy chain variable region (VH) and a heavy chain constant region (CH), wherein the heavy chain constant region consists of CHI, CH2, and CH3 constant regions.
• Each immunoglobulin light chain sequence comprises a light chain variable region (VL) and a light chain constant region (CL).
• an IL2 molecule is incorporated into a complementarity determining region (CDR) of the VH or VL.
• the antibody cytokine engrafted protein comprises an
• IL2 molecule incorporated into a heavy chain CDR.
• the IL2 molecule is incorporated into heavy chain complementarity determining region 1 (HCDR1).
• the IL2 molecule is incorporated into heavy chain complementarity determining region 2 (HCDR2).
• the IL2 molecule is incorporated into heavy chain complementarity determining region 3 (HCDR3).
• the antibody cytokine engrafted protein comprises an
• the IL2 molecule incorporated into a light chain CDR.
• the IL2 molecule is incorporated into light chain complementarity determining region 1 (LCDR1).
• the IL2 molecule is incorporated into light chain complementarity determining region 2 (LCDR2).
• the IL2 molecule is incorporated into light chain complementarity determining region 3 (LCDR3).
• the antibody cytokine engrafted comprises an IL2 sequence incorporated into a CDR, whereby the IL2 sequence is inserted into the CDR sequence.
• the insertion can be at or near the N-terminal region of the CDR, in the middle region of the CDR or at or near the C-terminal region of the CDR.
• the antibody cytokine engrafted comprises an IL2 molecule incorporated into a CDR, whereby the IL2 sequence does not frameshift the CDR sequence.
• the antibody cytokine engrafted comprises an IL2 molecule incorporated into a CDR, whereby the IL2 sequence replaces all or part of a CDR sequence.
• a replacement can be the N-terminal region of the CDR, in the middle region of the CDR or at or near the C-terminal region the CDR.
• a replacement can be as few as one or two amino acids of a CDR sequence, or the entire CDR sequence.
• an IL2 molecule is engrafted directly into a CDR without a peptide linker, with no additional amino acids between the CDR sequence and the IL2 sequence.
• antibody cytokine engrafted proteins comprise immunoglobulin heavy chains of an IgG class antibody heavy chain.
• an IgG heavy chain is any one of an IgGl, an IgG2 or an IgG4 subclass.
• antibody cytokine engrafted proteins comprise heavy and light chain immunoglobulin sequences selected from a known, clinically utilized immunoglobulin sequence. In certain embodiments antibody cytokine engrafted proteins comprise heavy and light chain immunoglobulin sequences which are humanized sequences. In other certain embodiments antibody cytokine engrafted proteins comprise heavy and light chain immunoglobulin sequences which are human sequences.
• antibody cytokine engrafted proteins comprise heavy and light chain immunoglobulin sequences selected from germline immunoglobulin sequences.
• antibody cytokine engrafted proteins comprise heavy and light chain immunoglobulin sequences having binding specificity of the immunoglobulin variable domains to a target distinct from the binding specificity of the IL2 molecule.
• the binding specificity of the immunoglobulin variable domain to its target is retained by 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100%, in the presence of the engrafted cytokine.
• the retained binding specificity is to a non-human target.
• the retained binding specificity it to a virus, for example, RSV.
• the binding specificity is to a human target having therapeutic utility in conjunction with an IL2 therapy.
• targeting the binding specificity of the immunoglobulin conveys additional therapeutic benefit to the IL2 component.
• the binding specificity of the immunoglobulin to its target conveys synergistic activity with IL2.
• the binding specificity of the immunoglobulin is reduced by 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100%, by the engrafting of the IL2 molecule.
• Provided antibody cytokine engrafted proteins comprise an IL2 molecule engrafted into a complementarity determining region (CDR) of the VH or VL.
• the IL2 sequence has at least 85%, 89%, 90%, 91%, 92%, 93%, 94%,95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of SEQ ID NO:4.
• the IL2 molecule comprises the sequence of SEQ ID NO:4.
• the IL2 molecule consists of the sequence of SEQ ID NO:4.
• Provided antibody cytokine engrafted proteins comprise an IL2 molecule engrafted into a complementarity determining region (CDR) of the VH or VL.
• the IL2 sequence has at least 85%, 89%, 90%, 91%, 92%, 93%, 94%,95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of SEQ ID NO:6.
• the IL2 molecule comprises the sequence of SEQ ID NO:6.
• the IL2 molecule consists of the sequence of SEQ ID NO:6.
• the antibody cytokine engrafted protein confers pro immunomodulatory properties superior to human IL2, recombinant human IL2, Proleukin® or IL2 fused to an Fc.
• the antibody cytokine engrafted protein confers increased activity on CD8 T effector cells while providing reduced Treg activity as compared to human IL2, recombinant human IL2, Proleukin® or IL2 fused to an Fc.
• the antibody cytokine engrafted proteins comprise a modified immunoglobulin IgG having a modified Fc conferring modified effector function.
• the modified Fc region comprises a mutation selected from one or more of D265A, P329A, P329G, N297A, L234A, and L235A.
• the immunoglobulin heavy chain may comprise a mutation or combination of mutations conferring reduced effector function selected from any of D265A, P329A, P329G, N297A, D265A/P329A, D265A/N297A, L234/L235A, P329A/L234A/L235A, and
• the antibody cytokine engrafted proteins comprise (i) a heavy chain variable region having at least 85%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% amino acid sequence identity to a heavy chain variable region of SEQ ID NO: 19 and (ii) a light chain variable region having at least 85%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% amino acid sequence identity to a light chain variable region of SEQ ID NO:35.
• the immunoglobulin chain is an IgG class selected from IgGl, IgG2, or IgG4.
• the immunoglobulin optionally comprises a mutation or combination of mutations conferring reduced effector function selected from any of D265A, P329A, P329G, N297A, D265A/P329A,
• the antibody cytokine engrafted proteins comprise (i) a heavy chain variable region having at least 85%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% amino acid sequence identity to a heavy chain variable region of SEQ ID NO:51 and (ii) a light chain variable region having at least 85%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% amino acid sequence identity to a light chain variable region of SEQ ID NO:67.
• the immunoglobulin chain is an IgG class selected from IgGl, IgG2, or IgG4.
• the immunoglobulin optionally comprises a mutation or combination of mutations conferring reduced effector function selected from any of D265A, P329A, P329G, N297A, D265A/P329A,
• antibody cytokine engrafted constructs are generated by engrafting an IL2 sequence into a CDR region of an immunoglobulin scaffold. Both heavy and light chain immunoglobulin chains are produced to generate final antibody engrafted proteins.
• Antibody cytokine engrafted proteins confer preferred therapeutic activity on CD8 T effector cells, and the antibody cytokine engrafted proteins have reduced Treg activity as compared with native or recombinant human IL2 (rhIL2 or Proleukin®) or IL2 fused to an Fc.
• IL2 sequences containing specific muteins are inserted into a CDR loop of an immunoglobulin chain scaffold protein.
• Engrafted constructs can be prepared using any of a variety of known immunoglobulin sequences which have been utilized in clinical settings, known immunoglobulin sequences which are in current discovery and/or clinical development, human germline antibody sequences, as well as sequences of novel antibody immunoglobulin chains. Constructs are produced using standard molecular biology methodology utilizing recombinant DNA encoding relevant sequences. Sequences of IL2 in an exemplary scaffold, referred to as GFTX3b, are depicted in TABLE 2. Insertion points were selected to be the mid-point of the loop based on available structural or homology model data, however, insertion points can be adjusted toward the N or C-terminal end of the CDR loop.
• the present disclosure provides antibodies or fragments thereof that specifically bind to the low affinity IL2 receptor comprising an IL2 protein recombinantly inserted into a heterologous antibody protein or polypeptide to generate engrafted proteins.
• the disclosure provides engrafted proteins comprising an antibody or antigen- binding fragment of an antibody described herein or any other relevant scaffold antibody polypeptide (e.g.
• a full antibody immunoglobulin protein a Fab fragment, Fc fragment, Fv fragment, F(ab)2 fragment, a VH domain, a VH CDR, a VL domain, a VL CDR, etc.
• a heterologous cytokine protein polypeptide, or peptide, e.g., IL2.
• Methods for fusing or conjugating proteins, polypeptides, or peptides to an antibody or an antibody fragment are known in the art. See, e.g., U.S. Patent Nos. 5,336,603, 5,622,929, 5,359,046, 5,349,053, 5,447,851, and 5,112,946; European Patent Nos.
• EP 307,434 and EP 367,166 International Publication Nos. WO 96/04388 and WO 91/06570; Ashkenazi et al , 1991, Proc. Natl. Acad. Sci. USA 88: 10535-10539; Zheng et al, 1995, J. Immunol. 154:5590-5600; and Vil et al, 1992, Proc. Natl. Acad. Sci. USA 89: 11337- 11341. Additionally, antibody cytokine engrafted proteins may be generated through the techniques of gene-shuffling, motif- shuffling, exon-shuffling, and/or codon-shuffling (collectively referred to as "DNA shuffling").
• DNA shuffling may be employed to prepare engrafted protein constructs and/or to alter the activities of antibodies or fragments thereof (e.g. , antibodies or fragments thereof with higher affinities and lower dissociation rates). See, generally, U.S. Patent Nos.
• Antibodies or fragments thereof, or the encoded antibodies or fragments thereof, may be altered by being subjected to random mutagenesis by error-prone PCR, random nucleotide insertion or other methods prior to recombination.
• a polynucleotide encoding an antibody or fragment thereof that specifically binds to an antigen protein of interest may be recombined with one or more components, motifs, sections, parts, domains, fragments, etc. of one or more heterologous cytokine molecules, e.g., IL2, for preparation of antibody cytokine engrafted proteins as provided herein.
• IL2 heterologous cytokine molecules
• An antibody Fab contains six CDR loops, 3 in the light chain (CDRL1,
• CDRL2, CDRL3) and 3 in the heavy chain (CDRH1, CDRH2, CDRH3) which can serve as potential insertion sites for a cytokine protein.
• Structural and functional considerations are taken into account in order to determine which CDR loop(s) to insert the cytokine. As a CDR loop size and conformation vary greatly across different antibodies, the optimal CDR for insertion can be determined empirically for each particular antibody/protein combination. Additionally, since a cytokine protein will be inserted into a CDR loop, this can put additional constraints on the structure of the cytokine protein as discussed in Example 1.
• CDRs of immunoglobulin chains are determined by well-known numbering systems known in the art, including those described herein.
• CDRs have been identified and defined by (1) using the numbering system described in Kabat et al. (1991), "Sequences of Proteins of Immunological Interest,” 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD ("Kabat” numbering scheme), NIH publication No. 91- 3242; and (2) Chothia, see Al-Lazikani et al., (1997) “Standard conformations for the canonical structures of immunoglobulins," J.Mol.Biol. 273:927-948.
• An antibody cytokine engrafted protein further can be prepared using an antibody having one or more of the CDRs and/or VH and/or VL sequences shown herein (e.g., TABLE 2) as starting material to engineer a modified antibody cytokine engrafted protein, which may have altered properties from the starting antibody engrafted protein.
• any known antibody sequences may be utilized as a scaffold to engineer modified antibody cytokine engrafted protein.
• any known, clinically utilized antibody may be utilized as a starting materials scaffold for preparation of antibody engrafted protein.
• Known antibodies and corresponding immunoglobulin sequences include, e.g., palivizumab, alirocumab, mepolizumab, necitumumab, nivolumab, dinutuximab, secukinumab, evolocumab, blinatumomab, pembrolizumab, ramucirumab vedolizumab, siltuximab, obinutuzumab, trastuzumab, raxibacumab, pertuzumab, belimumab, ipilimumab, denosumab, tocilizumab, ofatumumab, canakinumab, golimumab, ustekinumab, certolizumab, catumaxomab, eculizumab, ranibizumab, panitumumab, natalizumab, bevacizumab, cetuximab,
• Known antibodies and immunoglobulin sequences also include germline antibody sequences.
• Framework sequences can be obtained from public DNA databases or published references that include germline antibody gene sequences.
• germline DNA sequences for human heavy and light chain variable region genes can be found in the "VBase" human germline sequence database, as well as in Kabat, E. A., et al., 1991 Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242; Tomlinson, I. M., et al, 1992 J. fol. Biol. 227:776-798; and Cox, J. P. L. et al , 1994 Eur. J Immunol. 24:827-836.
• antibody and corresponding immunoglobulin sequences from other known entities which can be in early discovery and/or drug development can be similarly adapted as starting material to engineer a modified antibody cytokine engrafted protein.
• a wide variety of antibody/immunoglobulin frameworks or scaffolds can be employed so long as the resulting polypeptide includes at least one binding region which accommodates incorporation of a cytokine (e.g., IL2).
• cytokine e.g., IL2
• Such frameworks or scaffolds include the 5 main idiotypes of human immunoglobulins, or fragments thereof, and include immunoglobulins of other animal species, preferably having humanized and/or human aspects. Novel antibodies, frameworks, scaffolds and fragments continue to be discovered and developed by those skilled in the art.
• Antibodies can be generated using methods that are known in the art. For preparation of monoclonal antibodies, any technique known in the art can be used (see, e.g., Kohler & Milstein, Nature 256:495-497 (1975); Kozbor et al , Immunology Today 4:72 (1983); Cole et al., Monoclonal Antibodies and Cancer Therapy, pp. 77-96. Alan R. Liss, Inc. 1985). Techniques for the production of single chain antibodies (U.S. Patent No. 4,946,778) can be adapted to produce antibodies for use in antibody cytokine engrafted proteins.
• transgenic mice or other organisms such as other mammals, can be used to express and identify primatized or humanized or human antibodies.
• phage display technology can be used to identify antibodies and heteromeric Fab fragments that specifically bind to selected antigens for use in antibody cytokine engrafted proteins (see, e.g. ,
• a primatized or humanized antibody has one or more amino acid residues introduced into it from a source which is non-primate or non-human.
• Such non- primate or non-human amino acid residues are often referred to as import residues, which are typically taken from an import variable domain.
• Humanization can be essentially performed following the method of Winter and co-workers ⁇ see, e.g., Jones et al., Nature 321 :522-525 (1986); Riechmann et al, Nature 332:323-327 (1988); Verhoeyen et al, Science 239: 1534- 1536 (1988) and Presta, Curr. Op.
• humanized antibodies are chimeric antibodies (U.S. Patent No. 4,816,567), wherein substantially less than an intact human variable domain has been substituted by the corresponding sequence from a non-human species.
• primatized or humanized antibodies are typically primate or human antibodies in which some complementary determining region ("CDR") residues and possibly some framework (“FR”) residues are substituted by residues from analogous sites in an originating species (e.g., rodent antibodies) to confer binding specificity.
• CDR complementary determining region
• FR framework residues
• an in vivo method for replacing a nonhuman antibody variable region with a human variable region in an antibody while maintaining the same or providing better binding characteristics relative to that of the nonhuman antibody may be utilized to convert non-human antibodies into engineered human antibodies. See, e.g., U.S. Patent Publication No. 20050008625, U.S. Patent Publication No. 2005/0255552.
• human V segment libraries can be generated by sequential cassette replacement in which only part of the reference antibody V segment is initially replaced by a library of human sequences; and identified human "cassettes" supporting binding in the context of residual reference antibody amino acid sequences are then recombined in a second library screen to generate completely human V segments (see, U.S. Patent Publication No.
• Various antibodies or antigen-binding fragments for use in preparation of antibody cytokine engrafted proteins can be produced by enzymatic or chemical modification of the intact antibodies, or synthesized de novo using recombinant DNA methodologies (e.g., single chain Fv), or identified using phage display libraries (see, e.g., McCafferty et al., Nature 348:552-554, 1990).
• minibodies can be generated using methods described in the art, e.g., Vaughan and Sollazzo, Comb. Chem. High Throughput Screen 4:417-30 2001.
• Bispecific antibodies can be produced by a variety of methods including engrafted of hybridomas or linking of Fab' fragments.
• Antibodies, antigen-binding molecules or antibody cytokine engrafted molecules of use in the present disclosure further include bispecific antibodies.
• a bispecific or bifunctional antibody is an artificial hybrid antibody having two different heavy/light chain pairs and two different binding sites.
• Other antigen-binding fragments or antibody portions include bivalent scFv (diabody), bispecific scFv antibodies where the antibody molecule recognizes two different epitopes, single binding domains (dAbs), and minibodies.
• Selected immunoglobulin sequences may thus be utilized in preparation of antibody cytokine engrafted protein constructs as provided herein.
• Antigen-binding fragments of antibodies e.g., a Fab fragment, scFv, can be used as building blocks to construct antibody cytokine engrafted proteins, and may optionally include multivalent formats.
• multivalent molecules comprise a constant region of an antibody (e.g., Fc).
• Antibody cytokine engrafted proteins can be engineered by modifying one or more residues within one or both variable regions (i.e., VH and/or VL) of an antibody, for example, within one or more CDR regions, and such adapted VH and/or VL region sequences are utilized for engrafting a cytokine or for preparation of cytokine engrafting.
• Antibodies interact with target antigens predominantly through amino acid residues that are located in the six heavy and light chain complementarity determining regions (CDRs). For this reason, the amino acid sequences within CDRs are more diverse between individual antibodies than sequences outside of CDRs.
• CDR sequences are responsible for most antibody-antigen interactions, it is possible to express recombinant antibodies that mimic the properties of a specific antibody by constructing expression vectors that include CDR sequences from a specific antibody grafted onto framework sequences from a different antibody with different properties (see, e.g., Riechmann, L. et al. , 1998 Nature 332:323-327; Jones, P. et al., 1986 Nature 321 :522-525; Queen, C. et al, 1989 Proc. Natl. Acad., U.S.A. 86: 10029-10033; U.S. Patent No. 5,225,539 to Winter, and U.S. Patent Nos.
• CDR1, CDR2, and/or CDR3 regions to thereby improve one or more binding properties (e.g. , affinity) of the antibody of interest, known as "affinity maturation," may be beneficial, e.g., to optimize antigen binding of an antibody in conjunction with the context of the cytokine engrafted protein.
• Site-directed mutagenesis or PCR-mediated mutagenesis can be performed to introduce the mutation(s) and the effect on antibody binding, or other functional property of interest, can be evaluated in in vitro or in vivo assays as described herein and/or alternative or additional assays known in the art. Conservative modifications can be introduced.
• the mutations may be amino acid substitutions, additions or deletions. Moreover, typically no more than one, two, three, four or five residues within a CDR region are altered.
• Engineered antibodies or antibody fragments include those in which modifications have been made to framework residues within VH and/or VL, e.g. to improve the properties of the antibody. In some embodiments such framework modifications are made to decrease immunogenicity of the antibody.
• one approach is to change one or more framework residues to the corresponding germline sequence. More specifically, an antibody that has undergone somatic mutation may contain framework residues that differ from germline sequence from which the antibody is derived. Such residues can be identified by comparing the antibody framework sequences to the germline sequences from which the antibody is derived. To return the framework region sequences to their germline configuration, the somatic mutations can be "backmutated" to the germline sequence by, for example, site-directed mutagenesis.
• Additional framework modification involves mutating one or more residues within the framework region, or even within one or more CDR regions, to remove T cell epitopes to thereby reduce the potential immunogenicity of the antibody. This approach is also referred to as "deimmunization" and is described in further detail in U.S. Patent Publication No. 20030153043 by Carr et al.
• Constant regions of the antibodies or antibody fragments utilized for preparation of the antibody cytokine engrafted protein can be any type or subtype, as appropriate, and can be selected to be from the species of the subject to be treated by the present methods ⁇ e.g. , human, non-human primate or other mammal, for example, agricultural mammal ⁇ e.g. , equine, ovine, bovine, porcine, camelid), domestic mammal ⁇ e.g. , canine, feline) or rodent ⁇ e.g., rat, mouse, hamster, rabbit).
• antibodies utilized in antibody cytokine engrafted proteins are engineered to generate humanized or Humaneered® antibodies.
• antibodies utilized in antibody cytokine engrafted proteins are human antibodies.
• antibody constant region isotype is IgG, for example, IgGl, IgG2, IgG3, IgG4.
• the constant region isotype is IgGi.
• antibody cytokine engrafted proteins comprise an IgG.
• antibody cytokine engrafted proteins comprise an IgGl Fc.
• antibody cytokine engrafted proteins comprise an IgG2 Fc.
• antibodies or antibody fragments utilized in preparation of antibody cytokine engrafted proteins may be engineered to include modifications within an Fc region, typically to alter one or more functional properties of the antibody, such as, e.g., serum half-life, complement fixation, Fc receptor binding, and/or antigen-dependent cellular cytotoxicity.
• an antibody, antibody fragment thereof, or antibody cytokine engrafted protein can be chemically modified (e.g., one or more chemical moieties can be attached to the antibody) or be modified to alter its glycosylation, again to alter one or more functional properties of the antibody cytokine engrafted protein.
• a hinge region of CHI is modified such that the number of cysteine residues in the hinge region is altered, e.g., increased or decreased.
• the number of cysteine residues in the hinge region of CHI is altered to, for example, facilitate assembly of the light and heavy chains or to increase or decrease the stability of the antibody cytokine engrafted protein.
• an Fc hinge region of an antibody is mutated to alter the biological half-life of the antibody cytokine engrafted protein.
• one or more amino acid mutations are introduced into the CH2-CH3 domain interface region of the Fc -hinge fragment such that the antibody cytokine engrafted protein has impaired Staphylococcyl protein A (SpA) binding relative to native Fc -hinge domain SpA binding.
• SpA Staphylococcyl protein A
• the present disclosure provides for antibody cytokine engrafted proteins that specifically bind to the IL2 low affinity receptor which have an extended half-life in vivo.
• an antibody cytokine engrafted protein is modified to increase its biological half-life.
• Antibody cytokine engrafted proteins having an increased half-life in vivo can also be generated introducing one or more amino acid modifications (i.e. , substitutions, insertions or deletions) into an IgG constant domain, or FcRn binding fragment thereof (preferably a Fc or hinge Fc domain fragment).
• one or more of the following mutations can be introduced: T252L, T254S, T256F, as described in U.S. Patent No.
• the antibody cytokine engrafted protein is altered within the CHI or CL region to contain a salvage receptor binding epitope taken from two loops of a CH2 domain of an Fc region of an IgG, as described in U.S. Patent Nos.
• the Fc region is altered by replacing at least one amino acid residue with a different amino acid residue to alter the effector functions of the antibody cytokine engrafted protein.
• one or more amino acids can be replaced with a different amino acid residue such that the antibody cytokine engrafted protein has an altered affinity for an effector ligand but retains antigen- binding ability of the parent antibody.
• the effector ligand to which affinity is altered can be, for example, an Fc receptor (FcR) or the CI component of complement. This approach is described in further detail in U.S. Patent Nos. 5,624,821 and 5,648,260, both by Winter et al.
• one or more amino acids selected from amino acid residues can be replaced with a different amino acid residue such that the antibody cytokine engrafted protein has altered Clq binding and/or reduced or abolished complement dependent cytotoxicity (CDC).
• CDC complement dependent cytotoxicity
• Antibody cytokine engrafted proteins containing such mutations mediate reduced or no antibody-dependent cellular cytotoxicity (ADCC) or complement-dependent cytotoxicity (CDC).
• ADCC antibody-dependent cellular cytotoxicity
• CDC complement-dependent cytotoxicity
• amino acid residues L234 and L235 of the IgGl constant region are substituted to Ala234 and Ala235.
• amino acid residue N267 of the IgGl constant region is substituted to Ala267.
• one or more amino acid residues are altered to thereby alter the ability of the antibody cytokine engrafted protein to fix complement. This approach is described further in PCT Publication WO 94/29351 by Bodmer et al.
• an Fc region is modified to increase the ability of the antibody to mediate antibody dependent cellular cytotoxicity (ADCC) and/or to increase the affinity of the antibody cytokine engrafted protein for an Fey receptor by modifying one or more amino acids.
• ADCC antibody dependent cellular cytotoxicity
• This approach is described further in PCT Publication WO 00/42072 by Presta.
• binding sites on human IgGl for FcyRl, FcyRII, FcyRIII and FcRn have been mapped and variants with improved binding have been described (see Shields, R.L. et al, 2001 J. Biol. Chen. 276:6591-6604).
• glycosylation of an antibody cytokine engrafted protein is modified.
• an aglycoslated antibody cytokine engrafted protein can be made (i.e., the antibody cytokine engrafted protein lacks glycosylation).
• Glycosylation can be altered to, for example, increase the affinity of the antibody for "antigen.”
• Such carbohydrate modifications can be accomplished by, for example, altering one or more sites of glycosylation within the antibody sequence.
• one or more amino acid substitutions can be made that result in elimination of one or more variable region framework glycosylation sites to thereby eliminate glycosylation at that site.
• Such aglycosylation can increase the affinity of the antibody for antigen.
• an antibody cytokine engrafted protein can be made that has an altered type of glycosylation, such as a hypofucosylated antibody cytokine engrafted protein having reduced amounts of fucosyl residues or an antibody having increased bisecting GlcNac structures.
• Such altered glycosylation patterns have been demonstrated to increase the antibody dependent cellular cytotoxicity (ADCC) ability of antibodies.
• ADCC antibody dependent cellular cytotoxicity
• Such carbohydrate modifications can be accomplished by, for example, expressing the antibody cytokine engrafted protein in a host cell with altered glycosylation machinery.
• Cells with altered glycosylation machinery have been described in the art and can be used as host cells in which to express recombinant antibody cytokine engrafted proteins to thereby produce an antibody cytokine engrafted protein with altered glycosylation.
• EP 1,176,195 by Hang et al. describes a cell line with a functionally disrupted FUT8 gene, which encodes a fucosyl transferase, such that antibody cytokine engrafted proteins expressed in such a cell line exhibit hypofucosylation.
• PCT Publication WO 03/035835 by Presta describes a variant CHO cell line, Lecl3 cells, with reduced ability to attach fucose to Asn(297)-linked carbohydrates, also resulting in hypofucosylation of antibody cytokine engrafted proteins expressed in that host cell (see also Shields, R.L. et al. , 2002 J. Biol. Chem. 277:26733-26740).
• glycoprotein-modifying glycosyl transferases e.g., beta(l,4)-N acetylglucosaminyltransf erase III (GnTIII)
• GnTIII glycoprotein-modifying glycosyl transferases
• antibody cytokine engrafted proteins expressed in the engineered cell lines exhibit increased bisecting GlcNac structures which results in increased ADCC activity of the antibodies (see also Umana et al. , 1999 Nat. Biotech. 17:176-180).
• one or more domains, or regions, of an antibody cytokine engrafted protein are connected via a linker, for example, a peptide linker, such as those that are well known in the art (see e.g., Holliger, P., et al. (1993) Proc. Natl. Acad. Sci. USA 90:6444-6448; Poljak, RJ., et al. (1994) Structure 2: 1121-1123).
• a linker for example, a peptide linker, such as those that are well known in the art (see e.g., Holliger, P., et al. (1993) Proc. Natl. Acad. Sci. USA 90:6444-6448; Poljak, RJ., et al. (1994) Structure 2: 1121-1123).
• a peptide linker may vary in length, e.g., a linker can be 1-100 amino acids in length, typically a linker is from five to 50 amino acids in length, e.g., 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50 amino acids in length.
• IL2 is engrafted into the CDR sequence optionally with one or more peptide linker sequences.
• one or more peptide linkers is independently selected from a (Gly n -Ser) m sequence (SEQ ID NO: 71), a (Gly n -Ala) m sequence (SEQ ID NO: 72), or any combination of a (Gly n -Ser)m/(Glyn-Ala) m sequence (SEQ ID NOS: 71-72), wherein each n is independently an integer from 1 to 5 and each m is independently an integer from 0 to 10.
• linkers include, but are not limited to, glycine-based linkers or gly/ser linkers G/S such as (G m S) n wherein n is a positive integer equal to 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 and m is an integer equal to 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 (SEQ ID NO: 73).
• Ser can be replaced with Ala e.g., linkers G/A such as (GmA)n wherein n is a positive integer equal to 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 and m is an integer equal to 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 (SEQ ID NO: 75).
• the linker includes multiple repeats of linkers.
• a linker includes combinations and multiples of G 4 S (SEQ ID NO: 74) and G 4 A (SEQ ID NO: 76).
• linkers include those based on flexible linker sequences that occur naturally in antibodies to minimize immunogenicity arising from linkers and junctions.
• linkage there is a natural flexible linkage between the variable domain and a CHI constant domain in antibody molecular structure. This natural linkage comprises approximately 10-12 amino acid residues, contributed by 4-6 residues from C-terminus of V domain and 4-6 residues from the N-terminus of the CHI domain.
• Antibody cytokine engrafted proteins can, e.g., employ linkers incorporating terminal 5-6 amino acid residues, or 11-12 amino acid residues, of CHI as a linker.
• the N-terminal residues of the CHI domain adopt a loop conformation without strong secondary structure, and, therefore, can act as a flexible linker.
• the N-terminal residues of the CHI domain are a natural extension of the variable domains, as they are part of the Ig sequences, and, therefore, minimize to a large extent any immunogenicity potentially arising from the linkers and junctions.
• a linker sequence includes a modified peptide sequence based on a hinge sequence.
• the antibody cytokine engrafted proteins can include marker sequences, such as a peptide to facilitate purification of antibody cytokine engrafted proteins.
• a marker amino acid sequence is a hexa-histidine peptide (SEQ ID NO: 78), such as the tag provided in a pQE vector (QIAGEN, Inc., 9259 Eton Avenue, Chatsworth, CA, 91311), among others, many of which are commercially available. As described in Gentz et al , 1989, Proc. Natl. Acad. Sci.
• hexa- histidine provides for convenient purification of the engrafted protein.
• Other peptide tags useful for purification include, but are not limited to, the hemagglutinin ("HA") tag, which corresponds to an epitope derived from the influenza hemagglutinin protein (Wilson et al , 1984, Cell 37:767), and the "flag" tag.
• Antibodies may also be attached to solid supports, which are particularly useful for immunoassays or purification of the target antigen.
• solid supports include, but are not limited to, glass, cellulose, polyacrylamide, nylon, polystyrene, polyvinyl chloride or polypropylene.
• Assays for identifying antibody cytokine engrafted proteins are known in the art and described herein. Agonist antibody cytokine engrafted proteins bind to the IL2 low affinity receptor and promote, induce, stimulate intracellular signalling resulting in CD8 T effector cell proliferation as well as other immunostimulatory effects.
• Binding of the antibody cytokine engrafted proteins to the IL2 low affinity receptor can be determined using any method known in the art.
• binding to the IL2 low affinity receptor can be determined using known techniques, including without limitation ELISA, Western blots, surface plasmon resonance (SPR) ⁇ e.g., BIAcore), and flow cytometry.
• SPR surface plasmon resonance
• Intracellular signalling through the IL2 low affinity receptor can be measured using any method known in the art.
• activation of the IL2 low affinity receptor by IL2 promotes STAT5 activation and signalling.
• Methods for measuring STAT5 activation are standard in the art (e.g., phosphorylation status of STAT5 protein, reporter gene assays, downstream signalling assays, etc.).
• Activation through the IL2 low affinity receptor expands CD8 T effector cells, so the absolute numbers of CD8 T effector cells can be assayed for or the ratio of CD8 T effector cells to Tregs can be assayed for.
• test cells or culture supernatant from test cells contacted with antibody cytokine engrafted proteins can be compared to control cells or culture supernatants from control cells that have not been contacted with an antibody cytokine engrafted protein and/or those that have been contacted with recombinant human IL2 (e.g. Proleukin®) or an IL2-Fc fusion molecule.
• human IL2 e.g. Proleukin®
• the activity of the antibody cytokine engrafted proteins can also be measured ex vivo and/or in vivo.
• methods for measuring STAT5 activation across various cell types ex vivo from animals treated with antibody cytokine engrafted proteins as compared to untreated control animals and/or animals similarly treated with Proleukin® may be used to show differential activity of the agonist antibody engrafted proteins across cell types.
• Preferred agonist antibody cytokine engrafted proteins have the ability to activate and expand CD8 T effector cells.
• in vivo activation and expansion of CD 8 T effector cells can be measured using any method known in the art, e.g., by flow cytometry.
• Preferred agonist antibody cytokine engrafted proteins can be therapeutically useful in preventing, reducing, alleviating or the treatment of cancer, for example: melanoma, lung cancer, colorectal cancer, prostate cancer, breast cancer and lymphoma.
• the efficacy of the antibody cytokine engrafted proteins can be determined by administering a therapeutically effective amount of the antibody cytokine engrafted protein to a subject and comparing the subject before and after administration of the antibody cytokine engrafted protein.
• Efficacy of the antibody cytokine engrafted proteins can also be determined by administering a therapeutically effective amount of an antibody cytokine engrafted protein to a test subject and comparing the test subject to a control subject who has not been administered the antibody and/or comparison to a subject similarly treated with Proleukin®.
• antibody cytokine engrafted proteins can be produced by any means known in the art, including but not limited to, recombinant expression, chemical synthesis, and enzymatic digestion of antibody tetramers.
• Recombinant expression can be from any appropriate host cells known in the art, for example, mammalian host cells, bacterial host cells, yeast host cells, insect host cells, etc.
• polynucleotides that encode the variable regions exemplified in any one of SEQ ID NO:20, SEQ ID NO:36, SEQ ID NO:52 and SEQ ID NO:68.
• the disclosure thus provides polynucleotides encoding the light and/or heavy chain polypeptides of the antibody cytokine engrafted proteins described herein, e.g., polynucleotides encoding light or heavy chain variable regions or segments comprising the complementary determining regions as described herein.
• the polynucleotide encoding the heavy chain variable regions comprises a sequence having at least 85%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% nucleic acid sequence identity with a polynucleotide selected from the group consisting of SEQ ID NO:20, and SEQ ID NO:52.
• the polynucleotide encoding the light chain variable regions comprises a sequence having at least 85%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% nucleic acid sequence identity with a polynucleotide selected from the group consisting of SEQ ID NO:36, and SEQ ID NO:68.
• the polynucleotide encoding the heavy chain has at least 85%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% nucleic acid sequence identity with a polynucleotide of SEQ ID NO:22.
• the polynucleotide encoding the light chain has at least 85%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% nucleic acid sequence identity with a polynucleotide of SEQ ID NO:38.
• the polynucleotide encoding the heavy chain has at least 85%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% nucleic acid sequence identity with a polynucleotide of SEQ ID NO:54.
• the polynucleotide encoding the light chain has at least 85%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% nucleic acid sequence identity with a polynucleotide selected of SEQ ID NO:70.
• Polynucleotides can encode only the variable region sequence of an antibody cytokine engrafted protein. They can also encode both a variable region and a constant region of the antibody cytokine engrafted protein. Some of the polynucleotide sequences encode a polypeptide that comprises variable regions of both the heavy chain and the light chain of one of the antibody cytokine engrafted proteins. Some other polynucleotides encode two polypeptide segments that respectively are substantially identical to the variable regions of the heavy chain and the light chain of one of the antibody cytokine engrafted proteins.
• polynucleotides or nucleic acids comprise DNA. In other embodiments polynucleotides or nucleic acids comprise RNA, which may be single stranded or double stranded.
• a recombinant host cell comprising the nucleic acids encoding one or more immunoglobulin protein chain of an antibody cytokine engrafted protein, and optionally, secretion signals.
• a recombinant host cell comprises a vector encoding one immunoglobulin protein chain and secretion signals.
• a recombinant host cell comprises one or more vectors encoding two immunoglobulin protein chains of the antibody cytokine engrafted protein and secretion signals.
• a recombinant host cell comprises a single vector encoding two immunoglobulin protein chains of the antibody cytokine engrafted protein and secretion signals.
• a recombinant host cell comprises two vectors, one encoding a heavy chain immunoglobulin protein chain, and another encoding a light chain immunoglobulin protein chain of the antibody cytokine engrafted protein, with each including secretion signals.
• a recombinant host cell may be a prokaryotic or eukaryotic cell.
• the host cell is a eukaryotic cell line.
• the host cell is a mammalian cell line.
• the host cell line is a CHO cell line for antibody production.
• the method comprises the steps of (i) culturing a host cell comprising one or more vectors encoding immunoglobulin protein chains of an antibody cytokine engrafted protein under conditions suitable for expression, formation, and secretion of the antibody cytokine engrafted protein and (ii) recovering the antibody cytokine engrafted protein.
• the polynucleotide sequences can be produced by de novo solid-phase DNA synthesis or by PCR mutagenesis of an existing sequence (e.g., sequences as described herein) encoding a polypeptide chain of an antibody cytokine engrafted protein.
• Direct chemical synthesis of nucleic acids can be accomplished by methods known in the art, such as the phosphotriester method of Narang et al., Meth. Enzymol. 68:90, 1979; the phosphodiester method of Brown et al., Meth. Enzymol. 68: 109, 1979; the diethylphosphoramidite method of Beaucage et al., Terra.
• Nonviral vectors and systems include plasmids, episomal vectors, typically with an expression cassette for expressing a protein or RNA, and human artificial chromosomes (see, e.g. , Harrington et al., Nat. Genet. 15:345, 1997).
• nonviral vectors useful for expression of the antibody cytokine engrafted protein polynucleotides and polypeptides in mammalian (e.g. , human) cells include pThioHis A, B & C, pcDNA3.1/His, pEBVHis A, B & C (Invitrogen, San Diego, CA), MPSV vectors, and numerous other vectors known in the art for expressing other proteins.
• Useful viral vectors include vectors based on retroviruses, adenoviruses, adeno-associated viruses, herpes viruses, vectors based on SV40, papilloma virus, HBP Epstein Barr virus, vaccinia virus vectors and Semliki Forest virus (SFV). See, Brent et al., supra; Smith, Annu. Rev. Microbiol. 49:807, 1995; and Rosenfeld et al, Cell 68: 143, 1992.
• the choice of expression vector depends on the intended host cells in which the vector is to be expressed.
• the expression vectors contain a promoter and other regulatory sequences (e.g., enhancers) that are operably linked to the polynucleotides encoding an immunoglobulin protein of the antibody cytokine engrafted protein.
• an inducible promoter is employed to prevent expression of inserted sequences except under inducing conditions.
• Inducible promoters include, e.g., arabinose, lacZ, metallothionein promoter or a heat shock promoter. Cultures of transformed organisms can be expanded under noninducing conditions without biasing the population for coding sequences whose expression products are better tolerated by the host cells.
• promoters In addition to promoters, other regulatory elements may also be required or desired for efficient expression of an immunoglobulin chain or fragment of the antibody cytokine engrafted proteins. These elements typically include an ATG initiation codon and adjacent ribosome binding site or other sequences. In addition, the efficiency of expression may be enhanced by the inclusion of enhancers appropriate to the cell system in use (see, e.g. , Scharf et al., Results Probl. Cell Differ. 20: 125, 1994; and Bittner et al, Meth. Enzymol., 153:516, 1987). For example, the SV40 enhancer or CMV enhancer may be used to increase expression in mammalian host cells.
• Expression vectors can also provide a secretion signal sequence position to form an antibody cytokine engrafted protein that exported out of the cell and into the culture medium.
• the inserted immunoglobulin sequences of the antibody cytokine engrafted proteins are linked to a signal sequences before inclusion in the vector.
• Vectors to be used to receive sequences encoding immunoglobulin light and heavy chain variable domains sometimes also encode constant regions or parts thereof. Such vectors allow expression of the variable regions as engrafted proteins with the constant regions thereby leading to production of intact antibody cytokine engrafted proteins or fragments thereof. Typically, such constant regions are human.
• Host cells for harboring and expressing the antibody cytokine engrafted protein chains can be either prokaryotic or eukaryotic.
• E. coli is one prokaryotic host useful for cloning and expressing the polynucleotides of the present disclosure.
• Other microbial hosts suitable for use include bacilli, such as Bacillus subtilis, and other enterobacteriaceae, such as Salmonella, Serratia, and various Pseudomonas species.
• bacilli such as Bacillus subtilis
• enterobacteriaceae such as Salmonella, Serratia, and various Pseudomonas species.
• any number of a variety of well-known promoters will be present, such as the lactose promoter system, a tryptophan (trp) promoter system, a beta-lactamase promoter system, or a promoter system from phage lambda.
• the promoters typically control expression, optionally with an operator sequence, and have ribosome binding site sequences and the like, for initiating and completing transcription and translation.
• Other microbes, such as yeast can also be employed to express antibody cytokine engrafted protein polypeptides. Insect cells in combination with baculovirus vectors can also be used.
• mammalian host cells are used to express and produce the antibody cytokine engrafted protein polypeptides.
• they can be either a mammalian cell line containing an exogenous expression vector.
• These include any normal mortal or normal or abnormal immortal animal or human cell.
• suitable host cell lines capable of secreting intact immunoglobulins have been developed, including the CHO cell lines, various Cos cell lines, HeLa cells, myeloma cell lines, transformed B-cells and hybridomas.
• Expression vectors for mammalian host cells can include expression control sequences, such as an origin of replication, a promoter, and an enhancer (see, e.g. , Queen et al., Immunol. Rev. 89:49-68, 1986), and necessary processing information sites, such as ribosome binding sites, RNA splice sites, polyadenylation sites, and transcriptional terminator sequences.
• expression control sequences such as an origin of replication, a promoter, and an enhancer (see, e.g. , Queen et al., Immunol. Rev. 89:49-68, 1986)
• necessary processing information sites such as ribosome binding sites, RNA splice sites, polyadenylation sites, and transcriptional terminator sequences.
• These expression vectors usually contain promoters derived from mammalian genes or from mammalian viruses.
• Suitable promoters may be constitutive, cell type-specific, stage-specific, and/or modulatable or regulatable.
• Useful promoters include, but are not limited to, the metallothionein promoter, the constitutive adenovirus major late promoter, the dexamethasone-inducible MMTV promoter, the SV40 promoter, the MRP polIII promoter, the constitutive MPSV promoter, the tetracycline- inducible CMV promoter (such as the human immediate-early CMV promoter), the constitutive CMV promoter, and promoter-enhancer combinations known in the art.
• Methods for introducing expression vectors containing the polynucleotide sequences of interest vary depending on the type of cellular host. For example, calcium chloride transfection is commonly utilized for prokaryotic cells, whereas calcium phosphate treatment or electroporation may be used for other cellular hosts (see generally Sambrook et al., supra).
• Other methods include, e.g., electroporation, calcium phosphate treatment, liposome-mediated transformation, injection and microinjection, ballistic methods, virosomes, immunoliposomes, polycation:nucleic acid conjugates, naked DNA, artificial virions, engrafted to the herpes virus structural protein VP22 (Elliot and O'Hare, Cell 88:223, 1997), agent-enhanced uptake of DNA, and ex vivo transduction. For long-term, high-yield production of recombinant proteins, stable expression will often be desired.
• cell lines which stably express antibody cytokine engrafted protein immunoglobulin chains can be prepared using expression vectors which contain viral origins of replication or endogenous expression elements and a selectable marker gene. Following introduction of the vector, cells may be allowed to grow for 1-2 days in an enriched media before they are switched to selective media.
• the purpose of the selectable marker is to confer resistance to selection, and its presence allows growth of cells which successfully express the introduced sequences in selective media.
• Resistant, stably transfected cells can be proliferated using tissue culture techniques appropriate to the cell type.
• compositions comprising Antibody Cytokine Engrafted Proteins
• compositions comprising an antibody cytokine engrafted protein formulated together with a pharmaceutically acceptable carrier.
• pharmaceutical compositions additionally contain other therapeutic agents that are suitable for treating or preventing a given disorder.
• Pharmaceutically acceptable carriers enhance or stabilize the composition, or facilitate preparation of the composition.
• Pharmaceutically acceptable carriers include solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible.
• a pharmaceutical composition of the present disclosure can be administered by a variety of methods known in the art. Route and/or mode of administration vary depending upon the desired results. It is preferred that administration be by parenteral administration (e.g., selected from any of intravenous, intramuscular, intraperitoneal, intrathecal, intraarterial, or subcutaneous), or administered proximal to the site of the target.
• parenteral administration e.g., selected from any of intravenous, intramuscular, intraperitoneal, intrathecal, intraarterial, or subcutaneous
• a pharmaceutically acceptable carrier is suitable for administration by any one or more of intravenous, intramuscular, intraperitoneal, intrathecal, intraarterial, subcutaneous, intranasal, inhalational, spinal or epidermal administration (e.g., by injection).
• active compound e.g., antibody cytokine engrafted protein
• active compound may be coated in a material to protect the compound from the action of acids and other natural conditions that may inactivate the compound.
• the pharmaceutical composition is formulated for intravenous administration. In some embodiments the pharmaceutical composition is formulation for subcutaneous administration.
• An antibody cytokine engrafted protein can be made into aerosol formulations (i.e., they can be "nebulized") to be administered via inhalation. Aerosol formulations can be placed into pressurized acceptable propellants, such as dichlorodifluoromethane, propane, nitrogen, and the like.
• a pharmaceutical composition is sterile and fluid.
• Proper fluidity can be maintained, for example, by use of coating such as lecithin, by maintenance of required particle size in the case of dispersion and by use of surfactants.
• isotonic agents for example, sugars, polyalcohols such as mannitol or sorbitol, and sodium chloride in the composition.
• Long-term absorption of the injectable compositions can be brought about by including in the composition an agent which delays absorption, for example, aluminum monostearate or gelatin.
• compositions can be prepared for storage in a lyophilized form using appropriate excipients (e.g., sucrose).
• compositions can be prepared in accordance with methods well known and routinely practiced in the art.
• Pharmaceutically acceptable carriers are determined in part by the particular composition being administered, as well as by the particular method used to administer the composition. Accordingly, there is a wide variety of suitable formulations of pharmaceutical compositions.
• compositions are preferably manufactured under GMP conditions.
• a therapeutically effective dose or efficacious dose of an antibody cytokine engrafted protein is employed in the
• An antibody cytokine engrafted protein is formulated into pharmaceutically acceptable dosage form by conventional methods known to those of skill in the art. Dosage regimens are adjusted to provide the desired response (e.g., a therapeutic response). In determining a therapeutically or prophylactically effective dose, a low dose can be administered and then incrementally increased until a desired response is achieved with minimal or no undesired side effects. For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation. It is especially advantageous to formulate parenteral compositions in dosage unit form for ease of administration and uniformity of dosage.
• Dosage unit form refers to physically discrete units suited as unitary dosages for the subjects to be treated; each unit contains a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier. [00190] Actual dosage levels of active ingredients in the pharmaceutical compositions can be varied so as to obtain an amount of the active ingredient which is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, without being toxic to the patient.
• the selected dosage level depends upon a variety of pharmacokinetic factors including the activity of the particular compositions employed, or the ester, salt or amide thereof, the route of administration, the time of administration, the rate of excretion of the particular compound being employed, the duration of the treatment, other drugs, compounds and/or materials used in combination with the particular compositions employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors.
• an antibody cytokine engrafted protein is provided in an article of manufacture (i.e., a kit).
• a provided antibody cytokine engrafted protein is generally in a vial or a container.
• an article of manufacture comprises a container and a label or package insert, on or associated with the container.
• Suitable containers include, for example, a bottle, vial, syringe, solution bag, etc.
• the antibody cytokine engrafted protein can be in liquid or dried (e.g. , lyophilized) form.
• the container holds a composition which, by itself or combined with another composition, is effective for preparing a composition for treating, preventing and/or ameliorating cancer.
• the label or package insert indicates the composition is used for treating, preventing and/or ameliorating cancer.
• Articles of manufacture comprising an antibody cytokine engrafted protein, as described herein, optionally contain one or more additional agent.
• an article of manufacture contains antibody cytokine engrafted protein and a
• an antibody cytokine engrafted protein is provided in an article of manufacture (kit) with one or more additional active agent in the same formulation (e.g. , as mixtures).
• an antibody cytokine engrafted protein is provided in an article of manufacture (kit) with a second or third agent in separate formulations (e.g. , in separate containers).
• an article of manufacture (kit) contains aliquots of the antibody cytokine engrafted protein wherein the aliquot provides for one or more doses. In some embodiments aliquots for multiple administrations are provided, wherein doses are uniform or varied.
• varied dosing regimens are escalating or decreasing, as appropriate.
• dosages of an antibody cytokine engrafted protein and a second agent are independently uniform or independently varying.
• an article of manufacture comprises an additional agent such as an anti-cancer agent or immune checkpoint molecule. Selection of one or more additional agent will depend on the dosage, delivery, and disease condition to be treated.
• Antibody cytokine engrafted proteins find use in treatment, amelioration or prophylaxis of cancer.
• the disclosure provides methods of treatment of cancer in an individual in need thereof, comprising administering to the individual a therapeutically effective amount of an antibody cytokine engrafted protein, as described herein.
• an antibody cytokine engrafted protein is provided for use as a therapeutic agent in the treatment or prophylaxis of cancer in an individual.
• the disclosure provides a composition comprising such an antibody cytokine engrafted protein for use in treating or ameliorating cancer in an individual in need thereof.
• Conditions subject to treatment include various cancer indications.
• an individual was diagnosed with cancer.
• an individual may be in remission from cancer or may anticipate future onset.
• the patient has cancer, is suspected of having cancer, or is in remission from cancer.
• Cancers subject to treatment with an antibody cytokine engrafted protein usually derive benefit from activation of IL2 low affinity receptor signalling, as described herein.
• Cancer indications subject to treatment include without limitation: melanoma, lung cancer, colorectal cancer, prostate cancer, breast cancer and lymphoma
• a physician or veterinarian can start doses of an antibody cytokine engrafted protein employed in the pharmaceutical composition at levels lower than that required to achieve the desired therapeutic effect and gradually increase the dosage until the desired effect is achieved.
• effective doses of the compositions vary depending upon many different factors, including the specific disease or condition to be treated, means of administration, target site, physiological state of the patient, whether a patient is human or an animal, other medications administered, and whether treatment is prophylactic or therapeutic. Treatment dosages typically require titration to optimize safety and efficacy.
• dosage ranges from about 0.0001 to 100 mg/kg, and more usually 0.01 to 5 mg/kg, of the host body weight.
• dosages can be 1 mg/kg body weight or 10 mg/kg body weight or within the range of 1-10 mg/kg.
• Dosing can be daily, weekly, bi-weekly, monthly, or more or less often, as needed or desired.
• An exemplary treatment regime entails administration once weekly, once per every two weeks or once a month or once every 3 to 6 months.
• the antibody cytokine engrafted protein can be administered in single or divided doses.
• An antibody cytokine engrafted protein is usually administered on multiple occasions. Intervals between single dosages can be weekly, bi-weekly, monthly or yearly, as needed or desired. Intervals can also be irregular as indicated by measuring blood levels of antibody cytokine engrafted protein in the patient. In some methods, dosage is adjusted to achieve a plasma antibody cytokine engrafted protein concentration of 1-1000 ⁇ g/ml and in some methods 25-300 ⁇ g/ml. Alternatively, antibody cytokine engrafted protein can be administered as a sustained release formulation, in which case less frequent administration is required.
• composition therapy refers to the administration of two or more therapeutic agents to treat a therapeutic condition or disorder described in the present disclosure.
• administration encompasses co-administration of these therapeutic agents in a substantially simultaneous manner, such as in a single capsule having a fixed ratio of active ingredients.
• administration encompasses co-administration in multiple, or in separate containers (e.g. , capsules, powders, and liquids) for each active ingredient. Powders and/or liquids may be reconstituted or diluted to a desired dose prior to
• administration also encompasses use of each type of therapeutic agent in a sequential manner, either at approximately the same time or at different times. In either case, the treatment regimen will provide beneficial effects of the drug combination in treating the conditions or disorders described herein.
• the combination therapy can provide "synergy” and prove “synergistic”, i.e., the effect achieved when the active ingredients used together is greater than the sum of the effects that results from using the compounds separately.
• a synergistic effect can be attained when the active ingredients are: (1) co-formulated and administered or delivered
• alternation therapy a synergistic effect can be attained when the compounds are administered or delivered sequentially, e.g., by different injections in separate syringes.
• an effective dosage of each active ingredient is administered sequentially, i.e., serially, whereas in combination therapy, effective dosages of two or more active ingredients are administered together.
• the present disclosure provides a method of treating cancer by administering to a subject in need thereof an antibody cytokine engrafted protein in combination with one or more tyrosine kinase inhibitors, including but not limited to, EGFR inhibitors, Her2 inhibitors, Her3 inhibitors, IGFR inhibitors, and Met inhibitors.
• one or more tyrosine kinase inhibitors including but not limited to, EGFR inhibitors, Her2 inhibitors, Her3 inhibitors, IGFR inhibitors, and Met inhibitors.
• tyrosine kinase inhibitors include but are not limited to, Erlotinib hydrochloride (Tarceva®); Linifanib (N-[4-(3-amino-lH-indazol-4-yl)phenyl]-N'-(2-fluoro- 5-methylphenyl)urea, also known as ABT 869, available from Genentech); Sunitinib malate (Sutent®); Bosutinib (4-[(2,4-dichloro-5-methoxyphenyl)amino]-6-methoxy-7-[3-(4- methylpiperazin-l-yl)propoxy]quinoline-3-carbonitrile, also known as SKI-606, and described in US Patent No. 6,780,996); Dasatinib (Sprycel®); Pazopanib (Votrient®);
• Sorafenib (Nexavar®); Zactima (ZD6474); nilotinib (Tasigna®); Regorafenib (Stivarga®) and Imatinib or Imatinib mesylate (Gilvec® and Gleevec®).
• Epidermal growth factor receptor (EGFR) inhibitors include but are not limited to, Erlotinib hydrochloride (Tarceva®), Gefitnib (Iressa®); N-[4-[(3-Chloro-4- fluorophenyl)amino]-7-[[(3"S")-tetrahydro-3-furanyl]oxy]-6-quinazolinyl]- 4(dimethylamino)-2-butenamide, Tovok®); Vandetanib (Caprelsa®); Lapatinib (Tykerb®); (3R,4R)-4- Amino- 1 -((4-((3-methoxyphenyl)amino)pyrrolo[2, 1 -f] [ 1 ,2,4] triazin-5- yl)methyl)piperidin-3-ol (BMS690514); Canertinib dihydrochloride (CI-1033); 6-[4-[(4- Ethyl)
• EGFR antibodies include but are not limited to, Cetuximab (Erbitux®);
• Panitumumab (Vectibix®); Matuzumab (EMD-72000); Nimotuzumab (hR3);
• HER2 receptor Human Epidermal Growth Factor Receptor 2 (HER2 receptor) (also known as HER2 receptor) (also known as HER2 receptor)
• Neu, ErbB-2, CD340, or pi 85) inhibitors include but are not limited to, Trastuzumab (Herceptin®); Pertuzumab (Omnitarg®); Neratinib (HKI-272, (2E)-N-[4-[[3-chloro-4- [(pyridin-2-yl)methoxy]phenyl]amino]-3-cyano-7-ethoxyquinolin-6-yl]-4- (dimethylamino)but-2-enamide, and described PCT Publication No. WO 05/028443);
• Lapatinib or Lapatinib ditosylate (Tykerb®); (3R,4R)-4-amino-l-((4-((3- methoxyphenyl)amino)pyrrolo[2, 1-f] [1 ,2,4]triazin-5-yl)methyl)piperidin-3-ol (BMS690514); (2E)-N-[4-[(3-Chloro-4-fluorophenyl)amino]-7-[[(3S)-tetrahydro-3-furanyl]oxy]-6- quinazolinyl]-4-(dimethylamino)-2-butenamide (BIBW-2992, CAS 850140-72-6); N-[4-[[l- [(3-Fluorophenyl)methyl]-lH-indazol-5-yl]amino]-5-methylpyrrolo[2, l-f] [l ,2,4]triazin-6-
• Canertinib dihydrochloride (PD183805 or CI-1033); and N-(3,4-Dichloro-2-fluorophenyl)-6- methoxy-7-[[(3aa,5 ,6aa)-octahydro-2-methylcyclopenta[c]pyrrol-5-yl]methoxy]- 4- quinazolinamine (XL647, CAS 781613-23-8).
• HER3 inhibitors include but are not limited to, LJM716, MM-121 , AMG-888,
• RG7116 REGN-1400, AV-203, MP-RM-1 , MM-111, and MEHD-7945A.
• MET inhibitors include but are not limited to, Cabozantinib (XL 184, CAS
• IGF1R inhibitors include but are not limited to, BMS-754807, XL-228, OSI-
• GSK0904529A A-928605, AXL1717, KW-2450, MK0646, AMG479, IMCA12, MEDI-573, and BI836845. See e.g., Yee, JNCI, 104; 975 (2012) for review.
• the present disclosure provides a method of treating cancer by administering to a subject in need thereof an antibody cytokine engrafted protein in combination with one or more FGF downstream signaling pathway inhibitors, including but not limited to, MEK inhibitors, Braf inhibitors, PI3K/Akt inhibitors, SHP2 inhibitors, and also mTor inhibitors.
• FGF downstream signaling pathway inhibitors including but not limited to, MEK inhibitors, Braf inhibitors, PI3K/Akt inhibitors, SHP2 inhibitors, and also mTor inhibitors.
• mitogen-activated protein kinase (MEK) inhibitors include but are not limited to, XL-518 (also known as GDC-0973, Cas No. 1029872-29-4, available from ACC Corp.); 2-[(2-Chloro-4-iodophenyl)amino]-N-(cyclopropylmethoxy)-3,4-difluoro- benzamide (also known as CI-1040 or PD184352 and described in PCT Publication No.
• N-[3,4-Difluoro-2-[(2-fluoro- 4-iodophenyl)amino]-6-methoxyphenyl]-l-[(2R)-2,3-dihydroxypropyl]- cyclopropanesulfonamide also known as RDEA119 or BAY869766 and described in PCT Publication No.
• Pimasertib AS-703026, CAS 1204531-26-9
• Trametinib dimethyl sulfoxide GSK- 1120212, CAS 1204531-25-80.
• Phosphoinositide 3 -kinase (PI3K) inhibitors include but are not limited to, 4-
• mTor inhibitors include but are not limited to, Temsirolimus (Torisel®);
• Ridaforolimus (formally known as deferolimus, (lR,2R,45)-4-[(2R)-2
• the present disclosure provides a method of treating cancer by administering to a subject in need thereof an antibody cytokine engrafted protein in combination with one or more pro-apoptotics, including but not limited to, IAP inhibitors, Bcl2 inhibitors, MCll inhibitors, Trail agents, Chk inhibitors.
• an antibody cytokine engrafted protein in combination with one or more pro-apoptotics, including but not limited to, IAP inhibitors, Bcl2 inhibitors, MCll inhibitors, Trail agents, Chk inhibitors.
• IAP inhibitors include but are not limited to, NVP-LCL161,
• IAP inhibitors include but are not limited to those disclosed in WO04/005284, WO 04/007529, WO05/097791, WO 05/069894, WO 05/069888, WO 05/094818, US2006/0014700, US2006/0025347, WO 06/069063, WO 06/010118, WO 06/017295, and WO08/134679.
• BCL-2 inhibitors include but are not limited to, 4-[4-[[2-(4-Chlorophenyl)-
• PARAs Proapoptotic receptor agonists
• DR4 TRAILR1
• DR5 Proapoptotic receptor agonists
• TRAILR2 including but are not limited to, Dulanermin (AMG-951, RhApo2L/TRAIL); Mapatumumab (HRS-ETR1, CAS 658052-09-6); Lexatumumab (HGS-ETR2, CAS 845816-
• Apomab (Apomab®); Conatumumab (AMG655, CAS 896731-82-1); and
• Tigatuzumab (CS1008, CAS 946415-34-5, available from Daiichi Sankyo).
• Checkpoint Kinase (CHK) inhibitors include but are not limited to, 7- Hydroxystaurosporine (UCN-01); 6-Bromo-3-(l-methyl-lH-pyrazol-4-yl)-5-(3R)-3- piperidinyl-pyrazolo[l,5-fl]pyrimidin-7-amine (SCH900776, CAS 891494-63-6); 5-(3- Fluorophenyl)-3-ureidothiophene-2-carboxylic acid N-[(S)-piperidin-3-yl]amide (AZD7762, CAS 860352-01-8); 4-[((3S)-l-Azabicyclo[2.2.2]oct-3-yl)amino]-3-(lH-benzimidazol-2-yl)- 6-chloroquinolin-2(lH)-one (CHIR 124, CAS 405168-58-3); 7-Aminodactinomycin (7- AAD),
• the present disclosure provides a method of treating cancer by administering to a subject in need thereof an antibody cytokine engrafted protein in combination with one or more FGFR inhibitors.
• FGFR inhibitors include but are not limited to, Brivanib alaninate (BMS-582664, (5)-((R)-l-(4-(4-Fluoro-2-methyl-lH- indol-5-yloxy)-5-methylpyrrolo[2,l-
• the present disclosure provides a method of treating cancer by administering to a subject in need thereof an antibody drug conjugate in combination with an FGFR2 inhibitor, such as 3-(2,6- dichloro-3,5-dimethoxyphenyl)- 1 -(6((4-(4-ethylpiperazin- 1 -yl)phenyl)amino)pyrimidin-4- yl)-l-methylurea (also known as BGJ-398); or 4-amino-5-fluoro-3-(5-(4-methylpiperazinl- yl)-lH-benzo[(i]imidazole-2-yl)quinolin-2(lH)-one (also known as dovitinib or TKI-258).
• an FGFR2 inhibitor such as 3-(2,6- dichloro-3,5-dimethoxyphenyl)- 1 -(6((4-(4-ethylpiperazin- 1 -yl)phenyl)amino)
• AZD4547 (Gavine et al, 2012, Cancer Research 72, 2045-56, N-[5-[2-(3,5- Dimethoxyphenyl)ethyl]-2H-pyrazol-3-yl]-4-(3R,5S)-diemthylpiperazin-l-yl)benzamide), Ponatinib (AP24534; Gozgit et al, 2012, Mol Cancer Ther., 11; 690-99; 3-[2-(imidazo[l,2- b]pyridazin-3-yl)ethynyl]-4-methyl-N- ⁇ 4- [(4-methylpiperazin- 1 - yl)methyl] -3- (trifluoromethyl)phenyl ⁇ benzamide, CAS 943319-70-8).
• the antibody cytokine engrafted proteins can also be administered in combination with an immune checkpoint inhibitor.
• the antibody cytokine engrafted proteins can be administered in combination with an inhibitor of an immune checkpoint molecule chosen from one or more of PD-1, PD-L1, PD-L2, TIM3, CTLA-4, LAG-3, CEACAM-1, CEACAM-5, VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4 or TGFR
• the immune checkpoint inhibitor is an anti-PD-1 antibody, wherein the anti-PD-1 antibody is chosen from Nivolumab, Pembrolizumab or Pidilizumab.
• the anti-PD-1 antibody molecule is Nivolumab.
• Alternative names for Nivolumab include MDX- 1106, MDX- 1106-04, ONO-4538, or BMS-936558.
• the anti-PD- 1 antibody is Nivolumab (CAS Registry Number: 946414-94-4).
• Nivolumab is a fully human IgG4 monoclonal antibody which specifically blocks PDl.
• Nivolumab (clone 5C4) and other human monoclonal antibodies that specifically bind to PDl are disclosed in US 8,008,449 and WO2006/121168.
• the anti-PD- 1 antibody is Pembrolizumab.
• Pembrolizumab (also referred to as Lambrolizumab, MK-3475, MK03475, SCH-900475 or KEYTRUDA ® ; Merck) is a humanized IgG4 monoclonal antibody that binds to PD-1.
• Pembrolizumab and other humanized anti-PD- 1 antibodies are disclosed in Hamid, O. et al. (2013) New England Journal of Medicine 369 (2): 134-44, US 8,354,509 and
• the anti-PD- 1 antibody is Pidilizumab. Pidilizumab
• CT-011 Cure Tech
• Cure Tech is a humanized IgGlk monoclonal antibody that binds to PDl.
• anti-PDl antibodies include AMP 514 (Amplimmune) and, e.g., anti-PDL antibodies
• the antibody cytokine engrafted proteins can be administered with the anti-Tim3 antibody disclosed in US2015/0218274. In other embodiments, the antibody cytokine engrafted proteins can be administered with the anti-PD-Ll antibody disclosed in US2016/0108123, Durvalumab® (MEDI4736), Atezolizumab® (MPDL3280A) or
• Antibody cytokine engrafted proteins were generated by engineering an IL2 sequence into CDR regions of various immunoglobulin scaffolds, then both heavy and light chain immunoglobulin chains were used to generate final antibody cytokine proteins.
• Antibody cytokine engrafted proteins confer preferred therapeutic properties of IL2;
• antibody cytokine engrafted proteins have reduced undesired effects, such as increased Treg cell activity, as compared with rhIL2.
• IL2 sequences containing muteins SEQ ID NO: 4 or 6
• Antibody cytokine engrafted proteins were prepared using a variety of known immunoglobulin sequences which have been utilized in clinical settings as well as germline antibody sequences. Sequences of IL2 in an exemplary scaffold, referred to as GFTX3b, are depicted in TABLE 2. Insertion points were selected to be the mid-point of the loop based on available structural or homology model data.
• Antibody cytokine engrafted proteins were produced using standard molecular biology methodology utilizing recombinant DNA encoding the relevant sequences.
• IL2 antibody cytokine engrafted molecules the structure of the antibody candidate considered for cytokine engrafting was initially solved. From this structure, it was noted that the paratope was at the extreme N-terminus of the antibody "arm" and that a cytokine engrafted into this location would present the cytokine to its respective receptor. Because of the grafting technology, each antibody IL2 engrafted protein is constrained by a CDR loop of different length, sequence and structural environments. As such, IL2 was engrafted into all six CDRs, corresponding to LCDR-1, LCDR-2, LCDR-3 and HCDR-1, HCDR-2 and HCDR-3.
• HCDR-1 was chosen because it had the best combination of properties
• the structural center of the CDR loop was chosen as this would provide the most space on either side (of linear size 3.8 A x the number of residues) and without being bound by any one theory, this provided a stable molecule by allowing the IL2 to more readily fold independently.
• the structural center of each CDR was also known. This coincided with the center of the CDR loop sequence as defined using the Chothia numbering format.
• the insertion point of the IL-2 grafts were shifted away from the center and toward either the N or C terminal portion of the CDR loop. However, shifting IL2 within the CDR loop did not make a significant difference in biological activity.
• each CDR was chosen on a structural basis, with the hypothesis that grafting into the CDR would provide some level of steric hindrance to individual subunits of the IL2 receptor.
• the final selection of which CDR graft was best for a particular cytokine was based on desired biology and biophysical properties.
• the nature of the cytokine receptor, the cytokine/receptor interactions and the mechanism of signaling also played a role and this was done by comparing each individual antibody cytokine molecule for their respective properties.
• SEQ ID NO: 10 (Rabat) HCDR1 APTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTA
• SEQ ID NO: 42 (Rabat) HCDR1 APTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTR
• SEQ ID NO:50 HCDR3 ARSMI TNWYFDV
• SEQ ID NO:54 DNA CAAGTCACACTGCGTGAAAGCGGCCCTGCCCTGGTCAA
• Example 2 IgG.IL2R67A.Hl Has Extended Half-Life Compared to Proleukin® (IL-2)
• Naive CD-I mice were dosed LP. and blood collected from all animals at pre- dose, 1 hour, 3, 7, 24, 31, 48, 55 and 72 hours post-dose. Blood samples were centrifuged, and plasma samples obtained. Resulting plasma samples were transferred into a single polypropylene tube and frozen at -80°C. All samples were analyzed, and concentrations of IgG.IL2R67A.Hl in plasma measured using immuno-assays. Pharmacokinetic parameters such as half-life were calculated. Each sample was run in duplicate, with each of the duplicated analyses requiring 5 ⁇ L ⁇ of sample that had been diluted 1 :20.
• Example 3 IgG.IL2R67A.Hl selectively expands CD8 T effectors and is better tolerated than IL-2 Fc or Proleukin® in normal B6 mice
• IgG.IL2R67A.Hl augments CD 8 T effectors over Tregs without causing the adverse events seen with Proleukin® administration.
• CD8 T effector expansion was monitored at day 4, day 8 and day 11.
• the CD8 T effector cell population was greatly expanded, without Treg expansion. This was in contrast to Proleukin® and an IL-2Fc fusion, in which mortality and morbidity were observed at equimolar doses of IL-2.
• IgG.IL2R67A.Hl (lx/week) at equimolar concentrations. Eight days after first treatment, spleens were processed to obtain a single cell suspension and washed in RPMI (10% FBS). Red blood cells were lysed with Red Blood Cell Lysis Buffer (Sigma #R7757) and cells counted for cell number and viability. FACS staining was performed under standard protocols using FACS buffer (lxPBS + 0.5% BSA + 0.05% sodium azide).
• Rat anti-mouse CD3-efluor 450 (Ebioscience #48-0032), Rat anti-mouse CD4- Pacific Blue (BD Pharmingen #558107), Rat anti-mouse CD8-PerCp (BD Pharmingen #553036), Rat anti-mouse CD44 FITC (Pharmingen #553133), Rat anti-mouse CD25-APC (Ebioscience #17-0251), Rat anti-mouse Nkl. l (Ebioscience #95-5941) and subsequently fixed/permeabilized and stained for FoxP3 according to the anti-Mouse/Rat FoxP3 Staining Set PE (Ebioscience #72-5775). Cells were analyzed on the Becton- Dickinson LSR Fortessa® or Becton-Dickinson FACS LSR II, and data analyzed with Flow Jo® software.
• FIGS 3A-3C shows the preferential expansion of CD8 T effector cells in B6 female mice after administration of Proleukin® (5x weekly), IL2-Fc and IgG.IL2R67A.Hl (lx/week) at Proleukin® equimolar concentrations (IgG.IL2R67A.Hl and IL2-Fc 100 ⁇ g ⁇ lnmol IL2 equivalent).
• the data in the graphs demonstrate that CD8 T effector cells proliferate without similar proliferation of Tregs. Contrast this data to Proleukin® which expanded both CD8 T effectors and Tregs.
• IgG.IL2R67A.Hl was superior in both absolute numbers of CD 8 T effector cell expansion and in the ratio CD 8 T effector cells:Tregs to an IL2-Fc fusion construct, demonstrating that there is a structural and functional basis for the IgG.IL2R67A.Hl antibody cytokine engrafted protein.
• Figures 3D- 3F shows that the beneficial effect of IgG.IL2R67A.Hl is more apparent at higher doses.
• 500 ⁇ g (5nmol IL2 equivalent) of IgG.IL2R67A.Hl was administered to B6 mice, the preferential expansion of CD 8 T effector cells was seen relative to Treg cells similar to the lower dose.
• mice were found dead after only a single dose at the higher level (data not shown). This indicates that IgG.IL2R67A.Hl has a larger therapeutic index that IL2-Fc fusion constructs, and can be safely administered in a wider dosage range.
• Example 4 IgG.IL2R67A.Hl selectively expands CD8 T effector cells, and is better tolerated than Proleukin® in NOD Mice
• the non-obese diabetic (NOD) mouse develops type 1 diabetes spontaneously and is often used as an animal model for human type 1 diabetes.
• IgG.IL2R67A.Hl, IL2-Fc and Proleukin® were administered to NOD mice at Proleukin® equimolar equivalents.
• administration of IgG.IL2R67A.Hl at this dose preferentially expanded CD 8 T effector cells over Tregs as shown in the graph in Figure 4A.
• administration of IgG.IL2R67A.Hl showed no adverse events in NOD mice, while the Proleukin® treated group had 5 moribund mice and 2 deaths.
• Figure 4B is a graph reporting the dosages, fold cellular changes and cell type from the NOD mouse model.
• Example 5 IgG.IL2R67A.Hl shows single-agent efficacy in a CT26 colon tumor mouse model
• CT26 (ATCC CRL-2638) cells were grown in sterile conditions in a 37° C incubator with 5% CO2. The cells were cultured in RPMI 1640 media supplemented with 10% FBS. Cells were passed every 3-4 days. For the day of injection, cells were harvested (Passage 11) and re-suspended in HBSS at a concentration of 2.5x 10 6 /ml.
• mice were used. For each mouse, 0.25 x 10 6 cells were implanted with subcutaneously injection into right flank using a 28g needle (100 ⁇ injection volume). After implantation, animals were calipered and weighed 3 times per week once tumors were palpable. Caliper measurements were calculated using (LxWxW)/2. Mice were fed with normal diet and housed in SPF animal facility in accordance with the Guide for Care and Use of Laboratory Animals and regulations of the Institutional Animal Care and Use Committee.
• mice were administered by intraperitoneal route 12.5-100 ⁇ g of IgG.IL2R67A.Hl. Tumors were measured twice a week. Average tumor volumes were plotted using Prism 5 (GraphPad®) software. An endpoint for efficacy studies was achieved when tumor size reached a volume of 1000 mm 3 . Following injection, mice were also closely monitored for signs of clinical deterioration.
• mice were euthanized.
• IgG.IL2R67A.Hl was efficacious in the CT26 mouse model at doses ranging from 12.5 ⁇ g to 100 ⁇ g, with 4 administrations of IgG.IL2R67A.Hl over 17 days in a 20 day study.
• the tumor volume curves shown in Figure 5 are indicative of the efficacy of IgG.IL2R67A.Hl in this study, as tumor volumes were kept under 200mm for 15 days and then under 400mm for the remaining 5 days.
• Example 6 IgG.IL2R67A.Hl and additional cancer therapeutics show efficacy in a B16 mouse model
• B16F10 melanoma mouse model was used.
• B 16F10 cells (ATCC CRL-6475) were grown in sterile conditions in a 37 °C incubator with 5% CO2 for two weeks.
• B 16F10 cells were cultured in DMEM+10 FBS. Cells were harvested and re-suspended in FBS-free medium DMEM at a concentration of 1 x 10 6 /100 ⁇ .
• B 16F10 cells were Radii tested for mycoplasma and murine viruses. Cells were implanted into the right flank of B6 mice using a 28 gauge needle (100 ⁇ injection volume). After implant, mice were calipered and weighed 2 times per week once tumors were palpable. Caliper measurements were calculated using (L x W x W)/2.
• IgG.IL2R67A.Hl was used as a single agent or in combination with the TA99 antibody, which binds Trpl, an antigen that is expressed on B16F10 cells.
• An IL2-Fc fusion was administered as a single agent or in combination with the TA99 antibody.
• the TA99 antibody was administered as a single agent.
• IgG.IL2R67A.Hl when administered as a single agent at a 500 ⁇ g dose was the most efficacious treatment in this model ( Figure 6).
• the next best treatment was the combination of IgG.IL2R67A.Hl (100 ⁇ g) and TA99.
• This combination was more efficacious than IgG.IL2F71A.Hl as a single agent at 100 ⁇ g, TA99 in combination with IgG.IL2F71A.Hl at 500 ⁇ g and IL2-Fc as a single agent or as an IL2-Fc/TA99 combination.
• TA99 was administered a single agent, it had no effect, and the mean tumor volume was similar to untreated control.
• This data demonstrates that IgG.IL2R67A.Hl is efficacious as a single agent in melanoma mouse tumor model, but it is also efficacious when paired with another anti-cancer agent.
• Example 7 Activity of IgG.IL2R67A.Hl and IgG.IL2F71A.Hl in Human Cells [00237]
• human peripheral blood mononuclear cells PBMC were assayed for pSTAT5 activity. PBMC cells were rested in serum-free test media, and plated. IgG.IL2R67A.Hl,
• IgG.IL2F71A.Hl or Proleukin® was added to the PBMCs, and incubated for 20 minutes at 37°C. After 20 min, cells were fixed with 1.6% formaldehyde, washed and stained with surface markers. After 30 minutes at room temperature, samples were washed and re- suspended cell pellets were permeabilized with -20°C methanol, washed and stained for pSTAT5 and DNA intercalators. Cells were run on Cytof® and data analyzed with Flow Jo® software to quantify the level of pSTAT5 activity.
• the table in Figure 7 demonstrates the preferential activation IgG.IL2R67A.Hl has for CD8 T effector cells and minimizes the activation of Treg cells.
• IL2 sequences containing a mutein were inserted into CDR loops of an immunoglobulin chain scaffold.
• Antibody cytokine engrafted proteins were prepared using a variety of known immunoglobulin sequences which have been utilized in clinical settings as well as germline antibody sequences.
• One of the antibodies used has RSV as its antigen.
• an ELISA assay was run on RSV proteins either in PBS or a carbonate buffer. As shown in Figure 8, this appears to be influenced by which CDR was chosen for IL2 engrafting.
• IgG.IL2R67A.Hl has RSV binding similar to the un-grafted (un-modified) original antibody.
• engrafting IL2 into the light chain of CDR3 (CDR-L3) or into CDR-H3 reduces binding.
• CDR-L3 CDR3
• IL2 engrafted into an irrelevant antibody (Xolair) produces no binding.

Landscapes

• Health & Medical Sciences (AREA)
• Life Sciences & Earth Sciences (AREA)
• Chemical & Material Sciences (AREA)
• Engineering & Computer Science (AREA)
• Organic Chemistry (AREA)
• Immunology (AREA)
• General Health & Medical Sciences (AREA)
• Bioinformatics & Cheminformatics (AREA)
• Medicinal Chemistry (AREA)
• Genetics & Genomics (AREA)
• Zoology (AREA)
• Biomedical Technology (AREA)
• Biochemistry (AREA)
• Proteomics, Peptides & Aminoacids (AREA)
• Veterinary Medicine (AREA)
• Pharmacology & Pharmacy (AREA)
• Animal Behavior & Ethology (AREA)
• Public Health (AREA)
• Molecular Biology (AREA)
• Biotechnology (AREA)
• Wood Science & Technology (AREA)
• Biophysics (AREA)
• Epidemiology (AREA)
• Virology (AREA)
• Microbiology (AREA)
• Gastroenterology & Hepatology (AREA)
• General Engineering & Computer Science (AREA)
• Cell Biology (AREA)
• General Chemical & Material Sciences (AREA)
• Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
• Chemical Kinetics & Catalysis (AREA)
• Pulmonology (AREA)
• Hematology (AREA)
• Mycology (AREA)
• Endocrinology (AREA)
• Reproductive Health (AREA)
• Toxicology (AREA)
• Peptides Or Proteins (AREA)
• Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
• Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)

Priority Applications (23)

Applications Claiming Priority (2)

Related Child Applications (2)

Publications (1)

Family

ID=62685011

Family Applications (1)

Country Status (17)

Cited By (9)

Families Citing this family (42)

Citations (72)

Family Cites Families (179)

• 2018
  • 2018-05-22 US US16/616,318 patent/US12006354B2/en active Active
  • 2018-05-22 EA EA201992765A patent/EA201992765A1/ru unknown
  • 2018-05-22 EP EP18732889.3A patent/EP3630813A1/en active Pending
  • 2018-05-22 IL IL322309A patent/IL322309A/en unknown
  • 2018-05-22 CA CA3063983A patent/CA3063983A1/en active Pending
  • 2018-05-22 PE PE2019002452A patent/PE20200303A1/es unknown
  • 2018-05-22 MY MYPI2019006760A patent/MY206158A/en unknown
  • 2018-05-22 KR KR1020197037949A patent/KR20200010468A/ko active Pending
  • 2018-05-22 BR BR112019024556-1A patent/BR112019024556A2/pt unknown
  • 2018-05-22 CN CN201880033883.2A patent/CN110662762A/zh active Pending
  • 2018-05-22 PE PE2024003023A patent/PE20251254A1/es unknown
  • 2018-05-22 WO PCT/IB2018/053623 patent/WO2018215936A1/en not_active Ceased
  • 2018-05-22 MX MX2019014023A patent/MX2019014023A/es unknown
  • 2018-05-22 JP JP2019564847A patent/JP7791642B2/ja active Active
  • 2018-05-22 AU AU2018274216A patent/AU2018274216A1/en not_active Abandoned
• 2019
  • 2019-11-20 CO CONC2019/0013001A patent/CO2019013001A2/es unknown
  • 2019-11-21 CL CL2019003390A patent/CL2019003390A1/es unknown
  • 2019-11-21 PH PH12019502621A patent/PH12019502621A1/en unknown
  • 2019-11-21 IL IL270814A patent/IL270814A/en unknown
  • 2019-11-22 MX MX2024012897A patent/MX2024012897A/es unknown
• 2021
  • 2021-10-11 AU AU2021250843A patent/AU2021250843B2/en active Active
• 2023
  • 2023-11-02 JP JP2023188444A patent/JP7774025B2/ja active Active
  • 2023-12-26 US US18/396,301 patent/US20240141022A1/en active Pending
• 2024
  • 2024-12-24 JP JP2024227489A patent/JP2025060802A/ja active Pending

Patent Citations (83)