WO2014210558A1 - Thrombin cleavable linker with xten and its uses thereof - Google Patents

Thrombin cleavable linker with xten and its uses thereof Download PDF

Info

Publication number
WO2014210558A1
WO2014210558A1 PCT/US2014/044731 US2014044731W WO2014210558A1 WO 2014210558 A1 WO2014210558 A1 WO 2014210558A1 US 2014044731 W US2014044731 W US 2014044731W WO 2014210558 A1 WO2014210558 A1 WO 2014210558A1
Authority
WO
WIPO (PCT)
Prior art keywords
amino acids
chimeric molecule
vwf
fviii
seq
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2014/044731
Other languages
English (en)
French (fr)
Inventor
Ekta Seth Chhabra
John KULMAN
Tongyao Liu
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Biogen Inc
Biogen MA Inc
Original Assignee
Biogen Idec Inc
Biogen Idec MA Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=52142742&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=WO2014210558(A1) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Priority to US14/894,108 priority Critical patent/US20160251408A1/en
Priority to EA201592022A priority patent/EA201592022A1/ru
Priority to MX2015016567A priority patent/MX2015016567A/es
Priority to CA2913078A priority patent/CA2913078A1/en
Priority to KR1020227045978A priority patent/KR20230007555A/ko
Priority to EP14817900.5A priority patent/EP3013358A4/en
Priority to CN201480029781.5A priority patent/CN105392495A/zh
Priority to BR112015031194-6A priority patent/BR112015031194B1/pt
Priority to KR1020247004922A priority patent/KR102714760B1/ko
Priority to HK16111718.0A priority patent/HK1223302A1/zh
Priority to SG11201509313PA priority patent/SG11201509313PA/en
Priority to JP2016524268A priority patent/JP2016523919A/ja
Priority to KR1020157033268A priority patent/KR102666819B1/ko
Application filed by Biogen Idec Inc, Biogen Idec MA Inc filed Critical Biogen Idec Inc
Priority to AU2014302100A priority patent/AU2014302100B2/en
Priority to EP24150415.8A priority patent/EP4368194A3/en
Priority to IL297611A priority patent/IL297611B2/en
Priority to KR1020247032926A priority patent/KR102865153B1/ko
Priority to NZ713904A priority patent/NZ713904A/en
Publication of WO2014210558A1 publication Critical patent/WO2014210558A1/en
Priority to IL242436A priority patent/IL242436B/en
Priority to PH12015502614A priority patent/PH12015502614A1/en
Anticipated expiration legal-status Critical
Priority to IL266462A priority patent/IL266462B2/en
Priority to AU2020203063A priority patent/AU2020203063B2/en
Priority to US17/479,705 priority patent/US20220106383A1/en
Priority to US18/358,601 priority patent/US20240083975A1/en
Priority to AU2023219840A priority patent/AU2023219840A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/745Blood coagulation or fibrinolysis factors
    • C07K14/755Factors VIII, e.g. factor VIII C (AHF), factor VIII Ag (VWF)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/36Blood coagulation or fibrinolysis factors
    • A61K38/37Factors VIII
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/02Stomatological preparations, e.g. drugs for caries, aphtae, periodontitis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • A61P17/02Drugs for dermatological disorders for treating wounds, ulcers, burns, scars, keloids, or the like
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/02Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/08Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00Drugs for disorders of the muscular or neuromuscular system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00Drugs for disorders of the blood or the extracellular fluid
    • A61P7/04Antihaemorrhagics; Procoagulants; Haemostatic agents; Antifibrinolytic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/30Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/35Fusion polypeptide containing a fusion for enhanced stability/folding during expression, e.g. fusions with chaperones or thioredoxin
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/50Fusion polypeptide containing protease site
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/70Fusion polypeptide containing domain for protein-protein interaction
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/90Fusion polypeptide containing a motif for post-translational modification

Definitions

  • Haemophilia A is a bleeding disorder caused by defects in the gene encoding coagulation factor VIII (FVIII) and affects 1 -2 in 10,000 male births. Graw et al., Nat. Rev. Genet. 6(6): 488-501 (2005). Patients affected with hemophilia A can be treated with infusion of purified or recombinantly produced FVIII. All commercially available FVIII products, however, are known to have a half-life of about 8-12 hours, requiring frequent intravenous administration to the patients. See Weiner M.A. and Cairo, M.S., Pediatric Hematology Secrets, Lee, M.T., 12.
  • the present invention is directed to a chimeric molecule comprising a Von
  • VWF Willebrand Factor
  • HI Hemthelial growth factor
  • XTEN sequence a VWF linker connecting the VWF protein with the heterologous moiety
  • the VWF linker comprises a polypeptide selected from: (i) an a2 region from Factor VIII (FVIII); (ii) an al region from FVIII; (iii) an a3 region from FVIII; (iv) a thrombin cleavage site which comprises X-V-P-R (SEQ ID NO: 3) and a PARI exosite interaction motif, wherein X is an aliphatic amino acid; or (v) any combination thereof, and wherein the XT EN sequence is connected to the VWF protein, the heterologous moiety (HI), the VWF linker, or any combination thereof, .n one embodiment, the XTEN sequence connects the VWF protein with the VWF linker or the VWF linker with the heterologous moiety.
  • the chimeric molecule further comprises a second polypeptide chain which comprises a FVIII protein, wherein the first polypeptide chain and the second polypeptide chain are associated with each other.
  • the FVIII protein in the chimeric molecule further comprises an additional XTEN sequence.
  • the additional XTEN sequence can be linked to the N-terminus or the C- terminus of the FVIII protein or inserted between two FVIII amino acids adjacent to each other.
  • the second polypeptide chain further comprises a second heterologous moiety (H2).
  • the instant disclosure also includes a chimeric molecule comprising a first polypeptide chain which comprises a VWF protein, a heterologous moiety (HI), and a VWF linker connecting the VWF protein and the heterologous moiety (HI) and a second polypeptide chain comprising a FVIII protein and an XTEN sequence, wherein the VWF linker in the first polypeptide chain comprises: (i) an a2 region from FVIII; (ii) an al region from FVIII; (iii) an a3 region from r VIII; (iv) a thrombin cleavage site which comprises X-V-P-R (SEQ ID NO: 3) and a PARI exosite interaction motif, wherein X is an aliphatic amino acid; or (v) any combination thereof, and wherein the first polypeptide chain and the second polypeptide chain are associated with each other.
  • the VWF linker in the first polypeptide chain comprises: (i) an a2 region from FV
  • the XTEN sequence is connected to the N-terminus or the C-terminus of the FVIII protein or inserted between two FVIII amino acids adjacent to each other.
  • the chimeric molecule further comprises an additional XTEN sequence, which is connected to the VWF protein, the heterologous moiety, the VWF linker, or any combination thereof.
  • the chimeric molecule further comprises a second heterologous moiety (H2).
  • the second heterologous moiety is connected to the FVIII protein, the XTEN sequence, or both.
  • the XTEN sequence either connected to a VWF protein, a VWF linker, a FVIII protein, or any other components in the chimeric molecules, comprises about 42 amino acids, about 72 amino acids, about 108 amino acids, about 144 amino acids, about 180 amino acids, about 216 amino acids, about 252 amino acids, about 288 amino acids, about 324 amino acids, about 360 amino acids, about 396 amino acids, about 432 amino acids, about 468 amino acids, about 504 amino acids, about 540 amino acids, about 576 amino acids, about 612 amino acids, about 624 amino acids, about 648 amino acids, about 684 amino acids, about 720 amino acids, about 756 amino acids, about 792 amino acids, about 828 amino acids, about 836 amino acids, about 864 amino acids, about 875 amino acids, about 912 amino acids, about 923 amino acids, about 948 amino acids, about 1044 amino acids, about 1140 amino acids, about 1236 amino acids, about 1318 amino acids
  • the XTEN polypeptide is selected from AE42, AE72, AE864, AE576, AE288, AE144, AG864, AG576, AG288, or AG144.
  • the XTEN polypeptide is selected from SEQ ID NO: 39; SEQ ID NO: 40; SEQ ID NO: 47; SEQ ID NO: 45; SEQ ID NO: 44; SEQ ID NO: 41 ; SEQ ID NO: 48; SEQ ID NO: 46, SEQ ID NO: 44, or SEQ ID NO: 42.
  • the additional XTEN sequence in the chimeric molecules comprises about 42 amino acids, about 72 amino acids, about 108 amino acids, about 144 amino acids, about 180 amino acids, about 216 amino acids, about 252 amino acids, about 288 amino acids, about 324 amino acids, about 360 amino acids, about 396 amino acids, about 432 amino acids, about 468 amino acids, about 504 amino acids, about 540 amino acids, about 576 amino acids, about 612 amino acids, about 624 amino acids, about 648 amino acids, about 684 amino acids, about 720 amino acids, about 756 amino acids, about 792 amino acids, about 828 amino acids, about 836 amino acids, about 864 amino acids, about 875 amino acids, about 912 amino acids, about 923 amino acids, about 948 amino acids, about 1044 amino acids, about 1140 amino acids, about 1236 amino acids, about 1318 amino acids, about 1332 amino acids, about 1428 amino acids, about 1524 amino acids, about 1620 amino acids, about 1716 amino acids, about 1812 amino
  • the additional XTEN polypeptide is selected from AE42, AE72, AE864, AE576, AE288, AE144, AG864, AG576, AG288, or AG144.
  • the additional XTEN polypeptide is selected from SEQ ID NO: 39; SEQ ID NO: 40; SEQ ID NO: 47; SEQ ID NO: 45; SEQ ID NO: 43; SEQ ID NO: 41 ; SEQ ID NO: 48; SEQ ID NO: 46, SEQ ID NO: 44, or SEQ ID NO: 42.
  • the VWF linker useful for connecting a VWF protein and a heterologous moiety in the chimeric molecules comprises an a2 region which comprises an amino acid sequence at least about 80%, about 85%, about 90%, about 95%, or 100% identical to Glu720 to Arg740 corresponding to full-length FVIII, wherein the a2 region is capable of being cleaved by thrombin.
  • the a2 region comprises ISDKNTGDYYEDSYEDISAYLLSKNNAIEPRSFS (SEQ ID NO: 4).
  • the VWF linker useful for connecting a VWF protein and a heterologous moiety comprises an al region which comprises an amino acid sequence at least about 80%, about 85%, about 90%, about 95%, or 100% identical to Met337 to Arg372 corresponding to full-length FVIII, wherein the al region is capable of being cleaved by thrombin.
  • the al region comprises ISMKNNEEAEDYDDDLTDSEMDVVRFDDDNSPSFIQIRSV (SEQ ID NO: 5).
  • the VWF linker useful for connecting a VWF protein and a heterologous moiety comprises an a3 region which comprises an amino acid sequence at least about 80%, about 85%, about 90%, about 95%, or 100% identical to Glul649 to Argl689 corresponding to full-length FVIII, wherein the a3 region is capable of being cleaved by thrombin.
  • the a3 region comprises ISEITRTTLQSDQEEIDYDDTISVEMKKEDFDIYDEDENQSPRSFQ (SEQ ID NO: 6).
  • the VWF linker useful for connecting a VWF protein and a heterologous moiety comprises a thrombin cleavage site which comprises X-V-P-R (SEQ ID NO: 3) and a PARI exosite interaction motif and wherein the PARI exosite interaction motif comprises S-F-L-L-R-N (SEQ ID NO: 7).
  • the PARI exosite interaction motif further comprises a sequence selected from P, P-N, P-N-D, P-N-D-K (SEQ ID NO: 8), P-N-D-K-Y (SEQ ID NO: 9), P-N-D-K-Y-E (SEQ ID NO: 10), P-N-D-K- Y-E-P (SEQ ID NO: 11), P-N-D-K- Y-E-P-F (SEQ ID NO: 12), P-N-D-K- Y-E-P-F-W (SEQ ID NO: 13), P-N-D-K-Y-E-P-F-W-E (SEQ ID NO: 14), P-N-D-K-Y- E-P-F-W-E-D (SEQ ID NO: 20), P-N-D-K-Y-E-P-F-W-E-E (SEQ ID NO: 21), P-N-D-K-Y-E-P-F-W-E
  • the VWF linker comprises GGL VPRSFLLRNPNDK YEPF WEDEE S (SEQ ID NO: 24).
  • thrombin cleaves the VWF linker faster than thrombin would cleave the thrombin cleavage site if the thrombin cleavage site were substituted for the VWF linker in the chimeric molecule.
  • thrombin cleaves the VWF linker at least about 10 times, at least about 20 times, at least about 30 times, at least about 40 times, at least about 50 times, at least about 60 times, at least about 70 times, at least about 80 times, at least about 90 times or at least about 100 times faster than thrombin would cleave the thrombin cleavage site if the thrombin cleavage site were substituted for the VWF linker in the chimeric molecule.
  • the VWF linker further comprises one or more amino acids having a length of at least about 5, 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1200, 1400, 1600, 1800, or 2000 amino acids.
  • the one or more amino acids comprise a gly peptide.
  • the one or more amino acids comprise GlyGly.
  • the one or more amino acids comprise a gly/ser peptide.
  • the gly/ser peptide has a formula of (Gly 4 Ser)n or S(Gly 4 Ser)n, wherein n is a positive integer selected from 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 30, 40, 50, 60, 70, 80, or 100.
  • the (Gly 4 Ser)n linker is (Gly 4 Ser) 3 (SEQ ID NO: 89) or (Gly 4 Ser) 4 (SEQ ID NO: 90).
  • the VWF protein useful for the chimeric molecule of the invention can comprise the D' domain and D3 domain of VWF, wherein the D' domain and D3 domain are capable of binding to a FVIII protein.
  • the D' domain of the VWF protein comprises an amino acid sequence at least about 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical to amino acids 764 to 866 of SEQ ID NO: 2.
  • the D3 domain of the VWF protein comprises an amino acid sequence at least about 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical to amino acids 867 to 1240 of SEQ ID NO: 2.
  • the VWF protein contains at least one amino acid substitution at a residue corresponding to residue 1099, residue 1142, or both residues 1099 and 1142 of SEQ ID NO: 2.
  • an amino acid other than cysteine is substituted for a residue corresponding to residue 1099, residue 1142, or both residues 1099 and 1 142 of SEQ ID NO: 2.
  • the sequence of the VWF protein comprises amino acids 764 to 1240 of SEQ ID NO: 2.
  • the VWF protein further comprises the Dl domain, the D2 domain, or the Dl and D2 domains of VWF.
  • the VWF protein further comprises a VWF domain selected from the Al domain, the A2 domain, the A3 domain, the D4 domain, the Bl domain, the B2 domain, the B3 domain, the CI domain, the C2 domain, the CK domain, one or more fragments thereof, or any combinations thereof.
  • the VWF protein consists essentially of or consists of: (1) the D' and D3 domains of VWF or fragments thereof; (2) the Dl , D', and D3 domains of VWF or fragments thereof; (3) the D2, D', and D3 domains of VWF or fragments thereof; (4) the Dl, D2, D', and D3 domains of VWF or fragments thereof; or (5) the Dl, D2, D', D3, and Al domains of VWF or fragments thereof.
  • the VWF protein further comprises a signal peptide of VWF.
  • the VWF protein is pegylated, glycosylated, hesylated, or polysialylated.
  • pegylated refers to having polyethylene glycol (PEG) on the protein; the term “glycosylated” refers to having glycosylation on the protein; the term “hesylated” refers to having hydroxyethyl starch (HES) on the protein; and the term “polysialylated” refers to having polysialic acids (PSA) on the protein. Examples of PEG, HES, and PSA are shown elsewhere herein.
  • the heterologous moiety (HI) fused to the VWF protein via a VWF linker is capable of extending the half-life of the chimeric molecule.
  • the heterologous moiety (HI) comprises an immunoglobulin constant region or a portion thereof, albumin, albumin-binding moiety, PAS, HAP, transferrin or a fragment thereof, polyethylene glycol (PEG), hydroxyethyl starch (HES), PSA, the C- terminal peptide (CTP) of the ⁇ subunit of human chorionic gonadotropin, or any combination thereof.
  • the heterologous moiety comprises an FcRn binding partner.
  • the heterologous moiety comprises an Fc region.
  • the heterologous moiety (HI) comprises a clearance receptor, or fragment thereof, wherein the clearance receptor blocks binding of the FVIII protein to FVIII clearance receptors.
  • the clearance receptor is a low-density lipoprotein receptor-related protein 1 (LRP1) or FVIII-binding fragment thereof.
  • the second heterologous moiety fused to the FVIII protein via an optional FVIII linker comprises an immunoglobulin constant region or a portion thereof, albumin, albumin-binding polypeptide, PAS, the C-terminal peptide (CTP) of the ⁇ subunit of human chorionic gonadotropin, polyethylene glycol (PEG), hydroxyethyl starch (HES), albumin-binding small molecules, or any combinations thereof.
  • the second heterologous moiety (H2) is capable of extending the half-life of the FVIII protein.
  • the second heterologous moiety (H2) comprises a polypeptide, a non-polypeptide moiety, or both.
  • the second heterologous moiety comprises an immunoglobulin constant region or a portion thereof.
  • the second heterologous moiety comprises an FcRn binding partner.
  • the second heterologous moiety comprises a second Fc region.
  • the first heterologous moiety fused to the VWF protein via a VWF linker and the second heterologous moiety fused to the FVIII protein via an optional linker, in which an XTEN sequence is fused to any one of the components, are associated with each other.
  • the association between the first polypeptide chain and the second polypeptide is a covalent bond.
  • the association between the first heterologous moiety and the second heterologous moiety is a disulfide bond.
  • the first heterologous moiety is an FcRn binding partner and the second heterologous moiety is an FcRn binding partner.
  • the first heterologous moiety is an Fc region
  • the second heterologous moiety is an Fc region.
  • the FVIII protein is linked to the second heterologous moiety by a FVIII linker.
  • the second linker is a cleavable linker.
  • the FVIII linker is identical to the VWF linker. In other embodiments, the FVIII linker is different from the VWF linker.
  • a chimeric molecule of the invention comprises a formula selected from: (a) V-L1-X1-H1 :H2-L2-X2-C; (b) V-X1 -L1-H1 :H2-L2-X2-C; (c) V-Ll- X1-H1 :H2-X2-L2-C; (d) V-X1-L1-H1 :H2-X2-L2-C; (e) V-L1-X1-H1 : H2-L2-C(X2); (f) V-X1-L1-H1 :H2-L2-C(X2); (g) C-X2-L2-H2:H1-X1-L1-V; (h) C-X2-L2-H2:H1-L1-X1- V; (i) C-L2-X2-H2:H1-L1-X1-V; ) C-L2-X2-H2:H1-L1-X1-V; ) C-
  • a chimeric molecule comprises a formula selected from: (a) V-
  • the VWF protein can inhibit or prevent binding of endogenous VWF to the FVIII protein.
  • the FVIII protein in the chimeric molecules can comprise a third heterologous moiety (H3).
  • the third heterologous moiety (H3) can be an XTEN sequence.
  • the FVIII protein comprises a fourth heterologous moiety (H4).
  • the fourth heterologous moiety (H4) can be an XTEN sequence.
  • the FVIII protein comprises a fifth heterologous moiety (H5).
  • the fifth heterologous moiety can be an XTEN sequence.
  • the FVIII protein comprises the sixth heterologous moiety (H6).
  • the sixth heterologous moiety can be an XTEN sequence.
  • one or more of the third heterologous moiety (H3), the fourth heterologous moiety (H4), the fifth heterologous moiety (H5), and the sixth heterologous moiety (H6) are capable of extending the half-life of the chimeric molecule.
  • the third heterologous moiety (H3), the fourth heterologous moiety (H4), the fifth heterologous moiety (H5), and the sixth heterologous moiety (H6) are linked to the C terminus or N terminus of FVIII or inserted between two amino acids of the FVIII protein.
  • one or more of the third heterologous moiety, the fourth heterologous moiety, the fifth heterologous moiety, and the sixth heterologous moiety comprise a length selected from one or more of about 42 amino acids, about 72 amino acids, about 108 amino acids, about 144 amino acids, about 180 amino acids, about 216 amino acids, about 252 amino acids, about 288 amino acids, about 324 amino acids, about 360 amino acids, about 396 amino acids, about 432 amino acids, about 468 amino acids, about 504 amino acids, about 540 amino acids, about 576 amino acids, about 612 amino acids, about 624 amino acids, about 648 amino acids, about 684 amino acids, about 720 amino acids, about 756 amino acids, about 792 amino acids, about 828 amino acids, about 836 amino acids, about 864 amino acids, about 875 amino acids, about 912 amino acids, about 923 amino acids, about 948 amino acids, about 1044 amino acids, about 1140 amino acids, about 1236 amino acids, about 1318 amino acids, about 1332 amino
  • the XTEN sequence of the third heterologous moiety, the fourth heterologous moiety, the fifth heterologous moiety, or the sixth heterologous moiety can be selected from AE42, AE72, AE864, AE576, AE288, AE144, AG864, AG576, AG288, or AG144. More specifically, the XTEN sequence can be selected from SEQ ID NO: 39; SEQ ID NO: 40; SEQ ID NO: 47; SEQ ID NO: 45; SEQ ID NO: 43; SEQ ID NO: 41 ; SEQ ID NO: 48; SEQ ID NO: 46, SEQ ID NO: 44, or SEQ ID NO: 42.
  • the half-life of the chimeric molecule is extended at least about 1.5 times, at least about 2 times, at least about 2.5 times, at least about 3 times, at least about 4 times, at least about 5 times, at least about 6 times, at least about 7 times, at least about 8 times, at least about 9 times, at least about 10 times, at least about 11 times, or at least about 12 times longer than wild-type FVIII.
  • the instant disclosure also provides a polynucleotide or a set of polynucleotides encoding a chimeric molecule or a complementary sequence thereof.
  • the polynucleotide or the set of polynucleotides can further comprise a polynucleotide chain, which encodes PC5 or PC7.
  • vector or a set of vectors comprising the polynucleotide or the set of polynucleotides and one or more promoter operably linked to the polynucleotide or the set of polynucleotides.
  • the vector or the set of vectors can further comprises an additional polynucleotide chain encoding PC5 or PC7.
  • the present invention also includes a host cell comprising the polynucleotide or the set of the polynucleotides or the vector or the set of vectors.
  • the host cell is a mammalian cell.
  • the host cell is selected from a HEK293 cell, CHO cell, or BHK cell.
  • the invention includes a pharmaceutical composition comprising a chimeric molecule disclosed herein, the polynucleotide or the set of polynucleotides encoding the chimeric molecule, the vector or the set of vectors comprising the polynucleotide or the set of polynucleotides, or the host cell disclosed herein, and a pharmaceutically acceptable carrier.
  • the chimeric molecule in the composition has extended half-life compared to wild type FVIII protein.
  • the half-life of the chimeric molecule in the composition is extended at least about 1.5 times, at least about 2 times, at least about 2.5 times, at least about 3 times, at least about 4 times, at least about 5 times, at least about 6 times, at least about 7 times, at least about 8 times, at least about 9 times, at least about 10 times, at least about 11 times, or at least about 12 times longer than wild type FVIII.
  • a method of reducing a frequency or degree of a bleeding episode in a subject in need thereof comprising administering an effective amount of a chimeric molecule disclosed herein* the polynucleotide or the set of polynucleotides encoding the chimeric molecule, the vector or the set of vectors disclosed herein, the host cell disclosed herein, or the composition disclosed herein.
  • the invention also includes a method of preventing an occurrence of a bleeding episode in a subject in need thereof comprising administering an effective amount of a chimeric molecule disclosed herein, the polynucleotide or the set of polynucleotides encoding the chimeric molecule, the vector or the set of vectors disclosed herein, the host cell disclosed herein, or the composition disclosed herein.
  • the bleeding episode is from a bleeding coagulation disorder, hemarthrosis, muscle bleed, oral bleed, hemorrhage, hemorrhage into muscles, oral hemorrhage, trauma, trauma capitis, gastrointestinal bleeding, intracranial hemorrhage, intra-abdominal hemorrhage, intrathoracic hemorrhage, bone fracture, central nervous system bleeding, bleeding in the retropharyngeal space, bleeding in the retroperitoneal space, bleeding in the illiopsoas sheath, or any combinations thereof.
  • a bleeding coagulation disorder hemarthrosis, muscle bleed, oral bleed, hemorrhage, hemorrhage into muscles, oral hemorrhage, trauma, trauma capitis, gastrointestinal bleeding, intracranial hemorrhage, intra-abdominal hemorrhage, intrathoracic hemorrhage, bone fracture, central nervous system bleeding, bleeding in the retropharyngeal space, bleeding in the retroperitoneal space, bleeding
  • a chimeric molecule disclosed herein, the polynucleotide or the set of polynucleotides encoding the chimeric molecule, the vector or the set of vectors disclosed herein, the host cell disclosed herein, or the composition disclosed herein can be administered by a route selected from topical administration, intraocular administration, parenteral administration, intrathecal administration, subdural administration, oral administration, or any combinations thereof.
  • the instant disclosure also includes a method of making a chimeric molecule, comprising transfecting one or more host cell with a polynucleotide disclosed herein or a vector disclosed herein and expressing the chimeric molecule in the host cell.
  • the method further comprises isolating the chimeric molecule.
  • the FVIII activity of the chimeric molecule can be measured by aPTT assay or ROTEM assay.
  • FIG. 1 shows an exemplary diagram of a chimeric molecule (FVIII-XTEN/VWF heterodimer) comprising two polypeptide chains, the first chain comprising a VWF protein (e.g., a D' domain and a D3 domain of VWF) fused to an Fc region via a thrombin cleavable VWF linker and the second chain comprising a FVIII protein fused to a second Fc region via a FVIII linker.
  • the FVIII protein comprises one or more XTENs in various domains of FVIII.
  • VWF-031 comprises a linker of 48 amino acids comprising a thrombin cleavage site of L-V-P-R (SEQ ID NO: 25).
  • VWF-034 comprises an XTEN sequence having 288 amino acids and a linker of 35 amino acids comprising a thrombin cleavage site of L-V-P-R (SEQ ID NO: 25).
  • VWF-035 comprises a linker of 73 amino acids comprising a thrombin cleavage site of L-V-P-R (SEQ ID NO: 25).
  • VWF-036 comprises a linker of 98 amino acids comprising a thrombin cleavage site of L-V-P-R (SEQ ID NO: 25).
  • VWF-039 comprises a VWF linker of 26 amino acids comprising a thrombin cleavage site of L-V-P-R (SEQ ID NO: 25) and a PARI exosite interaction motif.
  • VWF- 051 comprises a linker of 54 amino acids comprising a thrombin cleavage site of A-L-R- P-R-V-V (SEQ ID NO: 26).
  • VWF-052 comprises a linker of 48 amino acids without any thrombin cleavage site (control).
  • VWF-054 comprises a VWF linker of 40 amino acids comprising an al region from FVIII.
  • VWF-055 comprises a VWF linker of 34 amino acids comprising an a2 region from FVIII.
  • VWF-056 comprises a VWF linker of 46 amino acids comprising an a3 region from FVIII.
  • FIG. 3A shows the rate of thrombin-mediated cleavage in units of resonance units per second (RU/s) as a function of capture density in units of RU for VWF-Fc fusion constructs, i.e., VWF-031, VWF-034, VWF-036, VWF-039, VWF-051, and VWF-052.
  • FIG. 3B shows the rate of thrombin-mediated cleavage in units of resonance units per second (RU/s) as a function of capture density in units of RU for VWF-Fc fusion constructs, i.e., VWF-031, VWF-034, VWF-036, VWF-051, and VWF-052.
  • each VWF-Fc fusion construct was captured at various densities and subsequently exposed to a fixed concentration of human alpha-thrombin.
  • the slope of each curve in FIG. 3 A and FIG. 3B directly reflect the susceptibility to thrombin cleavage for each construct.
  • FIG. 4A shows the rate of thrombin-mediated cleavage in units of resonance units per second (RU/s) as a function of capture density in units of RU for VWF-Fc fusion constructs, i.e., VWF-054, VWF-055, and VWF-056.
  • FIG. 4B shows the rate of thrombin-mediated cleavage in units of resonance units per second (RU/s) as a function of capture density in units of RU for VWF-Fc fusion constructs, i.e., VWF-031, VWF- 039, VWF-054, VWF-055, and VWF-056.
  • each VWF-Fc fusion construct was captured at various densities and subsequently exposed to a fixed concentration of human alpha-thrombin.
  • the slopes of each curve in FIG. 4A and FIG. 4B directly reflect the susceptibility to thrombin cleavage for each construct.
  • FIG. 5 shows the results of a linear regression analysis to determine the susceptibility of various VWF-Fc constructs, VWF-031 , VWF-034, VWF-036, VWF- 039, VWF-051 , VWF-052, VWF-054, VWF-055, and VWF-056, to thrombin-mediated cleavage. Values are expressed in units of inverse seconds and reflect the slopes of the curves presented in FIG. 3 and FIG. 4. The relative susceptibility of two different constructs is derived from the quotient of their respective slopes.
  • Slope V wF-039/slopevwF- 03 ⁇ is 71, indicating that VWF-Fc fusion construct VWF-039 is 71 -fold more susceptible to thrombin-mediated cleavage than is VWF-031.
  • SlopevwF-05 5 /slopevwF-03i is 65, and slope V wF-o 5 i/slope V wF-03i is 1.8.
  • FIG. 6 shows clotting time of various chimeric molecules in a HemA patient measured by whole blood ROTEM assay.
  • FVIII 55 /VWF-031 comprises two polypeptide chains, the first chain comprising BDD FVIII fused to an Fc region and the second chain comprising a D' domain and a D3 domain of VWF fused to an Fc region via a minimal thrombin cleavage site (i.e., L-V-P-R (SEQ ID NO: 25)).
  • FVIII 55 /VWF-039 comprises two polypeptide chains, the first chain comprising BDD FVIII fused to an Fc region and the second chain comprising a D' domain and a D3 domain of VWF fused to an Fc region via a VWF linker comprising L-V-P-R (SEQ ID NO: 25) and a PARI exosite interaction motif.
  • FVIII 55/VWF-055 comprises two polypeptide chains, the first chain comprising BDD FVIII fused to an Fc region and the second chain comprising a D' domain and a D3 domain of VWF fused to an Fc region via a VWF linker comprising an a2 region from FVIII.
  • FIG. 7 shows a diagram of representative FVIII-VWF heterodimer and F Villi 69
  • FVIII 169 construct comprises a B domain deleted ' VlII protein with R1648A substitution fused to an Fc region, wherein an XTEN sequence (e.g., AE288) is inserted at amino acid 745 corresponding to mature full length FVIII (Al-al-A2-a2-288XTEN-a3-A3-Cl-C2-Fc).
  • FVIII286 construct comprises a B domain deleted FVIII protein with R1648 substitution fused to an Fc region, wherein an XTEN sequence (e.g., AE288) is inserted at amino acid 745 corresponding to mature full length FVIII, with additional a2 region in between FVIII and Fc (Al -al-A2-a2-288XTEN-a3-A3-Cl-C2-a2-Fc).
  • an XTEN sequence e.g., AE288
  • VWF057 is a VWF-Fc fusion construct that comprises D'D3 domain of the VWF protein (with two amino acid substitutions in D'D3 domain, i.e., C336A and C379A) linked to the Fc region via a VWF linker, which comprises LVPR thrombin site ("LVPR") and GS linker ("GS"), wherein an XTEN sequence (i.e., 144XTEN) is inserted between D'D3 domain and the VWF linker (D'D3-144XTEN-GS+LVPR-Fc).
  • LVPR LVPR thrombin site
  • GS GS linker
  • VWF059 is a VWF-Fc fusion construct that comprises D'D3 domain of the VWF protein (with two amino acid substitutions in D'D3 domain, i.e., C336A and C379A) linked to the Fc region via an acidic region 2 (a2) region as a VWF linker, wherein an XTEN sequence is inserted between D'D3 domain and the VWF linker.
  • VWF062 is a VWF-Fc fusion construct that comprises D'D3 domain of the VWF protein (with two amino acid substitutions in D'D3 domain, i.e., C336A and C379A) linked to the Fc region, wherein an XTEN sequence is inserted between D'D3 domain and the Fc region (D'D3-144XTEN-Fc).
  • FIG. 8 shows acute efficacy of FVIII-XTEN-Fc/D'D3-Linker-Fc heterodimers
  • FVIII 169/VWF034, FVIII169/VWF059, and FVIII169/VWF057 compared to B domain deleted FVIII ("SQ BDD FVIII" or "BDD-rFVIII" or vehicle control in HemA mice tail clip model.
  • BDD-rFVIII is shown as circle while FVIH1.69/VWF034 is shown as square, FVIII169/VWF059 is shown as triangle, FVffll69/VWF057 is shown as hollow circle, and vehicle is shown as inverted triangle.
  • VWF034 is a VWF-Fc fusion construct that comprises a D' domain and a D3 domain of VWF fused an Fc region via a VWF linker, which comprises LVPR, wherein an XTEN sequence (i.e., 288XTEN) is inserted between D'D3 domain and the VWF linker (D'D3-288XTEN-LVPR-Fc).
  • XTEN sequence i.e., 288XTEN
  • the construct details of FVIII 169, VWF059, and VWF057 are shown elsewhere herein.
  • the median blood loss (uL) of mice after dosing of 75 IU/kg of the construct in each treatment groups are indicated by the horizontal lines.
  • the present invention is directed to a chimeric molecule comprising an XTEN sequence and a thrombm cleavable linker connecting a VWF protein or a FVIII protein with a heterologous moiety, e.g., a half-life extending moiety.
  • the invention also provides a chimeric molecule comprising two polypeptide chains, the first chain comprising a VWF protein fused to a heterologous moiety, and a second chain comprising a FVIII protein and a second heterologous moiety, wherein the chimeric molecule comprises an XTEN sequence in the first or second polypeptide chains and wherein either the VWF protein or the FVIII protein (or both) is fused to the heterologous moiety via a VWF linker or a FVIII linker (or both).
  • the thrombin cleavable linker VWF linker or FVIII linker
  • VWF linker or FVIII linker can be cleaved efficiently by thrombin at the site of injury where thrombin is readily available.
  • chimeric molecules are illustrated in the instant description and figures.
  • the invention pertains to chimeric molecules having the structures set forth, for example, in FIGS. 1 to 7.
  • the invention pertains to polynucleotide encoding chimeric molecule constructs disclosed herein.
  • a or “an” entity refers to one or more of that entity; for example, “a nucleotide sequence,” is understood to represent one or more nucleotide sequences.
  • the terms “a” (or “an”), “one or more,” and “at least one” can be used interchangeably herein.
  • polynucleotide or “nucleotide” is intended to encompass a singular nucleic acid as well as plural nucleic acids, and refers to an isolated nucleic acid molecule or construct, e.g., messenger RNA (mR A) or plasmid DNA (pDNA).
  • a polynucleotide comprises a conventional phosphodiester bond or a non- conventional bond (e.g., an amide bond, such as found in peptide nucleic acids (PNA)).
  • PNA peptide nucleic acids
  • nucleic acid refers to any one or more nucleic acid segments, e.g., DNA or RNA fragments, present in a polynucleotide.
  • isolated nucleic acid or polynucleotide is intended a nucleic acid molecule, DNA or RNA, which has been removed from its native environment.
  • a recombinant polynucleotide encoding a Factor VIII polypeptide contained in a vector is considered isolated for the purposes of the present invention.
  • Further examples of an isolated polynucleotide include recombinant polynucleotides maintained in heterologous host cells or purified (partially or substantially) from other polynucleotides in a solution.
  • Isolated RNA molecules include in vivo or in vitro RNA transcripts of polynucleotides of the present invention.
  • Isolated polynucleotides or nucleic acids according to the present invention further include such molecules produced synthetically.
  • a polynucleotide or a nucleic acid can include regulatory elements such as promoters, enhancers, ribosome binding sites, or transcription termination signals.
  • a "coding region” or “coding sequence” is a portion of polynucleotide which consists of codons translatable into amino acids.
  • a “stop codon” (TAG, TGA, or TAA) is typically not translated into an amino acid, it may be considered to be part of a coding region, but any flanking sequences, for example promoters, ribosome binding sites, transcriptional terminators, introns, and the like, are not part of a coding region.
  • coding region typically determined by a start codon at the 5' terminus, encoding the amino terminus of the resultant polypeptide, and a translation stop codon at the 3 'terminus, encoding the carboxyl terminus of the resulting polypeptide.
  • Two or more coding regions of the present invention can be present in a single polynucleotide construct, e.g., on a single vector, or in separate polynucleotide constructs, e.g., on separate (different) vectors.
  • a single vector can contain just a single coding region, or comprise two or more coding regions, e.g., a single vector can separately encode a first polypeptide chain and a second polypeptide chain of a chimeric molecule as described below.
  • a vector, polynucleotide, or nucleic acid of the invention can encode heterologous coding regions, either fused or unfused to a nucleic acid encoding a chimeric molecule of the invention.
  • Heterologous coding regions include without limitation specialized elements or motifs, such as a secretory signal peptide or a heterologous functional domain.
  • Certain proteins secreted by mammalian cells are associated with a secretory signal peptide which is cleaved from the mature protein once export of the growing protein chain across the rough endoplasmic reticulum has been initiated.
  • signal peptides are generally fused to the N- terminus of the polypeptide, and are cleaved from the complete or "full-length" polypeptide to produce a secreted or "mature" form of the polypeptide.
  • a native signal peptide e.g., a FVIII signal peptide or a VWF signal peptide is used, or a functional derivative of that sequence that retains the ability to direct the secretion of the polypeptide that is operably associated with it.
  • a heterologous mammalian signal peptide e.g., a human tissue plasminogen activator (TP A) or mouse ⁇ -glucuronidase signal peptide, or a functional derivative thereof, can be used.
  • downstream refers to a nucleotide sequence that is located 3' to a reference nucleotide sequence.
  • downstream nucleotide sequences relate to sequences that follow the starting point of transcription. For example, the translation initiation codon of a gene is located downstream of the start site of transcription.
  • upstream refers to a nucleotide sequence that is located 5' to a reference nucleotide sequence.
  • upstream nucleotide sequences relate to sequences that are located on the 5' side of a coding region or starting point of transcription. For example, most promoters are located upstream of the start site of transcription.
  • regulatory region refers to nucleotide sequences located upstream (5' non-coding sequences), within, or downstream (3' non-coding sequences) of a coding region, and which influence the transcription, RNA processing, stability, or translation of the associated coding region. Regulatory regions may include promoters, translation leader sequences, introns, polyadenylation recognition sequences, RNA processing sites, effector binding sites and stem-loop structures. If a coding region is intended for expression in a eukaryotic cell, a polyadenylation signal and transcription termination sequence will usually be located 3' to the coding sequence.
  • a polynucleotide which encodes a gene product can include a promoter and/or other transcription or translation control elements operably associated with one or more coding regions.
  • a coding region for a gene product e.g., a polypeptide
  • a coding region and a promoter are "operably associated" if induction of promoter function results in the transcription of mRNA encoding the gene product encoded by the coding region, and if the nature of the linkage between the promoter and the coding region does not interfere with the ability of the promoter to direct the expression of the gene product or interfere with the ability of the DMA template to be transcribed.
  • Other transcription control elements besides a promoter, for example enhancers, operators, repressors, and transcription termination signals, can also be operably associated with a coding region to direct gene product expression.
  • transcription control regions which function in vertebrate cells, such as, but not limited to, promoter and enhancer segments from cytomegaloviruses (the immediate early promoter, in conjunction with intron-A), simian virus 40 (the early promoter), and retroviruses (such as Rous sarcoma virus).
  • Other transcription control regions include those derived from vertebrate genes such as actin, heat shock protein, bovine growth hormone and rabbit B-globin, as well as other sequences capable of controlling gene expression in eukaryotic cells. Additional suitable transcription control regions include tissue-specific promoters and enhancers as well as lymphokine-inducible promoters (e.g., promoters inducible by interferons or interleukins).
  • translation control elements are known to those of ordinary skill in the art. These include, but are not limited to ribosome binding sites, translation initiation and termination codons, and elements derived from picornaviruses (particularly an internal ribosome entry site, or IRES, also referred to as a CITE sequence).
  • IRES internal ribosome entry site
  • expression refers to a process by which a polynucleotide produces a gene product, for example, an RNA or a polypeptide.
  • RNA messenger RNA
  • tRNA transfer RNA
  • shRNA small hairpin RNA
  • siRNA small interfering RNA
  • expression produces a "gene product.”
  • a gene product can be either a nucleic acid, e.g., a messenger RNA produced by transcription of a gene, or a polypeptide which is translated from a transcript.
  • Gene products described herein further include nucleic acids with post transcriptional modifications, e.g., polyadenylation or splicing, or polypeptides with post translational modifications, e.g., methylation, glycosylation, the addition of lipids, association with other protein subunits, or proteolytic cleavage.
  • post transcriptional modifications e.g., polyadenylation or splicing
  • polypeptides with post translational modifications e.g., methylation, glycosylation, the addition of lipids, association with other protein subunits, or proteolytic cleavage.
  • a "vector” refers to any vehicle for the cloning of and/or transfer of a nucleic acid into a host cell.
  • a vector may be a replicon to which another nucleic acid segment may be attached so as to bring about the replication of the attached segment.
  • a "replicon” refers to any genetic element (e.g., plasmid, phage, cosmid, chromosome, virus) that functions as an autonomous unit of replication in vivo, i.e., capable of replication under its own control.
  • the term “vector” includes both viral and nonviral vehicles for introducing the nucleic acid into a cell in vitro, ex vivo or in vivo.
  • Plasmids A large number of vectors are known and used in the art including, for example, plasmids, modified eukaryotic viruses, or modified bacterial viruses. Insertion of a polynucleotide into a suitable vector can be accomplished by ligating the appropriate polynucleotide fragments into a chosen vector that has complementary cohesive termini.
  • Vectors may be engineered to encode selectable markers or reporters that provide for the selection or identification of cells that have incorporated the vector. Expression of selectable markers or reporters allows identification and/or selection of host cells that incorporate and express other coding regions contained on the vector.
  • selectable marker genes known and used in the art include: genes providing resistance to ampicillin, streptomycin, gentamycin, kanamycin, hygromycin, bialaphos herbicide, sulfonamide, and the like; and genes that are used as phenotypic markers, i.e., anthocyanin regulatory genes, isopentanyl transferase gene, and the like.
  • reporters known and used in the art include: luciferase (Luc), green fluorescent protein (GFP), chloramphenicol acetyltransferase (CAT), -galactosidase (LacZ), -glucuronidase (Gus), and the like. Selectable markers may also be considered to be reporters.
  • Plasmid refers to an extra-chromosomal element often carrying a gene that is not part of the central metabolism of the cell, and usually in the form of circular double-stranded DNA molecules.
  • Such elements may be autonomously replicating sequences, genome integrating sequences, phage or nucleotide sequences, linear, circular, or supercoiled, of a single- or double-stranded DNA or RNA, derived from any source, in which a number of nucleotide sequences have been joined or recombined into a unique construction which is capable of introducing a promoter fragment and DNA sequence for a selected gene product along with appropriate 3' untranslated sequence into a cell.
  • Eukaryotic viral vectors that can be used include, but are not limited to, adenovirus vectors, retrovirus vectors, adeno-associated virus vectors, poxvirus, e.g., vaccinia virus vectors, baculovirus vectors, or herpesvirus vectors.
  • Non-viral vectors include plasmids, liposomes, electrically charged lipids (cytofectins), DNA-protein complexes, and biopolymers.
  • a "cloning vector” refers to a "replicon,” which is a unit length of a nucleic acid that replicates sequentially and which comprises an origin of replication, such as a plasmid, phage or cosmid, to which another nucleic acid segment may be attached so as to bring about the replication of the attached segment.
  • Certain cloning vectors are capable of replication in one cell type, e.g., bacteria and expression in another, e.g., eukaryotic cells.
  • Cloning vectors typically comprise one or more sequences that can be used for selection of cells comprising the vector and/or one or more multiple cloning sites for insertion of nucleic acid sequences of interest.
  • expression vector refers to a vehicle designed to enable the expression of an inserted nucleic acid sequence following insertion into a host cell.
  • the inserted nucleic acid sequence is placed in operable association with regulatory regions as described above.
  • Vectors are introduced into host cells by methods well known in the art, e.g., transfection, electroporation, microinjection, transduction, cell fusion, DEAE dextran, calcium phosphate precipitation, lipofection (lysosome fusion), use of a gene gun, or a DNA vector transporter.
  • “Culture,” “to culture” and “culturing,” as used herein, means to incubate cells under in vitro conditions that allow for cell growth or division or to maintain cells in a living state.
  • “Cultured cells” means cells that are propagated in vitro.
  • polypeptide is intended to encompass a singular
  • polypeptide as well as plural “polypeptides,” and refers to a molecule composed of monomers (amino acids) linearly linked by amide bonds (also known as peptide bonds).
  • polypeptide refers to any chain or chains of two or more amino acids, and does not refer to a specific length of the product.
  • peptides, dipeptides, tripeptides, oligopeptides, "protein,” “amino acid chain,” or any other term used to refer to a chain or chains of two or more amino acids are included within the definition of "polypeptide,” and the term “polypeptide” can be used instead of, or interchangeably with any of these terms.
  • polypeptide is also intended to refer to the products of post-expression modifications of the polypeptide, including without limitation glycosylation, acetylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, or modification by non-naturally occurring amino acids.
  • a polypeptide can be derived from a natural biological source or produced recombinant technology, but is not necessarily translated from a designated nucleic acid sequence. It can be generated in any manner, including by chemical synthesis.
  • an "isolated" polypeptide or a fragment, variant, or derivative thereof refers to a polypeptide that is not in its natural milieu. No particular level of purification is required. For example, an isolated polypeptide can simply be removed from its native or natural environment. Recombinantly produced polypeptides and proteins expressed in host cells are considered isolated for the purpose of the invention, as are native or recombinant polypeptides which have been separated, fractionated, or partially or substantially purified by any suitable technique.
  • fragments or variants of polypeptides are also included in the present invention.
  • fragments or variants of polypeptides include any polypeptides which retain at least some of the properties (e.g., FcRn binding affinity for an FcRn binding domain or Fc variant, coagulation activity for an FVIII variant, or FVIII binding activity for the VWF protein) of the reference polypeptide.
  • Fragments of polypeptides include proteolytic fragments, as well as deletion fragments, in addition to specific antibody fragments discussed elsewhere herein, but do not include the naturally occurring full-length polypeptide (or mature polypeptide).
  • Variants of polypeptide binding domains or binding molecules of the present invention include fragments as described above, and also polypeptides with altered amino acid sequences due to amino acid substitutions, deletions, or insertions. Variants can be naturally or non-naturally occurring. Non-naturally occurring variants can be produced using art-known mutagenesis techniques. Variant polypeptides can comprise conservative or non- conservative amino acid substitutions, deletions or additions.
  • VWF fragment or "VWF fragments” used herein means any VWF fragments that interact with FVIII and retain at least one or more properties that are normally provided to FVIII by full-length VWF, e.g., preventing premature activation to FVIIIa, preventing premature proteolysis, preventing association with phospholipid membranes that could lead to premature clearance, preventing binding to FVIII clearance receptors that can bind naked FVIII but not VWF-bound FVIII, and/or stabilizing the FVIII heavy chain and light chain interactions.
  • the "VWF fragment" as used herein comprises a D' domain and a D3 domain of the VWF protein, but does not include the Al domain, the A2 domain, the A3 domain, the D4 domain, the Bl domain, the B2 domain, the B3 domain, the CI domain, the C2 domain, and the CK domain of the VWF protein.
  • half-life limiting factor or "FVIII half-life limiting factor” as used herein indicates a factor that prevents the half-life of a FVIII protein from being longer than 1.5 fold or 2 fold compared to wild-type FVIII (e.g., ADVATE ® or REFACTO ® ).
  • full length or mature VWF can act as a FVIII half-life limiting factor by inducing the FVIII and VWF complex to be cleared from system by one or more VWF clearance pathways.
  • endogenous VWF is a FVIII half-life limiting factor.
  • a full-length recombinant VWF molecule non-covalently bound to a FVIII protein is a FVIII-half-life limiting factor.
  • endogenous VWF indicates VWF molecules naturally present in plasma.
  • the endogenous VWF molecule can be multimer, but can be a monomer or a dimer. Endogenous VWF in plasma binds to FVIif and forms a non- covalent complex with FVIII.
  • a "conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain.
  • Families of amino acid residues having similar side chains have been defined in the art, including basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g.
  • a string of amino acids can be conservatively replaced with a structurally similar string that differs in order and/or composition of side chain family members.
  • sequence identity between two polypeptides is determined by comparing the amino acid sequence of one polypeptide to the sequence of a second polypeptide.
  • sequence identity is determined by comparing the amino acid sequence of one polypeptide to the sequence of a second polypeptide.
  • whether any particular polypeptide is at least about 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identical to another polypeptide can be determined using methods and computer programs/software known in the art such as, but not limited to, the BESTFIT program (Wisconsin Sequence Analysis Package, Version 8 for Unix, Genetics Computer Group, University Research Park, 575 Science Drive, Madison, WI 5371 1).
  • BESTFIT uses the local homology algorithm of Smith and Waterman, Advances in Applied Mathematics 2:482-489 (1981), to find the best segment of homology between two sequences.
  • the parameters are set, of course, such that the percentage of identity is calculated over the full-length of the reference polypeptide sequence and that gaps in homology of up to 5% of the total number of amino acids in the reference sequence are allowed.
  • an "amino acid corresponding to" or an "equivalent amino acid" in a VWF sequence or a FVIII protein sequence is identified by alignment to maximize the identity or similarity between a first VWF or FVIII sequence and a second VWF or FVIII sequence.
  • the number used to identify an equivalent amino acid in a second VWF or FVIII sequence is based on the number used to identify the corresponding amino acid in the first VWF or FVIII sequence.
  • a "fusion" or “chimeric” molecule comprises a first amino acid sequence linked to a second amino acid sequence with which it is not naturally linked in nature.
  • the amino acid sequences which normally exist in separate proteins can be brought together in the fusion polypeptide, or the amino acid sequences which normally exist in the same protein can be placed in a new arrangement in the fusion polypeptide, e.g., fusion of a Factor VIII domain of the invention with an immunoglobulin Fc domain.
  • a fusion protein is created, for example, by chemical synthesis, or by creating and translating a polynucleotide in which the peptide regions are encoded in the desired relationship.
  • a chimeric protein can further comprises a second amino acid sequence associated with the first amino acid sequence by a covalent, non-peptide bond or a non-covalent bond.
  • half-life refers to a biological half-life of a particular polypeptide in vivo.
  • Half-life may be represented by the time required for half the quantity administered to a subject to be cleared from the circulation and/or other tissues in the animal.
  • a clearance curve of a given polypeptide is constructed as a function of time, the curve is usually biphasic with a rapid a-phase and longer ⁇ -phase.
  • the a-phase typically represents an equilibration of the administered polypeptide between the intra- and extra-vascular space and is, in part, determined by the size of the polypeptide.
  • the ⁇ - phase typically represents the catabolism of the polypeptide in the intravascular space.
  • chimeric molecule of the invention are monophasic, and thus do not have an alpha phase, but just the single beta phase. Therefore, in certain embodiments, the term half-life as used herein refers to the half-life of the polypeptide in the ⁇ -phase. The typical ⁇ phase half-life of a human antibody in humans is 21 days.
  • heterologous as applied to a polynucleotide or a polypeptide, means that the polynucleotide or polypeptide is derived from a distinct entity from that of the entity to which it is being compared. Therefore, a heterologous polypeptide linked to a VWF protein means a polypeptide chain that is linked to a VWF protein and is not a naturally occurring part of the VWF protein. For instance, a heterologous polynucleotide or antigen can be derived from a different species, different cell type of an individual, or the same or different type of cell of distinct individuals.
  • linked refers to a first amino acid sequence or nucleotide sequence joined to a second amino acid sequence or nucleotide sequence (e.g., via a peptide bond or a phosphodiester bond, respectively).
  • covalently linked refers to a covalent bond, e.g., a disulfide bond, a peptide bond, or one or more amino acids, e.g., a linker, between the two moieties that are linked together.
  • the first amino acid or nucleotide sequence can be directly joined to the second amino acid or nucleotide sequence or alternatively an intervening sequence can join the first sequence to the second sequence.
  • the term "linked,” “fused,” or “connected” means not only a fusion of a first amino acid sequence to a second amino acid sequence at the C-terminus or the N-terminus, but also includes insertion of the whole first amino acid sequence (or the second amino acid sequence) into any two amino acids in the second amino acid sequence (or the first amino acid sequence, respectively).
  • the first amino acid sequence can be joined to a second amino acid sequence by a peptide bond or a linker.
  • the first nucleotide sequence can be joined to a second nucleotide sequence by a phosphodiester bond or a linker.
  • the linker can be a peptide or a polypeptide (for polypeptide chains) or a nucleotide or a nucleotide chain (for nucleotide chains) or any chemical moiety (for both polypeptide and polynucleotide chains).
  • the covalent linkage is sometimes indicated as (-) or hyphen.
  • association with refers to a covalent or non-covalent bond formed between a first amino acid chain and a second amino acid chain.
  • the term “associated with” means a covalent, non-peptide bond or a non- covalent bond. In some embodiments this association is indicated by a colon, i.e., (:). In another embodiment, it means a covalent bond except a peptide bond.
  • the term "covalently associated” as used herein means an association between two moieties by a covalent bond, e.g., a disulfide bond, a peptide bond, or one or more amino acids (e.g., a linker).
  • the amino acid cysteine comprises a thiol group that can form a disulfide bond or bridge with a thiol group on a second cysteine residue.
  • the CHI and CL regions are associated by a disulfide bond and the two heavy chains are associated by two disulfide bonds at positions coiTesponding to 239 and 242 using the Kabat numbering system (position 226 or 229, EU numbering system).
  • covalent bonds include, but are not limited to, a peptide bond, a metal bond, a hydrogen bond, a disulfide bond, a sigma bond, a pi bond, a delta bond, a glycosidic bond, an agnostic bond, a bent bond, a dipolar bond, a Pi backbond, a double bond, a triple bond, a quadruple bond, a quintuple bond, a sextuple bond, conjugation, hyperconjugation, aromaticity, hapticity, or antibonding.
  • Non-limiting examples of non-covalent bond include an ionic bond (e.g., cation-pi bond or salt bond), a metal bond, an hydrogen bond (e.g., dihydrogen bond, dihydrogen complex, low-barrier hydrogen bond, or symmetric hydrogen bond), van der Walls force, London dispersion force, a mechanical bond, a halogen bond, aurophilicity, intercalation, stacking, entropic force, or chemical polarity.
  • an ionic bond e.g., cation-pi bond or salt bond
  • a metal bond e.g., an hydrogen bond (e.g., dihydrogen bond, dihydrogen complex, low-barrier hydrogen bond, or symmetric hydrogen bond), van der Walls force, London dispersion force, a mechanical bond, a halogen bond, aurophilicity, intercalation, stacking, entropic force, or chemical polarity.
  • cleavage site refers to a site recognized by an enzyme.
  • a polypeptide has an enzymatic cleavage site cleaved by an enzyme that is activated during the clotting cascade, such that cleavage of such sites occurs at the site of clot formation.
  • a FVIII linker connecting a FVIII protein and a second heterologous moiety can comprise a cleavage site. Exemplary such sites include e.g., those recognized by thrombin, Factor XIa or Factor Xa.
  • Exemplary FXIa cleavage sites include, e.g, TQSFNDFTR (SEQ ID NO: 27) and SVSQTSKLTR (SEQ ID NO: 28).
  • Exemplary thrombin cleavage sites include, e.g, DFLAEGGGVR (SEQ ID NO: 29), TTKIKPR (SEQ ID NO: 30), LVPRG (S£Q iD NO: 31) and ALRPR (amino acids 1 to 5 of SEQ ID NO: 26).
  • Other enzymatic cleavage sites are known in the art.
  • a cleavage site that can be cleaved by thrombin is referred to herein as "thrombin cleavage site.”
  • processing site refers to a type of enzymatic cleavage site in a polypeptide which is the target for enzymes that function after translation of the polypeptide. In one embodiment, such enzymes function during transport from the Golgi lumen to the trans-Golgi compartment. Intracellular processing enzymes cleave polypeptides prior to secretion of the protein from the cell. Examples of such processing sites include, e.g., those targeted by the PACE/furin (where PACE is an acronym for Paired basic Amino acid Cleaving Enzyme) family of endopeptidases.
  • the "funn" family of enzymes includes, e.g., PCSK1 (also known as PCl/Pc3), PCSK2 (also known as PC2), PCSK3 (also known as furin or PACE), PCSK4 (also known as PC4), PCSK5 (also known as PC5 or PC6), PCSK6 (also known as PACE4), or PCS 7 (also known as PC7/LPC, PC8, or SPC7).
  • PCSK1 also known as PCl/Pc3
  • PCSK2 also known as PC2
  • PCSK3 also known as furin or PACE
  • PCSK4 also known as PC4
  • PCSK5 also known as PC5 or PC6
  • PCS 7 also known as PC7/LPC, PC8, or SPC7.
  • PC7/LPC PC8, or SPC7
  • Furin refers to the enzymes corresponding to EC No. 3.4.21.75.
  • Furin is subtilisin-like proprotein convertase, which is also known as PACE (Paired basic Amino acid Cleaving Enzyme). Furin deletes sections of inactive precursor proteins to convert them into biologically active proteins. During its intracellular transport, pro-peptide is cleaved from mature VWF molecule by a furin enzyme in the Golgi.
  • constructs that include more than one processing or cleavage site it will be understood that such sites may be the same or different.
  • Hemostatic disorder means a genetically inherited or acquired condition characterized by a tendency to hemorrhage, either spontaneously or as a result of trauma, due to an impaired ability or inability to form a fibrin clot. Examples of such disorders include the hemophilias. The three main forms are hemophilia A (factor VIII deficiency), hemophilia B (factor IX deficiency or "Christmas disease”) and hemophilia C (factor XI deficiency, mild bleeding tendency).
  • factor VIII deficiency factor VIII deficiency
  • hemophilia B factor IX deficiency or "Christmas disease”
  • hemophilia C factor XI deficiency, mild bleeding tendency
  • hemostatic disorders include, e.g., von Willebrand disease, Factor XI deficiency (PTA deficiency), Factor XII deficiency, deficiencies or structural abnormalities in fibrinogen, prothrombin, Factor V, Factor VII, Factor X or factor XIII, Bernard-Soulier syndrome, which is a defect or deficiency in GPIb.
  • PTA deficiency Factor XI deficiency
  • Factor XII deficiency deficiencies or structural abnormalities in fibrinogen
  • prothrombin Factor V
  • Factor VII Factor VII
  • Factor X or factor XIII Bernard-Soulier syndrome
  • GPIb the receptor for VWF
  • GPIb the receptor for VWF
  • the chimeric molecules of the invention can be used prophylactically.
  • prophylactic treatment refers to the administration of a molecule prior to a bleeding episode.
  • the subject in need of a general hemostatic agent is undergoing, or is about to undergo, surgery.
  • the chimeric protein of the invention can be administered prior to or after surgery as a prophylactic.
  • the chimeric protein of the invention can be administered during or after surgery to control an acute bleeding episode.
  • the surgery can include, but is not limited to, liver transplantation, liver resection, dental procedures, or stem cell transplantation.
  • the chimeric molecule of the invention is also used for on-demand (also referred to as "episodic") treatment.
  • on-demand treatment or “episodic treatment” refers to the administration of a chimeric molecule in response to symptoms of a bleeding episode or before an activity that may cause bleeding.
  • the on-demand (episodic) treatment can be given to a subject when bleeding starts, such as after an injury, or when bleeding is expected, such as before surgery.
  • the on- demand treatment can be given prior to activities that increase the risk of bleeding, such as contact sports.
  • acute bleeding refers to a bleeding episode regardless of the underlying cause.
  • a subject may have trauma, uremia, a hereditary bleeding disorder (e.g., factor VII deficiency) a platelet disorder, or resistance owing to the development of antibodies to clotting factors.
  • Treat, treatment, treating, as used herein refers to, e.g., the reduction in severity of a disease or condition; the reduction in the duration of a disease course; the amelioration of one or more symptoms associated with a disease or condition; the provision of beneficial effects to a subject with a disease or condition, without necessarily curing the disease or condition, or the prophylaxis of one or more symptoms associated with a disease or condition.
  • the term "treating" or "treatment” means maintaining a FVIII trough level at least about 1 IU/dL, 2 IU/dL, 3 IU/dL, 4 IU/dL, 5 IU/dL, 6 IU/dL, 7 IU/dL, 8 IU/dL, 9 IU/dL, 10 IU/dL, 11 IU/dL, 12 IU/dL, 13 IU/dL, 14 IU/dL, 15 IU/dL, 16 IU/dL, 17 IU/dL, 18 IU/dL, 19 IU/dL, or 20 IU/dL in a subject by administering a chimeric molecule of the invention.
  • treating or treatment means maintaining a FVIII trough level between about 1 and about 20 IU/dL, about 2 and about 20 IU/dL, about 3 and about 20 IU/dL, about 4 and about 20 IU/dL, about 5 and about 20 IU/dL, about 6 and about 20 IU/dL, about 7 and about 20 IU/dL, about 8 and about 20 IU/dL, about 9 and about 20 IU/dL, or about 10 and about 20 IU/dL.
  • Treatment or treating of a disease or condition can also include maintaining FVIII activity in a subject at a level comparable to at least about 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, or 20% of the FVIII activity in a non-hemophiliac subject.
  • the minimum trough level required for treatment can be measured by one or more known methods and can be adjusted (increased or decreased) for each person.
  • Chimeric molecules of the invention are designed to improve release of a VWF protein or a FVIII protein from another moiety that the VWF protein or FVIII protein is fused to.
  • the invention provides a thrombin cleavable linker that can be cleaved fast and efficient at the site of injury.
  • a chimeric molecule can comprise a von Willebrand Factor (VWF) protein, a heterologous moiety (HI), an XTEN sequence, and a VWF linker connecting the VWF protein with the heterologous moiety, wherein the VWF linker comprises a polypeptide selected from: (i) an a2 region from Factor VIII (FVIII); (ii) an al region from FVIII; (iii) an a3 region from FVIII; (iv) a thrombin cleavage site which comprises X-V-P-R (SEQ ID NO: 3) and a PARI exosite interaction motif, wherein X is an aliphatic amino acid; or (v) any combination thereof, and wherein the XTEN sequence is connected to the VWF protein, the heterologous moiety (HI), the VWF linker, or any combination thereof.
  • VWF von Willebrand Factor
  • a chimeric molecule can comprise a first polypeptide chain which comprises a VWF protein, a heterologous moiety (HI), and a VWF linker connecting the VWF protein and the heterologous moiety (HI) and a second polypeptide chain comprising a FVIII protein and an XTEN sequence, wherein the VWF linker in the first polypeptide chain comprises: (i) an a2 region from FVIII; (ii) an al region from FVIII; (iii) an a3 region from FVIII; (iv) a thrombin cleavage site which comprises X-V-P-R (SEQ ID NO: 3) and a PARI exosite interaction motif, wherein X is an aliphatic amino acid; or (v) any combination thereof, and wherein the first polypeptide chain and the second polypeptide chain are associated with each other.
  • the VWF linker in the first polypeptide chain comprises: (i) an a2 region from FVIII; (ii
  • a chimeric molecule comprises a polypeptide chain comprising a FVIII protein fused to a heterologous moiety via a FVIII linker, wherein the FVIH linker comprises: (i) an a2 region from FVIII; (ii) an al region from FVIII; (iii) an a3 region from FVIII; (iv) a thrombin cleavage site which comprises X-V- P-R (SEQ ID NO: 3) and a PARI exosite interaction motif, wherein X is an aliphatic amino acid; or (v) any combination thereof.
  • the present invention provides a chimeric molecule comprising a VWF protein fused to an XTEN sequence via a VWF linker, wherein the VWF linker comprises a polypeptide selected from: (i) an a2 region from FVIII; (ii) an al region from FVIII; (iii) an a3 region from FVIII; (iv) a thrombin cleavage site which comprises X-V-P-R (SEQ ID NO: 3) and a PARI exosite interaction motif, wherein X is an aliphatic amino acid; or (v) any combination thereof.
  • the VWF linker comprises a polypeptide selected from: (i) an a2 region from FVIII; (ii) an al region from FVIII; (iii) an a3 region from FVIII; (iv) a thrombin cleavage site which comprises X-V-P-R (SEQ ID NO: 3) and a PARI exosite interaction motif
  • a chimeric molecule comprises a VWF protein, a heterologous moiety (HI), an XTEN sequence, and a VWF linker connecting the VWF protein with the heterologous moiety, wherein the XTEN sequence is located between the VWF protein and the VWF linker and wherein the VWF linker comprises a polypeptide selected from: (i) an a2 region from Factor VIII (FVIII); (ii) an al region from FVIII; (iii) an a3 region from FVIII; (iv) a thrombin cleavage site which comprises X-V-P-R (SEQ ID NO: 3) and a PARI exosite interaction motif, wherein X is an aliphatic amino acid; or (v) any combination thereof.
  • FVIII Factor VIII
  • a thrombin cleavage site which comprises X-V-P-R (SEQ ID NO: 3) and a PARI exosite interaction motif, wherein X is an ali
  • a chimeric molecule comprises a VWF protein, a heterologous moiety (HI), an XTEN sequence, and a VWF linker connecting the VWF protein with the heterologous moiety, wherein the XTEN sequence is located between the VWF linker and the heterologous moiety and wherein the VWF linker comprises a polypeptide selected from: (i) an a2 region from FVIII; (ii) an al region from FVIII; (iii) an a3 region from FVIII; (iv) a thrombin cleavage site which comprises X-V-P-R (SEQ ID NO: 3) and a PARI exosite interaction motif, wherein X is an aliphatic amino acid; or (v) any combination thereof.
  • a polypeptide selected from: (i) an a2 region from FVIII; (ii) an al region from FVIII; (iii) an a3 region from FVIII; (iv) a thrombin
  • the chimeric molecule further comprises a polypeptide chain, which comprises a FVIII protein, wherein the first chain comprising the VWF protein and the second chain comprising the FVIII protein are associated with each other.
  • the association can be a covalent, e.g., disulfide bond, association.
  • the polypeptide chain comprising a FVIII protein further comprises an additional XTEN sequence.
  • the additional XTEN sequence can be linked to the N-terminus or the C-terminus of the FVIII protein or inserted between two FVIII amino acids adjacent to each other.
  • the chain comprising a FVIII protein further comprises a second heterologous moiety (H2).
  • the FVIII protein is fused to the second heterologous moiety via a FVIII linker.
  • the FVIII linker is identical to the VWF linker connecting the VWF protein and the heterologous moiety.
  • the FVIII Linker is different from the VWF linker connecting the VWF protein and the heterologous moiety.
  • a chimeric molecule comprises a formula selected from:
  • the FVIII protein in the chimeric molecule comprises a third heterologous moiety (H3), which can be an XTEN sequence.
  • the FVIII protein of the chimeric molecule comprises a fourth heterologous moiety (H4), which can be an XTEN sequence.
  • the FVIII protein of the chimeric molecule comprises a fifth heterologous moiety (H5), which can be an XTEN sequence.
  • the FVIII protein of the chimeric molecule comprises the sixth heterologous moiety (H6), which can be an XTEN sequence.
  • one or more of the third heterologous moiety (H3), the fourth heterologous moiety (H4), the fifth heterologous moiety (H5), and the sixth heterologous moiety (H6) are capable of extending the half-life of the chimeric molecule.
  • the third heterologous moiety (H3), the fourth heterologous moiety (H4), the fifth heterologous moiety (H5), and the sixth heterologous moiety (H6) are linked to the C-terminus or N-terminus of FVIII or inserted between two amino acids of the FVIII protein.
  • the instant invention also provides a chimeric molecule comprising a first polypeptide chain which comprises a VWF protein, a heterologous moiety (HI), and a VWF linker connecting the VWF protein and the heterologous moiety (HI) and a second polypeptide chain comprising a FVIII protein and an XTEN sequence, wherein the VWF linker in the first polypeptide chain comprises: (i) an a2 region from FVIII; (ii) an al region from FVIII; (iii) an a3 region from FVIII; (iv) a thrombin cleavage site which comprises X-V-P-R (SEQ ID NO: 3) and a PARI exosite interaction motif, wherein X is an aliphatic amino acid; or (v) any combination thereof, and wherein the first polypeptide chain and the second polypeptide chain are associated with each other.
  • the VWF linker in the first polypeptide chain comprises: (i) an a2 region from FV
  • the chimeric molecule further comprises an additional XTEN sequence, which is connected to the VWF protein, the heterologous moiety, the VWF linker, or any combination thereof.
  • the chimeric molecule further comprises a second heterologous moiety (H2).
  • the second heterologous moiety of the chimeric molecule is connected to the FVIII protein, the XTEN sequence, or both.
  • the second heterologous moiety is connected to the FVIII protein or the XTE sequence via a FVIII linker.
  • the FVIII linker is identical to the VWF linker. In some embodiments, the FVIII linker is different from the VWF linker.
  • a chimeric molecule comprises a formula selected from:
  • the FVIII protein of the chimeric molecule comprises a third heterologous moiety (H3), which can be an XTEN sequence.
  • the FVIII protein of the chimeric molecule comprises a fourth heterologous moiety (H4), which is an XTEN sequence.
  • the FVIII protein of the chimeric molecule comprises a fifth heterologous moiety (H5), which can be an XTEN sequence
  • the FVIII protein comprises the sixth heterologous moiety (H6), which can be an XTEN sequence.
  • one or more of the third heterologous moiety (H3), the fourth heterologous moiety (H4), the fifth heterologous moiety (H5), and the sixth heterologous moiety (H6) are capable of extending the half-life of the chimeric molecule.
  • the third heterologous moiety (H3), the fourth heterologous moiety (H4), the fifth heterologous moiety (H5), and/or the sixth heterologous moiety (H6) are linked to the C terminus or N terminus of FVIII or inserted between two amino acids of the FVIII protein.
  • a chimeric molecule of the invention can comprise a FVIII protein, an XTEN sequence, and a heterologous moiety fused by a FVIII linker, which comprises (i) an a2 region from FVIII; (ii) an al region from FVIII; (iii) an a3 region from FVIII; (iv) a thrombin cleavage site which comprises X-V-P-R (SEQ ID NO: 3) and a PARI exosite interaction motif, wherein X is an aliphatic amino acid; or (v) any combination thereof.
  • a FVIII linker which comprises (i) an a2 region from FVIII; (ii) an al region from FVIII; (iii) an a3 region from FVIII; (iv) a thrombin cleavage site which comprises X-V-P-R (SEQ ID NO: 3) and a PARI exosite interaction motif, wherein X is an alipha
  • a chimeric molecule comprises two polypeptide chains, the first chain comprising a FVIII protein fused to a first Fc region via a FVIII linker, and a second chain comprising a VWF protein (e.g., a D' domain and a D3 domain of VWF) fused to an Fc region, wherein the FVIII linker in the first polypeptide chain comprises: (i) an a2 region from FVIII; (ii) an al region from FVIII; (iii) an a3 region from FVIII; (iv) a thrombin cleavage site which comprises X-V-P-R (SEQ ID NO: 3) and a PARI exosite interaction motif, wherein X is an aliphatic amino acid; or (v) any combination thereof, and wherein the first polypeptide chain and the second polypeptide chain are associated with each other and wherein an XTEN sequence is linked to the first polypeptide (e.g.
  • a chimeric molecule comprises a formula selected from:
  • V-L2-X2-H2 H1-L1-X1-C
  • V-X2-L2-H2 H1-L1-X1-C
  • V-L2-X2-H2 Hl- Xl-Ll-C
  • V-X2-L2-H2 H1-X1-L1-C
  • V-L2-X2-H2 Hl-Ll-C(Xl)
  • V-X2- L2-H2 Hl-Ll-C(Xl)
  • V-X2- L2-H2 Hl-Ll-C(Xl)
  • the VWF linker or FVIII linker useful for a chimeric molecule of the invention is a thrombin cleavable linker fusing a VWF protein with a heterologous moiety or & FVIII protein with a heterologous moiety.
  • the VWF linker or FVIII linker comprises an al region of FVIII.
  • the VWF linker or FVIII linker comprises an a2 region of FVIII.
  • the VWF linker or FVIII linker comprises an a3 region of FVIII.
  • the VWF linker or FVIII linker comprises a thrombin cleavage site which comprises X-V-P-R (SEQ ID NO: 3) and a PARI exosite interaction motif, wherein X is an aliphatic amino acid.
  • the VWF linker or FVIII linker comprises an al region which comprises an amino acid sequence at least about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, or 100% identical to Met337 to Arg372 corresponding to full-length mature FVIII, wherein the al region is capable of being cleaved by thrombin.
  • the VWF linker or FVIII linker comprises an al region which comprises an amino acid sequence at least about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, or 100% identical to amino acids 337 to 374 corresponding to full-length mature FVIII, wherein the al region is capable of being cleaved by thrombin.
  • the VWF linker or FVIII linker further comprises additional amino acids, e.g., one, two, three, four, five, ten, or more.
  • the VWF linker or FVIII linker comprises ISMKNNEEAEDYDDDLTDSEMDVVRFDDDNSPSFIQIRSV (SEQ ID NO: 5).
  • the VWF linker or FVIII linker comprises an a2 region which comprises an amino acid sequence at least about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, or 100% identical to Glu720 to Arg740 corresponding to full-length mature FVIII, wherein the a2 region is capable of being cleaved by thrombin.
  • the VWF linker or FVIII linker comprises an a2 region which comprises an amino acid sequence at least about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, or 100%) identical to amino acids 712 to 743 corresponding to full-length mature FVIII.
  • the VWF linker or FVIII linker further comprises additional amino acids, e.g., one, two, three, four, five, ten, or more.
  • the VWF linker comprises ISDKNTGDYYEDSYEDISAYLLSKNNAIEPRSFS (SEQ ID NO: 4) [0096]
  • the VWF linker or FVIII linker comprises an a3 region which comprises an amino acid sequence at least about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, or 100% identical to Glul649 to Argl689 corresponding to full-length mature FVIII, wherein the a3 region is capable of being cleaved by thrombin.
  • the VWF linker or FVIII linker comprises an a3 region which comprises an amino acid sequence at least about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, or 100% identical to amino acids 1649 to 1692 corresponding to full-length mature FVIII, wherein the a3 region is capable of being cleaved by thrombin.
  • the VWF linker or FVIII linker further comprises additional amino acids, e.g., one, two, three, four, five, ten, or more.
  • a VWF linker or FVIII linker comprises ISEITRTTLQSDQEEIDYDDTISVEMKKEDFDIYDEDENQSPRSFQ (SEQ ID NO: 6)
  • the VWF linker or FVIII linker comprises a thrombin cleavage site comprising X-V-P-R (SEQ ID NO: 3) and a PARI exosite interaction motif and wherein the PARI exosite interaction motif comprises S-F-L-L-R-N (SEQ ID NO: 7).
  • the PARI exosite interaction motif further comprises an amino acid sequence selected from P, P-N, P-N-D, P-N-D-K (SEQ ID NO: 8), P-N-D-K-Y (SEQ ID NO: 9), P-N-D-K- Y-E (SEQ ID NO: 10), P-N-D-K- Y-E-P (SEQ ID NO: 11), P- N-D-K-Y-E-P-F (SEQ ID NO: 12), P-N-D-K- Y-E-P-F-W (SEQ ID NO: 13), P-N-D-K- Y-E-P-F-W-E (SEQ ID NO: 14), P-N-D-K- Y-E-P-F-W-E-D (SEQ ID NO: 20), P-N-D- K-Y-E-P-F-W- -D-E (SEQ ID NO: 21), P-N-D-K-Y-Y-K (
  • the aliphatic amino acid for the thrombin cleavage site comprising X- V-P-R is selected from Glycine, Alanine, Valine, Leucine, or Isoleucine.
  • the thrombin cleavage site comprises L-V-P-R.
  • thrombin cleaves the VWF linker or FVIII linker faster than thrombin would cleave the thrombin cleavage site (e.g., L-V-P-R) if the thrombin cleavage site (L-V-P-R) were substituted for the VWF linker or FVIII linker, respectively (i.e., without the PARI exosite interaction motif).
  • thrombin cleaves the VWF linker or FVIII linker faster than thrombin would cleave the thrombin cleavage site (e.g., L-V-P-R) if the thrombin cleavage site (L-V-P-R) were substituted for the VWF linker or FVIII linker, respectively (i.e., without the PARI exosite interaction motif).
  • thrombin cleaves the VWF linker or FVIII linker at least about 10 times, at least about 20 times, at least about 30 times, at least about 40 times, at least about 50 times, at least about 60 times, at least about 70 times, at least about 80 times, at least about 90 times or at least about 100 times faster than thrombin would cleave the thrombin cleavage site (e.g., L-V-P-R) if the thrombin cleavage site (e.g., L-V-P-R) were substituted for the VWF linker or FV.III linker.
  • the thrombin cleavage site e.g., L-V-P-R
  • a VWF linker or FVIII linker comprising (i) an al region
  • a thrombin cleavage site X-V-P-R and a PARI exosite interaction motif further com prises one or more amino acids having a length of at least about 2, 5, 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 1 10, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1200, 1400, 1600, 1800, or 2000 amino acids.
  • the one or more amino acids comprise a gly peptide. In another embodiment, the one or more amino acids comprise GlyGly. In other embodiments, the one or more amino acids comprise IleSer. In still other embodiments, the one or more amino acids comprise a gly/ser peptide. In yet other embodiments, the one or more amino acids comprise a gly/ser peptide having a formula of (Gly 4 Ser)n or S(Gly 4 Ser)n, wherein n is a positive integer selected from 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 30, 40, 50, 60, 70, 80, or 100. In some embodiments, the one or more amino acids comprise (Gly 4 Ser) 3 (SEQ ID NO: 89) or (Gly 4 Ser) 4 (SEQ ID NO: 90).
  • VWF also known as F8VWF
  • F8VWF is a large multimeric glycoprotein present in blood plasma and produced constitutively in endothelium (in the Weibel-Palade bodies), megakaryocytes (a-granules of platelets), and subendothelian connective tissue.
  • the basic VWF monomer is a 2813 amino acid protein.
  • VWF protein includes, but is not limited to, full-length VWF protein or functional VWF fragments comprising a D' domain and a D3 domain, which are capable of inhibiting binding of endogenous VWF to FVIII.
  • a VWF protein binds to FVIII.
  • the VWF protein blocks the VWF binding site on FVIII, thereby inhibiting interaction of FVIII with endogenous VWF.
  • a VWF protein is not cleared by a VWF clearance pathway.
  • the VWF proteins include derivatives, variants, mutants, or analogues that retain these activities of VWF.
  • SEQ ID NO: 1 is the amino acid sequence encoded by SEQ ID NO: 1. Each domain of VWF is listed in Table 1.
  • V F 1 ATGATTCCTG CCAGATTTGC CGGGGTGCTG
  • the VWF protein as used herein can comprise a D' domain and a D3 domain of VWF. wherein the VWF protein binds to FVIII and inhibits binding of endogenous VWF (full-length VWF) to FVIII.
  • the VWF protein comprising the D' domain and the D3 domain can further comprise a. VWF domain selected from an Al domain, an A2 domain, an A3 domain, a Dl domain, a D2 domain, a D4 domain, a Bl domain, a B2 domain, a B3 domain, a CI domain, a C2 domain, a CK domain, one or more fragments thereof, or any combination thereof.
  • a VWF protein comprises, consists essentially of, or consists of: (1 ) the D' and D3 domains of VWF or fragments thereof; (2) the Dl, D', and D3 domains of VWF or fragments thereof; (3) the D2, D', and D3 domains of VWF or fragments thereof; (4) the Dl, D2, D', and D3 domains of VWF or fragments thereof; or (5) the Dl, D2, D', D3, or Al domains of VWF or fragments thereof.
  • the VWF protein described herein does not contain a VWF clearance receptor binding site.
  • the VWF protein of the present invention can comprise any other sequences linked to or fused to the VWF protein.
  • a VWF protein described herein can further comprise a signal peptide.
  • a VWF protein binds to or is associated with a FVIII protein.
  • the VWF protein of the invention can protect FVIII from protease cleavage and FVIII activation, stabilizes the heavy chain and light chain of FVIII, and prevents clearance of FVIII by scavenger receptors.
  • the VWF protein binds to or associates with a FVIII protein and blocks or prevents binding of the FVIII protein to phospholipid and activated Protein C.
  • the VWF protein of the invention reduces the clearance of FVIII by endogenous VWF clearance receptors and thus extends half-life of the FVIII protein.
  • the half-life extension of a FVIII protein is thus due to the association of the FVIII protein with a VWF protein lacking a VWF clearance receptor binding site and thereby shielding and/or protecting of the FVIII protein from endogenous VWF which contains the VWF clearance receptor binding site.
  • the FVIII protein bound to or protected by the VWF protein can also allow recycling of a FVIU protein.
  • the FVIII/VWF heterodimers of the invention are shielded from the VWF clearance pathway, further extending FVIII half-life.
  • a VWF protein of the present invention comprises a D' domain and a D3 domain of VWF, wherein the D' domain is at least about 60%, 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical to amino acids 764 to 866 of SEQ ID NO: 2, wherein the VWF protein prevents binding of endogenous VWF to FVIII.
  • a VWF protein comprises a D' domain and a D3 domain of V WF, wherein the D3 domain is at least 60%, 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical to amino acids 867 to 1240 of SEQ ID NO: 2, wherein the VWF protein prevents binding of endogenous VWF to FVIII.
  • a VWF protein described herein comprises, consists essentially of, or consists of a D' domain and a D3 domain of VWF, which are at least 60%, 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical to amino acids 764 to 1240 of SEQ ID NO: 2, wherein the VWF protein prevents binding of endogenous VWF to FVIII.
  • a VWF protein comprises, consists essentially of, or consists of the Dl , D2, D', and D3 domains at least 60%, 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical to amino acids 23 to 1240 of SEQ ID NO: 2, wherein the VWF protein prevents binding of endogenous VWF to FVIII.
  • the VWF protein further comprises a signal peptide operably linked thereto.
  • a VWF protein of the invention consists essentially of or consists of (1) the D'D3 domain, the D1D'D3 domain, D2D'D3 domain, or D1D2DO3 domain and (2) an additional VWF sequence up to about 10 amino acids (e.g., any sequences from amino acids 764 to 1240 of SEQ ID NO: 2 to amino acids 764 to 1250 of SEQ ID NO: 2), up to about 15 amino acids (e.g., any sequences from amino acids 764 to 1240 of SEQ ID NO: 2 to amino acids 764 to 1255 of SEQ ID NO: 2), up to about 20 amino acids (e.g., any sequences from amino acids 764 to 1240 of SEQ ID NO: 2 to amino acids 764 to 1260 of SEQ ID NO: 2), up to about 25 amino acids (e.g., any sequences from amino acids 764 to 1240 of SEQ ID NO: 2 to amino acids 764 to 1265 of SEQ ID NO: 2), or up to about 30 amino acids (e.g.,
  • the VWF protein comprising or consisting essentially of a D' domain and a D3 domain is neither amino acids 764 to 1274 of SEQ ID NO: 2 nor the full-length mature VWF.
  • the D1D2 domain is expressed in trans with the D'D3 domain.
  • the D1D2 domain is expressed in cis with the D'D3 domain.
  • a VWF protein comprising D'D3 domains linked to D1D2 domains further comprises an intracellular processing site, e.g., (a processing site by PACE (furin) or PC5), allowing cleavage of the D1D2 domains from the D'D3 domains upon expression.
  • an intracellular processing site e.g., (a processing site by PACE (furin) or PC5).
  • a VWF protein comprises a D' domain and a D3 domain, but does not comprise an amino acid sequence selected from (1) amino acids 1241 to 2813 of SEQ ID NO: 2, (2) amino acids 1270 to amino acids 2813 of SEQ ID NO: 2, (3) amino acids 1271 to amino acids 2813 of SEQ ID NO: 2, (4) amino acids 1272 to amino acids 2813 of SEQ ID NO: 2, (5) amino acids 1273 to amino acids 2813 of SEQ ID NO: 2, (6) amino acids 1274 to amino acids 2813 of SEQ ID NO: 2, or any combination thereof.
  • a VWF protein of the present invention comprises, consists essentially of, or consists of an amino acid sequence corresponding to a D' domain, D3 domain, and Al domain, wherein the amino acid sequence is at least 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical to amino acid 764 to 1479 of SEQ ID NO: 2, wherein the VWF protein prevents binding of endogenous VWF to FVIII.
  • the VWF protein is not amino acids 764 to 1274 of SEQ ID NO: 2.
  • a VWF protein of the invention comprises a D' domain and a D3 domain, but does not comprise at least one VWF domain selected from (1) an Al domain, (2) an A2 domain, (3) an A3 domain, (4) a D4 domain, (5) a Bl domain, (6) a B2 domain, (7) a B3 domain, (8) a CI domain, (9) a C2 domain, (10) a CK domain, (11) a CK domain and C2 domain, (12) a CK domain, a C2 domain, and a CI domain, (13) a CK domain, a C2 domain, a CI domain, a B3 domain, (14) a CK domain, a C2 domain, a CI domain, a B3 domain, a B2 domain, (15) a CK domain, a C2 domain, a CI domain, a B3 domain, a B2 domain, and a Bl domain, (16) a CK domain, a
  • a VWF protein comprises D'D3 domains and one or more domains or modules.
  • domains or modules include, but are not limited to, the domains and modules disclosed in Zhour et al., Blood published online April 6, 2012: DOI 10.1 182/blood-2012-01-405134.
  • the VWF protein can comprise D'D3 domain and one or more domains or modules selected from Al domain, A2 domain, A3 domain, D4N module, VWD4 module, C8-4 module, TIL-4 module, CI module, C2 module, C3 module, C4 module, C5 module, C5 module, C6 module, or any combination thereof
  • a VWF protein of the invention forms a multimer, e.g. , dimer, trimer, tetramer, pentamer, hexamer, heptamer, or the higher order multimers.
  • the VWF protein is a monomer having only one VWF protein.
  • the VWF protein of the present invention can have one or more amino acid substitutions, deletions, additions, or modifications.
  • the VWF protein can include amino acid substitutions, deletions, additions, or modifications such that the VWF protein is not capable of forming a disulfide bond or forming a dimer or a multimer.
  • the amino acid substitution is within the D' domain and the D3 domain.
  • a VWF protein of the invention contains at least one amino acid substitution at a residue corresponding to residue 1099, residue 1142, or both residues 1099 and 1142 of SEQ ID NO: 2.
  • the at least one amino acid substitution can be any amino acids that are not occurring naturally in the wild type VWF.
  • the amino acid substitution can be any amino acids other than cysteine, e.g., isoleucine, alanine, leucine, asparagine, lysine, aspartic acid, methionine, phenylalanine, glutamic acid, threonine, glutamine, tryptophan, glycine, valine, proline, serine, tyrosine, arginine, or histidine.
  • the amino acid substitution has one or more amino acids that prevent or inhibit the VWF proteins from forming multimers.
  • the VWF protein comprises an amino acid substitution from cysteine to alanine at residue 336 corresponding to D'D3 domain of VWF (residue 1099 of SEQ ID NO: 2), and amino acid substitution from cysteine to alanine at residue 379 corresponding to D'D3 domain of VWF (residue 1142 of SEQ ID NO: 2), or both.
  • the VWF protein useful herein can be further modified to improve its interaction with FVIII, e.g., to improve binding affinity to FVIII.
  • the VWF protein comprises a serine residue at the residue corresponding to amino acid 764 of SEQ ID NO: 2 and a lysine residue at the residue corresponding to amino acid 773 of SEQ ID NO: 2. Residues 764 and/or 773 can contribute to the binding affinity of the VWF proteins to FVIII.
  • the VWF proteisn useful for the invention can have other modifications, e.g., the protein can be pegylated, glycosylated, hesylated, or polysialylated.
  • a heterologous moiety that can be fused to a VWF protein via a VWF linker or to a FVIII protein via a FVIII linker can be a heterologous polypeptide or a heterologous non-polypeptide moiety.
  • the heterologous moiety is a half-life extending molecule which is known in the art and comprises a polypeptide, a non- polypeptide moiety, or the combination of both.
  • a heterologous polypeptide moiety can comprise a FVIII protein, an immunoglobulin constant region or a portion thereof, albumin or a fragment thereof, an albumin binding moiety, transferrin or a fragment thereof, a PAS sequence, a HAP sequence, a derivative or variant thereof, the C-terminal peptide (CTP) of the ⁇ subunit of human chorionic gonadotropin, or any combination thereof
  • the non-polypeptide binding moiety comprises polyethylene glycol (PEG), polysialic acid, hydroxyethyl starch (HES), a derivative thereof, or any combination thereof.
  • An immunoglobulin constant region is comprised of domains denoted CH
  • constant heavy domains CHI, CH2, etc.
  • the constant region can be comprised of three or four CH domains.
  • Some isotypes (e.g. IgG) constant regions also contain a hinge region. See Janeway et al. 2001, Immunobiology, Garland Publishing, N.Y., N.Y.
  • an immunoglobulin constant region or a portion thereof for producing the chimeric protein of the present invention may be obtained from a number of different sources.
  • an immunoglobulin constant region or a portion thereof is derived from a human immunoglobulin. It is understood, however, that the immunoglobulin constant region or a portion thereof may be derived from an immunoglobulin of another mammalian species, including for example, a rodent (e.g., a mouse, rat, rabbit, guinea pig) or non-human primate (e.g. chimpanzee, macaque) species.
  • rodent e.g., a mouse, rat, rabbit, guinea pig
  • non-human primate e.g. chimpanzee, macaque
  • the immunoglobulin constant region or a portion thereof may be derived from any immunoglobulin class, including IgM, IgG, IgD, IgA and IgE, and any immunoglobulin isotype, including IgGl, IgG2, IgG3 and IgG4.
  • the human isotype IgGl is used.
  • immunoglobulin constant region gene sequences e.g. human constant region gene sequences
  • Constant region domains sequence can be selected having a particular effector function (or lacking a particular effector function) or with a particular modification to reduce immunogenicity.
  • Many sequences of antibodies and antibody-encoding genes have been published and suitable Ig constant region sequences (e.g. hinge, CH2, and/or CH3 sequences, or portions thereof) can be derived from these sequences using art recognized techniques.
  • the genetic material obtained using any of the foregoing methods may then be altered or synthesized to obtain polypeptides of the present invention. It will further be appreciated that the scope of this invention encompasses alleles, variants and mutations of constant region DNA sequences.
  • sequences of the immunoglobulin constant region or a portion thereof can be cloned, e.g., using the polymerase chain reaction and primers which are selected to amplify the domain of interest.
  • mRNA can be isolated from hybridoma, spleen, or lymph cells, reverse transcribed into DNA, and antibody genes amplified by PCR.
  • PCR amplification methods are described in detail in U.S. Pat. Nos. 4,683,195; 4,683,202; 4,800,159; 4,965,188; and in, e.g., "PCR Protocols: A Guide to Methods and Applications” Innis et al. eds., Academic Press, San Diego, CA (1990); Ho et al. 1989. Gene 77:51 ; Horton et al. 1993. Methods Enzymol. 217:270).
  • An immunoglobulin constant region used herein can include all domains and the hinge region or portions thereof, in one embodiment, the immunoglobulin constant region or a portion thereof comprises CH2 domain, CH3 domain, and a hinge region, i.e., an Fc region or an FcRn binding partner.
  • Fc region is defined as the portion of a polypeptide which corresponds to the Fc region of native immunoglobulin, i.e., as formed by the dimeric association of the respective Fc domains of its two heavy chains.
  • a native Fc region forms a homodimer with another Fc region.
  • the "Fc region” refers to the portion of a single immunoglobulin heavy chain beginning in the hinge region just upstream of the papain cleavage site (i.e. residue 216 in IgG, taking the first residue of heavy chain constant region to be 114) and ending at the C-terminus of the antibody. Accordingly, a complete Fc domain comprises at least a hinge domain, a CH2 domain, and a CH3 domain.
  • the Fc region of an immunoglobulin constant region can include the CH2, CH3, and CH4 domains, as well as the hinge region.
  • Chimeric proteins comprising an Fc region of an immunoglobulin bestow several desirable properties on a chimeric protein including increased stability, increased serum half-life (see Capon et al, 1989, Nature 337:525) as well as binding to Fc receptors such as the neonatal Fc receptor (FcRn) (U.S. Pat. Nos. 6,086,875, 6,485,726, 6,030,613; WO 03/077834; US2003-0235536A1), which are incorporated herein by reference in their entireties.
  • FcRn neonatal Fc receptor
  • An immunoglobulin constant region or a portion thereof can be an FcRn binding partner.
  • FcRn is active in adult epithelial tissues and expressed in the lumen of the intestines, pulmonary airways, nasal surfaces, vaginal surfaces, colon and rectal surfaces (U.S. Pat. No. 6,485,726).
  • An FcRn binding partner is a portion of an immunoglobulin that binds to FcRn.
  • the FcRn receptor has been isolated from several mammalian species including humans. The sequences of the human FcRn, monkey FcRn, rat FcRn, and mouse FcRn are known (Story et al. 1994, J. Exp. Med. 180:2377).
  • the FcRn receptor binds IgG (but not other immunoglobulin classes such as IgA, IgM, IgD, and IgE) at relatively low H, actively transports the IgG transcellularly in a luminal to serosal direction, and then releases the IgG at relatively higher pH found in the interstitial fluids. It is expressed in adult epithelial tissue (U.S. Pat. Nos.
  • FcRn binding partners useful in the present invention encompass molecules that can be specifically bound by the FcRn receptor including whole IgG, the Fc fragment of IgG, and other fragments that include the complete binding region of the FcRn receptor.
  • the region of the Fc portion of IgG that binds to the FcRn receptor has been described based on X-ray crystallography (Burmeister et al. 1994, Nature 372:379).
  • the major contact area of the Fc with the FcRn is near the junction of the CH2 and CHS domains.
  • Fc-FcRn contacts are all within a single Ig heavy chain.
  • the FcRn binding partners include whole IgG, the Fc fragment of IgG, and other fragments of IgG that include the complete binding region of FcRn.
  • the major contact sites include amino acid residues 248, 250-257, 272, 285, 288, 290-291, 308-31 1, and 314 of the CH2 domain and amino acid residues 385-387, 428, and 433-436 of the CH3 domain.
  • References made to amino acid numbering of immunoglobulins or immunoglobulin fragments, or regions, are all based on Kabat et al. 1991, Sequences of Proteins of Immunological Interest, U.S. Department of Public Health, Bethesda, Md.
  • Fc regions or FcRn binding partners bound to FcRn can be effectively shuttled across epithelial barriers by FcRn, thus providing a non-invasive means to systemically administer a desired therapeutic molecule.
  • fusion proteins comprising an Fc region or an FcRn binding partner are endocytosed by cells expressing the FcRn. But instead of being marked for degradation, these fusion proteins are recycled out into circulation again, thus increasing the in vivo half-life of these proteins.
  • the portions of immunoglobulin constant regions are an Fc region or an FcRn binding partner that typically associates, via disulfide bonds and other non-specific interactions, with another Fc region or another FcRn binding partner to form dimers and higher order multimers.
  • An FcRn binding partner region is a molecule or a portion thereof that can be specifically bound by the FcRn receptor with consequent active transport by the FcRn receptor of the Fc region.
  • Specifically bound refers to two molecules forming a complex that is relatively stable under physiologic conditions. Specific binding is characterized by a high affinity and a low to moderate capacity as distinguished from nonspecific binding which usually has a low affinity with a moderate to high capacity. Typically, binding is considered specific when the affinity constant KA is higher than 10 6 M "1 , or higher than 10 M " . If necessary, non-specific binding can be reduced without substantially affecting specific binding by varying the binding conditions.
  • the appropriate binding conditions such as concentration of the molecules, ionic strength of the solution, temperature, time allowed for binding, concentration of a blocking agent (e.g. serum albumin, milk casein), etc., may be optimized by a skilled artisan using routine techniques.
  • VWF linker or linked to a FVIII protein via a FVIII linker is albumin or a functional fragment thereof.
  • the albumin fused to the VWF protein is covalently associated with an albumin fused to a FVIII protein.
  • HSA Human serum albumin
  • HA Human serum albumin
  • the term "albumin” as used herein includes full-length albumin or a functional fragment, variant, derivative, or analog thereof. Examples of albumin or the fragments or variants thereof are disclosed in US Pat. Publ. Nos. 2008/0194481A1, 2008/0004206 Al, 2008/0161243 Al, 2008/0261877 Al, or 2008/0153751 Al or PCT Appl. Publ. Nos. 2008/033413 A2, 2009/058322 Al , or 2007/021494 A2, which are incorporated herein by references in their entireties.
  • VWF linker or to a FVIII protein via a FVIII linker is an albumin binding moiety, which comprises an albumin binding peptide, a bacterial albumin binding domain, an albumin- binding antibody fragment, or any combination thereof.
  • the albumin binding protein can be a bacterial albumin binding protein, an antibody or an antibody fragment including domain antibodies (see U.S. Pat. No. 6,696,245).
  • An albumin binding protein for example, can be a bacterial albumin binding domain, such as the one of streptococcal protein G (Konig, T. and Skerra, A. (1998) J Immunol. Methods 218, 73- 83).
  • albumin binding peptides that can be used as conjugation partner are, for instance, those having a Cys-Xaa ⁇ -Xaa 2 -Xaa 3 -Xaa 4 -Cys consensus sequence, wherein Xaa ! is Asp, Asn, Ser, Thr, or Trp; Xaa 2 is Asn, Gin, H is, He, Leu, or Lys; Xaa 3 is Ala, Asp, Phe, Trp, or Tyr; and aa4 is Asp, Gly, Leu, Phe, Ser, or Thr as described in US patent application 2003/0069395 or Dennis et al. (Dennis et al. (2002) J Biol. Chem. 277, 35035-35043).
  • a heterologous moiety linked to a VWF protein via a VWF linker or to a FVIII protein via a FVIII linker is a PAS sequence.
  • a chimeric molecule comprises a VWF protein described herein fused to a PAS sequence via a VWF linker.
  • a chimeric molecule of the invention comprises a first chain comprising a VWF protein fused to a PAS sequence via a VWF linker and a second chain comprising a FVIII protein and an additional optional PAS sequence, wherein the PAS sequence shields or protects the VWF binding site on the FVIII protein, thereby inhibiting or preventing interaction of the FVIII protein with endogenous VWF.
  • the two PAS sequences can be covalently associated with each other.
  • a PAS sequence means an amino acid sequence comprising mainly alanine and serine residues or comprising mainly alanine, serine, and proline residues, the amino acid sequence forming random coil conformation under physiological conditions.
  • the PAS sequence is a building block, an amino acid polymer, or a sequence cassette comprising, consisting essentially of, or consisting of alanine, serine, and proline which can be used as a part of the heterologous moiety in the chimeric protein.
  • an amino acid polymer also may form random coil conformation when residues other than alanine, serine, and proline are added as a minor constituent in the PAS sequence.
  • minor constituent means that amino acids other than alanine, serine, and proline may be added in the PAS sequence to a certain degree, e.g., up to about 12%, i.e., about 12 of 100 amino acids of the PAS sequence, up to about 10%, i.e.
  • about 10 of 100 amino acids of the PAS sequence up to about 9%, i.e., about 9 of 100 amino acids, up to about 8%), i.e., about 8 of 100 amino acids, about 6%, i.e., about 6 of 100 amino acids, about 5%, i.e., about 5 of 100 amino acids, about 4%, i.e., about 4 of 100 amino acids, about 3%, i.e., about 3 of 100 amino acids, about 2%, i.e., about 2 of 100 amino acids, about 1%, i.e., about 1 of 100 of the amino acids.
  • amino acids different from alanine, serine and proline may be selected from the group consisting of Arg, Asn, Asp, Cys, Gin, Glu, Gly, His, He, Leu, Lys, Met, Phe, Thr, Trp, Tyr, and Val.
  • the PAS sequence stretch forms a random coil conformation and thereby can mediate an increased in vivo and/or in vitro stability to the VWF factor or the protein of coagulation activity. Since the random coil domain does not adopt a stable structure or function by itself, the biological activity mediated by the VWF protein or the FVIII protein to which it is fused is essentially preserved.
  • the PAS sequences that form random coil domain are biologically inert, especially with respect to proteolysis in blood plasma, immunogenicity, isoelectric point/electrostatic behavior, binding to cell surface receptors or internalization, but are still biodegradable, which provides clear advantages over synthetic polymers such as PEG.
  • Non-limiting examples of the PAS sequences forming random coil conformation comprise an amino acid sequence selected from the group consisting of ASPAAPAPASPAAPAPSAPA (SEQ ID NO: 32), AAPASPAPAAPSAPAPAAPS (SEQ ID NO: 33), APSSPSPSAPSSPSPASPSS (SEQ ID NO: 34), APSSPSPSAPSSPSPASPS (SEQ ID NO: 35), SSPSAPSPSSPASPSPSSPA (SEQ ID NO: 36), AASPAAPSAPPAAASPAAPSAPPA (SEQ ID NO: 37) and ASAAAPAAASAAASAPSAAA (SEQ ID NO: 38) or any combination thereof. Additional examples of PAS sequences are known from, e.g., US Pat. Pub!. No. 2010/0292130 Al and PCT Appl. Publ. No. WO 2008/155134 Al .
  • VWF linker or to a FVIII protein via a FVIII linker is a glycine-rich homo-amino-acid polymer (HAP).
  • the HAP sequence can comprise a repetitive sequence of glycine, which has at least 50 amino acids, at least 100 amino acids, 120 amino acids, 140 amino acids, 160 amino acids, 180 amino acids, 200 amino acids, 250 amino acids, 300 amino acids, 350 amino acids, 400 amino acids, 450 amino acids, or 500 amino acids in length.
  • the HAP sequence is capable of extending half-life of a moiety fused to or linked to the HAP sequence.
  • Non-limiting examples of the HAP sequence includes, but are not limited to (Gly) n , (Gly 4 Ser) n or S(Gly 4 Ser) n , wherein n is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20.
  • n is 20, 21, 22, 23, 24, 25, 26, 26, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, or 40.
  • n is 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, or 200. See, e.g., Schlapschy M et al, Protein Eng. Design Selection, 20: 273-284 (2007).
  • VWF linker or to a I V 111 protein via a FVIII linker is transferrin or a fragment thereof. Any transferrin may be used to make chimeric molecules of the invention.
  • transferrin may be used to make chimeric molecules of the invention.
  • wild-type human Tf (Tf) is a 679 amino acid protein, of approximately 75 KDa (not accounting for glycosylation), with two main domains, N (about 330 amino acids) and C (about 340 amino acids), which appear to originate from a gene duplication.
  • Transferrin comprises two domains, N domain and C domain.
  • N domain comprises two subdomains, Nl domain and N2 domain
  • C domain comprises two subdomains, CI domain and C2 domain.
  • the transferrin portion of the chimeric molecule includes a transferrin splice variant.
  • a transferrin splice variant can be a splice variant of human transferrin, e.g., Genbank Accession AAA61140.
  • the transferrin portion of the chimeric molecule includes one or more domains of the transferrin sequence, e.g., N domain, C domain, Nl domain, N2 domain, CI domain, C2 domain or any combination thereof.
  • a heterologous moiety attached to a VWF protein via a
  • VWF linker or to a FVIII protein via a FVIII linker is a soluble polymer known in the art, including, but not limited to, polyethylene glycol, ethylene glycol/propylene glycol copolymers, carboxymethylcellulose, dextran, or polyvinyl alcohol.
  • the heterologous moiety such as soluble polymer can be attached to any positions within the chimeric molecule.
  • a chimeric molecule comprises a VWF protein fused to a heterologous moiety (e.g., an Fc region) via a VWF linker, wherein the VWF protein is further linked to PEG.
  • a chimeric molecule comprises a VWF protein fused to an Fc region via a VWF linker and a FVIII protein, which are associated with each other, wherein the FVIII protein is linked to PEG.
  • chemically modified derivatives of the chimeric molecule of the invention which may provide additional advantages such as increased solubility, stability and circulating time of the polypeptide, or decreased immunogenicity (see U.S. Pat. No. 4,179,337).
  • the chemical moieties for modification can be selected from water soluble polymers including, but not limited to, polyethylene glycol, ethylene glycol/propylene glycol copolymers, carboxyme hylcellulose, dextran, or polyvinyl alcohol.
  • a chimeric molecule may be modified at random positions within the molecule or at the N- or C- terminus, or at predetermined positions within the molecule and may include one, two, three or more attached chemical moieties.
  • the polymer can be of any molecular weight, and can be branched or unbranched.
  • the molecular weight is between about 1 kDa and about 100 kDa for ease in handling and manufacturing. Other sizes may be used, depending on the desired profile (e.g., the duration of sustained release desired, the effects, if any on biological activity, the ease in handling, the degree or lack of antigenicity and other known effects of the polyethylene glycol to a protein or analog).
  • the polyethylene glycol may have an average molecular weight of about 200, 500, 1000, 1500, 2000, 2500, 3000, 3500, 4000, 4500, 5000, 5500, 6000, 6500, 7000, 7500, 8000, 8500, 9000, 9500, 10,000, 10,500, 11,000, 11,500, 12,000, 12,500, 13,000, 13,500, 14,000, 14,500, 15,000, 15,500, 16,000, 16,500, 17,000, 17,500, 18,000, 18,500, 19,000, 19,500, 20,000, 25,000, 30,000, 35,000, 40,000, 45,000, 50,000, 55,000, 60,000, 65,000, 70,000, 75,000, 80,000, 85,000, 90,000, 95,000, or 100,000 kDa.
  • the polyethylene glycol may have a branched structure.
  • Branched polyethylene glycols are described, for example, in U.S. Pat. No. 5,643,575; Morpurgo et al, Appl. Biochem. Biotechnol. 56:59-72 (1996); Vorobjev et al. > Nucleosides Nucleotides 18:2745-2750 (1999); and Caliceti et al, Bioconjug. Chem. 10:638-646 (1999), each of which is incorporated herein by reference in its entirety.
  • the degree of substitution may also vary.
  • the pegylated proteins of the invention may be linked, on average, to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15, 17, 20, or more polyethylene glycol molecules.
  • the average degree of substitution within ranges such as 1-3, 2-4, 3-5, 4-6, 5-7, 6-8, 7-9, 8-10, 9-11, 10-12, 11-13, 12-14, 13-15, 14-16, 15-17, 16-18, 17-19, or 18-20 polyethylene glycol moieties per protein molecule. Methods for determining the degree of substitution are discussed, for example, in Delgado et al, Crit. Rev. Them. Drug Carrier Sys. 9:249-304 (1992).
  • a FVIII protein used in the invention is conjugated to one or more polymers.
  • the polymer can be water-soluble and covalently or non-covalently attached to Factor VIII or other moieties conjugated to Factor VIII.
  • Non-limiting examples of the polymer can be poly(alkylene oxide), poly(vinyl pyrrolidone), polyvinyl alcohol), polyoxazoline, or poly (aery loylmorpholine). Additional types of polymer- conjugated FVIII are disclosed in U.S. Patent No. 7,199,223.
  • VWF linker or a FVIII protein via a FVIII linker is a polymer, e.g., hydroxyethyl starch (HES) or a derivative thereof.
  • HES hydroxyethyl starch
  • HES Hydroxyethyl starch
  • HES is a derivative of naturally occurring amylopectin and is degraded by alpha-amylase in the body.
  • HES is a substituted derivative of the carbohydrate polymer amylopectin, which is present in corn starch at a concentration of up to 95% by weight, HES exhibits advantageous biological properties and is used as a blood volume replacement agent and in hernodilution therapy in the clinics (Sommermeyer et al., Whypharmazie, 8(8), 271-278 (1987); and Weidler et al., Arzneim.-Forschung/Drug Res., 41, 494-498 (1991)).
  • Amylopectin contains glucose moieties, wherein in the main chain alpha- 1,4- glycosidic bonds are present and at the branching sites alpha- 1 ,6-glycosidic bonds are found.
  • the physical-chemical properties of this molecule are mainly determined by the type of glycosidic bonds. Due to the nicked alpha- 1,4-glycosidic bond, helical structures with about six glucose-monomers per turn are produced.
  • the physico-chemical as well as the biochemical properties of the polymer can be modified via substitution. The introduction of a hydroxyethyl group can be achieved via alkaline hydroxyethylation.
  • HES is mainly characterized by the molecular weight distribution and the degree of substitution.
  • the degree of substitution denoted as DS, relates to the molar substitution, is known to the skilled people. See Sommermeyer et al, Rohpharmazie, 8(8), 271-278 (1987), as cited above, in particular p. 273.
  • hydroxyethyl starch has a mean molecular weight (weight mean) of from 1 to 300 kD, from 2 to 200kD, from 3 to 100 kD, or from 4 to 70kD.
  • hydroxyethyl starch can further exhibit a molar degree of substitution of from 0.1 to 3, preferably 0.1 to 2, more preferred, 0.1 to 0.9, preferably 0.1 to 0.8, and a ratio between C2:C6 substitution in the range of from 2 to 20 with respect to the hydroxyethyl groups.
  • HES having a mean molecular weight of about 130 kD is a HES with a degree of substitution of 0.2 to 0.8 such as 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, or 0.8, preferably of 0.4 to 0.7 such as 0.4, 0.5, 0.6, or 0.7.
  • HES with a mean molecular weight of about 130 kD is VOLUVEN ® from Fresenius.
  • VOLUVEN ® is an artificial colloid, employed, e.g., for volume replacement used in the therapeutic indication for therapy and prophylaxis of hypovolaemia.
  • VOLUVEN ® The characteristics of VOLUVEN ® are a mean molecular weight of 130,000+/-20,000 D, a molar substitution of 0.4 and a C2:C6 ratio of about 9:1.
  • ranges of the mean molecular weight of hydroxyethyl starch are, e.g., A to 70 kD or 10 to 70 kD or 12 to 70 kD or 18 to 70 kD or 50 to 70 kD or 4 to 50 kD or 10 to 50 kD or 12 to 50 kD or 18 to 50 kD or 4 to 18 kD or 10 to 18 kD or 12 to 18 kD or 4 to 12 kD or 10 to 12 kD or 4 to 10 kD.
  • the mean molecular weight of hydroxyethyl starch employed is in the range of from more than 4 kD and below 70 kD, such as about 10 kD, or in the range of from 9 to 10 kD or from 10 to 1 1 kD or from 9 to 11 kD, or about 12 kD, or in the range of from 11 to 12 kD) or from 12 to 13 kD or from 1 1 to 13 kD.
  • 18 kD or about 18 kD, or in the range of from 17 to 18 kD or from 18 to 19 kD or from 17 to 19 kD, or about 30 kD, or in the range of from 29 to 30, or from 30 to 31 kD, or about 50 kD, or in the range of from 49 to 50 kD or from 50 to 51 kD or from 49 to 51 kD.
  • the heterologous moiety can be mixtures of hydroxyethyl starches having different mean molecular weights and/or different degrees of substitution and/or different ratios of C2: C6 substitution. Therefore, mixtures of hydroxyethyl starches may be employed having different mean molecular weights and different degrees of substitution and different ratios of C2: C6 substitution, or having different mean molecular weights and different degrees of substitution and the same or about the same ratio of C2:C6 substitution, or having different mean molecular weights and the same or about the same degree of substitution and different ratios of C2:C6 substitution, or having the same or about the same mean molecular weight and different degrees of substitution and different ratios of C2:C6 substitution, or having different mean molecular weights and the same or about the same degree of substitution and the same or about the same ratio of C2:C6 substitution, or having the same or about the same mean molecular weights and different degrees of substitution and the same ratio of C2:C6 substitution, or having the same or about the same
  • VWF protein via a VWF linker or to a FVIH protein via a.
  • FViil linker is a polymer, e.g., polysialic acids (PSAs) or a derivative thereof.
  • PSAs polysialic acids
  • Poly sialic acids (PSAs) are naturally occurring unbranched polymers of sialic acid produced by certain bacterial strains and in mammals in certain cells. Roth J., et al. (1993) in Polysialic Acid: From Microbes to Man, eds. Roth J., Rutishauser U., Troy F. A. (Birkhauser Verlag, Basel, Switzerland), pp 335-348.
  • compositions of different polysialic acids also varies such that there are homopolymeric forms i.e. the alpha-2,8-linked polysialic acid comprising the capsular polysaccharide of E. coli strain Kl and the group-B meningococci, which is also found on the embryonic form of the neuronal cell adhesion molecule (N-CAM).
  • N-CAM neuronal cell adhesion molecule
  • Heteropolymeric forms also exist—such as the alternating alpha-2,8 alpha-2,9 polysialic acid of E. coli strain K92 and group C polysaccharides of N. meningitidis.
  • Sialic acid may also be found in alternating copolymers with monomers other than sialic acid such as group W135 or group Y of K meningitidis.
  • Polysialic acids have important biological functions including the evasion of the immune and complement systems by pathogenic bacteria and the regulation of glial adhesiveness of immature neurons during foetal development (wherein the polymer has an anti-adhesive function) Cho and Troy, P.N.A.S., USA, 91 (1994) 11427-1 1431 , although there are no known receptors for polysialic acids in mammals.
  • the alpha-2,8-linked polysialic acid of E. coli strain Kl is also known as 'colorninic acid' and is used (in various lengths) to exemplify the present invention.
  • Various methods of attaching or conjugating polysialic acids to a polypeptide have been described (for example, see U.S. Pat. No. 5,846,951; WO-A-0187922, and US 2007/0191597 Al, which are incorporated herein by reference in their entireties.
  • XTEN sequence refers to extended length polypeptides with non- naturally occurring, substantially non-repetitive sequences that are composed mainly of small hydrophilic amino acids, with the sequence having a low degree or no secondary or tertiary structure under physiologic conditions.
  • XTENs can serve as a carrier, conferring certain desirable pharmacokinetic, physicochemical and pharmaceutical properties when linked to a VWF protein or a FVTII protein of the invention to create a chimeric protein. Such desirable properties include but are not limited to enhanced pharmacokinetic parameters and solubility characteristics.
  • XTEN specifically excludes antibodies or antibody fragments such as single- chain antibodies or Fc fragments of a light chain or a heavy chain.
  • the XTEN sequence of the invention is a peptide or a polypeptide having greater than about 20, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1200, 1400, 1600, 1800, or 2000 amino acid residues.
  • XTEN is a peptide or a polypeptide having greater than about 20 to about 3000 amino acid residues, greater than 30 to about 2500 residues, greater than 40 to about 2000 residues, greater than 50 to about 1500 residues, greater than 60 to about 1000 residues, greater than 70 to about 900 residues, greater than 80 to about 800 residues, greater than 90 to about 700 residues, greater than 100 to about 600 residues, greater than 110 to about 500 residues, or greater than 120 to about 400 residues.
  • the XTEN sequence of the invention can comprise one or more sequence motif of
  • the XTEN comprises non-overlapping sequence motifs in which about 80%, or at least about 85%, or at least about 90%, or about 91%, or about 92%, or about 93%, or about 94%, or about 95%, or about 96%, or about 97%, or about 98%, or about 99% or about 100% of the sequence consists of multiple units of non- overlapping sequences selected from a single motif family selected from Table 2A, resulting in a family sequence.
  • family means that the XTEN has motifs selected only from a single motif category from Table 2A; i.e., AD, AE, AF, AG, AM, AQ, BC, or BD XTEN, and that any other amino acids in the XTEN not from a family motif are selected to achieve a needed property, such as to permit incorporation of a restriction site by the encoding nucleotides, incorporation of a cleavage sequence, or to achieve a better linkage to FVIII or VWF.
  • an XTEN sequence comprises multiple units of non-overlapping sequence motifs of the AD motif family, or of the AE motif family, or of the AF motif family, or of the AG motif family, or of the AM motif family, or of the AQ motif family, or of the BC family, or of the BD family, with the resulting XTEN exhibiting the range of homology described above.
  • the XTEN comprises multiple units of motif sequences from two or more of the motif families of Table 2A. These sequences can be selected to achieve desired physical/chemical characteristics, including such properties as net charge, hydrophilicity, lack of secondary structure, or lack of repetitiveness that are conferred by
  • XTEN can have varying lengths for insertion into or linkage to FVIII or VWF or any other components of the chimeric molecule.
  • the length of the XTEN sequence(s) is chosen based on the property or function to be achieved in the fusion protein.
  • XTEN can be short or intermediate length sequence or longer sequence that can serve as carriers.
  • the XTEN include short segments of about 6 to about 99 amino acid residues, intermediate lengths of about 100 to about 399 amino acid residues, and longer lengths of about 400 to about 1000 and up to about 3000 amino acid residues.
  • the XTEN inserted into or linked to FVIII or VWF can have lengths of about 6, about 12, about 36, about 40, about 42, about 72, about 96, about 144, about 288, about 400, about 500, about 576, about 600, about 700, about 800, about 864, about 900, about 1000, about 1500, about 2000, about 2500, or up to about 3000 amino acid residues in length.
  • the XTEN sequences is about 6 to about 50, about 50 to about 100, about 100 to 150, about 150 to 250, about 250 to 400, about 400 to about 500, about 500 to about 900, about 900 to 1500, about 1500 to 2000, or about 2000 to about 3000 amino acid residues in length.
  • an XTEN inserted into or linked to FVIII or VWF can vary without adversely affecting the activity of the FVIII or VWF.
  • one or more of the XTEN used herein has 36 amino acids, 42 amino acids, 72 amino acids, 144 amino acids, 288 amino acids, 576 amino acids, or 864 amino acids in length and can be selected from one or more of the XTEN family sequences; i.e., AD, AE, AF, AG, AM, AQ, BC or BD.
  • the XTEN sequence used in the invention is at least 60%
  • the XTEN sequence is selected from the group consisting of AE42, AE864, AE576, AE288, AE144, AG864, AG576, AG288, AG144, and any combinations thereof.
  • the XTEN sequence is AE288.
  • the amino acid sequences for certain XTEN sequences of the invention are shown in Table 2B.
  • the XTEN amino acids that are not glycine (G), alanine (A), serine (S), threonine (T), glutamate (E) and proline (P) are either interspersed throughout the XTEN sequence, are located within or between the sequence motifs, or are concentrated in one or more short stretches of the XTEN sequence, e.g., to create a linker between the XTEN and the other components; e.g., VWF protein.
  • the XTEN component comprises amino acids other than glycine (G), alanine (A), serine (S), threonine (T), glutamate (E) and proline (P)
  • Hydrophobic residues that are less favored in construction of XTEN include tryptophan, phenylalanine, tyrosine, leucine, isoleucine, valine, and methionine.
  • the XTEN sequences can contain less than 5% or less than 4% or less than 3% or less than 2% or less than 1% or none of the following amino acids: cysteine (to avoid disulfide formation and oxidation), methionine (to avoid oxidation), asparagine and glutamine (to avoid desamidation).
  • the XTEN comprising other amino acids in addition to glycine (G), alanine (A), serine (S), threonine (T), glutamate (E) and proline (P) have a sequence with less than 5% of the residues contributing to alpha-helices and beta-sheets as measured by the Chou-Fasman algorithm and have at least 90%, or at least about 95%> or more random coil formation as measured by the GOR algorithm.
  • the XTEN sequence used in the invention affects the physical or chemical property, e.g., pharmacokinetics, of the chimeric protein of the present invention.
  • the XTEN sequence used in the present invention can exhibit one or more of the following advantageous properties: conformational flexibility, enhanced aqueous solubility, high degree of protease resistance, low immunogenicity, low binding to mammalian receptors, or increased hydrodynamic (or Stokes) radii.
  • the XTEN sequence linked to a FVIII protein in this invention increases pharmacokinetic properties such as longer terminal half-life or increased area under the curve (AUC), so that the chimeric protein described herein stays in vivo for an increased period of time compared to wild type I ' V l l l .
  • the XTEN sequence used in this invention increases pharmacokinetic properties such as longer terminal half-life or increased area under the curve (AUC), so that FVIII protein stays in vivo for an increased period of time compared to wild type FVIII.
  • a variety of methods and assays can be employed to determine the physical/chemical properties of proteins comprising the XTEN sequence. Such methods include, but are not limited to analytical centrifugation, EPR, HPLC-ion exchange, HPLC-size exclusion, HPLC-reverse phase, light scattering, capillary electrophoresis, circular dichroism, differential scanning calorimetry, fluorescence, HPLC-ion exchange, HPLC-size exclusion, IR, NMR, Raman spectroscopy, refractometry, and UV/Visible spectroscopy. Additional methods are disclosed in Amau et al, Prot Expr and Purif 48, 1-13 (2006).
  • a "FVIII protein” as used herein means a functional FVIII polypeptide in its normal role in coagulation, unless otherwise specified.
  • the term a FVIII protein includes a functional fragment, variant, analog, or derivative thereof that retains the function of full-length wild-type Factor VIII in the coagulation pathway.
  • a "FVIII protein” is used interchangeably with FVIII polypeptide (or protein) or FVIII. Examples of the FVIII functions include, but not limited to, an ability to activate coagulation, an ability to act as a cofactor for factor IX, or an ability to form a tenase complex with factor IX in the presence of Ca and phospholipids, which then converts Factor X to the activated form Xa.
  • the FVIII protein can be the human, porcine, canine, rat, or murine FVIII protein.
  • comparisons between FVIII from humans and other species have identified conserved residues that are likely to be required for function (Cameron et al, Thromb. Haemost. 79:317-22 (1998); US 6,251,632).
  • a number of tests are available to assess the function of the coagulation system: activated partial thromboplastin time (aPTT) test, chromogenic assay, ROTEM assay, prothrombin time (PT) test (also used to determine INR), fibrinogen testing (often by the Clauss method), platelet count, platelet function testing (often by PFA-100), TCT, bleeding time, mixing test (whether an abnormality corrects if the patient's plasma is mixed with normal plasma), coagulation factor assays, antiphosholipid antibodies, D- dimer, genetic tests (e.g.
  • the aPTT test is a performance indicator measuring the efficacy of both the
  • Intrinsic also referred to the contact activation pathway
  • FIX recombinant clotting factors
  • PT prothrombin time
  • ROTEM analysis provides information on the whole kinetics of haemostasis: clotting time, clot formation, clot stability and lysis.
  • the different parameters in thromboelastometry are dependent on the activity of the plasmatic coagulation system, platelet function, fibrinolysis, or many factors which influence these interactions.
  • This assay can provide a complete view of secondary haemostasis.
  • FVIII polypeptide and polynucleotide sequences are known, as are many functional fragments, mutants and modified versions. Examples of human FVIII sequences (full-length) are shown as subsequences in SEQ ID NO: 16 or 18.
  • FVIII polypeptides include full-length FVIII, full-length FVIII minus Met at the N-terminus, mature FVIII (minus the signal sequence), mature FVIII with an additional
  • FVIII variants include B domain deletions, whether partial or full deletions.
  • the human FVIII B-domain is replaced with the human Factor V B-domain as shown in U.S. Pat. No. 5,004,803.
  • the cDNA sequence encoding human Factor VIII and amino acid sequence are shown in SEQ ID NOs: 1 and 2, respectively, of U.S Patent No. 7,211,559.
  • porcine FVIII sequence is published in Toole, j. J., et al, Proc. Natl. Acad.
  • the FVIII protein (or FVIII portion of a chimeric protein) may be at least 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical to a FVIII amino acid sequence of amino acids 1 to 1438 of SEQ ID NO: 18 or amino acids 1 to 2332 of SEQ ID NO: 16 (without a signal sequence), wherein the FVIII has a clotting activity, e.g., activates Factor IX as a cofactor to convert Factor X to activated Factor X.
  • a clotting activity e.g., activates Factor IX as a cofactor to convert Factor X to activated Factor X.
  • the FVIII (or FVIII portion of a chimeric protein) may be identical to a FVIII amino acid sequence of amino acids 1 to 1438 of SEQ ID NO: 18 or amino acids 1 to 2332 of SEQ ID NO: 16 (without a signal sequence).
  • the FVIII protein may further comprise a signal sequence.
  • the "B-domain" of FVIII is the same as the B-domain known in the art that is defined by internal amino acid sequence identity and sites of proteolytic cleavage, e.g., residues Ser741-Argl648 of full-length human FVIII.
  • the other human FVIII domains are defined by the following amino acid residues: Al, residues Alal- Arg372; A2, residues Ser373-Arg740; A3, residues Serl690-Asn2019; CI, residues Lys2020-Asn2172; C2, residues Ser2173-Tyr2332.
  • the A3-C1-C2 sequence includes residues Serl690-Tyr2332.
  • BDD FVIII B-domain-deleted factor VIE
  • BDD FVIII REFACTO ® (recombinant BDD FVIII), which has the same sequence as the Factor VIII portion of the sequence in Table 5. (BDD FVIII heavy chain is double underlined; B domain is italicized; and BDD FVIII light chain is in plain text).
  • a "B-domain-deleted FVIII" may have the full or partial deletions disclosed in
  • a B-domain-deleted FVIII sequence of the present invention comprises any one of the deletions disclosed at col. 4, line 4 to col. 5, line 28 and Examples 1-5 of U.S. Pat. No. 6,316,226 (also in US 6,346,513).
  • a B-domain deleted Factor VIII is the S743/Q1638 B-domain deleted Factor VIII (SQ BDD FVIII) (e.g., Factor VIII having a deletion from amino acid 744 to amino acid 1637, e.g., Factor VIII having amino acids 1-743 and amino acids 1638-2332 of SEQ ID NO: 16, i.e., SEQ ID NO: 18).
  • a B-domain-deleted FVIII of the present invention has a deletion disclosed at col. 2, lines 26-51 and examples 5-8 of U.S. Patent No. 5,789,203 (also US 6,060,447, US 5,595,886, and US 6,228,620).
  • a B-domain-deleted Factor VIII has a deletion described in col. 1, lines 25 to col. 2, line 40 of US Patent No. 5,972,885; col. 6, lines 1-22 and example 1 of U.S. Patent no. 6,048,720; col. 2, lines 17-46 of U.S. Patent No. 5,543,502; col. 4, line 22 to col. 5, line 36 of U.S. Patent no. 5,171,844; col. 2, lines 55-68, figure 2, and example 1 of U.S. Patent No. 5,112,950; col. 2, line 2 to col. 19, line 21 and table 2 of U.S. Patent No. 4,868,112; col. 2, line 1 to col. 3, line 19, col. 3, line 40 to col.
  • a B-domain-deleted FVIII has a deletion of most of the B domain, but still contains amino-terminal sequences of the B domain that are essential for in vivo proteolytic processing of the primary translation product into two polypeptide chain, as disclosed in WO 91/09122.
  • a B-domain-deleted FVIII is constructed with a deletion of amino acids 747-1638, i.e., virtually a complete deletion of the B domain. Hoeben R.C., et al J Biol. Chem. 265 (13): 7318-7323 (1990).
  • a B- domain-deleted Factor VIII may also contain a deletion of amino acids 771 -1666 or amino acids 868-1562 of FVIII.
  • Additional B domain deletions that are part of the invention include: deletion of amino acids 982 through 1562 or 760 through 1639 (Toole et al, Proc. Natl. Acad. Sci. U.S.A. (1986) 83, 5939-5942)), 797 through 1562 (Eaton, et al. Biochemistry (1986) 25:8343- 8347)), 741 through 1646 (Kaufman (PCT published application No.
  • BDD FVIII includes a FVIII polypeptide containing fragments of the B-domain that retain one or more N- linked g!ycosylation sites, e.g., residues 757, 784, 828, 900, 963, or optionally 943, which correspond to the amino acid sequence of the full-length FVIII sequence.
  • the B-domain fragments include 226 amino acids or 163 amino acids of the B-domain as disclosed in Miao, H.Z., et al, Blood 103(a): 3412-3419 (2004), Kasuda, A, et al, J. Thromb. Haemost. 6: 1352-1359 (2008), and Pipe, S.W., et al, J Thromb. Haemost. 9: 2235-2242 (2011) (i.e., the first 226 amino acids or 163 amino acids of the B domain are retained).
  • the FVIII with a partial B-domain is FVIII198.
  • FVIII198 is a partial B-domain containing single chain FVIIIFc molecule-226N6.
  • BDD FVIII further comprises a point mutation at residue 309 (from Phe to Ser) to improve expression of the BDD FVIII protein. See Miao, H.Z., et al, Blood 103(a): 3412-3419 (2004).
  • the BDD FVIII includes a FVIII polypeptide containing a portion of the B-domain, but not containing one or more furin cleavage sites (e.g., Argl313 and Arg 1648). See Pipe, S.W., et al, J. Thromb. Haemost. 9: 2235-2242 (2011). Each of the foregoing deletions may be made in any FVIII sequence.
  • a FVIII protein useful in the present invention can include FVIII having one or more additional heterologous sequences or chemical or physical modifications therein, which do not affect the FVIII coagulation activity.
  • Such heterologous sequences or chemical or physical modifications can be fused to the C-terminus or N-terminus of the FVIII protein or inserted between one or more of the two amino acid residues in the FVIII protein.
  • Such insertions in the FVIII protein do not affect the FVIII coagulation activity or FVIII function.
  • the insertions improve pharmacokinetic properties of the FVIII protein (e.g., half-life).
  • the insertions can be more than two, three, four, five, or six sites.
  • FVIII is cleaved right after Arginine at amino acid 1648 (in full-length Factor VIII or SEQ ID NO: 16), amino acid 754 (in the S743/Q1638 B- domain deleted Factor VIII or SEQ ID NO: 16), or the corresponding Arginine residue (in other variants), thereby resulting in a heavy chain and a light chain.
  • FVIII comprises a heavy chain and a light chain, which are linked or associated by a metal ion-mediated non-covalent bond.
  • FVIII is a single chain FVIII that has not been cleaved right after Arginine at amino acid 1648 (in full-length FVIII or SEQ ID NO: 16), amino acid 754 (in the S743/Q1638 B-domain-deleted FVIII or SEQ ID NO: 18), or the corresponding Arginine residue (in other variants).
  • a single chain FVIII may comprise one or more amino acid substitutions.
  • the amino acid substitution is at a residue corresponding to residue 1648, residue 1645, or both of full-length mature Factor VIII polypeptide (SEQ ID NO: 16) or residue 754, residue 751, or both of SQ BDD Factor VIII (SEQ ID NO: 18).
  • the amino acid substitution can be any amino acids other than arginine, e.g., isoleucine, leucine, lysine, methionine, phenylalanine, threonine, tryptophan, valine, alanine, asparagine, aspartic acid, cysteine, glutamic acid, glutamine, glycine, proline, selenocysteine, serine, tyrosine, histidine, ornithine, pyrrolysine, or taurine.
  • FVIII can further be cleaved by thrombin and then activated as FVIIIa, serving as a cofactor for activated Factor IX (FIXa).
  • FVIII is cleaved by thrombin after three Arginine residues, at amino acids 372, 740, and 1689 (corresponding to amino acids 372, 740, and 795 in the B-domain deleted FVIII sequence), the cleavage generating FVIIIa having the 50kDa Al, 43kDa A2, and 73kDa A3-C1-C2 chains.
  • the FVIII protein useful for the present invention is non-active FVIII.
  • the FVIII protein is an activated FVIII.
  • the protein having FVIII polypeptide linked to or associated with the VWF protein can comprise a sequence at least 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 16 or 18, wherein the sequence has the FVIII clotting activity, e.g., activating Factor IX as a cofactor to convert Factor X to activated Factor X (FXa).
  • FXa Factor IX as a cofactor to convert Factor X to activated Factor X
  • the FVIII protein further comprises one or more heterologous moieties that are fused to the C-terminus or N-terminus of the FVIII protein or that are inserted between two adjacent amino acids in the FVIII protein.
  • the heterologous moieties comprise an amino acid sequence of at least about 50 amino acids, at least about 100 amino acids, at least about 150 amino acids, at least about 200 amino acids, at least about 250 amino acids, at least about 300 amino acids, at least about 350 amino acids, at least about 400 amino acids, at least about 450 amino acids, at least about 500 amino acids, at least about 550 amino acids, at least about 600 amino acids, at least about 650 amino acids, at least about 700 amino acids, at least about 750 amino acids, at least about 800 amino acids, at least about 850 amino acids, at least about 900 amino acids, at least about 950 amino acids, or at least about 1000 amino acids.
  • the half-life of the chimeric molecule is extended at least about 1.5 times, at least about 2 times, at least about 2.5 times, at least about 3 times, at least about 4 times, at least about 5 times, at least about 6 times, at least about 7 times, at least about 8 times, at least about 9 times, at least about 10 times, at least about 11 times, or at least about 12 times longer than wild-type FVIII.
  • Other exemplary FVIII variants are also disclosed in US Publication No.
  • Also provided in the invention is a polynucleotide encoding the chimeric molecule described herein.
  • a VWF protein is linked to a heterologous moiety via a VWF linker and to a FVIII protein and an XTEN sequence in a chimeric protein as a single polypeptide chain
  • the invention is drawn to a single polynucleotide encoding the single polypeptide chain.
  • a polynucleotide can comprise the first nucleotide region and the second nucleotide region.
  • the first nucleotide region and the second nucleotide region are on the same polynucleotide.
  • the first nucleotide region and the second nucleotide region are on two different polynucleotides (e.g., different vectors).
  • the present invention is directed to a set of polynucleotides comprising a first nucleotide chain and a second nucleotide chain, wherein the first nucleotide chain encodes a VWF protein, an XTEN sequence, a VWF linker, and a heterologous moiety of the chimeric protein and the second nucleotide chain encodes a FVIII protein and a second heterologous moiety.
  • the present invention is directed to a set of polynucleotides comprising a first nucleotide chain and a second nucleotide chain, wherein the first nucleotide chain encodes a VWF protein, and a heterologous moiety of the chimeric protein and the second nucleotide chain encodes a FVIII protein fused to a second heterologous moiety via a FVIII linker, wherein at least one XTEN sequence is fused to the chimeric protein.
  • the present invention is directed to a set of polynucleotides comprising a first nucleotide chain and a second nucleotide chain, wherein the first nucleotide chain encodes a VWF protein, a VWF linker, and a heterologous moiety of the chimeric protein and the second nucleotide chain encodes a FVIII protein, a FVIII linker, and a second heterologous moiety, wherein at least one XTEN sequence is fused to the chimeric protein.
  • the set of polynucleotides further comprises an additional nucleotide chain (e.g., a second nucleotide chain when the chimeric polypeptide is encoded by a single polynucleotide chain or a third nucleotide chain when the chimeric protein is encoded by two polynucleotide chains) which encodes a protein convertase.
  • an additional nucleotide chain e.g., a second nucleotide chain when the chimeric polypeptide is encoded by a single polynucleotide chain or a third nucleotide chain when the chimeric protein is encoded by two polynucleotide chains
  • the protein convertase can be selected from proprotein convertase subtilisin/kexin type 5 (PCS 5 or PC5), proprotein convertase subtilisin/kexin type 7 (PCSK7 or PC5), a yeast Kex 2, proprotein convertase subtilisin/kexin type 3 (PACE or PCSK3), or two or more combinations thereof.
  • the protein convertase is PACE, PC5, or PC7.
  • the protein convertase is PC5 or PC7. See International Application no. PCT/US201 1/043568, which is incorporated herein by reference.
  • the protein convertase is PACE/furin.
  • the invention includes a set of the polynucleotides comprising a first nucleotide sequence encoding a VWF protein comprising a D' domain and a D3 domain of VWF fused to a first heterologous moiety via a VWF linker, a second nucleotide sequence encoding a FVIII protein and a second heterologous moiety, and a third nucleotide sequence encoding a Dl domain and D2 domain of VWF and wherein an XTEN sequence is present either in the first chain or in the second chain.
  • the Dl domain and D2 domain are separately expressed (not linked to the D'D3 domain of the VWF protein) in order for the proper disulfide bond formation and folding of the D'D3 domains.
  • the D1D2 domain expression can either be in cis or trans.
  • an expression vector refers to any nucleic acid construct which contains the necessary elements for the transcription and translation of an inserted coding sequence, or in the case of an RNA viral vector, the necessary elements for replication and translation, when introduced into an appropriate host cell.
  • Expression vectors can include plasmids, phagemids, viruses, and derivatives thereof.
  • Expression vectors of the invention will include polynucleotides encoding the chimeric molecule.
  • a coding sequence for the chimeric molecule is operably linked to an expression control sequence.
  • two nucleic acid sequences are operably linked when they are covalently linked in such a way as to permit each component nucleic acid sequence to retain its functionality.
  • a coding sequence and a gene expression control sequence are said to be operably linked when they are covalently linked in such a way as to place the expression or transcription and/or translation of the coding sequence under the influence or control of the gene expression control sequence.
  • Two DNA sequences are said to be operably linked if induction of a promoter in the 5' gene expression sequence results in the transcription of the coding sequence and if the nature of the linkage between the two DNA sequences does not (1) result in the introduction of a frame-shift mutation, (2) interfere with the ability of the promoter region to direct the transcription of the coding sequence, or (3) interfere with the ability of the corresponding RNA transcript to be translated into a protein.
  • a gene expression sequence would be operably linked to a coding nucleic acid sequence if the gene expression sequence were capable of effecting transcription of that coding nucleic acid sequence such that the resulting transcript is translated into the desired protein or polypeptide.
  • a gene expression control sequence as used herein is any regulatory nucleotide sequence, such as a promoter sequence or promoter-enhancer combination, which facilitates the efficient transcription and translation of the coding nucleic acid to which it is operably linked.
  • the gene expression control sequence may, for example, be a mammalian or viral promoter, such as a constitutive or inducible promoter.
  • Constitutive mammalian promoters include, but are not limited to, the promoters for the following genes: hypoxanthine phosphoribosyl transferase (HPRT), adenosine deaminase, pyruvate kinase, beta-actin promoter, and other constitutive promoters.
  • Exemplary viral promoters which function constitutively in eukaryotic cells include, for example, promoters from the cytomegalovirus (CMV), simian virus (e.g., SV40), papilloma virus, adenovirus, human immunodeficiency virus (HIV), Rous sarcoma virus, cytomegalovirus, the long terminal repeats (LTR) of Moloney leukemia virus, and other retroviruses, and the thymidine kinase promoter of herpes simplex virus.
  • CMV cytomegalovirus
  • simian virus e.g., SV40
  • papilloma virus e.g., SV40
  • HSV40 human immunodeficiency virus
  • HSV human immunodeficiency virus
  • Rous sarcoma virus cytomegalovirus
  • LTR long terminal repeats
  • the promoters useful as gene expression sequences of the invention also include inducible promoter
  • Inducible promoters are expressed in the presence of an inducing agent.
  • the metallothionein promoter is induced to promote transcription and translation in the presence of certain metal ions.
  • Other inducible promoters are known to those of ordinary skill in the art.
  • the gene expression control sequence shall include, as necessary, 5' non-transcribing and 5' non-translating sequences involved with the initiation of transcription and translation, respectively, such as a TATA box, capping sequence, CAAT sequence, and the like.
  • 5' non-transcribing sequences will include a promoter region which includes a promoter sequence for transcriptional control of the operably joined coding nucleic acid.
  • the gene expression sequences optionally include enhancer sequences or upstream activator sequences as desired.
  • Viral vectors include, but are not limited to, nucleic acid sequences from the following viruses: retrovirus, such as Moloney murine leukemia virus, Harvey murine sarcoma virus, murine mammary tumor virus, and Rous sarcoma virus; adenovirus, adeno-associated virus; SV40-type viruses; polyomaviruses; Epstein-Barr viruses; papilloma viruses; herpes virus; vaccinia virus; polio virus; and RNA virus such as a retrovirus.
  • retrovirus such as Moloney murine leukemia virus, Harvey murine sarcoma virus, murine mammary tumor virus, and Rous sarcoma virus
  • adenovirus adeno-associated virus
  • SV40-type viruses polyomaviruses
  • Epstein-Barr viruses Epstein-Barr viruses
  • papilloma viruses herpes virus
  • vaccinia virus vaccinia virus
  • Non-cytopathic viruses include retroviruses, the life cycle of which involves reverse transcription of genomic viral RNA into DNA with subsequent proviral integration into host cellular DNA. Retroviruses have been approved for human gene therapy trials. Most useful are those retroviruses that are replication- deficient (i.e., capable of directing synthesis of the desired proteins, but incapable of manufacturing an infectious particle). Such genetically altered retroviral expression vectors have general utility for the high-efficiency transduction of genes in vivo.
  • the virus is an adeno-associated virus, a double-stranded
  • the adeno-associated virus can be engineered to be replication-deficient and is capable of infecting a wide range of cell types and species, it further has advantages such as heat and lipid solvent stability; high transduction frequencies in cells of diverse lineages, including hemopoietic cells; and lack of superinfection inhibition thus allowing multiple series of transductions.
  • the adeno-associated virus can integrate into human cellular DNA in a site-specific manner, thereby minimizing the possibility of insertional mutagenesis and variability of inserted gene expression characteristic of retroviral infection.
  • adeno-associated virus infections have been followed in tissue culture for greater than 100 passages in the absence of selective pressure, implying that the adeno-associated virus genomic integration is a relatively stable event.
  • the adeno-associated virus can also function in an extrachromosomal fashion.
  • Plasmid vectors have been extensively described in the art and are well-known to those of skill in the art. See, e.g. , Sambrook et al., Molecular Cloning: A Laboratory Manual, Second Edition, Cold Spring Harbor Laboratory Press, 1989. In the last few years, plasmid vectors have been found to be particularly advantageous for delivering genes to cells in vivo because of their inability to replicate within and integrate into a host genome. These plasmids, however, having a promoter compatible with the host cell, can express a peptide from a gene operably encoded within the plasmid.
  • Plasmids available from commercial suppliers include pBR322, pUC18, pUC19, various pcDNA plasmids, pRC/CMV, various pCMV plasmids, pSV40, and pBlueScript. Additional examples of specific plasmids include pcDNA3.1, catalog number V79020; pcDNA3.1/hygro, catalog number V87020; pcDNA4/myc-His, catalog number V86320; and pBudCE4.1, catalog number V53220, all from Invitrogen (Carlsbad, CA.). Other plasmids are well-known to those of ordinary skill in the art.
  • plasmids may be custom designed using standard molecular biology techniques to remove and/or add specific fragments of DNA.
  • Autographa californica nuclear polyhidrosis virus (AcNPV) is used as a vector to express the foreign genes.
  • the virus grows in Spodoptera frugiperda cells.
  • a coding sequence may be cloned into non-essential regions (for example, the polyhedron gene) of the virus and placed under control of an ACNPV promoter (for example, the polyhedron promoter).
  • Another system which can be used to express the proteins of the invention is the glutamine synthetase gene expression system, also referred to as the "GS expression system” (Lonza Biologies PLC, Berkshire UK). This expression system is described in detail in U.S. Pat. No. 5,981,216.
  • a number of viral based expression systems may be utilized.
  • a coding sequence may be ligated to an adenovirus transcription/translation control complex, e.g., the late promoter and tripartite leader sequence.
  • This chimeric gene may then be inserted in the adenovirus genome by in vitro or in vivo recombination. Insertion in a non-essential region of the viral genome (e.g., region El or E3) will result in a recombinant virus that is viable and capable of expressing peptide in infected hosts.
  • the vaccinia 7.5 K promoter may be used. See, e.g., Mackett et al. (1982) Proc Natl Acad Sci USA 79:7415; Mackett et al. (1984) J Virol 49:857; Panicali et al. (1982) Proc Natl Acad Sci USA 79:4927.
  • the polynucleotides can be designed to encode multiple units of the protein of the invention separated by enzymatic cleavage sites.
  • the resulting polypeptide can be cleaved (e.g., by treatment with the appropriate enzyme) in order to recover the polypeptide units.
  • This can increase the yield of polypeptides driven by a single promoter.
  • the translation of each polypeptide encoded by the mR A is directed internally in the transcript; e.g., by an internal ribosome entry site, IRES.
  • the polycistronic construct directs the transcription of a single, large polycistronic mRNA which, in turn, directs the translation of multiple, individual polypeptides. This approach eliminates the production and enzymatic processing of polyproteins and may signif cantly increase the yield of polypeptides driven by a single promoter.
  • Vectors used in transformation will usually contain a selectable marker used to identify transformants. In bacterial systems, this can include an antibiotic resistance gene such as ampicillin or kanamycin. Selectable markers for use in cultured mammalian cells include genes that confer resistance to drugs, such as neomycin, hygromycin, and methotrexate. The selectable marker may be an amplifiable selectable marker. One amplifiable selectable marker is the dihydrofolate reductase (DHFR) gene. Simonsen C C et al. (1983) Proc Natl Acad Sci USA 80:2495-9. Selectable markers are reviewed by Thilly (1986) Mammalian Cell Technology, Butterworth Publishers, Stoneham, Mass., and the choice of selectable markers is well within the level of ordinary skill in the art.
  • DHFR dihydrofolate reductase
  • Selectable markers may be introduced into the cell on a separate plasmid at the same time as the gene of interest, or they may be introduced on the same plasmid. If on the same plasmid, the selectable marker and the gene of interest may be under the control of different promoters or the same promoter, the latter arrangement producing a dicistronic message. Constructs of this type are known in the art (for example, U.S. Pat. No. 4,713,339).
  • the expression vectors can encode for tags that permit easy purification of the recombinantly produced protein.
  • tags include, but are not limited to, vector pUR278 (Ruther et al. (1983) EMBO J 2: 1791), in which coding sequences for the protein to be expressed may be ligated into the vector in frame with the lac z coding region so that a tagged fusion protein is produced;
  • pGEX vectors may be used to express proteins of the invention with a glutathione S-transferase (GST) tag. These proteins are usually soluble and can easily be purified from cells by adsorption to glutathione-agarose beads followed by elution in the presence of free glutathione.
  • the vectors include cleavage sites (thrombin or Factor Xa protease or PRESCISSION PROTEASETM (Pharmacia, Peapack, N. J.)) for easy removal of the tag after purification.
  • the expression vector or vectors are then transfected or co-transfected into a suitable target cell, which will express the polypeptides. Transfection techniques known in the art include, but are not limited to, calcium phosphate precipitation (Wigler et al. (1978) Cell 14:725), electroporation (Neumann et al. (1982) EMBO J 1 :841), and liposome-based reagents.
  • host-expression vector systems may be utilized to express the proteins described herein including both prokaryotic and eukaryotic cells.
  • microorganisms such as bacteria (e.g., E. coli) transformed with recombinant bacteriophage DNA or plasmid DNA expression vectors containing an appropriate coding sequence; yeast or filamentous fungi transformed with recombinant yeast or fungi expression vectors containing an appropriate coding sequence; insect cell systems infected with recombinant virus expression vectors (e.g.
  • baculovirus containing an appropriate coding sequence
  • plant cell systems infected with recombinant virus expression vectors e.g., cauliflower mosaic virus or tobacco mosaic virus
  • recombinant plasmid expression vectors e.g., Ti plasmid
  • animal cell systems including mammalian cells (e.g., HEK 293, CHO, Cos, HeLa, HKB1 1, and BH cells).
  • the host cell is a eukaryotic cell.
  • a eukaryotic cell refers to any animal or plant cell having a definitive nucleus.
  • Eukaryotic cells of animals include cells of vertebrates, e.g., mammals, and cells of invertebrates, e.g., insects.
  • Eukaryotic cells of plants specifically can include, without limitation, yeast cells.
  • a eukaryotic cell is distinct from a prokaryotic cell, e.g., bacteria.
  • the eukaryotic cell is a mammalian cell.
  • a mammalian cell is any cell derived from a mammal. Mammalian cells specifically include, but are not limited to, mammalian cell lines.
  • the mammalian cell is a human cell.
  • the mammalian cell is a HEK 293 cell, which is a human embryonic kidney cell line.
  • HEK 293 cells are available as CRL-1533 from American Type Culture Collection, Manassas, VA, and as 293-H cells, Catalog No. 11631-017 or 293-F cells, Catalog No. 11625-019 from Invitrogen (Carlsbad, Calif).
  • the mammalian cell is a PER.C6 ® cell, which is a human cell line derived from retina. PER.C6 ® cells are available from Crucell (Leiden, The Netherlands).
  • the mammalian cell is a Chinese hamster ovary (CHO) cell. CHO cells are available from American Type Culture Collection, Manassas, VA. (e.g., CHO- Kl; CCL-61).
  • the mammalian cell is a baby hamster kidney (BHK) cell. BHK cells are available from American Type Culture Collection, Manassas, Va. (e.g., CRL-1632).
  • the mammalian cell is a HKB1 1 cell, which is a hybrid cell line of a HEK293 cell and a human B cell line.
  • HKB1 1 cell which is a hybrid cell line of a HEK293 cell and a human B cell line.
  • a plasmid encoding a VWF protein, a VWF linker, a heterologous smoiety or the chimeric protein of the invention further includes a selectable marker, e.g., zeocin resistance, and is transfected into HEK 293 cells, for production of the chimeric protein.
  • a selectable marker e.g., zeocin resistance
  • transfected cells are stably transfected. These cells can be selected and maintained as a stable cell line, using conventional techniques known to those of skill in the art.
  • Host cells containing DNA constructs of the protein are grown in an appropriate growth medium.
  • appropriate growth medium means a medium containing nutrients required for the growth of cells. Nutrients required for cell growth may include a carbon source, a nitrogen source, essential amino acids, vitamins, minerals, and growth factors.
  • the media can contain one or more selection factors.
  • the media can contain bovine calf serum or fetal calf serum (JtCS). In one embodiment, the media contains substantially no IgG.
  • the growth medium will generally select for cells containing the DNA construct by, for example, drug selection or deficiency in an essential nutrient which is complemented by the selectable marker on the DNA construct or co-transfected with the DNA construct.
  • Cultured mammalian cells are generally grown in commercially available serum-containing or serum-free media (e.g., MEM, DMEM, DMEM/F12).
  • the medium is CD293 (Invitrogen, Carlsbad, CA.).
  • the medium is CD 17 (Invitrogen, Carlsbad, CA.). Selection of a medium appropriate for the particular cell line used is within the level of those ordinary skilled in the art.
  • the host cells are cultured under conditions that allow expression of both chains.
  • culturing refers to maintaining living cells in vitro for at least a definite time. Maintaining can, but need not include, an increase in population of living cells.
  • cells maintained in culture can be static in population, but still viable and capable of producing a desired product, e.g., a recombinant protein or recombinant fusion protein.
  • Suitable conditions for culturing eukaryotic cells are well known in the art and include appropriate selection of culture media, media supplements, temperature, pH, oxygen saturation, and the like.
  • culturing can include the use of any of various types of scale-up systems including shaker flasks, roller bottles, hollow fiber bioreactors, stirred-tank bioreactors, airlift bioreactors, Wave bioreactors, and others.
  • the cell culture conditions are also selected to allow association of the first chain and the second chain in the chimeric molecule.
  • Conditions that allow expression of the chimeric molecule may include the presence of a source of vitamin K.
  • stably transfected HEK 293 cells are cultured in CD293 media (Invitrogen, Carlsbad, CA) or OptiCHO media (Invitrogen, Carlsbad, CA) supplemented with 4 mM glutamine.
  • the present invention is directed to a method of expressing, making, or producing the chimeric protein comprising a) transfecting a host cell with a polynucleotide encoding the chimeric molecule and b) culturing the host cell in a culture medium under a condition suitable for expressing the chimeric molecule, wherein the chimeric molecule is expressed.
  • the protein product containing the chimeric molecule is secreted into the media.
  • Media is separated from the cells, concentrated, filtered, and then passed over two or three affinity columns, e.g., a protein A column and one or two anion exchange columns.
  • the present invention relates to the chimeric polypeptide produced by the methods described herein.
  • the invention also includes a method of improving FVIII activity of a chimeric fVITI protein comprising a VWF protein fused to a first heterologous moiety and an XTEN sequence and a FVIII protein fused to a second heterologous moiety, the method comprising inserting a VWF linker between the VWF protein and the first heterologous moiety, wherein the VWF linker comprises a polypeptide selected from: (i) an a2 region from Factor VIII (FVIII); (ii) an al region from FVIII; (iii) an a3 region from FVIII; (iv) a thrombin cleavage site which comprises X-V-P-R (SEQ ID NO: 3) and a PARI exosite interaction motif, wherein X is an aliphatic amino acid; or (v) any combination thereof.
  • the FVIII activity is measured by aPTT assay or ROTEM assay.
  • compositions containing the chimeric molecule of the present invention may contain a suitable pharmaceutically acceptable carrier.
  • suitable pharmaceutically acceptable carrier may contain excipients and/or auxiliaries that facilitate processing of the active compounds into preparations designed for delivery to the site of action.
  • the pharmaceutical composition can be formulated for parenteral administration
  • Formulations for injection can be presented in unit dosage form, e.g., in ampoules or in multidose containers with an added preservative.
  • the compositions can take such forms as suspensions, solutions, or emulsions in oily or aqueous vehicles, and contain formulatory agents such as suspending, stabilizing and/or dispersing agents.
  • the active ingredient can be in powder form for constitution with a suitable vehicle, e.g., pyrogen free water.
  • Suitable formulations for parenteral administration also include aqueous solutions of the active compounds in water-soluble form, for example, water-soluble salts.
  • suspensions of the active compounds as appropriate oily injection suspensions may be administered.
  • Suitable lipophilic solvents or vehicles include fatty oils, for example, sesame oil, or synthetic fatty acid esters, for example, ethyl oleate or triglycerides.
  • Aqueous injection suspensions .play contain substances, which increase the viscosity of the suspension, including, for example, sodium carboxymethyl cellulose, sorbitol and dextran.
  • the suspension may also contain stabilizers.
  • Liposomes also can be used to encapsulate the molecules of the invention for delivery into cells or interstitial spaces.
  • exemplary pharmaceutically acceptable carriers are physiologically compatible solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, water, saline, phosphate buffered saline, dextrose, glycerol, ethanol and the like.
  • the composition comprises isotonic agents, for example, sugars, polyalcohols such as mannitol, sorbitol, or sodium chloride.
  • the compositions comprise pharmaceutically acceptable substances such as wetting agents or minor amounts of auxiliary substances such as wetting or emulsifying agents, preservatives or buffers, which enhance the shelf life or effectiveness of the active ingredients.
  • compositions of the invention may be in a variety of forms, including, for example, liquid (e.g., injectable and infusible solutions), dispersions, suspensions, semisolid and solid dosage forms.
  • liquid e.g., injectable and infusible solutions
  • dispersions e.g., dispersions, suspensions, semisolid and solid dosage forms.
  • suspensions e.g., semisolid and solid dosage forms.
  • solid dosage forms e.g., liquid (e.g., injectable and infusible solutions), dispersions, suspensions, semisolid and solid dosage forms.
  • the preferred form depends on the mode of administration and therapeutic application.
  • the composition can be formulated as a solution, micro emulsion, dispersion, liposome, or other ordered structure suitable to high drug concentration.
  • Sterile injectable solutions can be prepared by incorporating the active ingredient in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization.
  • dispersions are prepared by incorporating the active ingredient into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above.
  • the preferred methods of preparation are vacuum drying and freeze-drying that yields a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution.
  • the proper fluidity of a solution can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
  • Prolonged absorption of injectable compositions can be brought about by including in the composition an agent that delays absorption, for example, monostearate salts and gelatin.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Veterinary Medicine (AREA)
  • Engineering & Computer Science (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Hematology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Zoology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Immunology (AREA)
  • Toxicology (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Epidemiology (AREA)
  • Neurology (AREA)
  • Rheumatology (AREA)
  • Diabetes (AREA)
  • Dermatology (AREA)
  • Biomedical Technology (AREA)
  • Neurosurgery (AREA)
  • Biotechnology (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Medicinal Preparation (AREA)
PCT/US2014/044731 2013-06-28 2014-06-27 Thrombin cleavable linker with xten and its uses thereof Ceased WO2014210558A1 (en)

Priority Applications (25)

Application Number Priority Date Filing Date Title
JP2016524268A JP2016523919A (ja) 2013-06-28 2014-06-27 Xtenを有するトロンビン切断可能リンカー及びその使用
AU2014302100A AU2014302100B2 (en) 2013-06-28 2014-06-27 Thrombin cleavable linker with XTEN and its uses thereof
MX2015016567A MX2015016567A (es) 2013-06-28 2014-06-27 Enlazador escindible por trombina con xten y usos del mismo.
CA2913078A CA2913078A1 (en) 2013-06-28 2014-06-27 Thrombin cleavable linker with xten and its uses thereof
KR1020227045978A KR20230007555A (ko) 2013-06-28 2014-06-27 Xten을 지닌 트롬빈 절단가능한 링커 및 이의 용도
EP14817900.5A EP3013358A4 (en) 2013-06-28 2014-06-27 Thrombin cleavable linker with xten and its uses thereof
CN201480029781.5A CN105392495A (zh) 2013-06-28 2014-06-27 具有xten的凝血酶可裂解连接子和其用途
BR112015031194-6A BR112015031194B1 (pt) 2013-06-28 2014-06-27 Molécula quimérica, composição farmacêutica, e uso dos anteriores
KR1020247004922A KR102714760B1 (ko) 2013-06-28 2014-06-27 Xten을 지닌 트롬빈 절단가능한 링커 및 이의 용도
HK16111718.0A HK1223302A1 (zh) 2013-06-28 2014-06-27 具有xten的凝血酶可裂解连接子和其用途
SG11201509313PA SG11201509313PA (en) 2013-06-28 2014-06-27 Thrombin cleavable linker with xten and its uses thereof
EA201592022A EA201592022A1 (ru) 2013-06-28 2014-06-27 Расщепляемый тромбином линкер, содержащий xten, и его применение
KR1020157033268A KR102666819B1 (ko) 2013-06-28 2014-06-27 Xten을 지닌 트롬빈 절단가능한 링커 및 이의 용도
US14/894,108 US20160251408A1 (en) 2013-06-28 2014-06-27 Thrombin cleavable linker with xten and its uses thereof
IL297611A IL297611B2 (en) 2013-06-28 2014-06-27 Thrombin cleavable linker with xten and its uses thereof
NZ713904A NZ713904A (en) 2013-06-28 2014-06-27 Thrombin cleavable linker with xten and its uses thereof
EP24150415.8A EP4368194A3 (en) 2013-06-28 2014-06-27 Thrombin cleavable linker with xten and its uses thereof
KR1020247032926A KR102865153B1 (ko) 2013-06-28 2014-06-27 Xten을 지닌 트롬빈 절단가능한 링커 및 이의 용도
IL242436A IL242436B (en) 2013-06-28 2015-11-04 A dissociable thrombin linker with castane and its uses
PH12015502614A PH12015502614A1 (en) 2013-06-28 2015-11-24 Thrombin cleavable linker with xten and its uses thereof
IL266462A IL266462B2 (en) 2013-06-28 2019-05-05 Binding of thrombin that degrades with castane and uses thereof
AU2020203063A AU2020203063B2 (en) 2013-06-28 2020-05-08 Thrombin cleavable linker with XTEN and its uses thereof
US17/479,705 US20220106383A1 (en) 2013-06-28 2021-09-20 Thrombin cleavable linker with xten and its uses thereof
US18/358,601 US20240083975A1 (en) 2013-06-28 2023-07-25 Thrombin cleavable linker with xten and its uses thereof
AU2023219840A AU2023219840A1 (en) 2013-06-28 2023-08-22 Thrombin cleavable linker with XTEN and its uses thereof

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201361840872P 2013-06-28 2013-06-28
US61/840,872 2013-06-28

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US14/894,108 A-371-Of-International US20160251408A1 (en) 2013-06-28 2014-06-27 Thrombin cleavable linker with xten and its uses thereof
US17/479,705 Continuation US20220106383A1 (en) 2013-06-28 2021-09-20 Thrombin cleavable linker with xten and its uses thereof

Publications (1)

Publication Number Publication Date
WO2014210558A1 true WO2014210558A1 (en) 2014-12-31

Family

ID=52142742

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2014/044731 Ceased WO2014210558A1 (en) 2013-06-28 2014-06-27 Thrombin cleavable linker with xten and its uses thereof

Country Status (17)

Country Link
US (3) US20160251408A1 (https=)
EP (2) EP4368194A3 (https=)
JP (6) JP2016523919A (https=)
KR (4) KR20230007555A (https=)
CN (3) CN113817069A (https=)
AU (3) AU2014302100B2 (https=)
CA (1) CA2913078A1 (https=)
CL (1) CL2015003710A1 (https=)
EA (1) EA201592022A1 (https=)
HK (1) HK1223302A1 (https=)
IL (3) IL297611B2 (https=)
MX (1) MX2015016567A (https=)
NZ (1) NZ713904A (https=)
PH (1) PH12015502614A1 (https=)
SG (3) SG10201710616XA (https=)
TW (3) TWI716340B (https=)
WO (1) WO2014210558A1 (https=)

Cited By (14)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9376672B2 (en) 2009-08-24 2016-06-28 Amunix Operating Inc. Coagulation factor IX compositions and methods of making and using same
US20180043012A1 (en) * 2015-03-06 2018-02-15 Csl Behring Recombinant Facility Ag Compounds for improving the half-life of von willebrand factor
EP2870250B1 (en) 2012-07-06 2018-04-18 Bioverativ Therapeutics Inc. Cell line expressing single chain factor viii polypeptides and uses thereof
US10138291B2 (en) 2012-07-11 2018-11-27 Bioverativ Therapeutics Inc. Factor VIII complex with XTEN and von Willebrand Factor protein, and uses thereof
US10370430B2 (en) 2012-02-15 2019-08-06 Bioverativ Therapeutics Inc. Recombinant factor VIII proteins
US10421798B2 (en) 2012-02-15 2019-09-24 Bioverativ Therapeutics Inc. Factor VIII compositions and methods of making and using same
US10548953B2 (en) 2013-08-14 2020-02-04 Bioverativ Therapeutics Inc. Factor VIII-XTEN fusions and uses thereof
US10745680B2 (en) 2015-08-03 2020-08-18 Bioverativ Therapeutics Inc. Factor IX fusion proteins and methods of making and using same
US11046749B2 (en) 2016-06-24 2021-06-29 Mogam Institute For Biomedical Research Chimera protein comprising FVIII and vWF factors, and use thereof
US11192936B2 (en) 2014-01-10 2021-12-07 Bioverativ Therapeutics Inc. Factor VIII chimeric proteins and uses thereof
US11370827B2 (en) 2012-01-12 2022-06-28 Bioverativ Therapeutics Inc. Chimeric factor VIII polypeptides and uses thereof
US11814421B2 (en) * 2016-11-11 2023-11-14 CSL Behring Lengnau AG Truncated von Willebrand Factor polypeptides for treating hemophilia
US12030925B2 (en) 2018-05-18 2024-07-09 Bioverativ Therapeutics Inc. Methods of treating hemophilia A
US12161696B2 (en) 2016-12-02 2024-12-10 Bioverativ Therapeutics Inc. Methods of treating hemophilic arthropathy using chimeric clotting factors

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
MY204234A (en) 2018-08-27 2024-08-16 Regeneron Pharma Use of raman spectroscopy in downstream purification

Citations (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2010060081A1 (en) * 2008-11-24 2010-05-27 Bayer Healthcare Llc Method of determining pegylated blood coagulation factor activity in a silica-based activated partial thromboplastin time assay
US20110183907A1 (en) * 2008-06-24 2011-07-28 Thomas Weimer Factor viii, von willebrand factor or complexes thereof with prolonged in vivo half-life
US20120178691A1 (en) * 2010-08-19 2012-07-12 Amunix Operating Inc. Factor viii compositions and methods of making and using same
US20120289468A1 (en) * 2009-11-13 2012-11-15 Grifols Therapeutics Inc. Von willebrand factor (vwf)-containing preparations, and methods, kits, and uses related thereto
US20130108629A1 (en) * 2009-12-06 2013-05-02 Biogen Idec Hemophilia Inc. Factor VIII-Fc Chimeric and Hybrid Polypeptides, and Methods of Use Thereof
WO2013106787A1 (en) * 2012-01-12 2013-07-18 Biogen Idec Ma Inc. Chimeric factor viii polypeptides and uses thereof
WO2013122617A1 (en) * 2012-02-15 2013-08-22 Amunix Operating Inc. Factor viii compositions and methods of making and using same

Family Cites Families (82)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4179337A (en) 1973-07-20 1979-12-18 Davis Frank F Non-immunogenic polypeptides
US4215051A (en) 1979-08-29 1980-07-29 Standard Oil Company (Indiana) Formation, purification and recovery of phthalic anhydride
US4713339A (en) 1983-01-19 1987-12-15 Genentech, Inc. Polycistronic expression vector construction
US4757006A (en) 1983-10-28 1988-07-12 Genetics Institute, Inc. Human factor VIII:C gene and recombinant methods for production
US4965199A (en) 1984-04-20 1990-10-23 Genentech, Inc. Preparation of functional human factor VIII in mammalian cells using methotrexate based selection
US4683195A (en) 1986-01-30 1987-07-28 Cetus Corporation Process for amplifying, detecting, and/or-cloning nucleic acid sequences
US4683202A (en) 1985-03-28 1987-07-28 Cetus Corporation Process for amplifying nucleic acid sequences
US4965188A (en) 1986-08-22 1990-10-23 Cetus Corporation Process for amplifying, detecting, and/or cloning nucleic acid sequences using a thermostable enzyme
US5981216A (en) 1985-04-01 1999-11-09 Alusuisse Holdings A.G. Transformed myeloma cell-line and a process for the expression of a gene coding for a eukaryotic polypeptide employing same
ATE72838T1 (de) 1985-04-12 1992-03-15 Genetics Inst Neue prokoagulierungsproteine.
KR910006424B1 (ko) 1985-08-21 1991-08-24 인코텍스 비.브이 편성브리프(brief) 제조방법
DE3785102T2 (de) 1986-01-03 1993-07-22 Genetics Inst Verfahren zur herstellung von faktor-viii:c-typ-proteinen.
US5595886A (en) 1986-01-27 1997-01-21 Chiron Corporation Protein complexes having Factor VIII:C activity and production thereof
US4800159A (en) 1986-02-07 1989-01-24 Cetus Corporation Process for amplifying, detecting, and/or cloning nucleic acid sequences
US5543502A (en) 1986-06-24 1996-08-06 Novo Nordisk A/S Process for producing a coagulation active complex of factor VIII fragments
US4912040A (en) 1986-11-14 1990-03-27 Genetics Institute, Inc. Eucaryotic expression system
CA1331157C (en) 1987-04-06 1994-08-02 Randal J. Kaufman Method for producing factor viii:c-type proteins
US6060447A (en) 1987-05-19 2000-05-09 Chiron Corporation Protein complexes having Factor VIII:C activity and production thereof
US6346513B1 (en) 1987-06-12 2002-02-12 Baxter Trading Gmbh Proteins with factor VIII activity: process for their preparation using genetically-engineered cells and pharmaceutical compositions containing them
IL86693A (en) 1987-06-12 1994-06-24 Stichting Centraal Lab Proteins with factor VIII activity, process for their preparation using genetically engineered cells and pharmaceutical compositions containing them
DE3720246A1 (de) 1987-06-19 1988-12-29 Behringwerke Ag Faktor viii:c-aehnliches molekuel mit koagulationsaktivitaet
FR2619314B1 (fr) 1987-08-11 1990-06-15 Transgene Sa Analogue du facteur viii, procede de preparation et composition pharmaceutique le contenant
US4994371A (en) 1987-08-28 1991-02-19 Davie Earl W DNA preparation of Christmas factor and use of DNA sequences
US5004803A (en) 1988-11-14 1991-04-02 Genetics Institute, Inc. Production of procoagulant proteins
SE465222C5 (sv) 1989-12-15 1998-02-10 Pharmacia & Upjohn Ab Ett rekombinant, humant faktor VIII-derivat och förfarande för dess framställning
US5846951A (en) 1991-06-06 1998-12-08 The School Of Pharmacy, University Of London Pharmaceutical compositions
US6376463B1 (en) 1992-04-07 2002-04-23 Emory University Modified factor VIII
US5364771A (en) 1992-04-07 1994-11-15 Emory University Hybrid human/porcine factor VIII
US5859204A (en) 1992-04-07 1999-01-12 Emory University Modified factor VIII
US6037452A (en) * 1992-04-10 2000-03-14 Alpha Therapeutic Corporation Poly(alkylene oxide)-Factor VIII or Factor IX conjugate
US5563045A (en) 1992-11-13 1996-10-08 Genetics Institute, Inc. Chimeric procoagulant proteins
SE504074C2 (sv) 1993-07-05 1996-11-04 Pharmacia Ab Proteinberedning för subkutan, intramuskulär eller intradermal administrering
US5643575A (en) 1993-10-27 1997-07-01 Enzon, Inc. Non-antigenic branched polymer conjugates
US6485726B1 (en) 1995-01-17 2002-11-26 The Brigham And Women's Hospital, Inc. Receptor specific transepithelial transport of therapeutics
US6086875A (en) 1995-01-17 2000-07-11 The Brigham And Women's Hospital, Inc. Receptor specific transepithelial transport of immunogens
US6030613A (en) 1995-01-17 2000-02-29 The Brigham And Women's Hospital, Inc. Receptor specific transepithelial transport of therapeutics
SE9503380D0 (sv) 1995-09-29 1995-09-29 Pharmacia Ab Protein derivatives
US6458563B1 (en) 1996-06-26 2002-10-01 Emory University Modified factor VIII
CA2225189C (en) 1997-03-06 2010-05-25 Queen's University At Kingston Canine factor viii gene, protein and methods of use
GB9722131D0 (en) 1997-10-20 1997-12-17 Medical Res Council Method
CA2378473A1 (en) * 1999-07-23 2001-02-01 The Regents Of The University Of California Modulation of platelet activation
EP2206720A1 (en) 2000-04-12 2010-07-14 Human Genome Sciences, Inc. Albumin fusion proteins
AU2001258536A1 (en) 2000-05-16 2001-11-26 Lipoxen Technologies Limited Derivatisation of proteins in aqueous solution
US20030228309A1 (en) * 2000-11-08 2003-12-11 Theodora Salcedo Antibodies that immunospecifically bind to TRAIL receptors
US7211395B2 (en) 2001-03-09 2007-05-01 Dyax Corp. Serum albumin binding moieties
US20080194481A1 (en) 2001-12-21 2008-08-14 Human Genome Sciences, Inc. Albumin Fusion Proteins
KR101271635B1 (ko) 2001-12-21 2013-06-12 휴먼 게놈 사이언시즈, 인코포레이티드 알부민 융합 단백질
EP2261250B1 (en) 2001-12-21 2015-07-01 Human Genome Sciences, Inc. GCSF-Albumin fusion proteins
AU2002316574B2 (en) 2002-03-15 2008-05-01 Brandeis University Central airway administration for systemic delivery of therapeutics
US7041635B2 (en) 2003-01-28 2006-05-09 In2Gen Co., Ltd. Factor VIII polypeptide
WO2004075923A2 (en) 2003-02-26 2004-09-10 Nektar Therapeutics Al, Corporation Polymer-factor viii moiety conjugates
CA2515798A1 (en) * 2003-02-27 2004-09-10 Her Majesty The Queen In Right Of Canada, As Represented By The Minister Of National Research Council Of Canada Peptide inhibitors of thrombin as potent anticoagulants
WO2005016974A1 (en) 2003-08-12 2005-02-24 Lipoxen Technologies Limited Sialic acid derivatives for protein derivatisation and conjugation
US7211559B2 (en) 2003-10-31 2007-05-01 University Of Maryland, Baltimore Factor VIII compositions and methods
GB0516091D0 (en) * 2005-08-04 2005-09-14 Haemostatix Ltd Therapeutic agent
MX2008001865A (es) 2005-08-12 2008-04-15 Human Genome Sciences Inc Proteinas de fusion de albumina.
US7846445B2 (en) * 2005-09-27 2010-12-07 Amunix Operating, Inc. Methods for production of unstructured recombinant polymers and uses thereof
JP2010503396A (ja) 2006-09-14 2010-02-04 ヒューマン ジノーム サイエンシーズ, インコーポレイテッド アルブミン融合タンパク質
US20100041872A1 (en) * 2006-10-04 2010-02-18 Defrees Shawn Glycerol linked pegylated sugars and glycopeptides
AU2007338298B2 (en) * 2006-12-22 2013-02-07 Csl Behring Gmbh Modified coagulation factors with prolonged in vivo half-life
ATE502114T1 (de) 2007-06-21 2011-04-15 Univ Muenchen Tech Biologisch aktive proteine mit erhöhter in-vivo- und/oder in-vitro-stabilität
CA2704234A1 (en) * 2007-11-09 2009-05-14 Baxter International Inc. Modified recombinant factor viii and von willebrand factor and methods of use
CA2748314C (en) * 2009-02-03 2018-10-02 Amunix Operating Inc. Extended recombinant polypeptides and compositions comprising same
US8703717B2 (en) 2009-02-03 2014-04-22 Amunix Operating Inc. Growth hormone polypeptides and methods of making and using same
US8680050B2 (en) 2009-02-03 2014-03-25 Amunix Operating Inc. Growth hormone polypeptides fused to extended recombinant polypeptides and methods of making and using same
WO2010111414A1 (en) * 2009-03-24 2010-09-30 Bayer Healthcare Llc Factor viii variants and methods of use
SI2440241T1 (sl) 2009-06-08 2017-11-30 Amunix Operating Inc. Polipeptidni rastni hormoni in postopki za njihovo izdelavo in uporabo
JP5839597B2 (ja) 2009-06-08 2016-01-06 アムニクス オペレーティング インコーポレイテッド グルコース調節ポリペプチド並びにその作成及び使用方法
AU2010290131C1 (en) * 2009-08-24 2015-12-03 Amunix Operating Inc. Coagulation factor VII compositions and methods of making and using same
WO2011028344A2 (en) 2009-08-25 2011-03-10 Amunix Operating Inc. Interleukin-1 receptor antagonist compositions and methods of making and using same
JP5544219B2 (ja) * 2009-09-24 2014-07-09 富士フイルム株式会社 内視鏡システム
US20110312881A1 (en) * 2009-12-21 2011-12-22 Amunix, Inc. Bifunctional polypeptide compositions and methods for treatment of metabolic and cardiovascular diseases
EP2591101B1 (en) 2010-07-09 2018-11-07 Bioverativ Therapeutics Inc. Systems for factor viii processing and methods thereof
SG10201505217WA (en) 2010-07-09 2015-08-28 Biogen Hemophilia Inc Chimeric clotting factors
CA2864126A1 (en) 2012-02-15 2013-08-22 Biogen Idec Ma Inc. Recombinant factor viii proteins
JP2015515482A (ja) * 2012-04-24 2015-05-28 ノヴォ ノルディスク アー/エス 血友病の治療に適する化合物
HRP20200007T1 (hr) * 2012-07-11 2020-03-20 Bioverativ Therapeutics Inc. Kompleks proteina faktora viii s xten i von willebrandovim faktorom, te njegova uporaba
EP2796145B1 (en) * 2013-04-22 2017-11-01 CSL Ltd. A covalent complex of von willebrand factor and faktor viii linked by a disulphide bridge
TW201536811A (zh) * 2013-05-31 2015-10-01 Biogen Idec Inc 嵌合fvii-xten分子及其用途
WO2014210547A1 (en) * 2013-06-28 2014-12-31 Biogen Idec Ma Inc. Thrombin cleavable linker
AU2015204646B2 (en) * 2014-01-10 2020-08-27 Bioverativ Therapeutics Inc. Factor VIII chimeric proteins and uses thereof
BR112020022164A2 (pt) * 2018-05-18 2021-02-02 Bioverativ Therapeutics Inc. métodos de tratamento de hemofilia a

Patent Citations (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20110183907A1 (en) * 2008-06-24 2011-07-28 Thomas Weimer Factor viii, von willebrand factor or complexes thereof with prolonged in vivo half-life
WO2010060081A1 (en) * 2008-11-24 2010-05-27 Bayer Healthcare Llc Method of determining pegylated blood coagulation factor activity in a silica-based activated partial thromboplastin time assay
US20120289468A1 (en) * 2009-11-13 2012-11-15 Grifols Therapeutics Inc. Von willebrand factor (vwf)-containing preparations, and methods, kits, and uses related thereto
US20130108629A1 (en) * 2009-12-06 2013-05-02 Biogen Idec Hemophilia Inc. Factor VIII-Fc Chimeric and Hybrid Polypeptides, and Methods of Use Thereof
US20120178691A1 (en) * 2010-08-19 2012-07-12 Amunix Operating Inc. Factor viii compositions and methods of making and using same
WO2013106787A1 (en) * 2012-01-12 2013-07-18 Biogen Idec Ma Inc. Chimeric factor viii polypeptides and uses thereof
WO2013122617A1 (en) * 2012-02-15 2013-08-22 Amunix Operating Inc. Factor viii compositions and methods of making and using same

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
PETERS ET AL.: "Biochemical and functional characterization of a recombinant monomeric factor VIII-Fc fusion protein", JOURNAL OF THROMBOSIS AND HAEMOSTASIS, vol. 11, no. 1, 1 January 2013 (2013-01-01), pages 132 - 141, XP055092640, DOI: 10.1111/JTH.12076 *

Cited By (18)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9758776B2 (en) 2009-08-24 2017-09-12 Amunix Operating Inc. Coagulation factor IX compositions and methods of making and using same
US9376672B2 (en) 2009-08-24 2016-06-28 Amunix Operating Inc. Coagulation factor IX compositions and methods of making and using same
US11370827B2 (en) 2012-01-12 2022-06-28 Bioverativ Therapeutics Inc. Chimeric factor VIII polypeptides and uses thereof
US11685771B2 (en) 2012-02-15 2023-06-27 Bioverativ Therapeutics Inc. Recombinant factor VIII proteins
US10370430B2 (en) 2012-02-15 2019-08-06 Bioverativ Therapeutics Inc. Recombinant factor VIII proteins
US10421798B2 (en) 2012-02-15 2019-09-24 Bioverativ Therapeutics Inc. Factor VIII compositions and methods of making and using same
EP2870250B1 (en) 2012-07-06 2018-04-18 Bioverativ Therapeutics Inc. Cell line expressing single chain factor viii polypeptides and uses thereof
EP2870250B2 (en) 2012-07-06 2022-06-29 Bioverativ Therapeutics Inc. Cell line expressing single chain factor viii polypeptides and uses thereof
US10138291B2 (en) 2012-07-11 2018-11-27 Bioverativ Therapeutics Inc. Factor VIII complex with XTEN and von Willebrand Factor protein, and uses thereof
US11091534B2 (en) 2012-07-11 2021-08-17 Bioverativ Therapeutics Inc. Factor VIII complex with XTEN and von Willebrand Factor protein, and uses thereof
US10548953B2 (en) 2013-08-14 2020-02-04 Bioverativ Therapeutics Inc. Factor VIII-XTEN fusions and uses thereof
US11192936B2 (en) 2014-01-10 2021-12-07 Bioverativ Therapeutics Inc. Factor VIII chimeric proteins and uses thereof
US20180043012A1 (en) * 2015-03-06 2018-02-15 Csl Behring Recombinant Facility Ag Compounds for improving the half-life of von willebrand factor
US10745680B2 (en) 2015-08-03 2020-08-18 Bioverativ Therapeutics Inc. Factor IX fusion proteins and methods of making and using same
US11046749B2 (en) 2016-06-24 2021-06-29 Mogam Institute For Biomedical Research Chimera protein comprising FVIII and vWF factors, and use thereof
US11814421B2 (en) * 2016-11-11 2023-11-14 CSL Behring Lengnau AG Truncated von Willebrand Factor polypeptides for treating hemophilia
US12161696B2 (en) 2016-12-02 2024-12-10 Bioverativ Therapeutics Inc. Methods of treating hemophilic arthropathy using chimeric clotting factors
US12030925B2 (en) 2018-05-18 2024-07-09 Bioverativ Therapeutics Inc. Methods of treating hemophilia A

Also Published As

Publication number Publication date
EP4368194A2 (en) 2024-05-15
TWI770467B (zh) 2022-07-11
JP2021072853A (ja) 2021-05-13
IL266462B (en) 2022-12-01
JP7623426B2 (ja) 2025-01-28
SG10201710616XA (en) 2018-02-27
AU2023219840A1 (en) 2023-09-14
US20220106383A1 (en) 2022-04-07
PH12015502614A1 (en) 2016-02-29
IL266462A (en) 2019-06-30
IL297611B1 (en) 2025-07-01
EA201592022A1 (ru) 2016-05-31
JP2025061316A (ja) 2025-04-10
JP7297837B2 (ja) 2023-06-26
AU2020203063A1 (en) 2020-05-28
HK1223302A1 (zh) 2017-07-28
CN105392495A (zh) 2016-03-09
EP3013358A1 (en) 2016-05-04
IL297611A (en) 2022-12-01
JP7005800B2 (ja) 2022-02-10
KR20240148954A (ko) 2024-10-11
JP2022000053A (ja) 2022-01-04
JP2019010124A (ja) 2019-01-24
IL266462B2 (en) 2023-04-01
TWI844042B (zh) 2024-06-01
TWI716340B (zh) 2021-01-21
MX2015016567A (es) 2016-03-31
US20160251408A1 (en) 2016-09-01
KR102714760B9 (ko) 2025-09-15
KR102865153B1 (ko) 2025-09-29
EP3013358A4 (en) 2017-03-22
SG10201913738YA (en) 2020-03-30
BR112015031194A2 (pt) 2017-09-19
AU2014302100A1 (en) 2015-11-26
TW202313672A (zh) 2023-04-01
TW201514204A (zh) 2015-04-16
US20240083975A1 (en) 2024-03-14
EP4368194A3 (en) 2024-07-31
JP2016523919A (ja) 2016-08-12
KR102714760B1 (ko) 2024-10-11
CA2913078A1 (en) 2014-12-31
CL2015003710A1 (es) 2016-08-26
KR20230007555A (ko) 2023-01-12
TW202045535A (zh) 2020-12-16
NZ713904A (en) 2022-02-25
JP2023107932A (ja) 2023-08-03
AU2020203063B2 (en) 2023-05-25
KR20240023705A (ko) 2024-02-22
KR102666819B1 (ko) 2024-05-23
AU2014302100B2 (en) 2020-02-13
KR20160023654A (ko) 2016-03-03
IL242436B (en) 2019-05-30
SG11201509313PA (en) 2016-01-28
CN113817069A (zh) 2021-12-21
IL297611B2 (en) 2025-11-01
CN113831415A (zh) 2021-12-24

Similar Documents

Publication Publication Date Title
US20240083975A1 (en) Thrombin cleavable linker with xten and its uses thereof
AU2020277146B2 (en) Factor VIII chimeric proteins and uses thereof
US12570691B2 (en) Purification of chimeric FVIII molecules
ES3034016T3 (en) Methods of treating hemophilia a
RU2812863C2 (ru) Способы лечения гемофилии a
EA051005B1 (ru) Расщепляемый тромбином линкер, содержащий xten, и его применение
EA041588B1 (ru) Расщепляемый тромбином линкер, содержащий xten, и его применение
BR122023020301B1 (pt) Uso de uma proteína quimérica compreendendo uma proteína fviii

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 201480029781.5

Country of ref document: CN

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 14817900

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 242436

Country of ref document: IL

ENP Entry into the national phase

Ref document number: 2016524268

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2014817900

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2913078

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 15276531

Country of ref document: CO

ENP Entry into the national phase

Ref document number: 20157033268

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 201592022

Country of ref document: EA

WWE Wipo information: entry into national phase

Ref document number: 12015502614

Country of ref document: PH

ENP Entry into the national phase

Ref document number: 2014302100

Country of ref document: AU

Date of ref document: 20140627

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: MX/A/2015/016567

Country of ref document: MX

WWE Wipo information: entry into national phase

Ref document number: 122022020217

Country of ref document: BR

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112015031194

Country of ref document: BR

WWE Wipo information: entry into national phase

Ref document number: A201512417

Country of ref document: UA

WWE Wipo information: entry into national phase

Ref document number: 14894108

Country of ref document: US

ENP Entry into the national phase

Ref document number: 112015031194

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20151214