WO2016183531A1 - Bacteria engineered to reduce hyperphenylalaninemia - Google Patents
Bacteria engineered to reduce hyperphenylalaninemia Download PDFInfo
- Publication number
- WO2016183531A1 WO2016183531A1 PCT/US2016/032562 US2016032562W WO2016183531A1 WO 2016183531 A1 WO2016183531 A1 WO 2016183531A1 US 2016032562 W US2016032562 W US 2016032562W WO 2016183531 A1 WO2016183531 A1 WO 2016183531A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- gene
- promoter
- genetically engineered
- phenylalanine
- pal
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/66—Microorganisms or materials therefrom
- A61K35/74—Bacteria
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/66—Microorganisms or materials therefrom
- A61K35/74—Bacteria
- A61K35/741—Probiotics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/02—Bacterial antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/24—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Enterobacteriaceae (F), e.g. Citrobacter, Serratia, Proteus, Providencia, Morganella, Yersinia
- C07K14/245—Escherichia (G)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/70—Vectors or expression systems specially adapted for E. coli
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/0004—Oxidoreductases (1.)
- C12N9/0012—Oxidoreductases (1.) acting on nitrogen containing compounds as donors (1.4, 1.5, 1.6, 1.7)
- C12N9/0014—Oxidoreductases (1.) acting on nitrogen containing compounds as donors (1.4, 1.5, 1.6, 1.7) acting on the CH-NH2 group of donors (1.4)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/0004—Oxidoreductases (1.)
- C12N9/0012—Oxidoreductases (1.) acting on nitrogen containing compounds as donors (1.4, 1.5, 1.6, 1.7)
- C12N9/0014—Oxidoreductases (1.) acting on nitrogen containing compounds as donors (1.4, 1.5, 1.6, 1.7) acting on the CH-NH2 group of donors (1.4)
- C12N9/0022—Oxidoreductases (1.) acting on nitrogen containing compounds as donors (1.4, 1.5, 1.6, 1.7) acting on the CH-NH2 group of donors (1.4) with oxygen as acceptor (1.4.3)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/88—Lyases (4.)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y104/00—Oxidoreductases acting on the CH-NH2 group of donors (1.4)
- C12Y104/03—Oxidoreductases acting on the CH-NH2 group of donors (1.4) with oxygen as acceptor (1.4.3)
- C12Y104/03002—L-Amino-acid oxidase (1.4.3.2)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y403/00—Carbon-nitrogen lyases (4.3)
- C12Y403/01—Ammonia-lyases (4.3.1)
- C12Y403/01024—Phenylalanine ammonia-lyase (4.3.1.24)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K2035/11—Medicinal preparations comprising living procariotic cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- compositions and therapeutic methods for reducing hyperphenylalaninemia relate to compositions and therapeutic methods for reducing hyperphenylalaninemia.
- the disclosure relates to genetically engineered bacteria that are capable of reducing hyperphenylalaninemia in a mammal.
- the compositions and methods disclosed herein may be used for treating diseases associated with hyperphenylalaninemia, e.g., phenylketonuria.
- Phenylalanine is an essential amino acid primarily found in dietary protein. Typically, a small amount is utilized for protein synthesis, and the remainder is hydroxylated to tyrosine in an enzymatic pathway that requires phenylalanine hydroxylase (PAH) and the cofactor tetrahydrobiopterin.
- PAH phenylalanine hydroxylase
- Hyperphenylalaninemia is a group of diseases associated with excess levels of phenylalanine, which can be toxic and cause brain damage.
- Primary hyperphenylalaninemia is caused by deficiencies in PAH activity that result from mutations in the PAH gene and/or a block in cofactor metabolism.
- Phenylketonuria is a severe form of hyperphenylalaninemia caused by mutations in the PAH gene.
- PKU is an autosomal recessive genetic disease that ranks as the most common inborn error of metabolism worldwide (1 in 3,000 births), and affects approximately 13,000 patients in the United States. More than 400 different PAH gene mutations have been identified (Hoeks et al., 2009). Current PKU therapies require substantially modified diets consisting of protein restriction.
- oral administration of the cofactor tetrahydrobiopterin also referred to as THB, BH4, Kuvan, or sapropterin
- THB cofactor tetrahydrobiopterin
- BH4 cofactor tetrahydrobiopterin
- sapropterin cofactor tetrahydrobiopterin
- phenylketonuria The annual cost of Kuvan, for example, may be as much as $57,000 per patient. Additionally, the side effects of Kuvan can include gastritis and severe allergic reactions (e.g., wheezing, lightheadedness, nausea, flushing of the skin).
- phenylalanine ammonia lyase is capable of metabolizing phenylalanine to non-toxic levels of ammonia and transcinnamic acid. Unlike PAH, PAL does not require THB cofactor activity in order to metabolize phenylalanine.
- Studies of oral enzyme therapy using PAL have been conducted, but "human and even the animal studies were not continued because PAL was not available in sufficient amounts at reasonable cost" (Sarkissian et al., 1999).
- a pegylated form of recombinant PAL (PEG-PAL) is also in development as an injectable form of treatment.
- LAAD L-amino acid deaminase
- PPA Phenylpyruvic acid
- LAAD has therefore been studied in the context of industrial PPA production (Hou et al. 2015, Appl Microbiol Biotechnol.
- Phenylpyruvic acid from L-phenylalanine using an L-amino acid deaminase from Proteus mirabilis: comparison of enzymatic and whole-cell biotransformation approaches Phenylpyruvate is unable to cross the blood brain barrier (Steele, Fed Proc. 1986 Jun;45(7):2060-4; "Blood-brain barrier transport of the alpha-keto acid analogs of amino acids.,” indicating that this conversion is useful in controlling the neurological phenotypes of PKU.
- the disclosure provides genetically engineered bacteria that encode and express a phenylalanine metabolizing enzyme (PME).
- PME phenylalanine metabolizing enzyme
- the disclosure provides genetically engineered bacteria that encode and express phenylalanine ammonia lyase and/or phenylalanine hydroxylase and/or L- aminoacid deaminase and are capable of reducing hyperphenylalaninemia.
- the genetically engineered bacteria are nonpathogenic and may be introduced into the gut in order to reduce toxic levels of phenylalanine.
- the phenylalanine ammonia lyase and/or phenylalanine hydroxylase and/or L-aminoacid deaminase is stably produced by the genetically engineered bacteria, and/or the genetically engineered bacteria are stably maintained in vivo and/or in vitro.
- the genetically engineered bacteria further comprise a phenylalanine transporter gene to increase their uptake of phenylalanine.
- the invention also provides pharmaceutical compositions comprising the genetically engineered bacteria, and methods of modulating and treating disorders associated with hyperphenylalaninemia.
- Fig. 1 depicts a synthetic biotic for treating phenylketonuria (PKU) and disorders characterized by hyperphenylalaninemia.
- Fig. 2A depicts a schematic of phenylalanine hydroxylase action in phenylketonuria (PKU).
- Fig. 2B depicts a schematic of phenylalanine hydroxylase (PAH) action.
- Fig. 2C depicts a schematic of phenylalanine ammonia lyase (PAL) action.
- Fig. 2D depicts a schematic of L-amino acid deaminase (LAAD; e.g., from Proteus mirabilis) action.
- LAAD L-amino acid deaminase
- Fig. 3 depicts a synthetic biotic for treating phenylketonuria (PKU) and disorders characterized by hyperphenylalaninemia.
- Fig. 4 depicts a synthetic biotic for treating phenylketonuria (PKU) and disorders characterized by hyperphenylalaninemia.
- Fig. 5 depicts a synthetic biotic for treating phenylketonuria (PKU) and disorders characterized by hyperphenylalaninemia.
- FIG. 6 depicts the gene organization of an exemplary construct comprising a gene encoding PAL3 and a Tet promoter sequence on a high-copy plasmid e.g., as comprised in SYN-PKU202, SYN-PKU303.
- Fig. 7 depicts the gene organization of an exemplary construct comprising a gene encoding PAL3 and an F R promoter sequence on a low-copy plasmid, e.g., as comprised in SYN-PKU304, SYN-PKU307, SYN-PKU305, SYN- PKU306.
- Fig. 8 depicts the gene organization of an exemplary construct comprising a gene encoding PAL3 and a Tet promoter sequence on a low-copy plasmid, e.g., SYN-PKU302, SYN-PKU201.
- Fig. 9 depicts the gene organization of an exemplary construct, e.g., comprised in SYN-PKU401, comprising a cloned LAAD gene under the control of a Tet promoter sequence and a Tet repressor gene.
- Fig. 10 depicts a schematic representation of the construction of a pheP knock-in strain, wherein recombineering is used to insert a second copy of pheP into the Nissle lacZ gene.
- Fig. 11 depicts the gene organization of an exemplary construct comprising a gene encoding PheP, a gene encoding TetR, and a tet promoter sequence for chromosomal insertion e.g., as for example comprised in SYN-PKU203, SYN- PKU401, SYN-PKU402, SYN-PKU302, and SYN-PKU303.
- Fig. 12 depicts the gene organization of an exemplary construct, comprising a cloned PAL3 gene under the control of an FNR promoter sequence, on a low-copy, kanamycin-resistant plasmid (pSClOl origin of replication, (Fig 12A).
- PAL3 degrades phenylalanine to non-toxic trans- cinnamate.
- Fig. 12B depicts an additional copy of the endogenous E. coli high affinity phenylalanine transporter, pheP, driven by the PfnrS promoter and inserted into the lacZ locus on the Nissle chromosome.
- Fig. 13 depicts schematic diagrams of non -limiting embodiments of the disclosure.
- Fig. 13A depicts phenylalanine degradation components integrated into the E. coli Nissle chromosome.
- engineered plasmid-free bacterial strains are used to prevent plasmid conjugation in vivo.
- multiple insertions of the PAL gene result in increased copy number and/or increased
- a copy of the endogenous E. coli high affinity phenylalanine transporter, pheP is driven by the PfnrS promoter and is inserted into the lacZ locus.
- Fig. 13B depicts a schematic diagram of one non-limiting embodiment of the disclosure, wherein the E. coli Nissle chromosome is engineered to contain four copies of PfnrS-PAL inserted at four different insertion sites across the genome (malE/K, yicS/nepI, agal/rsml, and cea), and one copy of a phenylalanine transporter gene inserted at a different insertion site (lacZ).
- the PAL gene is PAL3 derived from P. luminescens, and the phenylalanine transporter gene is pheP derived from E. coli.
- the strain is SYN-PKU511.
- Fig. 13C depicts a schematic diagram of one preferred embodiment of the disclosure, wherein the E.
- coli Nissle chromosome is engineered to contain five copies of PAL under the control of an oxygen level-dependent promoter (e.g., PfnrS-PAL3) inserted at different integration sites on the chromosome (malE/K, yicS/nepI, malP/T, agal/rsml, and cea), and one copy of a phenylalanine transporter gene under the control of an oxygen level- dependent promoter (e.g., PfnrS-pheP) inserted at a different integration site on the chromosome (lacZ).
- the genome is further engineered to include a thyA auxotrophy, in which the thyA gene is deleted and/or replaced with an unrelated gene, as well as a kanamycin resistance gene.
- Fig. 14 depicts the gene organization of a non-limiting exemplary construct comprising a gene encoding araC and a gene encoding LAAD from Proteus mirabilis and an arabinose inducible promoter (ParaBAD) sequence for chromosomal insertion into the endogenous arabinose operon for chromosomal integration, e.g., as comprised in SYN-PKU705.
- Fig. 14 depicts the gene organization of a non-limiting exemplary construct comprising a gene encoding araC and a gene encoding LAAD from Proteus mirabilis and an arabinose inducible promoter (ParaBAD) sequence for chromosomal insertion into the endogenous arabinose operon for chromosomal integration, e.g., as comprised in SYN-PKU705.
- Fig. 14 depicts the gene organization of a non-limiting exemplary construct comprising a gene encoding araC and a gene encoding
- 15A depicts phenylalanine concentrations in samples comprising bacteria expressing PALI or on low-copy (LC; SYN-PKUlOl) or high-copy (HC; SYN- PKU102) plasmids or PAL3 on low-copy (LC; SYN-PKU201) or high-copy (HC; SYN- PKU202) plasmids, induced with anhydrous tetracycline (ATC), and then grown in culture medium supplemented with 4 mM (660,000 ng/mL) of phenylalanine. Samples were removed at 0 hrs, 4 hrs, and 23 hrs. Phenylalanine concentrations were
- Fig. 15B depicts cinnamate levels in samples at 4 hrs and 23 hrs post-induction.
- the PAL3 gene is derived from Photorhabdus luminescens, an enter obacterium in the same taxonomic subdivision as Escherichia coli.
- Fig. 16A depicts phenylalanine concentrations in samples comprising bacteria expressing PALI or PAL3 on low-copy (LC) or high-copy (HC) plasmids, or further comprising a copy of pheP driven by the Tet promoter integrated into the chromosome.
- Bacteria were induced with ATC, and then grown in culture medium supplemented with 4 mM (660,000 ng/mL) of phenylalanine to an OD 6 oo of 2.0.
- Fig. 16B depicts cinnamate levels in samples at 2 hrs and 4 hrs post-induction.
- cinnamate may be used as an alternative biomarker for strain activity.
- Strains analyzed in this data set are SYN-PKUlOl, SYN-PKU102, SYN-PKU202, SYN- PKU201, SYN-PKU401, SYN-PKU402, SYN-PKU203, SYN-PKU302, SYN-PKU303.
- FIGs. 17A and 17B depict the state of one non-limiting embodiment of the PAL construct under non-inducing (Fig. 17A) and inducing (Fig. 17B) conditions.
- Fig. 17A depicts relatively low PAL and PheP production under aerobic conditions due to oxygen (0 2 ) preventing FNR from dimerizing and activating PAL and/or pheP gene expression.
- Fig. 17B depicts up-regulated PAL and PheP production under anaerobic conditions due to FNR dimerizing and inducing FNR promoter-mediated expression of PAL and pheP (squiggle above "PAL" and "pheP").
- Arrows adjacent to a single rectangle, or a cluster of rectangles depict the promoter responsible for driving transcription (in the direction of the arrow) of such gene(s). Arrows above each rectangle depict the expression product of each gene.
- Fig. 18 depicts ⁇ -galactosidase levels in samples comprising bacteria harboring a low-copy plasmid expressing lacZ from an F R-responsive promoter selected from the exemplary FNR promoters shown Table 3 (Pfnrl-5).
- FNR-responsive promoters were used to create a library of anaerobic-inducible reporters with a variety of expression levels and dynamic ranges. These promoters included strong ribosome binding sites.
- Bacterial cultures were grown in either aerobic (+0 2 ) or anaerobic conditions (-0 2 ). Samples were removed at 4 hrs and the promoter activity based on ⁇ -galactosidase levels was analyzed by performing standard ⁇ -galactosidase colorimetric assays.
- Fig. 19A depicts a schematic representation of the lacZ gene under the control of an exemplary FNR promoter (P fm s)- LacZ encodes the ⁇ -galactosidase enzyme and is a common reporter gene in bacteria.
- Fig. 19B depicts FNR promoter activity as a function of ⁇ -galactosidase activity in SYN-PKU304.
- SYN-PKU304 an engineered bacterial strain harboring a low-copy fiirS-lacZ fusion gene, was grown in the presence or absence of oxygen. Values for standard ⁇ -galactosidase colorimetric assays are expressed in Miller units (Miller, 1972). These data suggest that the fiirS promoter begins to drive high-level gene expression within 1 hr. under anaerobic conditions.
- Fig. 19C depicts the growth of bacterial cell cultures expressing lacZ over time, both in the presence and absence of oxygen.
- Fig. 20A and 20B depict phenylalanine levels produced under aerobic (Fig. 20A) or anaerobic conditions (Fig. 20B) in samples of wild-type Nissle, samples of bacteria comprising a low-copy plasmid expressing PAL3 from the Tet promoter or exemplary FNR promoters, or further comprising a copy of pheP driven by the Tet promoter and integrated into the chromosome. Samples were incubated in culture medium supplemented with ATC and 4 mM (660,000 ng/mL) of phenylalanine.
- Fig. 21 depicts phenylalanine concentrations in cultures of synthetic probiotic strains, with and without an additional copy of pheP inserted on the chromosome. After 1.5 hrs of growth, cultures were placed in Coy anaerobic chamber supplying 90% N 2 , 5% C0 2 , and 5% H 2 .
- bacteria were resuspended in assay buffer containing 4 mM phenylalanine. Aliquots were removed from cell assays every 30 min for 3 hrs for phenylalanine quantification by mass spectrometry. Phenylalanine degradation rates in strains comprising an additional copy of pheP (SYN-PKU304 and SYN-PKU305; left) were higher than strains lacking an additional copy of pheP (SYN-PKU308 and SYN-PKU307; right).
- Fig 22 depicts trans-cinnamate concentrations (PAL activity) for strains comprising single PAL3 insertions at various locations on the chromosome.
- Fig. 23 depicts trans-cinnamate concentrations (PAL activity) for strains comprising multiple PAL3 insertions at various locations on the chromosome.
- Fig. 24 depicts phenylalanine concentrations in cultures of synthetic probiotic strain SYN-PKU511 over time. After 2.5 hrs of growth, cultures were placed in Coy anaerobic chamber supplying 90% N2, 5% C02, and 5% H2. After 3.5 hrs of induction in phenylalanine containing medium, whole cell extracts were prepared every 30 min for 3 hrs and phenylalanine was quantified by mass spectrometry.
- SYN-PKU511 comprises 5 integrated copies of an anaerobically (FNR) controlled gene encoding phenylalanine ammonia lyase (PAL) at 5 chromosomal locations and an anaerobically controlled gene encoding a high affinity Phe transporter (pheP) integrated in the lacZ locus.
- FNR anaerobically
- PAL phenylalanine ammonia lyase
- pheP high affinity Phe transporter
- FIG. 25A and 25B depict phenylalanine concentrations in cultures of a synthetic probiotic strain, SYN-PKU401, which comprises a high copy pUC57-plasmid with LAAD driven by a Tet inducible promoter, cells were grown in flasks shaking at 37 C, and induced with TCA at early log phase for a duration of 2 hours. Cells were spun down and re-suspended in assay buffer containing phenylalanine. Cells were measured at various cell concentrations and at varying oxygen levels. Cells were either incubated aerobically (1 ml) in a 14 ml culture tube, shaking at 250 rpm.
- Fig. 25A depicts phenylalanine concentrations under aerobic conditions using two cell densities. A and B are duplicates under the same experimental conditions. The activity in aerobic conditions is ⁇ 50umol/hr./le9cells.
- Fig. 25B depicts phenylalanine concentrations of aerobically, microaerobically, or anaerobically grown cells.
- Fig. 26 A shows phenylalanine concentrations before and after feeding in an in vivo mouse model of PKU.
- homozygous BTBR- Pah enu2 mice were given water supplemented with 100 micrograms/mL ATC and 5% sucrose. Mice were fasted by removing chow overnight (10 hrs), and blood samples were collected by mandibular bleeding the next morning in order to determine baseline phenylalanine levels. Mice were given chow again, gavaged with 100 microliters (5xl0 9 CFU) of bacteria (SYN-PKU302 or control Nissle) after 1 hr., and allowed to feed for another 2 hrs. Serum phenylalanine concentrations were determined 2 hrs post- gavage.
- Fig. 26B shows the percent (%) change in blood phenylalanine concentrations before and after feeding as a male or female group average (p ⁇ 0.01).
- SYN-PKU303 is capable of intercepting enterorecirculating phenylalanine.
- SYN-PKU304 low copy plasmid containing fnrS-PAL
- SYN-PKU303 high copy plasmid containing Tet-PAL
- Figs. 29 A and 29B depict blood phenylalanine concentrations relative to baseline following subcutaneous phenylalanine challenge in an in vivo mouse model of PKU. Mice were orally gavaged with H20, SYN-PKU901, SYN-PKU303, or SYN- PKU304 at 30 and 90 minutes post-phenylalanine injection (0.1 mg/gram of average group body weight).
- Figs. 29A and 29B show blood phenylalanine concentrations at 2 hrs and 4 hrs post-phenylalanine injection, respectively.
- 30A and 30B show a dose-dependent decrease in blood phenylalanine levels in SYN-PKU304-treated mice compared to mice administered mock treatment (H20) or the parental strain (SYN-PKU901) (* 30% decrease; p ⁇ 0.05).
- This experiment represents one of eight studies of this same design, and each one shows that SYN- PKU304 is capable of intercepting enterorecirculating phenylalanine.
- Figs. 31 A and 31B depicts a schematic of PKU specific and PAL specific phenylalanine metabolites.
- Fig. 31A depicts a schematic of the conversion of phenylalanine to phenylpyruvic acid and phenyllactic acid in the absence of functional PAH.
- Fig. 31B depicts a schematic of the conversion of phenylalanine to trans-cinnamic acid by PAL3, which is further metabolized to hippuric acid by liver enzymes. These metabolites can be detected by mass spectrometry as described in Examples 24-26 or by other means.
- Figs. 31A depicts a schematic of the conversion of phenylalanine to phenylpyruvic acid and phenyllactic acid in the absence of functional PAH.
- Fig. 31B depicts a schematic of the conversion of phenylalanine to trans-cinnamic acid by PAL3, which is further metabolized to hippuric acid by liver enzymes. These metabol
- Fig. 32A depicts blood phenylalanine concentrations relative to baseline; total metabolic activity for SYN- PKU304 was calculated as 81.2umol/hr. and the total reduction in Aphe was 45% relative to SYN-PKU901 (P ⁇ 0.05).
- Fig. 32B depicts the blood phenylalanine concentration at 0 and 4 hours post phenylalanine injection.
- Fig. 32C depicts the blood phenylpyruvate concentration at 0 and 4 hours post phenylalanine injection.
- Fig. 32A depicts blood phenylalanine concentrations relative to baseline; total metabolic activity for SYN- PKU304 was calculated as 81.2umol/hr. and the total reduction in Aphe was 45% relative to SYN-PKU901 (P ⁇ 0.05).
- Fig. 32B depicts the blood phenylalanine concentration at 0 and 4 hours post phenylalanine injection.
- Fig. 32C depicts the blood phenylpyru
- FIG. 32D depicts the blood phenyllactate concentration at 0 and 4 hours post phenylalanine injection.
- Fig. 32E depicts the blood t-cinnamic acid concentration at 0 and 4 hours post phenylalanine injection.
- Fig. 32F depicts the blood hippuric acid concentration at 0 and 4 hours post phenylalanine injection.
- Figs. 33 A, 33B, 33C, 33D, 33E, and 33F depict blood phenylalanine concentrations relative to baseline and concentrations of phenylalanine (Fig. 33A), and absolute values of phenylalanine and PKU specific and PAL specific metabolites (Figs. 33B, 33C, 33D, 33E, and 33F) following subcutaneous phenylalanine challenge in an in vivo mouse model of PKU.
- Fig. 33A depicts blood
- Fig. 33B depicts the blood phenylalanine concentration at 0 and 4 hours post phenylalanine injection.
- Fig. 33C depicts the blood phenylpyruvate concentration at 0 and 4 hours post phenylalanine injection.
- Fig. 33D depicts the blood phenyllactate concentration at 0 and 4 hours post phenylalanine injection.
- Fig. 33E depicts the blood t-cinnamic acid concentration at 0 and 4 hours post phenylalanine injection.
- Fig. 33F depicts the blood hippuric acid concentration at 0 and 4 hours post phenylalanine injection.
- Fig. 34A depicts blood phenylalanine concentrations relative to baseline and concentrations
- Fig. 34B depicts the blood phenylalanine concentration at 0 and 4 hours post phenylalanine injection.
- Fig. 34C depicts the blood phenylpyruvate concentration at 0 and 4 hours post phenylalanine injection.
- Fig. 34D depicts the blood phenyllactate concentration at 0 and 4 hours post phenylalanine injection.
- Fig. 34E depicts the blood t-cinnamic acid concentration at 0 and 4 hours post phenylalanine injection.
- Fig. 34F depicts the blood hippuric acid concentration at 0 and 4 hours post phenylalanine injection.
- Fig. 35 depicts phenylalanine and 2 toxic analogs, p-fluoro-DL- phenylalanine, and o-fluoro-DL-phenyl alanine, which are useful for an untargeted approach to select PAL enzymes with increased activity.
- P-fluoro-DL-phenylalanine, and o-fluoro-DL-phenylalanine are incorporated into cellular protein in the place of phenylalanine, resulting in cell death. Since these compounds are readily taken up by PheP, and can act as a substrate for PAL as shown below, they can be employed in genetic selection and screening for the identification of strains with improved Phe consumption activity. Mutations allowing more efficient PAL metabolism may prevent the incorporation of the phenylalanine analog into cellular protein, therefore allowing growth under higher concentrations of the analog.
- Fig. 36 depicts a map of exemplary integration sites within the E. coli 1917 Nissle chromosome. These sites indicate regions where circuit components may be inserted into the chromosome without interfering with essential gene expression. Backslashes (/) are used to show that the insertion will occur between divergently or convergently expressed genes. Insertions within biosynthetic genes, such as thyA, can be useful for creating nutrient auxotrophies. In some embodiments, an individual circuit component is inserted into more than one of the indicated sites.
- Fig. 37 depicts three bacterial strains which constitutively express red fluorescent protein (RFP).
- RFP red fluorescent protein
- strains 1-3 the rfp gene has been inserted into different sites within the bacterial chromosome, and results in varying degrees of brightness under fluorescent light.
- Unmodified E. coli Nissle strain 4 is non-fluorescent.
- Fig. 38 depicts a graph of Nissle residence in vivo. Streptomycin- resistant Nissle was administered to mice via oral gavage without antibiotic pre- treatment. Fecal pellets from 6 total mice were monitored post-administration to determine the amount of administered Nissle still residing within the mouse
- the bars represent the number of bacteria administered to the mice.
- the line represents the number of Nissle recovered from the fecal samples each day for 10 consecutive days.
- Figs. 39A and 39B depict phenylalanine concentrations in SYN-PKU302 cultures over time. After 1.5 hrs of growth, ATC was added to cultures of SYN- PKU302, and SYN-PKU304 cultures were placed in Coy anaerobic chamber supplying 90% N 2 , 5% C0 2 , and 5% H 2 . After 4 hrs of induction, bacteria were resuspended in assay buffer containing 4 mM phenylalanine and at different pH (pH range 7.25-2.25). Aliquots were removed from cell assays every 30 min for 2 hrs for phenylalanine quantification by mass spectrometry. Phenylalanine degradation rates decreased as pH of the assay buffer decreased in both strains, SYN-PKU302 (Fig. 39A) and SYN- PKU304 (Fig. 39B).
- Fig. 40 depicts an exemplary schematic of the E. coli 1917 Nissle chromosome comprising multiple mechanisms of action (MoAs).
- Fig. 41 depicts the gene organization of an exemplary construct in which the PAL3 and pheP genes are co-transcribed under the control of an exemplary FNR promoter (Pf ra s)-
- Figs. 42A and 42B depict the gene organization of an exemplary construct in which the Int5 recombinase gene is operably linked to an exemplary FNR promoter (P f nrs), and the PAL3 gene is operably linked to a strong constitutive promoter.
- Fig. 42A depicts a schematic diagram of the PAL3 gene, flanked by Int5 sites, in the OFF orientation (3' to 5').
- Int5 gene expression is activated under anaerobic conditions, recombinatorial flipping of PAL3 to the ON orientation (5' to 3'; Fig. 42B) leads to the production of PAL3 and to phenylalanine metabolism. Any strong constitutive promoter sequence may be used.
- Figs. 43A, 43B, and 43C depict the gene organization of an exemplary construct in which the Int5 recombinase gene is operably linked to an FNR promoter (Pfnrs), and the gene encoding T7 RNA polymerase is flanked by recombinase sites and operably linked to a strong constitutive promoter.
- Fig. 43A depicts a schematic diagram of the T7 RNA polymerase gene, flanked by Int5 sites, in the OFF orientation. When Int5 gene expression is activated under anaerobic conditions, the T7 RNA polymerase gene is flipped to the ON orientation (Fig. 43B).
- T7 RNA polymerase expression leads to the production of PAL3 and to phenylalanine metabolism.
- Figs. 44A, 44B, and 44C depict the gene organization of an exemplary construct in which the Int5 recombinase gene is operably linked to an ParaBAD promoter (ParaBAo), and the gene encoding T7 RNA polymerase is flanked by recombinase sites and operably linked to a strong constitutive promoter.
- Fig. 43A depicts a schematic diagram of the T7 RNA polymerase gene, flanked by Int5 sites, in the OFF orientation. When Int5 gene expression is activated under anaerobic conditions, the T7 RNA polymerase gene is flipped to the ON orientation (Fig. 43B).
- T7 RNA polymerase expression leads to the production of PAL3 and to phenylalanine metabolism.
- Fig. 45A depicts a schematic of a recombinase-based switch to activate PAL3 expression using different inducible promoters and ribosome binding sites.
- recombinase expression causes recombinatorial flipping of the PAL3 gene to the ON orientation, leading to the production of PAL3 and to the degradation of phenylalanine.
- recombinase-based switches are tuned to respond to specific levels of an inducer.
- Fig. 45B depicts the relationship between the concentration of an inducer and the percentage of i J3-containing constructs in the ON orientation. The shaded area shows the predicted efficacy range of the inducer in vivo.
- Fig. 46A depicts another non-limiting embodiment of the disclosure, wherein the expression of a heterologous gene is activated by an exogenous
- the AraC transcription factor adopts a conformation that represses transcription.
- the AraC transcription factor undergoes a conformational change that allows it to bind to and activate the ParaBAD promoter (ParaBAo), which induces expression of the Tet repressor (TetR) and an anti-toxin.
- the anti-toxin builds up in the recombinant bacterial cell, while TetR prevents expression of a toxin (which is under the control of a promoter having a TetR binding site).
- both the antitoxin and TetR are not expressed.
- Fig. 46A also depicts another non- limiting embodiment of the disclosure, wherein the expression of an essential gene not found in the recombinant bacteria is activated by an exogenous environmental signal.
- the AraC transcription factor adopts a conformation that represses transcription of the essential gene under the control of the araBAD promoter and the bacterial cell cannot survive.
- the AraC In the presence of arabinose, the AraC
- transcription factor undergoes a conformational change that allows it to bind to and activate the araBAD promoter, which induces expression of the essential gene and maintains viability of the bacterial cell.
- Fig. 46B depicts a non-limiting embodiment of the disclosure, where an anti-toxin is expressed from a constitutive promoter, and expression of a heterologous gene is activated by an exogenous environmental signal.
- the AraC transcription factor adopts a conformation that represses transcription.
- the AraC transcription factor undergoes a conformational change that allows it to bind to and activate the araBAD promoter, which induces expression of TetR, thus preventing expression of a toxin.
- TetR is not expressed, and the toxin is expressed, eventually overcoming the anti-toxin and killing the cell.
- the constitutive promoter regulating expression of the anti -toxin should be a weaker promoter than the promoter driving expression of the toxin.
- the araC gene is under the control of a constitutive promoter in this circuit.
- Fig. 46C depicts another non-limiting embodiment of the disclosure, wherein the expression of a heterologous gene is activated by an exogenous environmental signal.
- the AraC transcription factor adopts a conformation that represses transcription.
- the AraC transcription factor undergoes a conformational change that allows it to bind to and activate the araB AD promoter, which induces expression of the Tet repressor (TetR) and an anti-toxin.
- TetR Tet repressor
- the anti-toxin builds up in the recombinant bacterial cell, while TetR prevents expression of a toxin (which is under the control of a promoter having a TetR binding site).
- araC gene is either under the control of a constitutive promoter or an inducible promoter (e.g., AraC promoter) in this circuit.
- Fig. 47 depicts the use of GeneGuards as an engineered safety
- Fig. 48A depicts a schematic diagram of a wild-type clbA construct.
- Fig. 48B depicts a schematic diagram of a clbA knockout construct.
- Fig. 49 depicts exemplary sequences of a wild-type clbA construct and a clbA knockout construct.
- Fig. 50 depicts a schematic of a secretion system based on the flagellar type III secretion in which a modified flagellum is used to secrete a therapeutic peptide of interest by recombinantly fusing the peptide to an N-terminal flagellar secretion signal of a native flagellar component so that the intracellularly expressed chimeric peptide can be mobilized across the inner and outer membranes into the surrounding host environment.
- Fig. 51 depicts a schematic of a type V secretion system for the extracellular production of recombinant proteins in which a therapeutic peptide (star) can be fused to an N-terminal secretion signal, a linker and the beta-domain of an auto- secreter.
- the N-terminal signal sequence directs the protein to the SecA- YEG machinery, which moves the protein across the inner membrane into the periplasm, followed by subsequent cleavage of the signal sequence.
- the beta-domain is recruited to the Bam complex where the beta-domain is folded and inserted into the outer membrane as a beta-barrel structure.
- the therapeutic peptide is then threaded through the hollow pore of the beta-barrel structure ahead of the linker sequence.
- the therapeutic peptide is freed from the linker system by an autocatalytic cleavage or by targeting of a membrane-associated peptidase (scissors) to a complementary protease cut site in the linker.
- Fig. 52 depicts a schematic of a type I secretion system, which translocates a passenger peptide directly from the cytoplasm to the extracellular space using HlyB (an ATP-binding cassette secreter; HlyD (a membrane fusion protein); and TolC (an outer membrane protein) which form a channel through both the inner and outer membranes.
- HlyB an ATP-binding cassette secreter
- HlyD a membrane fusion protein
- TolC an outer membrane protein
- Fig. 53 depicts a schematic of the outer and inner membranes of a gram- negative bacterium, and several deletion targets for generating a leaky or destabilized outer membrane, thereby facilitating the translocation of a therapeutic polypeptides to the extracellular space, e.g., therapeutic polypeptides of eukaryotic origin containing disulphide bonds.
- Fig. 54 depicts a schematic of non-limiting processes for designing and producing the genetically engineered bacteria of the present disclosure.
- Fig. 55 depicts a schematic of non-limiting manufacturing processes for upstream and downstream production of the genetically engineered bacteria of the present disclosure.
- Figs. 55A, B, C, D, and E depict a schematic of non-limiting manufacturing processes for upstream and downstream production of the genetically engineered bacteria of the present disclosure.
- Fig. 55A depicts the parameters for starter culture 1 (SCI): loop full - glycerol stock, duration overnight, temperature 37° C, shaking at 250 rpm.
- Fig. 55B depicts the parameters for starter culture 2 (SC2): 1/100 dilution from SCI, duration 1.5 hours, temperature 37° C, shaking at 250 rpm.
- Fig. 1 starter culture 1
- SC2 starter culture 2
- Fig. 55C depicts the parameters for the production bioreactor: inoculum - SC2, temperature 37° C, pH set point 7.00, pH dead band 0.05, dissolved oxygen set point 50%, dissolved oxygen cascade agitation/gas FLO, agitation limits 300-1200 rpm, gas FLO limits 0.5-20 standard liters per minute, duration 24 hours.
- Fig. 55D depicts the parameters for harvest: centrifugation at speed 4000 rpm and duration 30 minutes, wash IX 10% glycerol/PBS, centrifugation, re-suspension 10% glycerol/PBS.
- Fig. 55E depicts the parameters for vial fill/storage: 1-2 mL aliquots, -80° C.
- the present disclosure includes genetically engineered bacteria, pharmaceutical compositions thereof, and methods of modulating and treating disorders associated with hyperphenylalaninemia.
- the genetically engineered bacteria comprise a gene encoding non-native phenylalanine ammonia lyase (PAL) and are capable of processing and reducing phenylalanine in a mammal.
- PAL non-native phenylalanine ammonia lyase
- the genetically engineered bacteria and pharmaceutical compositions comprising those bacteria may be used to metabolize phenylalanine in the body into non-toxic molecules in order to treat and/or prevent conditions associated with hyperphenylalaninemia, including PKU.
- the compositions comprising the genetically engineered bacteria may be used in the methods of the disclosure to treat and/or prevent disorders associated with hyperphenylalaninemia.
- a diagnostic signal of hyperphenylalaninemia is a blood phenylalanine level of at least 2 mg/dL, at least 4 mg/dL, at least 6 mg/dL, at least 8 mg/dL, at least 10 mg/dL, at least 12 mg/dL, at least 14 mg/dL, at least 16 mg/dL, at least 18 mg/dL, at least 20 mg/dL, or at least 25 mg/dL.
- diseases associated with hyperphenylalaninemia include, but are not limited to, phenylketonuria, classical or typical phenylketonuria, atypical
- phenylketonuria permanent mild hyperphenylalaninemia, nonphenylketonuric hyperphenylalaninemia, phenylalanine hydroxylase deficiency, cofactor deficiency, dihydropteridine reductase deficiency, tetrahydropterin synthase deficiency, and Segawa's disease.
- Affected individuals can suffer progressive and irreversible neurological deficits, mental retardation, encephalopathy, epilepsy, eczema, reduced growth, microcephaly, tremor, limb spasticity, and/or hypopigmentation (Leonard 2006).
- Hyperphenylalaninemia can also be secondary to other conditions, e.g., liver diseases.
- PME phenylalanine metabolizing enzyme
- Trans-cinnamic acid has low toxicity and is converted by liver enzymes in mammals to hippuric acid, which is secreted in the urine.
- PAL may be substituted for the enzyme PAH to metabolize excess phenylalanine.
- PAL enzyme activity does not require THB cofactor activity.
- PAL is encoded by a PAL gene derived from a prokaryotic species.
- PAL is encoded by a PAL gene derived from a eukaryotic species.
- PAL is encoded by a PAL gene derived from a bacterial species, including but not limited to, Achromobacter xylosoxidans, Pseudomonas aeruginosa, Photorhabdus luminescens, Anabaena variabilis, and Agrobacterium tumefaciens .
- PAL is encoded by a PAL gene derived from Anabaena variabilis and referred to as "PALI” herein (Moffitt et al., 2007).
- PAL is encoded by a PAL gene derived from Photorhabdus luminescens and referred to as "PAL3" herein (Williams et al., 2005).
- PAL is encoded by a PAL gene derived from a yeast species, e.g., Rhodosporidium toruloides (Gilbert et al., 1985). In some embodiments, PAL is encoded by a PAL gene derived from a plant species, e.g., Arabidopsis thaliana (Wanner et al., 1995). Any suitable nucleotide and amino acid sequences of PAL, or functional fragments thereof, may be used.
- Phenylalanine hydroxylase and “PAH” are used to refer to an enzyme that catalyzes the hydroxylation of the aromatic side chain of phenylalanine to create tyrosine in the human body in conjunction with the cofactor tetrahydrobiopterin.
- the human gene encoding PAH is located on the long (q) arm of chromosome 12 between positions 22 and 24.2.
- the amino acid sequence of PAH is highly conserved among mammals. Nucleic acid sequences for human and mammalian PAH are well known and widely available. The full-length human cDNA sequence for PAH was reported in 1985 (Kwok et al. 1985). Active fragments of PAH are also well known (e.g., Kobe et al. 1997).
- L-Aminoacid Deaminase and “LAAD” are used to refer to an enzyme that catalyzes the stereospecific oxidative deamination of L-amino acids to generate their respective keto acids, ammonia, and hydrogen peroxide.
- LAAD catalyzes the conversion of phenylalanine to phenylpyruvate.
- Multiple LAAD enzymes are known in the art, many of which are derived from bacteria, such as Proteus, Providencia, and Morganella, or venom. LAAD is characterized by fast reaction rate of phenylalanine degradation (Hou et al., Appl Microbiol Technol.
- Phenylalanine transport through the inner membrane into the cytoplasm is not required for Proteus LAAD mediated phenylalanine degradation. Phenylalanine is readily taken up through the outer membrane into the periplasm without a transporter, eliminating the need for a transporter to improve substrate availability.
- the genetically engineered bacteria comprise a LAAD gene derived from a bacterial species, including but not limited to, Proteus, Providencia, and Morganella bacteria.
- the bacterial species is Proteus mirabilis.
- the bacterial species is Proteus vulgaris.
- the LAAD encoded by the genetically engineered bacteria is localized to the plasma membrane, facing into the periplasmic space and with the catalytic activity occurring in the periplasmic space.
- PME Phenylalanine metabolizing enzyme
- PME phenylalanine hydroxylase
- PAL phenylalanine ammonia lyase
- aminotransferase L-amino acid deaminase
- L-AAD L-amino acid deaminase
- the PME encoded by the genetically engineered bacteria requires a cofactor. In some embodiments, this cofactor is provided concurrently or sequentially with the administration of the genetically engineered bacteria. In other embodiments, the genetically engineered bacteria can produce the cofactor. In some embodiments, the genetically engineered bacteria encode a phenylalanine hydroxylase. In some embodiments, the genetically engineered bacteria encode a phenylalanine dehydrogenase. In some embodiments, the genetically engineered bacteria encode an aminotransferase.
- the PME encoded by the genetically engineered bacteria does not require a cofactor.
- the lack of need for a cofactor means that the rate of phenylalanine degradation by the enzyme is dependent on the availability of the substrate and is not limited by the availability of the cofactor.
- the PME produced by the genetically engineered bacteria is PAL.
- the PME produced by the genetically engineered bacteria is LAAD. In some embodiments,
- the genetically engineered bacteria encode combinations of PMEs.
- the catalytic activity of the PME is dependent on oxygen levels. In some embodiments, the PME is catalytically active under
- LAAD catalytic activity is dependent on oxygen.
- LAAD is active under low oxygen conditions, such as microaerobic conditions.
- the PME functions at very low levels of oxygen or in the absence of oxygen, e.g. as found in the colon.
- PAL activity is not dependent on the presence of oxygen.
- new or improved PMEs can be identified according to methods known in the art or described herein, and are encoded by the genetically engineered bacteria.
- the enzyme encoded by the genetically engineered bacteria is a wild type enzyme isolated from a viral, prokaryotic or eukaryotic organism.
- the enzyme sequence has been further modified or mutated to increase one or more specific properties of the enzyme, such as stability or catalytic activity.
- Phenylalanine metabolite refers to a metabolite that is generated as a result of the degradation of phenylalanine.
- the metabolite may be generated directly from phenylalanine, by the enzyme using phenylalanine as a substrate, or indirectly by a different enzyme downstream in the metabolic pathway, which acts on a phenylalanine metabolite substrate.
- phenylalanine metabolites are produced by the genetically engineered bacteria encoding a PME.
- the phenylalanine metabolite results directly or indirectly from PAH activity, e.g., from PAH produced by the genetically engineered bacteria.
- the metabolite is tyrosine.
- the phenylalanine metabolite accumulates in the blood or the urine of a PKU patient, due to defective PAH activity.
- PKU metabolites are phenylpyruvic acid and phenyl-lactic acid.
- Other examples include phenylacetate, phenylethylamine, and phenylacetyl glutamine.
- the phenylalanine metabolite results directly or indirectly from PAL action, e.g., from PAL produced by the genetically engineered bacteria.
- PAL action e.g., from PAL produced by the genetically engineered bacteria.
- PAL metabolites are trans-cinnamic acid and hippuric acid.
- the phenylalanine metabolite results directly or indirectly from LAAD action, e.g., from LAAD produced by the genetically engineered bacteria.
- LAAD metabolites are phenylpyruvate and phenyllactic acid.
- Phenylalanine transporter is used to refer to a membrane transport protein that is capable of transporting phenylalanine into bacterial cells (see, e.g., Pi et al., 1991).
- the pheP gene encodes a high affinity phenylalanine- specific permease responsible for phenylalanine transport (Pi et al., 1998).
- the phenylalanine transporter is encoded by a pheP gene derived from a bacterial species, including but not limited to, Acinetobacter calcoaceticus, Salmonella enterica, and Escherichia coli.
- phenylalanine transporters include Aageneral amino acid permease, encoded by the aroP gene, transports three aromatic amino acids, including phenylalanine, with high affinity, and is thought, together with PheP, responsible for the lion share of phenylalanine import. Additionally, a low level of phenylalanine transport activity has been traced to the activity of the LIV-I/LS system, which is a branched-chain amino acid transporter consisting of two periplasmic binding proteins, the LIV-binding protein (LIV-I system) and LS-binding protein (LS system), and membrane components, LivHMGF.
- LIV-I/LS system is a branched-chain amino acid transporter consisting of two periplasmic binding proteins, the LIV-binding protein (LIV-I system) and LS-binding protein (LS system), and membrane components, LivHMGF.
- the phenylalanine transporter is encoded by a aroP gene derived from a bacterial species. In some embodiments, the phenylalanine transporter is encoded by LIV-binding protein and LS- binding protein and LivHMGF genes derived from a bacterial species. In some embodiments, the genetically engineered bacteria comprise more than one type of phenylalanine transporter, selected from pheP, aroP, and the LIV-I/LS system.
- Phenylalanine and “Phe” are used to refer to an amino acid with the formula C 6 H 5 CH 2 CH( l 2 )COOH. Phenylalanine is a precursor for tyrosine, dopamine, norepinephrine, and epinephrine. L-phenylalanine is an essential amino acid and the form of phenylalanine primarily found in dietary protein; the stereoisomer D- phenylalanine is found is lower amounts in dietary protein; DL-phenylalanine is a combination of both forms. Phenylalanine may refer to one or more of L- phenylalanine, D-phenylalanine, and DL-phenylalanine.
- operably linked refers a nucleic acid sequence, e.g., a gene encoding PAL, that is joined to a regulatory region sequence in a manner which allows expression of the nucleic acid sequence, e.g., acts in cis.
- a regulatory region is a nucleic acid that can direct transcription of a gene of interest and may comprise promoter sequences, enhancer sequences, response elements, protein recognition sites, inducible elements, promoter control elements, protein binding sequences, 5' and 3' untranslated regions, transcriptional start sites, termination sequences, polyadenylation sequences, and introns.
- an "inducible promoter” refers to a regulatory region that is operably linked to one or more genes, wherein expression of the gene(s) is increased in the presence of an inducer of said regulatory region.
- a "directly inducible promoter” refers to a regulatory region, wherein the regulatory region is operably linked to a gene encoding a phenylalanine-metabolizing enzyme, e.g., PAL; in the presence of an inducer of said regulatory region, the phenylalanine-metabolizing enzyme is expressed.
- An "indirectly inducible promoter” refers to a regulatory system comprising two or more regulatory regions, for example, a first regulatory region that is operably linked to a gene encoding a first molecule, e.g., a transcriptional regulator, which is capable of regulating a second regulatory region that is operably linked to a gene encoding a phenylalanine-metabolizing enzyme. In the presence of an inducer of the first regulatory region, the second regulatory region may be activated or repressed, thereby activating or repressing expression of the
- inducible promoter Both a directly inducible promoter and an indirectly inducible promoter are encompassed by "inducible promoter.”
- Exogenous environmental conditions refer to settings or circumstances under which the promoter described above is directly or indirectly induced.
- the exogenous environmental conditions are specific to the gut of a mammal.
- the exogenous environmental conditions are specific to the upper gastrointestinal tract of a mammal.
- the exogenous environmental conditions are specific to the lower gastrointestinal tract of a mammal.
- the exogenous environmental conditions are specific to the small intestine of a mammal.
- exogenous environmental conditions refer to the presence of molecules or metabolites that are specific to the mammalian gut in a healthy or disease state, e.g., propionate.
- the exogenous environmental conditions are low-oxygen, microaerobic, or anaerobic conditions, such as the environment of the mammalian gut.
- Exogenous environmental condition(s) refer to setting(s) or circumstance(s) under which the promoter described herein is induced.
- exogenous environmental conditions is meant to refer to the environmental conditions external to the engineered microorganism, but endogenous or native to the host subject environment.
- exogenous and endogenous may be used interchangeably to refer to environmental conditions in which the environmental conditions are
- the exogenous environmental conditions are specific to the gut of a mammal. In some embodiments, the exogenous environmental conditions are specific to the upper gastrointestinal tract of a mammal. In some embodiments, the exogenous environmental conditions are specific to the lower gastrointestinal tract of a mammal. In some embodiments, the exogenous
- the exogenous environmental conditions are specific to the small intestine of a mammal.
- the exogenous environmental conditions are low-oxygen, microaerobic, or anaerobic conditions, such as the environment of the mammalian gut.
- exogenous environmental conditions are molecules or metabolites that are specific to the mammalian gut, e.g., propionate.
- the exogenous environmental condition is a tissue-specific or disease-specific metabolite or molecule(s).
- the exogenous environmental condition is a low- pH environment.
- the genetically engineered microorganism of the disclosure comprises a pH-dependent promoter.
- the genetically engineered microorganism of the disclosure comprises an oxygen level- dependent promoter.
- bacteria have evolved transcription factors that are capable of sensing oxygen levels. Different signaling pathways may be triggered by different oxygen levels and occur with different kinetics.
- oxygen level-dependent promoter or “oxygen level-dependent regulatory region” refers to a nucleic acid sequence to which one or more oxygen level- sensing transcription factors is capable of binding, wherein the binding and/or activation of the corresponding transcription factor activates downstream gene expression.
- oxygen level-dependent transcription factors include, but are not limited to, F R, ANR, and DNR.
- F R-responsive promoters, A R-responsive promoters, and D R-responsive promoters are known in the art (see, e.g., Castiglione et al., 2009; Eiglmeier et al., 1989; Galimand et al., 1991; Hasegawa et al., 1998; Hoeren et al., 1993; Salmon et al., 2003).
- Non-limiting examples are shown in Table 1.
- a promoter was derived from the E. coli Nissle fumarate and nitrate reductase gene S (fnrS) that is known to be highly expressed under conditions of low or no environmental oxygen (Durand and Storz, 2010; Boysen et al, 2010).
- the PfnrS promoter is activated under anaerobic conditions by the global transcriptional regulator FNR that is naturally found in Nissle. Under anaerobic conditions, FNR forms a dimer and binds to specific sequences in the promoters of specific genes under its control, thereby activating their expression.
- PfnrS inducible promoter is adopted to modulate the expression of proteins or RNA.
- PfnrS is used interchangeably in this application as FNRS, fnrS, F R, P-F RS promoter and other such related designations to indicate the promoter PfnrS.
- a "non-native" nucleic acid sequence refers to a nucleic acid sequence not normally present in a bacterium, e.g., an extra copy of an endogenous sequence, or a heterologous sequence such as a sequence from a different species, strain, or substrain of bacteria, or a sequence that is modified and/or mutated as compared to the unmodified sequence from bacteria of the same subtype.
- the non-native nucleic acid sequence is a synthetic, non-naturally occurring sequence ⁇ see, e.g., Purcell et al., 2013).
- the non-native nucleic acid sequence may be a regulatory region, a promoter, a gene, and/or one or more genes in a gene cassette.
- “non-native” refers to two or more nucleic acid sequences that are not found in the same relationship to each other in nature.
- the non- native nucleic acid sequence may be present on a plasmid or chromosome.
- multiple copies of any regulatory region, promoter, gene, and/or gene cassette may be present in the bacterium, wherein one or more copies of the regulatory region, promoter, gene, and/or gene cassette may be mutated or otherwise altered as described herein.
- the genetically engineered bacteria are engineered to comprise multiple copies of the same regulatory region, promoter, gene, and/or gene cassette in order to enhance copy number or to comprise multiple different components of a gene cassette performing multiple different functions.
- the genetically engineered bacteria of the invention comprise a gene encoding a phenylalanine- metabolizing enzyme that is operably linked to a directly or indirectly inducible promoter that is not associated with said gene in nature, e.g., an FNR promoter operably linked to a gene encoding PAL or a ParaBAD promoter operably linked to LAAD.
- Constant promoter refers to a promoter that is capable of facilitating continuous transcription of a coding sequence or gene under its control and/or to which it is operably linked.
- Constitutive promoters and variants are well known in the art and include, but are not limited to, BBa_J23100, a constitutive
- Escherichia coli ⁇ promoter ⁇ e.g., an osmY promoter (International Genetically Engineered Machine (iGEM) Registry of Standard Biological Parts Name BBa_J45992; BBa_J45993)), a constitutive Escherichia coli ⁇ 32 promoter ⁇ e.g., htpG heat shock promoter (BBa_J45504)), a constitutive Escherichia coli ⁇ 70 promoter ⁇ e.g., lacq promoter (BBa_J54200; BBa_J56015), E. coli CreABCD phosphate sensing operon promoter (BBa_J64951), GlnRS promoter (BBa_K088007), lacZ promoter
- iGEM International Genetically Engineered Machine
- BBa Kl 19000; BBa Kl 19001 M13K07 gene I promoter
- BBa_M13101 M13K07 gene II promoter
- BBa_M13102 M13K07 gene III promoter
- BBa_M13103 M13K07 gene IV promoter
- BBa_M13105 M13K07 gene V promoter
- M13K07 gene VI promoter (BBa_M13106), M13K07 gene VIII promoter
- BBa_M13108 M13110 (BBa_M13110)
- BBa_M13110 M13110
- a constitutive Bacillus subtilis ⁇ ⁇ promoter ⁇ e.g., promoter veg (BBa_K143013), promoter 43 (BBa_K143013), Pi iaG
- BBa_K823000 Pi epA (BBa_K823002), P veg (BBa_K823003)), a constitutive Bacillus subtilis ⁇ ⁇ promoter ⁇ e.g., promoter etc (BBa_K143010), promoter gsiB
- a Salmonella promoter ⁇ e.g., Pspv2 from Salmonella
- T7 promoter e.g., T7 promoter (BBa_I712074; BBa_I719005; BBa_J34814; BBa_J64997;
- BBa Kl 13010 BBa Kl 13011; BBa Kl 13012; BBa_R0085; BBa_R0180;
- the gut comprises the gastrointestinal (GI) tract, which starts at the mouth and ends at the anus, and additionally comprises the esophagus, stomach, small intestine, and large intestine.
- the gut also comprises accessory organs and glands, such as the spleen, liver, gallbladder, and pancreas.
- the upper gastrointestinal tract comprises the esophagus, stomach, and duodenum of the small intestine.
- the lower gastrointestinal tract comprises the remainder of the small intestine, i.e., the jejunum and ileum, and all of the large intestine, i.e., the cecum, colon, rectum, and anal canal.
- Bacteria can be found throughout the gut, e.g., in the gastrointestinal tract, and particularly in the intestines.
- the term "gene sequence” is meant to refer to a genetic sequence, e.g., a nucleic acid sequence.
- the gene sequence or genetic sequence is meant to include a complete gene sequence or a partial gene sequence.
- the gene sequence or genetic sequence is meant to include sequence that encodes a protein or polypeptide and is also menat to include genetic sequence that does not encode a protein or polypeptide, e.g., a regulatory sequence, leader sequence, signal sequence, or other non-protein coding sequence.
- Microorganism refers to an organism or microbe of microscopic, submicroscopic, or ultramicroscopic size that typically consists of a single cell.
- microorganisms include bacteria, viruses, parasites, fungi, certain algae, and protozoa.
- the microorganism is engineered ("engineered microorganism") to produce one or more therapeutic molecules or proteins of interest.
- the microorganism is engineered to take up and catabolize certain metabolites or other compounds from its environment, e.g., the gut.
- the microorganism is engineered to synthesize certain beneficial metabolites or other compounds (synthetic or naturally occurring) and release them into its environment.
- the engineered microorganism is an engineered bacterium.
- the engineered microorganism is an engineered virus.
- Non-pathogenic bacteria refer to bacteria that are not capable of causing disease or harmful responses in a host.
- non-pathogenic bacteria are Gram-negative bacteria.
- non-pathogenic bacteria are Gram-positive bacteria.
- non-pathogenic bacteria are commensal bacteria, which are present in the indigenous microbiota of the gut.
- non-pathogenic bacteria examples include, but are not limited to, Bacillus,
- Bacteroides Bacteroides, Bifidobacterium, Brevibacteria, Clostridium, Enterococcus, Escherichia, Lactobacillus, Lactococcus, Saccharomyces, and Staphylococcus, e.g., Bacillus coagulans, Bacillus subtilis, Bacteroides fragilis, Bacteroides subtilis, Bacteroides thetaiotaomicron, Bifidobacterium bifidum, Bifidobacterium infantis, Bifidobacterium lactis, Bifidobacterium longum, Clostridium butyricum, Enterococcus faecium,
- Naturally pathogenic bacteria may be genetically engineered to provide reduce or eliminate pathogenicity.
- Probiotic is used to refer to live, non-pathogenic microorganisms, e.g., bacteria, which can confer health benefits to a host organism that contains an appropriate amount of the microorganism.
- the host organism is a mammal.
- the host organism is a human.
- Some species, strains, and/or subtypes of non-pathogenic bacteria are currently recognized as probiotic.
- Examples of probiotic bacteria include, but are not limited to, Bifidobacteria, Escherichia, Lactobacillus, and Saccharomyces, e.g. , Bifidobacterium bifidum,
- the probiotic may be a variant or a mutant strain of bacterium (Arthur et al., 2012; Cuevas-Ramos et al., 2010; Olier et al., 2012; Nougayrede et al., 2006).
- Non-pathogenic bacteria may be genetically engineered to enhance or improve desired biological properties, e.g., survivability.
- Non-pathogenic bacteria may be genetically engineered to provide probiotic properties.
- Probiotic bacteria may be genetically engineered to enhance or improve probiotic properties.
- stable bacterium refers to a bacterial host cell carrying non-native genetic material, e.g., a PAL gene, which is incorporated into the host genome or propagated on a self-replicating extra- chromosomal plasmid, such that the non-native genetic material is retained, expressed, and/or propagated.
- non-native genetic material e.g., a PAL gene
- the stable bacterium is capable of survival and/or growth in vitro, e.g., in medium, and/or in vivo, e.g., in the gut.
- the stable bacterium may be a genetically modified bacterium comprising a PAL gene, in which the plasmid or chromosome carrying the PAL gene is stably maintained in the host cell, such that PAL can be expressed in the host cell, and the host cell is capable of survival and/or growth in vitro and/or in vivo.
- copy number affects the stability of expression of the non-native genetic material, e.g., a PAL gene or a PAH gene.
- copy number affects the level of expression of the non-native genetic material, e.g., a PAL gene or a PAH gene.
- module and “treat” and their cognates refer to an amelioration of a disease, disorder, and/or condition, or at least one discernible symptom thereof.
- modulate and “treat” refer to an amelioration of at least one measurable physical parameter, not necessarily discernible by the patient.
- modulate and “treat” refer to inhibiting the progression of a disease, disorder, and/or condition, either physically (e.g., stabilization of a discernible symptom), physiologically (e.g., stabilization of a physical parameter), or both.
- modulate and “treat” refer to slowing the progression of a disease, disorder, and/or condition, either physically (e.g., stabilization of a discernible symptom), physiologically (e.g., stabilization of a physical parameter), or both.
- modulate and “treat” refer to slowing the
- prevent and its cognates refer to delaying the onset or reducing the risk of acquiring a given disease, disorder and/or condition or a symptom associated with such disease, disorder, and/or condition.
- Those in need of treatment may include individuals already having a particular medical disease, as well as those at risk of having, or who may ultimately acquire the disease.
- the need for treatment is assessed, for example, by the presence of one or more risk factors associated with the development of a disease, the presence or progression of a disease, or likely receptiveness to treatment of a subject having the disease.
- Primary hyperphenylalaninemia e.g., PKU
- Hyperphenylalaninemia can also be secondary to other conditions, e.g., liver diseases. Treating hyperphenylalaninemia may encompass reducing or eliminating excess phenylalanine and/or associated symptoms, and does not necessarily encompass the elimination of the underlying disease.
- a "pharmaceutical composition” refers to a preparation of genetically engineered bacteria of the invention with other components such as a physiologically suitable carrier and/or excipient.
- physiologically acceptable carrier and “pharmaceutically acceptable carrier” which may be used interchangeably refer to a carrier or a diluent that does not cause significant irritation to an organism and does not abrogate the biological activity and properties of the administered bacterial compound.
- An adjuvant is included under these phrases.
- excipient refers to an inert substance added to a
- compositions to further facilitate administration of an active ingredient.
- examples include, but are not limited to, calcium bicarbonate, calcium phosphate, various sugars and types of starch, cellulose derivatives, gelatin, vegetable oils, polyethylene glycols, and surfactants, including, for example, polysorbate 20.
- terapéuticaally effective dose and “therapeutically effective amount” are used to refer to an amount of a compound that results in prevention, delay of onset of symptoms, or amelioration of symptoms of a condition, e.g.,
- a therapeutically effective amount may, for example, be sufficient to treat, prevent, reduce the severity, delay the onset, and/or reduce the risk of occurrence of one or more symptoms of a disease or condition associated with excess phenylalanine levels.
- a therapeutically effective amount, as well as a therapeutically effective frequency of administration, can be determined by methods known in the art and discussed below.
- polypeptide includes “polypeptide” as well as “polypeptides,” and refers to a molecule composed of amino acid monomers linearly linked by amide bonds (i.e., peptide bonds).
- polypeptide refers to any chain or chains of two or more amino acids, and does not refer to a specific length of the product.
- peptides include “peptides,” “dipeptides,” “tripeptides, “oligopeptides,” “protein,” “amino acid chain,” or any other term used to refer to a chain or chains of two or more amino acids, and the term “polypeptide” may be used instead of, or interchangeably with any of these terms.
- dipeptide refers to a peptide of two linked amino acids.
- tripeptide refers to a peptide of three linked amino acids.
- polypeptide is also intended to refer to the products of post-expression modifications of the polypeptide, including but not limited to glycosylate on, acetylation, phosphorylation, amidation, derivatization, proteolytic cleavage, or modification by non-naturally occurring amino acids,
- a polypeptide may be derived from a natural biological source or produced by
- polypeptide is produced by the genetically engineered bacteria or virus of the current invention
- a polypeptide of the invention may be of a size of about 3 or more, 5 or more, 10 or more, 20 or more, 25 or more, 50 or more, 75 or more, 100 or more, 200 or more, 500 or more, 1,000 or more, or 2,000 or more amino acids.
- Polypeptides may have a defined three-dimensional structure, although they do not necessarily have such structure. Polypeptides with a defined three-dimensional structure are referred to as folded, and polypeptides, which do not possess a defined three-dimensional structure, but rather can adopt a large number of different conformations, are referred to as unfolded.
- peptide or “polypeptide” may refer to an amino acid sequence that corresponds to a protein or a portion of a protein or may refer to an amino acid sequence that corresponds with nonprotein sequence, e.g., a sequence selected from a regulatory peptide sequence, leader peptide sequence, signal peptide sequence, linker peptide sequence, and other peptide sequence.
- polypeptide or a fragment, variant, or derivative thereof refers to a polypeptide that is not in its natural milieu. No particular level of purification is required.
- Recombinantly produced polypeptides and proteins expressed in host cells including but not limited to bacterial or mammalian cells, are considered isolated for purposed of the invention, as are native or recombinant polypeptides which have been separated, fractionated, or partially or substantially purified by any suitable technique.
- Recombinant peptides, polypeptides or proteins refer to peptides, polypeptides or proteins produced by recombinant DNA techniques, i.e.
- fragments of polypeptides of the present invention include proteolytic fragments, as well as deletion fragments.
- Fragments also include specific antibody or bioactive fragments or immunologically active fragments derived from any polypeptides described herein. Variants may occur naturally or be non- naturally occurring. Non-naturally occurring variants may be produced using mutagenesis methods known in the art. Variant polypeptides may comprise conservative or non-conservative amino acid substitutions, deletions or additions.
- Polypeptides also include fusion proteins.
- the term “variant” includes a fusion protein, which comprises a sequence of the original peptide or sufficiently similar to the original peptide.
- the term “fusion protein” refers to a chimeric protein comprising amino acid sequences of two or more different proteins. Typically, fusion proteins result from well known in vitro recombination techniques. Fusion proteins may have a similar structural function (but not necessarily to the same extent), and/or similar regulatory function (but not necessarily to the same extent), and/or similar biochemical function (but not necessarily to the same extent) and/or immunological activity (but not necessarily to the same extent) as the individual original proteins which are the components of the fusion proteins.
- “Derivatives” include but are not limited to peptides, which contain one or more naturally occurring amino acid derivatives of the twenty standard amino acids. "Similarity" between two peptides is determined by comparing the amino acid sequence of one peptide to the sequence of a second peptide. An amino acid of one peptide is similar to the corresponding amino acid of a second peptide if it is identical or a conservative amino acid substitution.
- amino acids belonging to one of the following groups represent conservative changes or substitutions: -Ala, Pro, Gly, Gin, Asn, Ser, Thr; -Cys, Ser, Tyr, Thr; -Val, He, Leu, Met, Ala, Phe; -Lys, Arg, His; -Phe, Tyr, Trp, His; and -Asp, Glu.
- the term "sufficiently similar” means a first amino acid sequence that contains a sufficient or minimum number of identical or equivalent amino acid residues relative to a second amino acid sequence such that the first and second amino acid sequences have a common structural domain and/or common functional activity.
- amino acid sequences that comprise a common structural domain that is at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%o, at least about 96%>, at least about 97%, at least about 98%o, at least about 99%>, or at least about 100%, identical are defined herein as sufficiently similar.
- variants will be sufficiently similar to the amino acid sequence of the peptides of the invention. Such variants generally retain the functional activity of the peptides of the present invention.
- Variants include peptides that differ in amino acid sequence from the native and wt peptide, respectively, by way of one or more amino acid deletion(s), addition(s), and/or substitution(s). These may be naturally occurring variants as well as artificially designed ones,
- linker refers to synthetic or non-native or non-naturally-occurring amino acid sequences that connect or link two polypeptide sequences, e.g., that link two polypeptide domains.
- synthetic refers to amino acid sequences that are not naturally occurring. Exemplar ⁇ ' linkers are described herein. Additional exemplary linkers are provided in US 20140079701 , the contents of which are herein incorporated by reference in its entirety.
- codon-optimized sequence refers to a sequence, which was modified from an existing coding sequence, or designed, for example, to improve translation in an expression host ceil or organism of a transcript RNA molecule transcribed from the coding sequence, or to improve transcription of a coding sequence.
- Codon optimization includes, but is not limited to, processes including selecting codons for the coding sequence to suit the codon preference of the expression host organism.
- Codon preference or codon bias differences in codon usage between organisms, is allowed by the degeneracy of the genetic code, and is well documented among many organisms. Codon bias often correlates with the efficiency of translation of messenger RNA (mRNA), which is in turn believed to be dependent on, inter alia, the properties of the codons being translated and the availability of particular transfer RNA (tRNA) molecules.
- mRNA messenger RNA
- tRNA transfer RNA
- the predominance of selected tRNAs in a cell is generally a reflection of the codons used most frequently in peptide synthesis. Accordingly, genes can be tailored for optimal gene expression in a given organism based on codon optimization.
- secretion system or “secretion protein” refers to a native or non-native secretion mechanism capable of secreting or exporting the protein(s) of interest or therapeutic protein(s) from the microbial, e.g., bacterial cytoplasm.
- the secretion system may comprise a single protein or may comprise two or more proteins assembled in a complex e.g., HlyBD.
- Non-limiting examples of secretion systems for gram negative bacteria include the modified type III flagellar, type I (e.g., hemolysin secretion system), type II, type IV, type V, type VI, and type VII secretion systems, resistance-nodulation-division (RND) multi-drug efflux pumps, various single membrane secretion systems.
- Non-liming examples of secretion systems for gram positive bacteria include Sec and TAT secretion systems.
- the proteins of interest include a "secretion tag" of either RNA or peptide origin to direct the protein(s) of interest or therapeutic protein(s) to specific secretion systems.
- the secretion system is able to remove this tag before secreting the protein(s) of interest from the engineered bacteria.
- the N-terminal peptide secretion tag is removed upon translocation of the "passenger" peptide from the cytoplasm into the periplasmic compartment by the native Sec system.
- the C-terminal secretion tag can be removed by either an autocatalytic or protease-catalyzed e.g., OmpT cleavage thereby releasing the protein(s) of interest into the extracellular milieu.
- transporter is meant to refer to a mechanism, e.g., protein or proteins, for importing a molecule, e.g., amino acid, toxin, metabolite, substrate, etc. into the microorganism from the extracellular milieu.
- the genetically engineered bacteria of the invention are capable of reducing excess phenylalanine.
- the genetically engineered bacteria are non-pathogenic bacteria.
- the genetically engineered bacteria are commensal bacteria.
- the genetically engineered bacteria are probiotic bacteria.
- the genetically engineered bacteria are naturally pathogenic bacteria that are modified or mutated to reduce or eliminate pathogenicity.
- non-pathogenic bacteria are Gram- negative bacteria.
- non-pathogenic bacteria are Gram-positive bacteria.
- Exemplary bacteria include, but are not limited to, Bacillus, Bacteroides, Bifidobacterium, Brevibacteria, Clostridium, Enter ococcus, Escherichia coli,
- Lactobacillus Lactococcus, Saccharomyces, and Staphylococcus, e.g., Bacillus coagulans, Bacillus subtilis, Bacteroides fragilis, Bacteroides subtilis, Bacteroides thetaiotaomicron, Bifidobacterium bifidum, Bifidobacterium infantis, Bifidobacterium lactis, Bifidobacterium longum, Clostridium butyricum, Enterococcus faecium,
- the genetically engineered bacteria are selected from the group consisting of Bacteroides fragilis, Bacteroides thetaiotaomicron, Bacteroides subtilis,
- the genetically engineered bacteria are any suitable bacteria.
- Escherichia coli strain Nissle 1917 (E. coli Nissle), a Gram-negative bacterium of the Enterobacteriaceae family that has evolved into one of the best characterized probiotics (Ukena et al., 2007).
- the strain is characterized by its complete harmlessness (Schultz, 2008), and has GRAS (generally recognized as safe) status (Reister et al., 2014, emphasis added).
- Genomic sequencing confirmed that E. coli Nissle lacks prominent virulence factors (e.g., E. coli a-hemolysin, P-fimbrial adhesins) (Schultz, 2008). In addition, it has been shown that E.
- E. coli Nissle does not carry pathogenic adhesion factors, does not produce any enterotoxins or cytotoxins, is not invasive, and is not uropathogenic (Sonnenborn et al., 2009). As early as in 1917, E. coli Nissle was packaged into medicinal capsules, called Mutaflor, for therapeutic use. It is commonly accepted that E. coli Nissle' s therapeutic efficacy and safety have convincingly been proven (Ukena et al., 2007).
- genes from one or more different species can be introduced into one another, e.g., the PAL gene from Rhodosporidium toruloides can be expressed in Escherichia coli (Sarkissian et al., 1999), and it is known that prokaryotic and eukaryotic phenylalanine ammonia lyases share sequence homology (Xiang and Moore, 2005).
- Unmodified E. coli Nissle and the genetically engineered bacteria of the invention may be destroyed, e.g., by defense factors in the gut or blood serum
- the genetically engineered bacteria may require continued administration.
- the residence time is calculated for a human subject. Residence time in vivo may be calculated for the genetically engineered bacteria of the invention (see, e.g., Fig. 38).
- the genetically engineered bacteria of the invention comprise a gene encoding PAL, wherein the PAL gene is operably linked to a directly or indirectly inducible promoter. In some embodiments, the bacteria comprise a non-native PAL gene. In some embodiments, the bacteria comprise additional copies of a native PAL gene. In some embodiments, the promoter is not associated with the PAL gene in nature. In some embodiments, the genetically engineered bacteria of the invention comprise a gene encoding PAH, wherein the PAH gene is operably linked to a directly or indirectly inducible promoter. In some embodiments, the bacteria comprise a non-native PAH gene. In some embodiments, the bacteria comprise additional copies of a native PAH gene.
- the genetically engineered bacteria further comprise a gene encoding a phenylalanine transporter (PheP).
- the bacteria comprise additional copies of a native gene encoding a phenylalanine transporter, wherein the phenylalanine transporter gene is operably linked to a directly or indirectly inducible promoter.
- the bacteria comprise a gene encoding a non- native phenylalanine transporter, wherein the phenylalanine transporter gene is operably linked to a directly or indirectly inducible promoter. Both embodiments are
- non-native phenylalanine transporter encompassed by the term "non-native" phenylalanine transporter.
- the promoter is not associated with the pheP gene in nature. In some embodiments, the same promoter controls expression of PheP and PAL or PAH.
- the promoter that is operably linked to PAL, PAH, and/or pheP is directly or indirectly induced by exogenous environmental conditions.
- the promoter is directly or indirectly induced by exogenous environmental conditions specific to the gut of a mammal.
- the promoter is directly or indirectly induced by exogenous environmental conditions specific to the small intestine of a mammal.
- the promoter is directly or indirectly induced by low-oxygen or anaerobic conditions such as the environment of the mammalian gut.
- the promoter is directly or indirectly induced by the presence of molecules or metabolites that are specific to the gut of a mammal, e.g., propionate. In some embodiments, the promoter is directly or indirectly induced by exposure to tetracycline. In some embodiments, the promoter is directly or indirectly induced by a molecule that is co-administered with the genetically engineered bacteria of the invention.
- the genetically engineered bacteria of the invention comprise a gene encoding a phenylalanine-metabolizing enzyme (PME) and are capable of reducing hyperphenylalaninemia.
- PME phenylalanine-metabolizing enzyme
- phenylalanine metabolizing enzymes include, but are not limited to, phenylalanine hydroxylase (PAH), phenylalanine ammonia lyase (PAL), aminotransferases, L-amino acid deaminase (L-AAD), and phenylalanine
- dehydrogenases or aminotransferases require cofactors, while L-AAD and PAL do not require any extra cofactor.
- the lack of need for a cofactor means that phenylalanine degradation by the enzyme encoded by the genetically engineered bacteria is dependent on the availability of the substrate and is not limited by the availability of the cofactor.
- Phenylalanine ammonia lyase (PAL; EC 4.3.1.24) is an enzyme that catalyzes a reaction converting L-phenylalanine to ammonia and trans-cinnamic acid. Phenylalanine ammonia lyase is specific for L-Phe, and to a lesser extent, L-Tyrosine. The reaction catalyzed by PAL is the spontaneous, non-oxidative deamination of L- phenylalanine to yield trans-cinnamic acid and ammonia.
- PAL is a monomer and requires no cofactors (MacDonald et al., Biochem Cell Biol 2007;85:273-82. A modern view of phenylalanine ammonia lyase). In micro-organisms, it has a catabolic role, allowing them to utilize L-phenylalanine (L- Phe) as a sole source of carbon and nitrogen.
- the genetically engineered bacteria of the invention comprise a PAL gene. PAL is capable of converting phenylalanine to non-toxic levels of transcinnamic acid and ammonia.
- Trans-cinnamic acid can further be converted to TCA metabolites benzoic and hippuric acids (Sarkissian et al., J Mass Spectrom. 2007 Jun;42(6):811-7; Quantitation of phenylalanine and its trans-cinnamic, benzoic and hippuric acid metabolites in biological fluids in a single GC-MS analysis).
- PAL enzyme activity does not require THB cofactor activity.
- PAL is encoded by a PAL gene derived from a bacterial species, including but not limited to, Achromobacter xylosoxidans,
- the bacterial species is Pseudomonas aeruginosa, Photorhabdus luminescens, Anabaena variabilis, and Agrobacterium tumefaciens.
- the bacterial species is
- the bacterial species is Anabaena variabilis.
- PAL is encoded by a PAL gene derived from a eukaryotic species, e.g., a yeast species, a plant species. Multiple distinct PAL proteins are known in the art.
- the genetically engineered bacteria convert more phenylalanine when the PAL gene is expressed than unmodified bacteria of the same bacterial subtype under the same conditions.
- the genetically engineered bacteria comprising PAL may be used to metabolize phenylalanine in the body into non-toxic molecules in order to treat conditions associated with hyperphenylalaninemia, including PKU.
- the genetically engineered bacteria express Anabaena variabilis PAL ("PALI").
- the genetically engineered bacteria express
- PAL3 Photorhabdus luminescens PAL
- LAAD catalyzes the stereospecific oxidative, i.e., oxygen consuming, deamination of L-amino acids to a-keto acids along with the production of ammonia and hydrogen peroxide via an imino acid intermediate.
- L-AADs are found in snake venoms, and in many bacteria (Bifulco et al. 2013), specifically in the cytomembranes of the Proteus, Providencia, and Morganella bacteria.
- L-AADs (EC 1.4.3.2) are flavoenzymes with a dimeric structure. Each subunit contains a non-covalently-bound flavin adenine dinucleotide (FAD) cofactor) and do not require any external cofactors.
- FAD flavin adenine dinucleotide
- Proteus mirabilis contains two types of L-AADs (Duerre and Chakrabarty 1975).
- One has broad substrate specificity and catalyzes the oxidation of aliphatic and aromatic L- amino acids to keto acids, typically L-phenylalanine (GenBank: U35383.1) (Baek et al., Journal of Basic Microbiology 2011, 51, 129-135; "Expression and characterization of a second L-amino acid deaminase isolated from Proteus mirabilis in Escherichia coli").
- the other type acts mainly on basic L-amino acids (GenBank: EU669819.1).
- LAADs from bacterial, fungal, and plant sources appear to be involved in the utilization of L- amino acids (i.e., ammonia produced by the enzymatic activity) as a nitrogen source.
- L- amino acids i.e., ammonia produced by the enzymatic activity
- Most eukaryotic and prokaryotic L-amino acid deaminases are extracellularly secreted, with the exception of from Proteus species LAADs, which are membrane-bound.
- L-AADs have been reported to be located in the plasma membrane, facing outward into the periplasmic space, in which the enzymatic activity resides (Pelmont J et al., (1972) "L-amino acid oxidases of Proteus mirabilis: general properties" Biochimie 54: 1359-1374).
- the genetically engineered bacteria of the invention comprise a LAAD gene.
- LAAD is capable of converting phenylalanine to non-toxic levels of phenylpyruvate, which can also further be degraded, e.g., by liver enzymes, to phenyllactate. Phenylpyruvate cannot cross the blood brain barrier, which allows LAAD to reduce the levels of phenylalanine in the brain without allowing the accumulation of another potentially toxic metabolite.
- LAAD is encoded by a LAAD gene derived from a bacterial species, including but not limited to, Proteus, Providencia, and Morganella bacteria. In some embodiments, the bacterial species is Proteus mirabilis.
- the bacterial species is Proteus vulgaris.
- the genetically engineered bacteria express Proteus mirabilis LAAD enzyme GenBank: U35383.1. Non-limiting examples of LAAD sequences of interest are shown in Table 2.
- the LAAD enzyme is derived from snake venom. According to the invention, genetically engineered bacteria convert more phenylalanine when the LAAD gene is expressed than unmodified bacteria of the same bacterial subtype under the same conditions. Thus, the genetically engineered bacteria comprising LAAD may be used to metabolize phenylalanine in the body into non-toxic molecules in order to treat conditions associated with
- hyperphenylalaninemia including PKU.
- the genetically engineered bacteria encode a wild type enzyme as it occurs in nature.
- the genetically engineered bacteria encode an enzyme which comprises mutations relative to the wild type sequence.
- the mutations increase stability of the enzyme.
- the mutations increase the catalytic activity of the enzyme.
- the genetically engineered bacteria comprise a gene encoding one or more of the proteins listed in Table 2.
- the genetically engineered bacteria comprise gene sequence(s) encoding one or more of the polypeptides comprising sequence of any of SEQ ID Nos: 1-8.
- the genetically engineered bacteria comprise gene sequence(s) encoding a polypeptide having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%,96%, 97%, 98%, or 99% identity with any of the sequences of SEQ ID Nos: 1-8.
- the genetically engineered bacteria encode one or more enzymes from Table 2, which comprise a mutation.
- the genetically engineered bacteria comprise a gene encoding wild type PAH.
- the genetically engineered bacteria encode a mutated PAH with increased stability and/or activity.
- the genetically engineered bacteria comprise a gene encoding wild type PAL. In some embodiments, the genetically engineered bacteria encode a mutated PAL with increased stability and/or activity. In some embodiments, the genetically engineered bacteria comprise a gene encoding wild type LAAD. In some embodiments, the genetically engineered bacteria encode a mutated LAAD with increased stability and/or activity. Methods for screening enzymes with desirable properties are known in the art and described herein.
- Phenylalanin M S T A VLENPGL GRKL SDF GQET S YIEDNCNQNG AI S SEQ ID e LIF SLKEE VGAL AK VLRLFEEND VNLTHIE SRP SRLK NO: 8 hydroxylase KDEYEFFTHLDKRSLPALTNIIKILRHDIGATVHELS
- the PME e.g., PAL, LAAD, or PAH
- the PME may be present on a plasmid or chromosome in the genetically engineered bacteria.
- the PME gene is expressed under the control of a constitutive promoter.
- the PME gene is expressed under the control of a promoter that is directly or indirectly induced by exogenous environmental conditions, as described herein.
- the PME gene is expressed under the control of a promoter that is directly or indirectly induced by exogenous environmental conditions, such as in the presence of molecules or metabolites specific to the gut of a mammal.
- the PME gene is expressed under the control of a promoter that is directly or indirectly induced by low-oxygen, microaerobic, or anaerobic conditions, wherein expression of the PME gene, e.g., the PAL gene, is activated under low-oxygen or anaerobic
- the genetically engineered bacteria encode a PAL gene which is directly or indirectly induced by low-oxygen or anaerobic conditions, such as the mammalian gut.
- the genetically engineered bacteria encode a LAAD gene which is directly or indirectly induced by oxygenated, low oxygen, or microaerobic conditions, such as conditions found in the the proximal intestine, including but not limited to the stomach, duodenum, and ileum.
- the genetically engineered bacteria encode a PME gene which is directly or indirectly induced by an environmental factor that is naturally present in a
- the genetically engineered bacteria encode a PME gene which is directly or indirectly induced by an environmental factor that is not naturally present in a mammalian gut, e.g., arabinose. In other embodiments, the genetically engineered bacteria encode a PME gene which is directly or indirectly induced by an environmental factor that is naturally present in a mammalian gut under inflammatory conditions.
- An oxygen level-dependent promoter is a nucleic acid sequence to which one or more oxygen level-sensing transcription factors is capable of binding, wherein the binding and/or activation of the corresponding transcription factor activates downstream gene expression.
- the PME gene is expressed under the control of an oxygen level-dependent promoter.
- the PAL gene is under the control of an oxygen level-dependent promoter that is activated under low-oxygen or anaerobic environments, such as the environment of the mammalian gut.
- the genetically engineered bacteria comprise a PME, e.g., PAL, expressed under the control of the fumarate and nitrate reductase regulator (F R) promoter.
- F R fumarate and nitrate reductase regulator
- E. coli F R is a major transcriptional activator that controls the switch from aerobic to anaerobic metabolism (Unden et al., 1997).
- FNR dimerizes into an active DNA binding protein that activates hundreds of genes responsible for adapting to anaerobic growth.
- In the aerobic state FNR is prevented from dimerizing by oxygen and is inactive.
- multiple distinct FNR nucleic acid sequences are inserted in the genetically engineered bacteria.
- the genetically engineered bacteria comprise a PME, e.g., PAL, expressed under the control of an alternate oxygen level-dependent promoter, e.g., an ANR promoter (Ray et al., 1997), a DNR promoter (Trunk et al., 2010).
- an alternate oxygen level-dependent promoter e.g., an ANR promoter (Ray et al., 1997), a DNR promoter (Trunk et al., 2010).
- phenylalanine metabolism is particularly activated in a low-oxygen or anaerobic environment, such as in the gut.
- P. aeruginosa the anaerobic regulation of arginine deiminase and nitrate reduction (ANR) transcriptional regulator is "required for the expression of physiological functions which are inducible under oxygen-limiting or anaerobic conditions" (Winteler et al., 1996; Sawers 1991).
- P. aeruginosa ANR is homologous with E. coli FNR, and "the consensus FNR site (TTGAT— ATCAA) was recognized efficiently by ANR and FNR" (Winteler et al., 1996).
- ANR activates numerous genes responsible for adapting to anaerobic growth. In the aerobic state, ANR is inactive.
- Pseudomonas fluorescens, Pseudomonas putida, Pseudomonas syringae, and Pseudomonas mendocina all have functional analogs of ANR (Zimmermann et al., 1991). Promoters that are regulated by ANR are known in the art, e.g., the promoter of the arcDABC operon (see, e.g., Hasegawa et al., 1998).
- the FNR family also includes the dissimilatory nitrate respiration regulator (DNR) (Arai et al., 1995), a transcriptional regulator which is required in conjunction with ANR for "anaerobic nitrate respiration of Pseudomonas aeruginosa" (Hasegawa et al., 1998).
- DNR dissimilatory nitrate respiration regulator
- the FNR-binding motifs "are probably recognized only by DNR” (Hasegawa et al., 1998).
- Any suitable transcriptional regulator that is controlled by exogenous environmental conditions and corresponding regulatory region may be used. Non-limiting examples include ArcA/B, ResD/E, NreA/B/C, and AirSR, and others are known in the art.
- FNR promoter sequences are known in the art, and any suitable FNR promoter sequence(s) may be used in the genetically engineered bacteria of the invention. Any suitable FNR promoter(s) may be combined with any suitable PAL. Non-limiting FNR promoter sequences are provided in Table 3, and non-limiting PAL sequences are also provided herein.
- the genetically engineered bacteria of the invention comprise one or more of: SEQ ID NO: 9, SEQ ID NO: 10, nirBl promoter (SEQ ID NO: 11), nirB2 promoter (SEQ ID NO: 12), nirB3 promoter (SEQ ID NO: 13), ydfZ promoter (SEQ ID NO: 14), nirB promoter fused to a strong ribosome binding site (SEQ ID NO: 15), ydfZ promoter fused to a strong ribosome binding site (SEQ ID NO: an anaerobically induced small RNA gene (fiirSl promoter SEQ ID NO: 9 or fiirS2 promoter SEQ ID NO: 17), nirB promoter fused to a crp binding site (SEQ ID NO: 18), and frirS fused to a crp binding site (SEQ ID NO: 19).
- genetically engineered bacteria comprise a nucleic acid sequence that is at least about 80%, at least about 85%>, at least about 90%, at least about 95%, or at least about 99% homologous to the DNA sequence of SEQ ID NO: 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 or a functional fragment thereof .
- nirB3 ATAAACCCGCTCATTTTGTCTATTTTTTGCACAAACATGAAATATCAGAC SEQ ID NO: 13 AATTCCGTGACTTAAGAAAATTTATACAAATCAGCAATATACCCATTAAG
- nirB+crp CCCGCTCATTTTGTCTATTTTTTGCACAAACATGAAATATCAGACAATTC SEQ ID NO: 19 CGTGACTTAAGAAAATTTATACAAATCAGCAATATACCCATTAAGGAGTA
- a PME e.g., PAL
- a transcriptional activator e.g., CRP
- CRP cyclic AMP receptor protein or catabolite activator protein or CAP
- glucose repression preference for glucose has been termed glucose repression, as well as carbon catabolite repression (Deutscher, 2008; Gorke and Stiilke, 2008).
- PME e.g., PAL
- expression is controlled by an oxygen level-dependent promoter fused to a
- PAL expression is controlled by an FNR
- cyclic AMP binds to CRP when no glucose is present in the environment. This binding causes a conformational change in CRP, and allows CRP to bind tightly to its binding site. CRP binding then activates transcription of the PME gene, e.g., PAL gene, by recruiting RNA polymerase to the FNR promoter via direct protein-protein interactions. In the presence of glucose, cyclic AMP does not bind to CRP and a PME, e.g., PAL, gene transcription is repressed.
- PME e.g., PAL
- an oxygen level-dependent promoter e.g., an FNR promoter fused to a binding site for a transcriptional activator is used to ensure that a PME, e.g., PAL, is not expressed under anaerobic conditions when sufficient amounts of glucose are present, e.g., by adding glucose to growth media in vitro.
- a PME e.g., PAL
- a PME e.g., LAAD
- a transcriptional activator e.g., CRP
- LAAD is not under the control of an FNRs
- LAAD requires oxygen to catalyze the degradation of phenylalanine to
- a PME e.g., PAL or LAAD
- an inducible promoter that is responsive to specific molecules or metabolites in the environment, e.g., the mammalian gut.
- the short-chain fatty acid propionate is a major microbial fermentation metabolite localized to the gut (Hosseini et al., 2011).
- PAL gene expression is under the control of a propionate-inducible promoter.
- PME gene expression is under the control of a propionate-inducible promoter that is activated by the presence of propionate in the mammalian gut. Any molecule or metabolite found in the mammalian gut, in a healthy and/or disease state, may be used to induce PME gene expression. Non-limiting examples include propionate, bilirubin, aspartate
- PME e.g., PAL and/or LAAD
- gene expression is under the control of a ParaBAD promoter, which is activated in the presence of the sugar arabinose.
- LAAD expression is under the control of the P ar aBAD promoter.
- expression of LAAD occurs under aerobic or microaerobic conditions.
- the PAL gene is expressed under the control of a promoter that is induced by exposure to tetracycline.
- gene expression is further optimized by methods known in the art, e.g., by optimizing ribosomal binding sites, manipulating transcriptional regulators, and/or increasing mRNA stability.
- the genetically engineered bacteria comprise a stably maintained plasmid or chromosome carrying the PAL gene, such that PAL can be expressed in the host cell, and the host cell is capable of survival and/or growth in vitro, e.g., in medium, and/or in vivo, e.g., in the gut.
- the genetically engineered bacteria comprise two or more distinct PAL genes.
- the genetically engineered bacteria comprise multiple copies of the same PAL gene.
- the PAL gene is present on a plasmid and operably linked to a directly or indirectly inducible promoter.
- the PAL gene is present on a plasmid and operably linked to a promoter that is induced under low- oxygen or anaerobic conditions. In some embodiments, the PAL gene is present on a chromosome and operably linked to a directly or indirectly inducible promoter. In some embodiments, the PAL gene is present in the chromosome and operably linked to a promoter that is induced under low-oxygen or anaerobic conditions. In some embodiments, the PAL gene is present on a plasmid and operably linked to a promoter that is induced by exposure to tetracycline.
- the genetically engineered bacteria comprise a stably maintained plasmid or chromosome carrying the LAAD gene, such that LAAD can be expressed in the host cell, and the host cell is capable of survival and/or growth in vitro, e.g., in medium, and/or in vivo, e.g., in the gut.
- the genetically engineered bacteria comprise two or more distinct LAAD genes.
- the genetically engineered bacteria comprise multiple copies of the same LAAD gene.
- the LAAD gene is present on a plasmid and operably linked to a directly or indirectly inducible promoter.
- the LAAD gene is present on a plasmid and operably linked to a promoter that is inducible, e.g., by arabinose or tetracycline. In some embodiments, the LAAD gene is present on a chromosome and operably linked to a directly or indirectly inducible promoter. In some embodiments, the LAAD gene is present in the chromosome and operably linked to a promoter that is induced, e.g., by arabinose. In some embodiments, the LAAD gene is present on a plasmid and operably linked to a promoter that is induced by exposure to tetracycline.
- the genetically engineered bacteria comprise an oxygen-level dependent transcriptional regulator, e.g., FNR, ANR, or D R, and corresponding promoter from a different bacterial species.
- the non-native oxygen-level dependent transcriptional regulator and promoter increase the transcription of genes operably linked to said promoter, e.g., PAL, in a low-oxygen or anaerobic environment, as compared to the native transcriptional regulator and promoter in the bacteria under the same conditions.
- the non-native oxygen-level dependent transcriptional regulator is an FNR protein from N. gonorrhoeae ⁇ see, e.g., Isabella et al., 2011).
- the corresponding wild-type transcriptional regulator is left intact and retains wild-type activity.
- the corresponding wild-type transcriptional regulator is deleted or mutated to reduce or eliminate wild-type activity.
- the genetically engineered bacteria comprise a wild-type oxygen-level dependent transcriptional regulator, e.g., FNR, ANR, or DNR, and corresponding promoter that is mutated relative to the wild-type promoter from bacteria of the same subtype.
- the mutated promoter enhances binding to the wild-type transcriptional regulator and increases the transcription of genes operably linked to said promoter, e.g., PAL, in a low-oxygen or anaerobic environment, as compared to the wild-type promoter under the same conditions.
- the genetically engineered bacteria comprise a wild-type oxygen-level dependent promoter, e.g., FNR, ANR, or DNR promoter, and corresponding transcriptional regulator that is mutated relative to the wild-type transcriptional regulator from bacteria of the same subtype.
- the mutated transcriptional regulator enhances binding to the wild-type promoter and increases the transcription of genes operably linked to said promoter, e.g., PAL, in a low-oxygen or anaerobic environment, as compared to the wild-type transcriptional regulator under the same conditions.
- the mutant oxygen-level dependent transcriptional regulator is an FNR protein comprising amino acid substitutions that enhance dimerization and FNR activity (see, e.g., Moore et al., 2006).
- the genetically engineered bacteria of the invention comprise multiple copies of the endogenous gene encoding the oxygen level- sensing transcriptional regulator, e.g., the FNR gene.
- the gene encoding the oxygen level-sensing transcriptional regulator is present on a plasmid.
- the gene encoding the oxygen level-sensing transcriptional regulator and the gene encoding PAL are present on different plasmids.
- the gene encoding the oxygen level-sensing transcriptional regulator and the gene encoding PAL are present on the same plasmid.
- the gene encoding the oxygen level-sensing transcriptional regulator is present on a chromosome.
- the gene encoding the oxygen level-sensing transcriptional regulator and the gene encoding PAL are present on different chromosomes. In some embodiments, the gene encoding the oxygen level-sensing transcriptional regulator and the gene encoding PAL are present on the same chromosome. In some instances, it may be advantageous to express the oxygen level- sensing transcriptional regulator under the control of an inducible promoter in order to enhance expression stability. In some embodiments, expression of the transcriptional regulator is controlled by a different promoter than the promoter that controls expression of the gene encoding the phenylalanine-metabolizing enzyme. In some embodiments, expression of the transcriptional regulator is controlled by the same promoter that controls expression of the phenylalanine-metabolizing enzyme. In some embodiments, the transcriptional regulator and the phenylalanine-metabolizing enzyme are divergently transcribed from a promoter region.
- the genetically engineered bacteria of the invention produce PAL under exogenous environmental conditions, such as the low- oxygen environment of the mammalian gut, to reduce blood phenylalanine by at least about 1.5-fold, at least about 2-fold, at least about 3-fold, at least about 4-fold, at least about 5-fold, at least about 6-fold, at least about 7-fold, at least about 8-fold, at least about 9-fold, at least about 10-fold, at least about 15-fold, at least about 20-fold, at least about 30-fold, at least about 40-fold, or at least about 50-fold as compared to unmodified bacteria of the same subtype under the same conditions.
- Phenylalanine may be measured by methods known in the art, e.g., blood sampling and mass spectrometry.
- cinnamate is measured by methods known in the art to assess PAL activity. Cinnamate production is directly correlated with phenylalanine degradation, and in some embodiments, that cinnamate may be used as an alternative biomarker for strain activity (Fig. 16B). Cinnamate can be further degraded to hippuric acid by liver enzymes; both can be measured as described in Example 24-26.
- PAL expression is measured by methods known in the art to assess PAL activity.
- the genetically engineered bacteria of the invention produce LAAD, to reduce blood phenylalanine by at least about 1.5-fold, at least about 2-fold, at least about 3-fold, at least about 4-fold, at least about 5-fold, at least about 6-fold, at least about 7-fold, at least about 8-fold, at least about 9-fold, at least about 10-fold, at least about 15-fold, at least about 20-fold, at least about 30-fold, at least about 40-fold, or at least about 50-fold as compared to unmodified bacteria of the same subtype under the same conditions. Certain unmodified bacteria will not have appreciable levels of phenylalanine processing.
- LAAD-mediated processing of phenylalanine will be appreciable under exogenous environmental conditions.
- Phenylalanine may be measured by methods known in the art, e.g., blood sampling and mass spectrometry. Pyruvic acid and phenylpyruvate, the LAAD generated degradation products can be measured using masspectrometry as described in Examples 24-26, and can be used as an additional readout of LAAD activity.
- the PME e.g., PAL, LAAD, and/or PAH
- the low-copy plasmid may be useful for increasing stability of expression.
- the low-copy plasmid may be useful for decreasing leaky expression under non-inducing conditions.
- the PME e.g., PAL, LAAD, and/or PAH
- the high-copy plasmid may be useful for increasing the PME, e.g., PAL, LAAD, and/or PAH, expression, thereby increasing the metabolism of phenylalanine and reducing hyperphenylalaninemia.
- PME e.g., PAL, LAAD, and/or PAH
- a genetically engineered bacterium comprising a the PME, e.g., PAL, LAAD, and/or PAH, expressed on a high-copy plasmid does not increase phenylalanine metabolism or decrease phenylalanine levels as compared to a genetically engineered bacterium comprising the same PME, e.g., PAL, LAAD, and/or PAH, expressed on a low-copy plasmid in the absence of heterologous pheP and additional copies of a native pheP. Genetically engineered bacteria comprising the same the PME gene, e.g., PAL, LAAD, and/or PAH gene on high and low copy plasmids were generated.
- the rate-limiting step of phenylalanine metabolism is phenylalanine availability ⁇ see, e.g., Fig. 16).
- even low-copy PAL plasmids are capable of almost completely eliminating Phe from a test sample (see, e.g., Fig. 16A).
- a low-copy PAL-expressing plasmid in conjunction in order to enhance the stability of PAL expression while maintaining high phenylalanine metabolism, and to reduce negative selection pressure on the transformed bacterium.
- the phenylalanine transporter is used in conjunction with the high-copy plasmid.
- a transporter may not increase phenylalanine degradation.
- Proteus mirabilis LAAD is localized to the plasma membrane, with the enzymatic catalysis occurring in the periplasm. Phenylalanine can readily traverse the outer membrane without the need of a transporter. Therefore, in embodiments, in which the genetically engineered bacteria express LAAD, a transporter may not be needed or improve phenylalanine metabolism.
- the PME e.g., PAL, LAAD, and lor PAH
- the PME gene is expressed on a chromosome.
- expression from the chromosome may be useful for increasing stability of expression of the PME.
- the PME gene e.g., PAL, LAAD, and /or i H gene(s)
- the PME gene is integrated into the bacterial chromosome at one or more integration sites in the genetically engineered bacteria.
- the PME gene, e.g., PAL, LAAD, and /or PAH gene(s) is inserted into the bacterial genome at one or more of the following insertion sites in E.
- coli Nissle malE/K, insB/I, araC/BAD, lacZ, agal/rsml, thyA, and malP/T.
- Any suitable insertion site may be used (see, e.g., Fig. 36).
- the insertion site may be anywhere in the genome, e.g., in a gene required for survival and/or growth, such as thyA (to create an auxotroph); in an active area of the genome, such as near the site of genome replication; and/or in between divergent promoters in order to reduce the risk of unintended transcription, such as between AraB and AraC of the arabinose operon.
- more than one copy e.g., two, three, four, five, six, seven, eight, nine, ten or more copies of the PME gene, e.g., PAL, PAH, and/or LAAD is integrated into the bacterial chromosome at one or more integration sites in the genetically engineered bacteria.
- the more than one copy of a PME gene may be more then one copy of the same PME gene or more than one copy of different PME genes.
- Exemplary constructs are shown in 4-13 below.
- Table 4 shows the sequence of an exemplary construct comprising a gene encoding PheP and an F R promoter sequence for chromosomal insertion (SEQ ID NO: 21), with the pheP sequence underlined and the FNR promoter sequence bolded.
- Table 5 shows the sequence of an exemplary construct comprising a gene encoding PALI and an FNR promoter sequence on a high-copy plasmid (SEQ ID NO: 22), with the PALI sequence underlined and the FNR promoter sequence bolded.
- Table 6 shows the sequence of an exemplary construct comprising a gene encoding PAL3 and an FNR promoter sequence on a high-copy plasmid (SEQ ID NO: 23), with the PAL3 sequence underlined and the FNR promoter sequence bolded.
- Table 7 shows the sequence of an exemplary construct comprising a gene encoding PALI and a Tet promoter sequence on a high- copy plasmid (SEQ ID NO: 24), with the PALI sequence underlined and the Tet promoter sequence bolded.
- Table 8 shows the sequence of an exemplary construct comprising a gene encoding PAL3 and a Tet promoter sequence on a high-copy plasmid (SEQ ID NO: 25), with the PAL3 sequence underlined and the Tet promoter sequence bolded.
- Table 9 shows the sequence of an exemplary construct comprising a gene encoding PALI and an FNR promoter sequence on a low-copy plasmid (SEQ ID NO: 26), with the PALI sequence underlined and the FNR promoter sequence bolded.
- Table 10 shows the sequence of an exemplary construct comprising a gene encoding PAL3 and an FNR promoter sequence on a low-copy plasmid (SEQ ID NO: 27), with the PAL3 sequence underlined and the FNR promoter sequence bolded.
- Table 11 shows the sequence of an exemplary construct comprising a gene encoding PALI and a Tet promoter sequence on a low-copy plasmid (SEQ ID NO: 28), with the PALI sequence underlined and the Tet promoter sequence bolded.
- Table 12 shows the sequence of an exemplary construct comprising a gene encoding PAL3 and a Tet promoter sequence on a low-copy plasmid (SEQ ID NO: 29), with the PAL3 sequence underlined and the Tet promoter sequence bolded.
- Table 13 shows the sequence of an exemplary construct comprising a gene encoding PheP, a gene coding TetR, and a Tet promoter sequence for chromosomal insertion (SEQ ID NO: 30), with the pheP sequence underlined, the TetR sequence
- the genetically engineered bacteria contain gene sequence(s) comprising one or more sequence(s) of any of SEQ ID Nos: 21-30. In some embodiments, the genetically engineered bacteria contain gene sequence(s) comprising one or more sequence(s) having at least 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%,96%, 97%, 98%, or 99% identity with any of the sequences of SEQ ID Nos: 21-30.
- each of PALI and PAL3 was expressed on a high-copy plasmid and a low-copy plasmid in genetically engineered E. coli Nissle. Surprisingly, each construct metabolized and reduced phenylalanine to similar levels (Fig. 15), and the rate-limiting step of phenylalanine metabolism was phenylalanine availability (Fig. 16). Thus, in some embodiments, it is advantageous to increase phenylalanine transport into the cell, thereby enhancing phenylalanine metabolism. Unexpectedly, even low-copy PAL plasmids are capable of almost completely eliminating Phe from a test sample when expressed in conjunction with pheP (Fig. 16A).
- a low-copy PAL-expressing plasmid in conjunction with pheP in order to enhance the stability of PAL expression while maintaining high phenylalanine metabolism, and to reduce negative selection pressure on the transformed bacterium.
- the phenylalanine transporter is used in conjunction with the high-copy plasmid.
- the genetically engineered bacteria further comprise a gene encoding a phenylalanine transporter.
- Phenylalanine transporters may be expressed or modified in the genetically engineered bacteria of the invention in order to enhance phenylalanine transport into the cell.
- PheP is a membrane transport protein that is capable of transporting phenylalanine into bacterial cells (see, e.g., Pi et al., 1991).
- the native pheP gene in the genetically modified bacteria of the invention is not modified.
- the genetically engineered bacteria of the invention comprise multiple copies of the native pheP gene.
- the genetically engineered bacteria of the invention comprise multiple copies of a non-native pheP gene.
- the genetically engineered bacteria of the invention comprise a pheP gene that is controlled by its native promoter, an inducible promoter, a promoter that is stronger than the native promoter, e.g., the GlnRS promoter or the P(Bla) promoter, or a constitutive promoter.
- expression of the pheP gene is controlled by a different promoter than the promoter that controls expression of the gene encoding the phenylalanine-metabolizing enzyme and/or the transcriptional regulator.
- expression of the pheP gene is controlled by the same promoter that controls expression of the phenylalanine- metabolizing enzyme and/or the transcriptional regulator.
- the pheP gene and the phenylalanine-metabolizing enzyme and/or the transcriptional regulator are divergently transcribed from a promoter region.
- expression of each of the genes encoding PheP, the phenylalanine-metabolizing enzyme, and the transcriptional regulator is controlled by a different promoter.
- expression of the genes encoding PheP, the phenylalanine-metabolizing enzyme, and the transcriptional regulator is controlled by the same promoter.
- the native pheP gene in the genetically modified bacteria is not modified, and one or more additional copies of the native pheP gene are inserted into the genome under the control of the same inducible promoter that controls expression of PAL, e.g., the F R promoter, or a different inducible promoter than the one that controls expression of PAL, or a constitutive promoter.
- the same inducible promoter that controls expression of PAL e.g., the F R promoter, or a different inducible promoter than the one that controls expression of PAL, or a constitutive promoter.
- the native pheP gene is not modified, and a copy of a non-native pheP gene from a different bacterial species is inserted into the genome under the control of the same inducible promoter that controls expression of PAL, e.g., the FNR promoter, or a different inducible promoter than the one that controls expression of PAL, or a constitutive promoter.
- the native pheP gene in the genetically modified bacteria is not modified, and one or more additional copies of the native pheP gene are present in the bacteria on a plasmid and under the control of the same inducible promoter that controls expression of PAL, e.g., the F R promoter, or a different inducible promoter than the one that controls expression of the PME, or a constitutive promoter.
- the native pheP gene is not modified, and a copy of a non-native pheP gene from a different bacterial species is present in the bacteria on a plasmid and under the control of the same inducible promoter that controls expression of PAL, e.g., the FNR promoter, or a different inducible promoter than the one that controls expression of PAL, or a constitutive promoter.
- the native pheP gene is mutagenized, mutants exhibiting increased phenylalanine transport are selected, and the mutagenized pheP gene is isolated and inserted into the genetically engineered bacteria (see, e.g., Pi et al., 1996; Pi et al., 1998).
- the phenylalanine transporter modifications described herein may be present on a plasmid or chromosome.
- the genetically engineered bacterium is E. coli Nissle, and the native pheP gene in E. coli Nissle is not modified; one or more additional copies the native E. coli Nissle pheP genes are inserted into the E. coli Nissle genome under the control of the same inducible promoter that controls expression of PAL, e.g., the FNR promoter, or a different inducible promoter than the one that controls expression of PAL, or a constitutive promoter.
- coli Nissle is not modified, and a copy of a non-native pheP gene from a different bacterium is inserted into the E. coli Nissle genome under the control of the same inducible promoter that controls expression of PAL, e.g., the FNR promoter, or a different inducible promoter than the one that controls expression of PAL, or a constitutive promoter.
- the genetically engineered bacterium is E. coli Nissle, and the native pheP gene in E. coli Nissle is not modified; one or more additional copies the native E.
- coli Nissle pheP genes are present in the bacterium on a plasmid and under the control of the same inducible promoter that controls expression of PAL, e.g., the FNR promoter, or a different inducible promoter than the one that controls expression of PAL, or a constitutive promoter.
- the native pheP gene in E is present in E.
- coli Nissle is not modified, and a copy of a non-native pheP gene from a different bacterium, are present in the bacterium on a plasmid and under the control of the same inducible promoter that controls expression of PAL, e.g., the FNR promoter, or a different inducible promoter than the one that controls expression of PAL, or a constitutive promoter.
- Escherichia coli has five distinct transport systems (AroP, Mtr, PheP, TnaB, and TyrP) for the accumulation of aromatic amino acids.
- a general amino acid permease, encoded by the aroP gene transports three aromatic amino acids, including phenylalanine, with high affinity, and is thought, together with PheP, responsible for the lion share of phenylalanine import. Additionally, a low level of accumulation of phenylalanine was observed in an aromatic amino acid transporter-deficient E.
- LIV-I/LS system which is a branched-chain amino acid transporter consisting of two periplasmic binding proteins, the LIV-binding protein (LIV-I system) and LS-binding protein (LS system), and membrane components, LivHMGF (Koyanagi et al., and references therein; Identification of the LIV-I/LS System as the Third
- Phenylalanine Transporter in Escherichia coli K-12 Phenylalanine Transporter in Escherichia coli K-12.
- the genetically engineered bacteria comprise an aroP gene.
- the genetically engineered bacterium is E. coli Nissle, and the native aroP gene in E. coli Nissle is not modified; one or more additional copies of the native E. coli Nissle aroP genes are present in the bacterium on a plasmid or in the chromosome and under the control of the same inducible promoter that controls expression of the PME, e.g., the FNR promoter, or the araBAD promoter, a different inducible promoter than the one that controls expression of the PME, or a constitutive promoter.
- coli Nissle is not modified, and a copy of a non-native aroP gene from a different bacterium, are present in the bacterium on a plasmid or in the chromosome and under the control of the same inducible promoter that controls expression of the PME, e.g., the FNR promoter or the AraBAD promoter, or a different inducible promoter than the one that controls expression of the PME, or a constitutive promoter.
- the same inducible promoter that controls expression of the PME e.g., the FNR promoter or the AraBAD promoter, or a different inducible promoter than the one that controls expression of the PME, or a constitutive promoter.
- the genetically engineered bacteria comprise AroP and PheP, under the control of the same or different inducible or constitutive promoters.
- the pheP gene is expressed on a chromosome. In some embodiments, expression from the chromosome may be useful for increasing stability of expression of pheP.
- the pheP gene is integrated into the bacterial chromosome at one or more integration sites in the genetically engineered bacteria. In some embodiments, the pheP gene is inserted into the bacterial genome at one or more of the following insertion sites in E.
- coli Nissle malE/K, insB/I, araC/BAD, lacZ, agal/rsml, thyA, and malP/T.
- Any suitable insertion site may be used (see, e.g., Fig. 36).
- the insertion site may be anywhere in the genome, e.g., in a gene required for survival and/or growth, such as thyA (to create an auxotroph); in an active area of the genome, such as near the site of genome replication; and/or in between divergent promoters in order to reduce the risk of unintended transcription, such as between AraB and AraC of the arabinose operon.
- the genetically engineered bacterium comprises multiple mechanisms of action and/or one or more auxotrophies.
- the bacteria are genetically engineered to comprise five copies of PAL under the control of an oxygen level-dependent promoter ⁇ e.g., 7f nr s-PAL3) inserted at different integration sites on the chromosome (e.g., malE/K, yicS/nepI, malP/T, agal/rsml, and cea), and one copy of a phenylalanine transporter gene under the control of an oxygen level-dependent promoter (e.g., 7f nr s-pheP) inserted at a different integration site on the chromosome (e.g., lacZ).
- the bacteria are genetically engineered to further include a kanamycin resistance gene, and a thyA auxotrophy, in which the thyA gene is deleted and/or replaced with an unrelated gene.
- the bacteria are genetically engineered to include multiple mechanisms of action (MoAs), e.g., circuits producing multiple copies of the same product (e.g., to enhance copy number) or circuits performing multiple different functions.
- MoAs mechanisms of action
- insertion sites include, but are not limited to, malE/K, yicS/nepI, insB/I, araC/BAD, lacZ, agal/rsml, thyA, malP/T, dapA, and cea, and others shown in Fig. 36.
- the genetically engineered bacteria may include four copies of PAL inserted at four different insertion sites, e.g., malE/K, insB/I, araC/BAD, and lacZ.
- the genetically engineered bacteria may also include four copies of PAL inserted at four different insertion sites, e.g., malE/K, yicS/nepI, agal/rsml, and cea, and one copy of a phenylalanine transporter gene inserted at a different insertion site, e.g. , lacZ (Fig. 13B).
- the genetically engineered bacteria may include three copies of PAL inserted at three different insertion sites, e.g. , malE/K, insB/I, and lacZ, and three copies of a phenylalanine transporter gene inserted at three different insertion sites, e.g. , dapA, cea, and araC/BAD.
- the genetically engineered bacteria comprise one or more of (1) PAL, PAH, LAAD for degradation of phenylalanine, in wild type or in a mutated form (for increased stability or metabolic activity) (2) transporter PheP or AroP for uptake of phenylalanine, in wild type or in mutated form (for increased stability or metabolic activity) (3) PAL, PAH, LAAD, and/or PheP for secretion and extracellular phenylalanine degradation, (4) components of secretion machinery, as described herein (5) Auxotrophy, e.g., deltaThyA (6) antibiotic resistance, including but not limited to, kanamycin or chloramphenicol resistance (7) mutations/deletions in genes involved in oxygen metabolism, as described herein and (8) mutations/deletions in genes of the endogenous Nissle phenylalanine synthesis pathway (e.g., delta PheA for Phe auxotrophy).
- Auxotrophy e.g., deltaThyA
- the genetically engineered bacteria comprise one or more copies of PAL3, (e.g., under the control of a Pfnr promoter) and one or more copies of PALI (e.g. under the control of a Pfnr promoter).
- the genetically engineered bacteria comprise one or more copies of PAL3, (e.g., under the control of a Pfnr promoter) and one or more copies of PALI (e.g. under the control of a Pfnr promoter); and further comprises one or more copies of a phenylalanine transporter (e.g., PheP and/or AroP, e.g., under the control of a Pfnr promoter).
- a phenylalanine transporter e.g., PheP and/or AroP, e.g., under the control of a Pfnr promoter.
- the genetically engineered bacteria comprise one or more copies of PAL3, (e.g., under the control of a Pfnr promoter) and one or more copies of LAAD (e.g., under the control of the ParaBAD promoter).
- the genetically engineered bacteria comprise one or more copies of PAL3, (e.g., under the control of a Pfnr promoter) and one or more copies of LAAD (e.g., under the control of the ParaBAD promoter); and further comprises one or more copies of a phenylalanine transporter (e.g., PheP and/or AroP, e.g., under the control of a Pfnr promoter).
- a phenylalanine transporter e.g., PheP and/or AroP, e.g., under the control of a Pfnr promoter.
- the genetically engineered bacteria comprise one or more copies of PAL3, (e.g., under the control of a Pfnr promoter) and one or more copies of PAH. In one embodiment, the genetically engineered bacteria comprise one or more copies of PAL3, (e.g., under the control of a Pfnr promoter) and one or more copies of PAH; and further comprises one or more copies of a phenylalanine transporter (e.g., PheP and/or AroP, e.g., under the control of a Pfnr promoter).
- a phenylalanine transporter e.g., PheP and/or AroP, e.g., under the control of a Pfnr promoter.
- the genetically engineered bacteria comprise one or more copies of PALI, (e.g., under the control of a Pfnr promoter) and one or more copies of LAAD (e.g., under the control of the ParaBAD promoter).
- PALI e.g., under the control of a Pfnr promoter
- LAAD e.g., under the control of the ParaBAD promoter
- the genetically engineered bacteria comprise one or more copies of PALI, (e.g., under the control of a Pfnr promoter) and one or more copies of LAAD (e.g., under the control of the ParaBAD promoter); and further comprises one or more copies of a phenylalanine transporter (e.g., PheP and/or AroP, e.g., under the control of a Pfnr promoter).
- the genetically engineered bacteria comprise one or more copies of PALI (e.g., under the control of a Pfnr promoter) and one or more copies of PAH.
- the genetically engineered bacteria comprise one or more copies of PALI (e.g., under the control of a Pfnr promoter) and one or more copies of PAH; and further comprises one or more copies of a phenylalanine transporter (e.g., PheP and/or AroP, e.g., under the control of a Pfnr promoter).
- the genetically engineered bacteria comprise one or more copies of PAH and one or more copies of LAAD (e.g., under the control of the ParaBAD promoter).
- the genetically engineered bacteria comprise one or more copies of PAH and one or more copies of LAAD (e.g., under the control of the ParaBAD promoter); and further comprises one or more copies of a phenylalanine transporter (e.g., PheP and/or AroP, e.g., under the control of a Pfnr promoter).
- PMEs and transporters may be integrated into any of the insertion sites described herein.
- the genetically engineered bacteria comprise one or more copies of PAL3, e.g. (e.g., under the control of a Pfnr promoter), one or more copies of LAAD (e.g., under the control of the ParaBAD promoter), and one or more copies of PAH.
- the genetically engineered bacteria comprise one or more copies of PAL3, e.g.
- a Pfnr promoter e.g., under the control of a Pfnr promoter
- one or more copies of LAAD e.g., under the control of the ParaBAD promoter
- PAH e.g., PAH
- a phenylalanine transporter e.g., PheP and/or AroP, e.g., under the control of a Pfnr promoter
- the genetically engineered bacteria comprise one or more copies of PAL3, e.g. (e.g., under the control of a Pfnr promoter), one or more copies of LAAD (e.g., under the control of the ParaBAD promoter), and one or more copies of PALI (e.g., under the control of a Pfnr promoter).
- the genetically engineered bacteria comprise one or more copies of PAL3, e.g.
- the genetically engineered bacteria comprise one or more copies of PAL3, e.g.
- the genetically engineered bacteria comprise one or more copies of PAL3, e.g. (e.g., under the control of a Pfnr promoter), one or more copies of PALI (e.g., under the control of a Pfnr promoter), and one or more copies of PAH; and further comprise one or more copies of a phenylalanine transporter (e.g., PheP and/or AroP, e.g., under the control of a Pfnr promoter).
- PAL3 e.g., under the control of a Pfnr promoter
- PALI e.g., under the control of a Pfnr promoter
- PAH a phenylalanine transporter
- the genetically engineered bacteria comprise one or more copies of LAAD (e.g., under the control of the ParaBAD promoter), one or more copies of PAH, and one or more copies of PALI (e.g., under the control of an Pfnr promoter).
- the genetically engineered bacteria comprise one or more copies of LAAD (e.g., under the control of the ParaBAD promoter), one or more copies of PAH, and one or more copies of PALI (e.g., under the control of an Pfnr promoter); and further comprise one or more copies of a phenylalanine transporter (e.g., PheP and/or AroP, e.g., under the control of a Pfnr promoter).
- a phenylalanine transporter e.g., PheP and/or AroP, e.g., under the control of a Pfnr promoter.
- PMEs and/or transporters may be integrated into any of the insertion sites described herein.
- PMEs and/or transporters may be comprised on low or high copy plasmids.
- PMEs and/or transporters may be integrated into any of the insertion sites described herein in combination with PMEs and/or transporters that are comprised on low or high copy plasmids.
- the genetically engineered bacteria comprise one or more copies of PAL3, e.g. (e.g., under the control of a Pfnr promoter), one or more copies of PALI, e.g. (e.g., under the control of a Pfnr promoter), one or more copies of LAAD (e.g., under the control of the ParaBAD promoter), and one or more copies of PAH.
- the genetically engineered bacteria comprise one or more copies of PAL3, e.g. (e.g., under the control of a Pfnr promoter), one or more copies of PALI, e.g.
- PMEs and transporters may be integrated into any of the insertion sites described herein. Alternatively, PMEs and/ortransporters may be comprised on low or high copy plasmids.
- the genetically engineered bacteria comprise one copy of PAL, (e.g., PALI or PAL3, e.g., under the control of a Pfnr promoter) one copy of PheP (e.g., under the control of a Pfnr promoter), and one copy of LAAD (e.g., under the control of the ParaBAD promoter).
- PAL e.g., PALI or PAL3
- PheP e.g., under the control of a Pfnr promoter
- LAAD e.g., under the control of the ParaBAD promoter
- the genetically engineered bacteria comprise one copy of PAL, (e.g., PALI or PAL3, e.g., under the control of a Pfnr promoter) two copies of PheP (e.g., under the control of a Pfnr promoter), and one copy of LAAD (e.g., under the control of the ParaBAD promoter).
- the genetically engineered bacteria comprise one copy of PAL, (e.g., PALI or PAL3, e.g., under the control of a Pfnr promoter) one copy of PheP (e.g., under the control of a Pfnr promoter), and two copies of LAAD (e.g., under the control of the ParaBAD promoter).
- the genetically engineered bacteria comprise one copy of PAL, (e.g., PALI or PAL3, e.g., under the control of a Pfnr promoter) two copies of PheP (e.g., under the control of a Pfnr promoter), and two copies of LAAD (e.g., under the control of the ParaBAD promoter).
- PAL e.g., PALI or PAL3, e.g., under the control of a Pfnr promoter
- PheP e.g., under the control of a Pfnr promoter
- LAAD e.g., under the control of the ParaBAD promoter
- and/ortransporters may be comprised on low or high copy plasmids.
- the genetically engineered bacteria comprise two copies of PAL (e.g., PALI or PAL3, e.g., under the control of a Pfnr promoter) one copy of PheP (e.g., under the control of a Pfnr promoter), and one copy of LAAD (e.g., under the control of the ParaBAD promoter).
- PAL e.g., PALI or PAL3
- PheP e.g., under the control of a Pfnr promoter
- LAAD e.g., under the control of the ParaBAD promoter
- the genetically engineered bacteria comprise two copies of PAL, (e.g., PALI or PAL3, e.g., under the control of a Pfnr promoter) two copies of PheP (e.g., under the control of a Pfnr promoter), and one copy of LAAD (e.g., under the control of the ParaBAD promoter).
- the genetically engineered bacteria comprise two copies of PAL, (e.g., PALI or PAL3, e.g., under the control of a Pfnr promoter) one copy of PheP (e.g., under the control of a Pfnr promoter), and two copies of LAAD (e.g., under the control of the ParaBAD promoter).
- the genetically engineered bacteria comprise two copies of PAL, (e.g., PALI or PAL3, e.g., under the control of a Pfnr promoter) two copies of PheP (e.g., under the control of a Pfnr promoter), and two copies of LAAD (e.g., under the control of the ParaBAD promoter).
- PAL e.g., PALI or PAL3
- Pfnr promoter e.g., under the control of a Pfnr promoter
- LAAD e.g., under the control of the ParaBAD promoter
- the genetically engineered bacteria comprise three copies of PAL, (e.g., PALI or PAL3, e.g., under the control of a Pfnr promoter) one copy of PheP (e.g., under the control of a Pfnr promoter), and one copy of LAAD (e.g., under the control of the ParaBAD promoter).
- PAL e.g., PALI or PAL3
- PheP e.g., under the control of a Pfnr promoter
- LAAD e.g., under the control of the ParaBAD promoter
- the genetically engineered bacteria comprise three copies of PAL, (e.g., PALI or PAL3, e.g., under the control of a Pfnr promoter) two copies of PheP (e.g., under the control of a Pfnr promoter), and one copy of LAAD (e.g., under the control of the ParaBAD promoter).
- the genetically engineered bacteria comprise three copies of PAL, (e.g., PALI or PAL3, e.g., under the control of a Pfnr promoter) one copy of PheP (e.g., under the control of a Pfnr promoter), and two copies of LAAD (e.g., under the control of the ParaBAD promoter).
- the genetically engineered bacteria comprise three copies of PAL, (e.g., PALI or PAL3, e.g., under the control of a Pfnr promoter) two copies of PheP (e.g., under the control of a Pfnr promoter), and two copies of LAAD (e.g., under the control of the ParaBAD promoter).
- PAL e.g., PALI or PAL3
- Pfnr promoter e.g., under the control of a Pfnr promoter
- LAAD e.g., under the control of the ParaBAD promoter
- the genetically engineered bacteria comprise three copies of PAL, (e.g., PALI or PAL3, e.g., under the control of a Pfnr promoter), three copies of PheP (e.g., under the control of a Pfnr promoter), and two copies of LAAD (e.g., under the control of the ParaBAD promoter).
- the genetically engineered bacteria comprise three copies of PAL, (e.g., PALI or PAL3, e.g., under the control of a Pfnr promoter), three copies of PheP (e.g., under the control of a Pfnr promoter), and one copy of LAAD (e.g., under the control of the ParaBAD promoter).
- the genetically engineered bacteria comprise four copies of PAL, (e.g., PALI or PAL3, e.g., under the control of a Pfnr promoter) one copy of PheP (e.g., under the control of a Pfnr promoter), and one copy of LAAD (e.g., under the control of the ParaBAD promoter).
- PAL e.g., PALI or PAL3
- PheP e.g., under the control of a Pfnr promoter
- LAAD e.g., under the control of the ParaBAD promoter
- the genetically engineered bacteria comprise four copies of PAL, (e.g., PALI or PAL3, e.g., under the control of a Pfnr promoter) two copies of PheP (e.g., under the control of a Pfnr promoter), and one copy of LAAD (e.g., under the control of the ParaBAD promoter).
- the genetically engineered bacteria comprise four copies of PAL, (e.g., PALI or PAL3, e.g., under the control of a Pfnr promoter) one copy of PheP (e.g., under the control of a Pfnr promoter), and two copies of LAAD (e.g., under the control of the ParaBAD promoter).
- the genetically engineered bacteria comprise four copies of PAL, (e.g., PALI or PAL3, e.g., under the control of a Pfnr promoter) two copies of PheP (e.g., under the control of a Pfnr promoter), and two copies of LAAD (e.g., under the control of the ParaBAD promoter).
- PAL e.g., PALI or PAL3
- PheP e.g., under the control of a Pfnr promoter
- LAAD e.g., under the control of the ParaBAD promoter
- the genetically engineered bacteria comprise five copies of PAL, (e.g., PALI or PAL3, e.g., under the control of a Pfnr promoter) one copy of PheP (e.g., under the control of a Pfnr promoter), and one copy of LAAD (e.g., under the control of the ParaBAD promoter).
- PAL e.g., PALI or PAL3
- PheP e.g., under the control of a Pfnr promoter
- LAAD e.g., under the control of the ParaBAD promoter
- the genetically engineered bacteria comprise five copies of PAL, (e.g., PALI or PAL3, e.g., under the control of a Pfnr promoter) two copies of PheP (e.g., under the control of a Pfnr promoter), and one copy of LAAD (e.g., under the control of the ParaBAD promoter).
- the genetically engineered bacteria comprise five copies of PAL, (e.g., PALI or PAL3, e.g., under the control of a Pfnr promoter) one copy of PheP (e.g., under the control of a Pfnr promoter), and two copies of LAAD (e.g., under the control of the ParaBAD promoter).
- the genetically engineered bacteria comprise five copies of PAL, (e.g., PALI or PAL3, e.g., under the control of a Pfnr promoter) two copies of PheP (e.g., under the control of a Pfnr promoter), and two copies of LAAD (e.g., under the control of the ParaBAD promoter).
- PAL e.g., PALI or PAL3
- PheP e.g., under the control of a Pfnr promoter
- LAAD e.g., under the control of the ParaBAD promoter
- the genetically engineered bacteria comprise one or more PMEs for metabolizing phenylalanine in combination with one or more PMEs for secretion. In one embodiment, the genetically engineered bacteria comprise one or more PMEs for metabolizing phenylalanine and a phenylalanine transporter in combination with one or more PMEs for secretion. In one embodiment, the genetically engineered bacteria comprise one or more PMEs for metabolizing phenylalanine and a
- the genetically engineered bacteria comprise two additional copies of PheP (in addition to the wild type gene). This provides redundancy, in case one of the PheP genes acquires a mutation.
- the PheP genes are inserted at lacZ and agal/rsml.
- the two copies of PheP are under the control of the PfnrS promoter.
- the genetically engineered bacteria comprise three copies of PAL3.
- the genetically engineered bacteria comprise three copies of PAL3, inserted at malEK, malPT, yicS/nepl. In one embodiment, the expression of the three copies of PAL3 is under the control of the PfnrS promoter. In one embodiment, the genetically engineered bacteria comprise one or more copies of LAAD. In one embodiment, the genetically engineered bacteria comprise one copy of LAAD, inserted in the arabinose operon. In one embodiment, LAAD is under the control of the endogenous ParaBAD promoter. In one embodiment, the genetically engineered bacteria comprise an auxotrophy, e.g., deltaThyA. In one embodiment, the genetically engineered bacteria comprise an antibiotic resistance.
- the genetically engineered bacteria comprise an antibiotic resistance and an auxotrophy, e.g., deltaThyA. In one embodiment, the genetically engineered bacteria do not comprise an auxotrophy, e.g., deltaThyA. In one embodiment, the genetically engineered bacteria do not comprise an antibiotic resistance. In one embodiment the genetically engineered bacteria comprise neither an antibiotic resistance nor an auxotrophy, e.g., deltaThyA.
- the genetically engineered bacteria comprise three copies of PAL, e.g., PAL3, 2 copies of PheP (in addition to the endogenous PheP), and one copy of LAAD.
- the genetically engineered bacteria comprise three copies of PAL, e.g., PAL3, 2 copies of PheP (in addition to the endogenous PheP), and one copy of LAAD, and an auxotrophy, e.g., delta ThyA.
- the genetically engineered bacteria comprise three copies of PAL, 2 copies of PheP (in addition to the endogenous PheP), and one copy of LAAD, and an antibiotic resistance gene.
- the genetically engineered bacteria comprise three copies of PAL, 2 copies of PheP (in addition to the endogenous PheP), and one copy of LAAD, and an antibiotic resistance gene and an auxotrophy, e.g., delta ThyA.
- the genetically engineered bacteria comprise three copies of PAL (each under control of a PfnrS promoter), 2 copies of PheP (each under control of a PfnrS promoter), and one copy of LAAD (under the control of the endogenous ParaBAD promoter).
- the genetically engineered bacteria comprise three copies of PAL (each under control of a PfnrS promoter), 2 copies of PheP (each under control of a PfnrS promoter), and one copy of LAAD (under the control of the endogenous ParaBAD promoter), and an antibiotic resistance.
- the genetically engineered bacteria comprise three copies of PAL (each under control of a PfnrS promoter), 2 copies of PheP (each under control of a PfnrS promoter), and one copy of LAAD (under the control of the endogenous ParaBAD promoter), and an auxotrophy, e.g., delta ThyA.
- the genetically engineered bacteria comprise three copies of PAL (each under control of a PfnrS promoter), 2 copies of PheP (each under control of a PfnrS promoter), and one copy of LAAD (under the control of the endogenous ParaBAD promoter), and an antibiotic resistance and an auxotrophy, e.g., deltaThyA.
- the genetically engineered bacteria comprise three copies of PAL (each under control of a PfnrS promoter and inserted at the malEK, malPT, and yicS/nepl sites), 2 copies of PheP (each under control of a PfnrS promoter and inserted at the LacZ and agal/rsml sites), and one copy of LAAD (under the control of the endogenous ParaBAD promoter, and inserted in the endogenous arabinose operon).
- PAL each under control of a PfnrS promoter and inserted at the malEK, malPT, and yicS/nepl sites
- PheP each under control of a PfnrS promoter and inserted at the LacZ and agal/rsml sites
- LAAD under the control of the endogenous ParaBAD promoter, and inserted in the endogenous arabinose operon
- the genetically engineered bacteria comprise three copies of PAL (each under control of a PfnrS promoter and inserted at the malEK, malPT, and yicS/nepl sites), 2 copies of PheP (each under control of a PfnrS promoter and inserted at the LacZ and agal/rsml sites), and one copy of LAAD (under the control of the endogenous ParaBAD promoter, and inserted in the endogenous arabinose operon), and further comprise an antibiotic resistance.
- PAL each under control of a PfnrS promoter and inserted at the malEK, malPT, and yicS/nepl sites
- PheP each under control of a PfnrS promoter and inserted at the LacZ and agal/rsml sites
- LAAD under the control of the endogenous ParaBAD promoter, and inserted in the endogenous arabinose operon
- the genetically engineered bacteria comprise three copies of PAL (each under control of a PfnrS promoter and inserted at the malEK, malPT, and yicS/nepl sites), 2 copies of PheP (each under control of a PfnrS promoter and inserted at the LacZ and agal/rsml sites), and one copy of LAAD (under the control of the endogenous ParaBAD promoter, and inserted in the endogenous arabinose operon) and further comprise an auxotrophy, e.g., deltaThyA.
- PAL each under control of a PfnrS promoter and inserted at the malEK, malPT, and yicS/nepl sites
- PheP each under control of a PfnrS promoter and inserted at the LacZ and agal/rsml sites
- LAAD under the control of the endogenous ParaBAD promoter, and inserted in the endogenous arabinose operon
- the genetically engineered bacteria comprise three copies of PAL (each under control of a PfnrS promoter and inserted at the malEK, malPT, and yicS/nepl sites), 2 copies of PheP (each under control of a PfnrS promoter and inserted at the LacZ and agal/rsml sites), and one copy of LAAD (under the control of the endogenous ParaBAD promoter, and inserted in the endogenous arabinose operon), and further comprise an antibiotic resistance and an auxotrophy, e.g., deltaThyA.
- PAL each under control of a PfnrS promoter and inserted at the malEK, malPT, and yicS/nepl sites
- PheP each under control of a PfnrS promoter and inserted at the LacZ and agal/rsml sites
- LAAD under the control of the endogenous ParaBAD promoter, and inserted in the endogenous arabinose operon
- the genetically engineered bacteria are SYN- PKU705.
- SYN-PKU705 further comprises an antibiotic resistance.
- SYN-PKU705 further comprises an auxotrophy, e.g., deltaThyA.
- SYN-PKU705 further comprises an antibiotic resistance and auxotrophy, e.g., deltaThyA.
- Table 14 contains non-limiting examples of the genetically engineered bacteria of the disclosure.
- the genetically engineered bacteria of Table 14 further contain a PME for secretion.
- lacZ :Vfiir-pheP : :cam (recombinase based strain)
- malPT .PfiirS: :PAL3 : :kan
- lacZ ::VfiirS-pheP
- SYN-PKU522 cea: : ⁇ fnrS-PAL3: :kan; lacZ: : ⁇ fnr-pheP: :cam
- lacZ : ⁇ fnr-pheP '; agal/rsmP..PfiirS: :pheP;
- yicS/nepI :VfnrS-PAL3; lacZ: : ⁇ fnr-pheP;
- yicS/nepI :VfnrS-PAL3: :kan; lacZ: : ⁇ fiir-pheP;
- malPT ?constitutive:.Tl polymerase (unflipped);
- the genetically engineered bacteria further comprise a native secretion mechanism (e.g., gram positive bacteria) or non-native secretion mechanism (e.g., gram negative bacteria) that is capable of secreting the protein(s) of interest or therapeutic protein(s), e.g., PAH, PAL or LAAD, from the bacterial cytoplasm.
- a native secretion mechanism e.g., gram positive bacteria
- non-native secretion mechanism e.g., gram negative bacteria
- Many bacteria have evolved sophisticated secretion systems to transport substrates across the bacterial cell envelope. Substrates, such as small molecules, proteins, and DNA, may be released into the extracellular space or periplasm (such as the gut lumen or other space), injected into a target cell, or associated with the bacterial membrane.
- secretion machineries may span one or both of the inner and outer membranes.
- the genetically engineered bacteria further comprise a non-native double membrane-spanning secretion system.
- Double membrane-spanning secretion systems include, but are not limited to, the type I secretion system (T1 SS), the type II secretion system (T2SS), the type III secretion system (T3SS), the type IV secretion system (T4SS), the type VI secretion system (T6SS), and the resistance-nodulation-division (RND) family of multi-drug efflux pumps (Pugsley 1993; Gerlach et al., 2007; Collinson et al., 2015; Costa et al., 2015; Reeves et al., 2015; WO2014138324A1, incorporated herein by reference).
- RTD resistance-nodulation-division
- T7SS type VII secretion system
- T2SS type VII secretion system
- double membrane-spanning secretions generally transport substrates from the bacterial cytoplasm directly into the extracellular space or into the target cell.
- the T2SS and secretion systems that span only the outer membrane may use a two-step mechanism, wherein substrates are first translocated to the periplasm by inner membrane-spanning transporters, and then transferred to the outer membrane or secreted into the extracellular space.
- Outer membrane-spanning secretion systems include, but are not limited to, the type V secretion or autotransporter system (T5SS), the curli secretion system, and the chaperone-usher pathway for pili assembly (Saier, 2006; Costa et al., 2015).
- the genetically engineered bacteria of the invention further comprise a type III or a type Ill-like secretion system (T3SS) from Shigella, Salmonella, E. coli, Bivrio, Burkholderia, Yersinia, Chlamydia, or
- T3SS type III or a type Ill-like secretion system
- the T3SS is capable of transporting a protein from the bacterial cytoplasm to the host cytoplasm through a needle complex.
- the T3SS may be modified to secrete the molecule from the bacterial cytoplasm, but not inject the molecule into the host cytoplasm. Thus, the molecule is secreted into the gut lumen or other extracellular space.
- the genetically engineered bacteria comprise said modified T3SS and are capable of secreting the protein(s) of interest or therapeutic protein(s) from the bacterial cytoplasm.
- the secreted molecule such as a heterologous protein or peptide, e.g., the protein of interest or therapeutic protein e.g., PAH, PAL or LAAD, comprises a type III secretion sequence that allows the protein(s) of interest or therapeutic protein(s) to be secreted from the bacteria.
- a flagellar type III secretion pathway is used to secrete the molecule of interest, e.g., PAH, PAL or LAAD.
- an incomplete flagellum is used to secrete a therapeutic peptide of interest, e.g., PAH, PAL or LAAD, by recombinantly fusing the peptide to an N-terminal flagellar secretion signal of a native flagellar component. In this manner, the intracellularly expressed chimeric peptide can be mobilized across the inner and outer membranes into the surrounding host environment.
- a Type V Autotransporter Secretion System is used to secrete the therapeutic peptide, e.g., PAH, PAL or LAAD. Due to the simplicity of the machinery and capacity to handle relatively large protein fluxes, the Type V secretion system is attractive for the extracellular production of recombinant proteins.
- a therapeutic peptide star
- the N-terminal signal sequence directs the protein to the SecA-YEG machinery which moves the protein across the inner membrane into the periplasm, followed by subsequent cleavage of the signal sequence.
- the Beta-domain is recruited to the Bam complex ('Beta-barrel assembly machinery') where the beta-domain is folded and inserted into the outer membrane as a beta-barrel structure.
- the therapeutic peptide e.g., PAH, PAL or LAAD
- PAH, PAL or LAAD is threaded through the hollow pore of the beta-barrel structure ahead of the linker sequence.
- the therapeutic peptide e.g., PAH, PAL or LAAD
- the secreted molecule such as a heterologous protein or peptide, e.g., the protein of interest or therapeutic protein, comprises an N- terminal secretion signal, a linker, and beta-domain of an autotransporter so as to allow the molecule to be secreted from the bacteria.
- a Hemolysin-based Secretion System is used to secrete the molecule of interest, e.g., e.g., PAH, PAL or LAAD.
- Type I Secretion systems offer the advantage of translocating their passenger peptide directly from the cytoplasm to the extracellular space, obviating the two-step process of other secretion types.
- Figure 11 shows the alpha-hemolysin (HlyA) of uropathogenic Escherichia coli. This pathway uses HlyB, an ATP-binding cassette transporter; HlyD, a membrane fusion protein; and TolC, an outer membrane protein. The assembly of these three proteins forms a channel through both the inner and outer membranes.
- the secretion signal-containing C-terminal portion of HlyA is fused to the C-terminal portion of a therapeutic peptide (star) to mediate secretion of this peptide.
- the genetically engineered bacteria further comprise a non-native single membrane-spanning secretion system.
- Single membrane- spanning exporters may act as a component of a secretion system, or may export substrates independently.
- Such exporters include, but are not limited to, ATP -binding cassette translocases, flagellum/virulence-related translocases, conjugation-related translocases, the general secretory system (e.g., the SecYEG complex m E. coli), the accessory secretory system in mycobacteria and several types of Gram-positive bacteria (e.g., Bacillus anthracis, Lactobacillus johnsonii, Corynebacterium glutamicum, Streptococcus gordonii, Staphylococcus aureus), and the twin-arginine translocation (TAT) system (Saier, 2006; Rigel and Braunstein, 2008; Albiniak et al., 2013).
- the general secretory system e.g., the SecYEG complex m E. coli
- the accessory secretory system in mycobacteria e.g., mycobacteria and several types of Gram-positive bacteria (e.g., Bacill
- the general secretory and TAT systems can both export substrates with cleavable N-terminal signal peptides into the periplasm, and have been explored in the context of biopharmaceutical production.
- the TAT system may offer particular advantages, however, in that it is able to transport folded substrates, thus eliminating the potential for premature or incorrect folding.
- the genetically engineered bacteria comprise a TAT or a TAT -like system and are capable of secreting the protein(s) of interest or therapeutic protein(s), e.g., PAH, PAL or LAAD, from the bacterial cytoplasm.
- the secretion systems disclosed herein may be modified to act in different species, strains, and subtypes of bacteria, and/or adapted to deliver different payloads.
- One way to secrete properly folded proteins in gram -negative bacteria- particularly those requiring disulphide bonds - is to target the periplasm in a bacterium with a destabilized outer membrane. In this manner the protein is mobilized into the oxidizing environment and allowed to fold properly. In contrast to orchestrated extracellular secretion systems, the protein is then able to escape the periplasmic space in a correctly folded form by membrane leakage. These "leaky” gram-negative mutants are therefore capable of secreting bioactive, properly disulphide-bonded polypeptides.
- the genetically engineered bacteria have a "leaky” or destabilized outer membrane.
- Destabilizing the bacterial outer membrane to induce leakiness can be accomplished by deleting or mutagenizing genes responsible for tethering the outer membrane to the rigid peptidoglycan skeleton, including for example, lpp, ompC, ompA, ompF, tolA, tolB, pal, degS, degP, and nlpl.
- Lpp is the most abundant polypeptide in the bacterial cell existing at -500,000 copies per cell and functions as the primary 'staple' of the bacterial cell wall to the peptidoglycan. Silhavy, T. J., Kahne, D. & Walker, S. The bacterial cell envelope. Cold Spring Harb Perspect Biol 2, a000414 (2010).
- TolA-PAL and OmpA complexes function similarly to Lpp and are other deletion targets to generate a leaky phenotype. Additionally, leaky phenotypes have been observed when periplasmic proteases are deactivated. The periplasm is very densely packed with protein and therefore encode several periplasmic proteins to facilitate protein turnover. Removal of periplasmic proteases such as degS, degP or nlpl can induce leaky phenotypes by promoting an excessive build-up of periplasmic protein. Mutation of the proteases can also preserve the effector polypeptide by preventing targeted degradation by these proteases.
- the engineered bacteria have one or more deleted or mutated membrane genes.
- the engineered bacteria have a deleted or mutated lpp gene.
- the engineered bacteria have one or more deleted or mutated gene(s), selected from ompA, ompA, and ompF genes.
- the engineered bacteria have one or more deleted or mutated gene(s), selected from tolA, tolB, and pal genes, in some embodiments, the engineered bacteria have one or more deleted or mutated periplasmic protease genes.
- the engineered bacteria have one or more deleted or mutated periplasmic protease genes selected from degS, degP, and nlpl. In some embodiments, the engineered bacteria have one or more deleted or mutated gene(s), selected from lpp, ompA, ompA, ompF, tolA, tolB, pal, degS, degP, and nlpl genes.
- the leaky phenotype can be made inducible by placing one or more membrane or periplasmic protease genes, e.g., selected from lpp, ompA, ompA, ompF, tolA, tolB, pal, degS, degP, and nlpl, under the control of an inducible promoter.
- membrane or periplasmic protease genes e.g., selected from lpp, ompA, ompA, ompF, tolA, tolB, pal, degS, degP, and nlpl
- expression of lpp or other cell wall stability protein or periplasmic protease can be repressed in conditions where the therapeutic polypeptide needs to be delivered (secreted).
- a transcriptional repressor protein or a designed antisense RNA can be expressed which reduces transcription or translation of a target membrane or periplasmic protease gene.
- overexpression of certain peptides can result in a destabilized phenotype, e.g., overexpression of colicins or the third topological domain of TolA, wherein peptide overexpression can be induced in conditions in which the therapeutic polypeptide needs to be delivered (secreted).
- these sorts of strategies would decouple the fragile, leaky phenotypes from biomass production.
- the engineered bacteria have one or more membrane and/or periplasmic protease genes under the control of an inducible promoter.
- Table 15 and Table 16 list secretion systems for Gram positive bacteria and Gram negative bacteria. These can be used to secrete polypeptides, proteins of interest or therapeutic protein(s) from the engineered bacteria, which are reviewed in Milton H. Saier, Jr. Microbe / Volume 1, Number 9, 2006 "Protein Secretion Systems in Gram-Negative Bacteria Gram-negative bacteria possess many protein secretion- membrane insertion systems that apparently evolved independently", the contents of which is herein incorporated by reference in its entirety.
- SP Protein secretary pathways
- Bcl-2 Eukaryotic Bcl-2 1.A.21 + 1? None family
- MTB (IISP) Main terminal 3.A.15 -14 ATP;
- the genetically engineered bacterial comprise a native or non-native secretion system described herein for the secretion of a PME, e.g., PAH, PAL and/or LAAD.
- the secretion system is selected from the modified type III flagellar, type I (e.g., hemolysin secretion system), type II, type IV, type V, type VI, and type VII secretion systems, resistance-nodulation-division (RND) multi-drug efflux pumps, a single membrane secretion system, Sec and, TAT secretion systems.
- the PMEs secreted by the genetically engineered bacteria are modified to increase resistance to proteases.
- the one or more PME administered is modified as described in Sakissian et al., 2011, Mol Genet Metab. 2011 Nov; 104(3): 249-254, the contents of which is herein incorporated by reference in its entirety.
- the secreted PAL is Av-p.C503S/p.C565S/p.F18A PAL.
- the secreted PAL is PEG- Av-p.C503S/p.C565S/p.F18A PAL.
- the one or more PMEs for secretion are under the control of an inducible promoter, as described herein.
- the one or more PMEs are under the control of the FNR promoter and are produced and secreted under anaerobic conditions.
- the PMEs for secretion are under the control of the ParaBAD promoter.
- the PMEs for secretion are under the control of a constitutive promoter.
- the engineered microorganism comprises gene sequence(s) that includes a secretion tag.
- the PME(s) include a "secretion tag" of either RNA or peptide origin to direct the PME(s) to specific secretion systems.
- a secretion tag for the Type I Hemolysin secretion system is encoded in the C-terminal 53 amino acids of the alpha hemolysin protein (HlyA). HlyA secretion signal.
- HlyB inserts into inner membrane to form a pore
- HlyD aligns HlyB with TolC (outer membrane pore) thereby forming a channel through inner and outer membrane.
- the C-terminal secretion tag can be removed by either an autocatalytic or protease-catalyzed e.g., OmpT cleavage thereby releasing the PME(s) into the extracellular milieu.
- the Type V Auto-secretion System utilizes an N-terminal Sec-dependent peptide tag (inner membrane) and C-terminal tag (outer-membrane). This uses Sec- system to get from cytoplasm to periplasm. C-terminal tag then inserts into the outer membrane forming a pore through which the "passenger protein" threads through. Once across the outer membrane, the passenger (anti-cancer molecule) is released from the membrane-embedded C-terminal tag by either an autocatalytic, intein-like mechanism or via a membrane-bound protease (I.e., OmpT). The N-terminal tag is removed by the Sec system.
- the secretion system is able to remove this tag before secreting the PME(s), e.g., PAL, PAH, and/or LAAD from the engineered bacteria.
- the N-terminal peptide secretion tag is removed upon translocation of the "passenger" peptide from the cytoplasm into the periplasmic compartment by the native Sec system.
- the C-terminal secretion tag can be removed by either an autocatalytic or protease-catalyzed e.g., OmpT cleavage thereby releasing the anti-cancer molecule(s) into the extracellular milieu.
- the tag is encoded in 5 'untranslated region of the mRNA and thus there is no peptide tag to cleave/remove.
- This modified system does not contain the "syringe" portion and instead uses the basal body of the flagella structure as the pore to translocate across both membranes and out through the forming flagella. If the fliC/fliD genes (encoding the flagella "taiP'/whip) are disrupted the flagella cannot fully form and this promotes overall secretion. In some embodiments, the tail portion can be removed entirely.
- the basal body closely resembles the flagella, however, instead of a "taiP'/whip, the traditional T3SS has a syringe to inject the passenger proteins into host cells.
- the secretion tag is encoded by an N-terminal peptide (lengths vary and there are several different tags, see PCT/US 14/020972). The N-terminal tag is not removed from the polypeptides in this secretion system.
- the PME contains expressed as fusion protein with the 53 amino acids of the C termini of alpha-hemolysin (hlyA) of E. coli CFT073 (C terminal secretion tag).
- LAAD catalytic activity is dependent on oxygen, and therefore may not be active in anaerobic environments in the intestine, e.g., the colon. Oxygen is present in more proximal compartments of the GI tract.
- the oxygen levels may fall as oxygen diffuses across the mucosal membrane.
- a gradual process of equilibration with the capillary levels of oxygen i.e., 5-10 torr; ref. 9 may occur.
- the colon On passage to the colon, with its heavy bacterial colonization, further decreases in oxygenation occur. Finally, the lumen of the distal colon displays marked hypoxia, as expected, based on the abundance of anaerobic bacteria at this site.
- LAAD activity is retained in microaerobic conditions, albeit at lower levels than under aerobic conditions (Fig. 25A and Fig.25B).
- LAAD therefore may be active in the more proximal areas of the intestine, such as stomach, duodenum, jejunum, and ileum.
- LAAD expressed by the genetically engineered bacteria may advantageously be active in a different compartment than PAL, which may be expressed in the colon if under the control of an F R promoter.
- the genetically engineered bacteria express two enzymes, which have different oxygen requirements and/or are induced under different oxygen conditions, such that an PME is expressed and active throughout the entire gastrointestinal system.
- the first enzyme e.g., LAAD
- LAAD which is dependent on the presence of oxygen
- the second enzyme e.g., PAL
- the colon under the control of an FNR promoter.
- Several strategies can be employed to further increase LAAD activity under oxygen limiting conditions. For example, the activity of other enzymes that consume large amounts of oxygen can be reduced or extinguished.
- One such enzyme is NADH dehydrogenase.
- E coli has two NADH dehydrogenases; nuo and ndh2, and is has been shown that knock out of both of these enzymes reduces oxygen consumption by 80%.
- additional measures are taken to conserve limiting oxygen, i.e., to allow LAAD to function under lower exogenous oxygen conditions in the genetically engineered bacteria expressing LAAD.
- the genetically engineered bacteria further comprise a mutation in one or more genes involved in oxygen consumption.
- one or both E is a mutation in one or more genes involved in oxygen consumption.
- coli NADH dehydrogenases are knocked out.
- the knocked out NADH dehydrogenase is nuo.
- the knocked out NADH dehydrogenase is ndh2.
- nuo and ndhl are knocked out.
- Other enzymes involved in E. coli oxygen metabolism may also be knocked out, including enzymes in the respiratory chain, such as cydB (a subunit of high affinity terminal oxidase), cydD (an enzyme required to make cytochrome D), and cyoABC (subunits of low affinity cytochrome oxidase).
- the genetically engineered bacteria harbor a knock out mutation/deletion in one more genes selected from cydB, cydD, and cyoABC.
- the one or more PME encoded by the genetically engineered bacteria are expressed and show activity in the stomach.
- the one or more PME encoded by the genetically engineered bacteria are expressed and show activity in the duodenum.
- the one or more PME encoded by the genetically engineered bacteria are expressed and show activity in the jejunum.
- the one or more PME encoded by the genetically engineered bacteria are expressed and show activity in the ileum.
- the one or more PME encoded by the genetically engineered bacteria are expressed and show activity in the colon.
- essential gene refers to a gene that is necessary for cell growth and/or survival.
- Bacterial essential genes are well known to one of ordinary skill in the art, and can be identified by directed deletion of genes and/or random mutagenesis and screening (see, e.g., Zhang and Lin, "DEG 5.0, a database of essential genes in both prokaryotes and eukaryotes,” Nucl Acids Res, 2009;37:D455- D458 and Gerdes et al., “Essential genes on metabolic maps," Curr Opin Biotechnol, 2006; 17(5):448-456, the entire contents of each of which are expressly incorporated herein by reference).
- an "essential gene” may be dependent on the circumstances and environment in which an organism lives. For example, a mutation of, modification of, or excision of an essential gene may result in the genetically engineered bacteria of the disclosure becoming an auxotroph.
- An auxotrophic modification is intended to cause bacteria to die in the absence of an exogenously added nutrient essential for survival or growth because they lack the gene(s) necessary to produce that essential nutrient.
- any of the genetically engineered bacteria described herein also comprise a deletion or mutation in a gene required for cell survival and/or growth.
- the essential gene is a DNA synthesis gene, for example, thyA.
- the essential gene is a cell wall synthesis gene, for example, dapA.
- the essential gene is an amino acid gene, for example, serA or MetA.
- Any gene required for cell survival and/or growth may be targeted, including but not limited to, cysE, glnA, ilvD, leuB, lysA, serA, metA, glyA, hisB, ilvA, pheA, proA, thrC, trpC, tyrA, thyA, uraA, dapA, dapB, dapD, dapE, dapF, flhD, metB, metC, proAB, and thil, as long as the corresponding wild-type gene product is not produced in the bacteria.
- Table 18 lists exemplary bacterial genes which may be disrupted or deleted to produce an auxotrophic strain. These include, but are not limited to, genes required for oligonucleotide synthesis, amino acid synthesis, and cell wall synthesis.
- Table 19 shows the survival of various amino acid auxotrophs in the mouse gut, as detected 24 hrs and 48 hrs post-gavage. These auxotrophs were generated using BW25113, a non-Nissle strain of E. coli.
- thymine is a nucleic acid that is required for bacterial cell growth; in its absence, bacteria undergo cell death.
- the thyA gene encodes thymidylate synthetase, an enzyme that catalyzes the first step in thymine synthesis by converting dUMP to dTMP (Sat et al., 2003).
- the bacterial cell of the disclosure is a thyA auxotroph in which the thyA gene is deleted and/or replaced with an unrelated gene.
- a thyA auxotroph can grow only when sufficient amounts of thymine are present, e.g., by adding thymine to growth media in vitro, or in the presence of high thymine levels found naturally in the human gut in vivo.
- the bacterial cell of the disclosure is auxotrophic in a gene that is complemented when the bacterium is present in the mammalian gut. Without sufficient amounts of thymine, the thyA auxotroph dies.
- the auxotrophic modification is used to ensure that the bacterial cell does not survive in the absence of the auxotrophic gene product ⁇ e.g., outside of the gut).
- Diaminopimelic acid is an amino acid synthetized within the lysine biosynthetic pathway and is required for bacterial cell wall growth (Meadow et al., 1959; Clarkson et al., 1971).
- any of the genetically engineered bacteria described herein is a dapD auxotroph in which dapD is deleted and/or replaced with an unrelated gene.
- a dapD auxotroph can grow only when sufficient amounts of DAP are present, e.g., by adding DAP to growth media in vitro, or in the presence of high DAP levels found naturally in the human gut in vivo. Without sufficient amounts of DAP, the dapD auxotroph dies.
- the auxotrophic modification is used to ensure that the bacterial cell does not survive in the absence of the auxotrophic gene product ⁇ e.g., outside of the gut).
- the genetically engineered bacterium of the present disclosure is a uraA auxotroph in which uraA is deleted and/or replaced with an unrelated gene.
- the uraA gene codes for UraA, a membrane-bound transporter that facilitates the uptake and subsequent metabolism of the pyrimidine uracil (Andersen et al., 1995).
- a uraA auxotroph can grow only when sufficient amounts of uracil are present, e.g., by adding uracil to growth media in vitro, or in the presence of high uracil levels found naturally in the human gut in vivo. Without sufficient amounts of uracil, the uraA auxotroph dies.
- auxotrophic modifications are used to ensure that the bacteria do not survive in the absence of the auxotrophic gene product ⁇ e.g., outside of the gut).
- the genetically engineered bacteria of the invention comprise a deletion or mutation in two or more genes required for cell survival and/or growth.
- essential genes include, but are not limited to, yhbV, yagG, hemB, secD, secF, ribD, ribE, thiL, dxs, ispA, dnaX, adk, hemH, IpxH, cysS, fold, rplT, infC, thrS, nadE, gapA, yeaZ, aspS, argS, pgsA, yeflA, metG, folE, yejM, gyrA, nrdA, nrdB, folC, accD, fabB, gltX, ligA, zipA, dapE, dapA, der, hisS, ispG, suhB, tadA, acpS, era, rnc, fisB, eno, pyrG, chpR, Ig
- the genetically engineered bacterium of the present disclosure is a synthetic ligand-dependent essential gene (SLiDE) bacterial cell.
- SLiDE bacterial cells are synthetic auxotrophs with a mutation in one or more essential genes that only grow in the presence of a particular ligand (see Lopez and Anderson, "Synthetic Auxotrophs with Ligand-Dependent Essential Genes for a BL21 (DE3) Biosafety Strain,” ACS Synth Biol 2015;4(12): 1279-1286, the entire contents of which are expressly incorporated herein by reference).
- the SLiDE bacterial cell comprises a mutation in an essential gene.
- the essential gene is selected from the group consisting of pheS, dnaN, tyrS, metG, and adk.
- the essential gene is dnaN comprising one or more of the following mutations: H191N, R240C, I317S, F319V, L340T, V347I, and S345C.
- the essential gene is dnaN comprising the mutations HI 9 IN, R240C, I317S, F319V, L340T, V347I, and S345C.
- the essential gene is pheS comprising one or more of the following mutations: F125G, P183T, P184A, R186A, and I188L.
- the essential gene is pheS comprising the mutations F125G, P183T, P184A, R186A, and I188L. In some embodiments, the essential gene is tyrS
- the essential gene is tyrS comprising the mutations L36V, C38A, and F40G. In some embodiments, the essential gene is metG comprising one or more of the following mutations: E45Q, N47R, I49G, and A51C. In some embodiments, the essential gene is metG comprising the mutations E45Q, N47R, I49G, and A51C. In some embodiments, the essential gene is adk comprising one or more of the following mutations: I4L, L5I, and L6G. In some embodiments, the essential gene is adk comprising the mutations I4L, L5I, and L6G.
- the genetically engineered bacterium is complemented by a ligand.
- the ligand is selected from the group consisting of benzothiazole, indole, 2-aminobenzothiazole, indole-3 -butyric acid, indole-3 -acetic acid, and L-histidine methyl ester.
- bacterial cells comprising mutations in metG are complemented by benzothiazole, indole, 2-aminobenzothiazole, indole-3 -butyric acid, indole-3 -acetic acid, or L-histidine methyl ester.
- Bacterial cells comprising mutations in i1 ⁇ 23 ⁇ 4V are complemented by benzothiazole, indole, or 2-aminobenzothiazole.
- Bacterial cells comprising mutations in pheS are complemented by benzothiazole or 2- aminobenzothiazole.
- Bacterial cells comprising mutations in tyrS are complemented by benzothiazole or 2-aminobenzothiazole.
- Bacterial cells comprising mutations in adk I4L, L5I and L6G are complemented by benzothiazole or indole.
- the genetically engineered bacterium comprises more than one mutant essential gene that renders it auxotrophic to a ligand.
- the bacterial cell comprises mutations in two essential genes.
- the bacterial cell comprises mutations in tyrS (L36V, C38A, and F40G) and metG (E45Q, N47R, I49G, and A51C).
- the bacterial cell comprises mutations in three essential genes.
- the bacterial cell comprises mutations in tyrS (L36V, C38A, and F40G), metG (E45Q, N47R, I49G, and A51C), and pheS (F125G, P183T, P184A, R186A, and I188L).
- the genetically engineered bacterium is a conditional auxotroph whose essential gene(s) is replaced using the arabinose system shown in FIGS. 43-47.
- the genetically engineered bacterium of the disclosure is an auxotroph and also comprises kill switch circuitry, such as any of the kill switch components and systems described herein.
- the genetically engineered bacteria may comprise a deletion or mutation in an essential gene required for cell survival and/or growth, for example, in a DNA synthesis gene, for example, thyA, cell wall synthesis gene, for example, dapA and/or an amino acid gene, for example, serA or MetA and may also comprise a toxin gene that is regulated by one or more transcriptional activators that are expressed in response to an environmental condition(s) and/or signal(s) (such as the described arabinose system) or regulated by one or more recombinases that are expressed upon sensing an exogenous environmental condition(s) and/or signal(s) (such as the recombinase systems described herein).
- a DNA synthesis gene for example, thyA
- cell wall synthesis gene for example, dapA
- an amino acid gene for example, serA or MetA
- toxin gene that is regulated by one or more transcriptional activators that are expressed in response to an environmental condition(s) and/or signal(s)
- the genetically engineered bacterium of the disclosure is an auxotroph and also comprises kill switch circuitry, such as any of the kill switch components and systems described herein, as well as another biosecurity system, such a conditional origin of replication (Wright et al., 2015).
- Phe-auxotrophy may also have utility for increasing the rate of phenylalanine degradation.
- the deletion of the pheA gene confers phenylalanine auxotrophy. By turning off endogenous bacterial phenylalanine production, this may drive increased uptake from the environment and also result in increased degradation of phenylalanine taken up from the environment.
- the genetically engineered bacteria comprise multi-layered genetic regulatory circuits for expressing the constructs described herein ⁇ see, e.g., U.S. Provisional Application No. 62/184,811, incorporated herein by reference in its entirety).
- the genetic regulatory circuits are useful to screen for mutant bacteria that produce a phenylalanine-metabolizing enzyme or rescue an auxotroph.
- the invention provides methods for selecting genetically engineered bacteria that produce one or more genes of interest.
- the invention provides genetically engineered bacteria comprising a gene or gene cassette for producing a phenylalanine-metabolizing enzyme (e.g., PAL or PAH) and a T7 polymerase-regulated genetic regulatory circuit.
- a phenylalanine-metabolizing enzyme e.g., PAL or PAH
- the genetically engineered bacteria comprise a first gene encoding a T7 polymerase, wherein the first gene is operably linked to an FNR-responsive promoter; a second gene or gene cassette for producing a phenylalanine-metabolizing enzyme, wherein the second gene or gene cassette is operably linked to a T7 promoter that is induced by the T7 polymerase; and a third gene encoding an inhibitory factor, lysY, that is capable of inhibiting the T7 polymerase.
- FNR does not bind the FNR-responsive promoter, and the phenylalanine-metabolizing enzyme is not expressed. LysY is expressed constitutively (P-lac constitutive) and further inhibits T7 polymerase.
- FNR dimerizes and binds to the FNR-responsive promoter T7 polymerase is expressed at a level sufficient to overcome lysY inhibition, and the phenylalanine-metabolizing enzyme is expressed.
- the lysY gene is operably linked to an additional FNR binding site. In the absence of oxygen, FNR dimerizes to activate T7 polymerase expression as described above, and also inhibits lysY expression.
- the invention provides genetically engineered bacteria comprising a gene or gene cassette for producing a phenylalanine-metabolizing enzyme ⁇ e.g., PAL or PAH) and a protease-regulated genetic regulatory circuit.
- a phenylalanine-metabolizing enzyme ⁇ e.g., PAL or PAH
- a protease-regulated genetic regulatory circuit e.g., PAL or PAH
- the genetically engineered bacteria comprise a first gene encoding an mf-lon protease, wherein the first gene is operably linked to an FNR-responsive promoter; a second gene or gene cassette for producing a phenylalanine-metabolizing enzyme operably linked to a Tet regulatory region (TetO); and a third gene encoding an mf-lon degradation signal linked to a Tet repressor (TetR), wherein the TetR is capable of binding to the Tet regulatory region and repressing expression of the second gene or gene cassette.
- the mf-lon protease is capable of recognizing the mf-lon degradation signal and degrading the TetR.
- FNR does not bind the FNR- responsive promoter, the repressor is not degraded, and the phenylalanine-metabolizing enzyme is not expressed.
- the mf-lon protease recognizes the mf-lon degradation signal and degrades the TetR, and the phenylalanine-metabolizing enzyme is expressed.
- the invention provides genetically engineered bacteria comprising a gene or gene cassette for producing a phenylalanine-metabolizing enzyme (e.g., PAL or PAH) and a repressor-regulated genetic regulatory circuit.
- a phenylalanine-metabolizing enzyme e.g., PAL or PAH
- a repressor-regulated genetic regulatory circuit e.g., PAL or PAH
- the genetically engineered bacteria comprise a first gene encoding a first repressor, wherein the first gene is operably linked to an F R-responsive promoter; a second gene or gene cassette for producing a phenylalanine-metabolizing enzyme operably linked to a first regulatory region comprising a constitutive promoter; and a third gene encoding a second repressor, wherein the second repressor is capable of binding to the first regulatory region and repressing expression of the second gene or gene cassette.
- the third gene is operably linked to a second regulatory region comprising a constitutive promoter, wherein the first repressor is capable of binding to the second regulatory region and inhibiting expression of the second repressor.
- F R does not bind the FNR-responsive promoter
- the first repressor is not expressed
- the second repressor is expressed
- the phenylalanine- metabolizing enzyme is not expressed.
- FNR dimerizes and binds the FNR-responsive promoter the first repressor is expressed, the second repressor is not expressed, and the phenylalanine-metabolizing enzyme is expressed.
- repressors useful in these embodiments include, but are not limited to, ArgR, TetR, ArsR, AscG, Lad, CscR, DeoR, DgoR, FruR, GalR, GatR, CI, LexA, RafR, QacR, and PtxS (US20030166191).
- the invention provides genetically engineered bacteria comprising a gene or gene cassette for producing a phenylalanine-metabolizing enzyme (e.g., PAL or PAH) and a regulatory RNA-regulated genetic regulatory circuit.
- the genetically engineered bacteria comprise a first gene encoding a regulatory RNA, wherein the first gene is operably linked to an FNR-responsive promoter, and a second gene or gene cassette for producing a phenylalanine- metabolizing enzyme.
- the second gene or gene cassette is operably linked to a constitutive promoter and further linked to a nucleotide sequence capable of producing an mRNA hairpin that inhibits translation of the phenylalanine-metabolizing enzyme.
- the regulatory RNA is capable of eliminating the mRNA hairpin and inducing translation via the ribosomal binding site.
- FNR does not bind the FNR-responsive promoter
- the regulatory RNA is not expressed, and the mRNA hairpin prevents the phenylalanine-metabolizing enzyme from being translated.
- F R dimerizes and binds the F R-responsive promoter
- the regulatory RNA is expressed, the mRNA hairpin is eliminated, and the phenylalanine- metabolizing enzyme is expressed.
- the invention provides genetically engineered bacteria comprising a gene or gene cassette for producing a phenylalanine-metabolizing enzyme (e.g., PAL or PAH) and a CRISPR-regulated genetic regulatory circuit.
- the genetically engineered bacteria comprise a Cas9 protein; a first gene encoding a CRISPR guide RNA, wherein the first gene is operably linked to an FNR- responsive promoter; a second gene or gene cassette for producing a phenylalanine- metabolizing enzyme, wherein the second gene or gene cassette is operably linked to a regulatory region comprising a constitutive promoter; and a third gene encoding a repressor operably linked to a constitutive promoter, wherein the repressor is capable of binding to the regulatory region and repressing expression of the second gene or gene cassette.
- the third gene is further linked to a CRISPR target sequence that is capable of binding to the CRISPR guide RNA, wherein said binding to the CRISPR guide RNA induces cleavage by the Cas9 protein and inhibits expression of the repressor.
- FNR does not bind the FNR-responsive promoter
- the guide RNA is not expressed, the repressor is expressed, and the phenylalanine-metabolizing enzyme is not expressed.
- FNR dimerizes and binds the FNR- responsive promoter the guide RNA is expressed, the repressor is not expressed, and the phenylalanine-metabolizing enzyme is expressed.
- the invention provides genetically engineered bacteria comprising a gene or gene cassette for producing a phenylalanine-metabolizing enzyme (e.g., PAL or PAH) and a recombinase-regulated genetic regulatory circuit.
- a phenylalanine-metabolizing enzyme e.g., PAL or PAH
- the genetically engineered bacteria comprise a first gene encoding a recombinase, wherein the first gene is operably linked to an FNR-responsive promoter, and a second gene or gene cassette for producing a phenylalanine-metabolizing enzyme operably linked to a constitutive promoter.
- the second gene or gene cassette is inverted in orientation (3 ' to 5') and flanked by recombinase binding sites, and the recombinase is capable of binding to the recombinase binding sites to induce expression of the second gene or gene cassette by reverting its orientation (5' to 3').
- FNR does not bind the FNR-responsive promoter, the recombinase is not expressed, the gene or gene cassette remains in the 3' to 5' orientation, and no functional phenylalanine-metabolizing enzyme is produced.
- FNR dimerizes and binds the FNR-responsive promoter, the recombinase is expressed, the gene or gene cassette is reverted to the 5' to 3' orientation, and a functional phenylalanine-metabolizing enzyme is produced (see, e.g., Fig. 42).
- the invention provides genetically engineered bacteria comprising a gene or gene cassette for producing a phenylalanine-metabolizing enzyme (e.g., PAL or PAH) and a polymerase- and recombinase-regulated genetic regulatory circuit.
- a phenylalanine-metabolizing enzyme e.g., PAL or PAH
- PAH polymerase- and recombinase-regulated genetic regulatory circuit
- the genetically engineered bacteria comprise a first gene encoding a recombinase, wherein the first gene is operably linked to an FNR- responsive promoter; a second gene or gene cassette for producing a phenylalanine- metabolizing enzyme operably linked to a T7 promoter; a third gene encoding a T7 polymerase, wherein the T7 polymerase is capable of binding to the T7 promoter and inducing expression of the phenylalanine-metabolizing enzyme.
- the third gene encoding the T7 polymerase is inverted in orientation (3' to 5') and flanked by recombinase binding sites, and the recombinase is capable of binding to the
- recombinase binding sites to induce expression of the T7 polymerase gene by reverting its orientation (5' to 3').
- FNR does not bind the FNR- responsive promoter
- the recombinase is not expressed, the T7 polymerase gene remains in the 3' to 5' orientation, and the phenylalanine-metabolizing enzyme is not expressed.
- FNR dimerizes and binds the FNR-responsive promoter the recombinase is expressed, the T7 polymerase gene is reverted to the 5' to 3' orientation, and the phenylalanine-metabolizing enzyme is expressed (see, e.g., Fig. 43).
- the genetically engineered bacteria comprise stable circuits for expressing genes of interest over prolonged periods.
- the genetically engineered bacteria are capable of producing a phenylalanine-metabolizing enzyme (e.g., PAL or PAH) and further comprise a toxin-anti -toxin system that simultaneously produces a toxin (hok) and a short-lived anti-toxin (sok), wherein loss of the plasmid causes the cell to be killed by the long-lived toxin (Danino et al., 2015).
- the genetically engineered bacteria further comprise alp? from B. subtilis plasmid pL20 and produces filaments that are capable of pushing plasmids to the poles of the cells in order to ensure equal segregation during cell division (Danino et al., 2015).
- the genetically engineered bacteria of the invention also comprise a plasmid that has been modified to create a host-plasmid mutual dependency.
- the mutually dependent host-plasmid platform is GeneGuard (Wright et al., 2015).
- the GeneGuard plasmid comprises (i) a conditional origin of replication, in which the requisite replication initiator protein is provided in trans; (ii) an auxotrophic modification that is rescued by the host via genomic translocation and is also compatible for use in rich media; and/or (iii) a nucleic acid sequence which encodes a broad-spectrum toxin.
- the toxin gene may be used to select against plasmid spread by making the plasmid DNA itself disadvantageous for strains not expressing the anti -toxin ⁇ e.g., a wild-type bacterium).
- the GeneGuard plasmid is stable for at least 100 generations without antibiotic selection.
- the GeneGuard plasmid does not disrupt growth of the host.
- the GeneGuard plasmid is used to greatly reduce unintentional plasmid propagation in the genetically engineered bacteria of the invention.
- the mutually dependent host-plasmid platform may be used alone or in combination with other biosafety mechanisms, such as those described herein ⁇ e.g., kill switches, auxotrophies).
- the genetically engineered bacteria comprise a GeneGuard plasmid.
- the genetically engineered bacteria comprise a GeneGuard plasmid and/or one or more kill switches.
- the genetically engineered bacteria comprise a GeneGuard plasmid and/or one or more auxotrophies.
- the genetically engineered bacteria comprise a GeneGuard plasmid, one or more kill switches, and/or one or more auxotrophies. Kill Switch
- the genetically engineered bacteria of the invention also comprise a kill switch (see, e.g., U.S. Provisional Application Nos.
- the kill switch is intended to actively kill genetically engineered bacteria in response to external stimuli. As opposed to an auxotrophic mutation where bacteria die because they lack an essential nutrient for survival, the kill switch is triggered by a particular factor in the environment that induces the production of toxic molecules within the microbe that cause cell death.
- Bacteria comprising kill switches have been engineered for in vitro research purposes, e.g., to limit the spread of a biofuel-producing microorganism outside of a laboratory environment.
- Bacteria engineered for in vivo administration to treat a disease may also be programmed to die at a specific time after the expression and delivery of a heterologous gene or genes, for example, a phenylalanine-metabolizing enzyme, or after the subject has experienced the therapeutic effect.
- the kill switch is activated to kill the bacteria after a period of time following oxygen level-dependent expression of the phenylalanine-metabolizing enzyme ⁇ e.g., PAL or PAH) and/or the phenylalanine transporter gene.
- the kill switch is activated in a delayed fashion following oxygen level- dependent expression of the phenylalanine-metabolizing enzyme and/or phenylalanine transporter gene.
- the bacteria may be engineered to die after the bacterium has spread outside of a disease site. Specifically, it may be useful to prevent long-term colonization of subjects by the microorganism, spread of the microorganism outside the area of interest (for example, outside the gut) within the subject, or spread of the microorganism outside of the subject into the environment (for example, spread to the environment through the stool of the subject).
- the switches that control their production can be based on, for example, transcriptional activation (toggle switches; see, e.g., Gardner et al., 2000), translation (riboregulators), or DNA recombination (recombinase-based switches), and can sense environmental stimuli such as anaerobiosis or reactive oxygen species.
- switches can be activated by a single environmental factor or may require several activators in AND, OR, NAND and NOR logic configurations to induce cell death.
- an AND riboregulator switch is activated by tetracycline, isopropyl ⁇ -D-l-thiogalactopyranoside (TPTG), and arabinose to induce the expression of lysins, which permeabilize the cell membrane and kill the cell.
- IPTG induces the expression of the endolysin and holin mRNAs, which are then derepressed by the addition of arabinose and tetracycline. All three inducers must be present to cause cell death. Examples of kill switches are known in the art (Callura et al., 2010).
- Kill switches can be designed such that a toxin is produced in response to an environmental condition or external signal (e.g., the bacteria is killed in response to an external cue) or, alternatively designed such that a toxin is produced once an environmental condition no longer exists or an external signal is ceased.
- an environmental condition or external signal e.g., the bacteria is killed in response to an external cue
- the genetically engineered bacteria of the disclosure are further programmed to die after sensing an exogenous environmental signal, for example, in a low-oxygen environment.
- the genetically engineered bacteria of the present disclosure comprise one or more genes encoding one or more recombinase(s), whose expression is induced in response to an environmental condition or signal and causes one or more recombination events that ultimately leads to the expression of a toxin which kills the cell.
- the at least one recombination event is the flipping of an inverted heterologous gene encoding a bacterial toxin which is then constitutively expressed after it is flipped by the first recombinase.
- constitutive expression of the bacterial toxin kills the genetically engineered bacterium.
- these types of kill switch systems once the engineered bacterial cell senses the exogenous environmental condition and expresses the heterologous gene of interest, the recombinant bacterial cell is no longer viable.
- the genetically engineered bacterium further expresses a heterologous gene encoding an anti -toxin in response to an exogenous environmental condition or signal.
- the at least one recombination event is flipping of an inverted
- heterologous gene encoding a bacterial toxin by a first recombinase.
- the inverted heterologous gene encoding the bacterial toxin is located between a first forward recombinase recognition sequence and a first reverse
- the heterologous gene encoding the bacterial toxin is constitutively expressed after it is flipped by the first recombinase.
- the anti-toxin inhibits the activity of the toxin, thereby delaying death of the genetically engineered bacterium.
- the genetically engineered bacterium is killed by the bacterial toxin when the heterologous gene encoding the anti-toxin is no longer expressed when the exogenous environmental condition is no longer present.
- the at least one recombination event is flipping of an inverted heterologous gene encoding a second recombinase by a first recombinase, followed by the flipping of an inverted heterologous gene encoding a bacterial toxin by the second recombinase.
- the inverted heterologous gene encoding the second recombinase is located between a first forward recombinase recognition sequence and a first reverse recombinase recognition sequence.
- the inverted heterologous gene encoding the bacterial toxin is located between a second forward recombinase recognition sequence and a second reverse recombinase recognition sequence.
- the heterologous gene encoding the second recombinase is constitutively expressed after it is flipped by the first recombinase.
- the heterologous gene encoding the bacterial toxin is constitutively expressed after it is flipped by the second recombinase.
- the genetically engineered bacterium is killed by the bacterial toxin.
- the genetically engineered bacterium further expresses a heterologous gene encoding an anti-toxin in response to the exogenous environmental condition.
- the anti-toxin inhibits the activity of the toxin when the exogenous environmental condition is present, thereby delaying death of the genetically engineered bacterium.
- the genetically engineered bacterium is killed by the bacterial toxin when the heterologous gene encoding the anti-toxin is no longer expressed when the exogenous environmental condition is no longer present.
- the at least one recombination event is flipping of an inverted heterologous gene encoding a second recombinase by a first recombinase, followed by flipping of an inverted heterologous gene encoding a third recombinase by the second recombinase, followed by flipping of an inverted heterologous gene encoding a bacterial toxin by the third recombinase.
- the at least one recombination event is flipping of an inverted heterologous gene encoding a first excision enzyme by a first recombinase.
- the inverted heterologous gene encoding the first excision enzyme is located between a first forward recombinase recognition sequence and a first reverse recombinase recognition sequence.
- the heterologous gene encoding the first excision enzyme is constitutively expressed after it is flipped by the first recombinase.
- the first excision enzyme excises a first essential gene.
- the programmed recombinant bacterial cell is not viable after the first essential gene is excised.
- the first recombinase further flips an inverted heterologous gene encoding a second excision enzyme.
- the inverted heterologous gene encoding the second excision enzyme is located between a second forward recombinase recognition sequence and a second reverse recombinase recognition sequence.
- the heterologous gene encoding the second excision enzyme is constitutively expressed after it is flipped by the first recombinase.
- the genetically engineered bacterium dies or is no longer viable when the first essential gene and the second essential gene are both excised.
- the genetically engineered bacterium dies or is no longer viable when either the first essential gene is excised or the second essential gene is excised by the first recombinase.
- the genetically engineered bacterium dies after the at least one recombination event occurs. In another embodiment, the genetically engineered bacterium is no longer viable after the at least one recombination event occurs.
- the recombinase can be a recombinase selected from the group consisting of: Bxbl, PhiC31, TP901, Bxbl, PhiC31, TP901, HK022, HPl, R4, Intl, Int2, Int3, Int4, Int5, Int6, Int7, Int8, Int9, IntlO, Intl 1, Intl2, Intl3, Intl4, Intl5, Intl6, Intl7, Intl8, Intl9, Int20, Int21, Int22, Int23, Int24, Int25, Int26, Int27, Int28, Int29, Int30, Int31, Int32, Int33, and Int34, or a biologically active fragment thereof.
- a toxin is produced in the presence of an environmental factor or signal.
- a toxin may be repressed in the presence of an environmental factor (i.e., not produced) and then produced once the environmental condition or external signal is no longer present.
- Such kill switches are called repression-based kill switches and represent systems in which the bacterial cells are viable only in the presence of an external factor or signal, such as arabinose or other sugar.
- Exemplary kill switch designs in which the toxin is repressed in the presence of an external factor or signal (and activated once the external signal is removed) is shown in Figs. 43-47.
- the disclosure provides recombinant bacterial cells which express one or more heterologous gene(s) upon sensing arabinose or other sugar in the exogenous environment.
- the recombinant bacterial cells contain the araC gene, which encodes the AraC
- the AraC transcription factor adopts a conformation that represses transcription of genes under the control of the araBAD promoter.
- the AraC transcription factor undergoes a conformational change that allows it to bind to and activate the araBAD promoter, which induces expression of the desired gene, for example TetR, which represses expression of a toxin gene.
- the toxin gene is repressed in the presence of arabinose or other sugar.
- the TetR gene is not activated and the toxin is expressed, thereby killing the bacteria.
- the arabinose system can also be used to express an essential gene, in which the essential gene is only expressed in the presence of arabinose or other sugar and is not expressed when arabinose or other sugar is absent from the environment.
- the one or more heterologous genes are directly or indirectly under the control of the araBAD promoter.
- the expressed heterologous gene is selected from one or more of the following: a heterologous therapeutic gene, a heterologous gene encoding an anti- toxin, a heterologous gene encoding a repressor protein or polypeptide, for example, a TetR repressor, a heterologous gene encoding an essential protein not found in the bacterial cell, and/or a heterologous encoding a regulatory protein or polypeptide.
- Arabinose inducible promoters are known in the art, including Para, P ara B, ParaC, and ParaB AD.
- the arabinose inducible promoter is from E. coli.
- the ParaC promoter and the P ar aBAD promoter operate as a bidirectional promoter, with the ParaBAD promoter controlling expression of a heterologous gene(s) in one direction, and the ParaC (in close proximity to, and on the opposite strand from the ParaBAD promoter), controlling expression of a heterologous gene(s) in the other direction.
- the ParaBAD promoter controlling expression of a heterologous gene(s) in one direction
- the ParaC in close proximity to, and on the opposite strand from the ParaBAD promoter
- the genetically engineered bacteria of the present disclosure contain a kill switch having at least the following sequences: a ParaBAD promoter operably linked to a heterologous gene encoding a tetracycline repressor (TetR) protein, a ParaC promoter operably linked to a heterologous gene encoding the AraC transcription factor, and a heterologous gene encoding a bacterial toxin operably linked to a promoter which is repressed by the TetR protein.
- TetR tetracycline repressor
- the AraC transcription factor activates the P ar aBAD promoter, which activates transcription of the TetR protein which, in turn, represses transcription of the toxin.
- AraC suppresses transcription from the P ar aBAD promoter and no TetR protein is expressed.
- expression of the heterologous toxin gene is activated, and the toxin is expressed.
- the toxin builds up in the recombinant bacterial cell, and the recombinant bacterial cell is killed.
- the araC gene encoding the AraC transcription factor is under the control of a constitutive promoter and is therefore constitutively expressed.
- the genetically engineered bacterium further comprises an anti-toxin under the control of a constitutive promoter.
- the toxin in the presence of arabinose, the toxin is not expressed due to repression by TetR protein, and the anti -toxin protein builds-up in the cell.
- TetR protein in the absence of arabinose, TetR protein is not expressed, and expression of the toxin is induced.
- the toxin begins to build-up within the recombinant bacterial cell.
- the recombinant bacterial cell is no longer viable once the toxin protein is present at either equal or greater amounts than that of the anti-toxin protein in the cell, and the recombinant bacterial cell will be killed by the toxin.
- the genetically engineered bacterium further comprises an anti-toxin under the control of the P ara BAD promoter.
- TetR and the anti-toxin are expressed, the anti-toxin builds up in the cell, and the toxin is not expressed due to repression by TetR protein.
- both the TetR protein and the anti-toxin are not expressed, and expression of the toxin is induced.
- the toxin begins to build-up within the recombinant bacterial cell.
- the recombinant bacterial cell is no longer viable once the toxin protein is expressed, and the recombinant bacterial cell will be killed by the toxin.
- the genetically engineered bacteria of the present disclosure contain a kill switch having at least the following sequences: a ParaBAD promoter operably linked to a heterologous gene encoding an essential polypeptide not found in the recombinant bacterial cell (and required for survival), and a Parac promoter operably linked to a heterologous gene encoding the AraC transcription factor.
- a ParaBAD promoter operably linked to a heterologous gene encoding an essential polypeptide not found in the recombinant bacterial cell (and required for survival)
- a Parac promoter operably linked to a heterologous gene encoding the AraC transcription factor.
- the AraC transcription factor activates the ParaBAD promoter, which activates transcription of the heterologous gene encoding the essential polypeptide, allowing the recombinant bacterial cell to survive.
- the sequence of P ara BAD promoter operably linked to a heterologous gene encoding an essential polypeptide not found in the recombinant bacterial cell can be present in the bacterial cell in conjunction with the TetR/toxin kill switch system described directly above.
- sequence of P ara BAD promoter operably linked to a heterologous gene encoding an essential polypeptide not found in the recombinant bacterial cell can be present in the bacterial cell in conjunction with the TetR/toxin/anti-toxin kill switch system described directly above.
- the bacteria may comprise a plasmid stability system with a plasmid that produces both a short-lived anti-toxin and a long-lived toxin.
- the bacterial cell produces equal amounts of toxin and anti-toxin to neutralize the toxin.
- the short-lived antitoxin begins to decay.
- the anti-toxin decays completely the cell dies as a result of the longer-lived toxin killing it.
- the engineered bacteria of the present disclosure further comprise the gene(s) encoding the components of any of the above-described kill switch circuits.
- the bacterial toxin is selected from the group consisting of a lysin, Hok, Fst, TisB, LdrD, Kid, SymE, MazF, FlmA, lbs, XCV2162, dinJ, CcdB, MazF, ParE, YafO, Zeta, hicB, relB, yhaV, yoeB, chpBK, hipA, microcin B, microcin B17, microcin C, microcin C7-C51, microcin J25, microcin ColV, microcin 24, microcin L, microcin D93, microcin L, microcin E492, microcin H47, microcin 147, microcin M, colicin A, colicin El, colicin K, colicin N, colicin U, colicin B, colicin la, colicin lb, colicin 5, colicin 10, colicin
- the anti-toxin is selected from the group consisting of an anti-lysin, Sok, RNAII, IstR, RdlD, Kis, SymR, MazE, FlmB, Sib, ptaRNAl, yafQ, CcdA, MazE, ParD, yafN, Epsilon, HicA, relE, prlF, yefM, chpBI, hipB, MccE, MccE CTD , MccF, Cai, ImmEl, Cki, Cni, Cui, Cbi, Iia, Imm, Cfi, ImlO, Csi, Cyi, Im2, Im7, Im8, Im9, Im3, Im4, ImmE6, cloacin immunity protein (Cim), ImmE5, ImmD, and Cmi, or a biologically active fragment thereof.
- the bacterial toxin is bactericidal to the genetically engineered bacterium. In one embodiment, the bacterial toxin is bacteriostatic to the genetically engineered bacterium.
- the genetically engineered bacterium provided herein is an auxotroph.
- the genetically engineered bacterium is an auxotroph selected from a cysE, glnA, ilvD, leuB, lysA, serA, metA, gfyA, hisB, ilvA, pheA, proA, thrC, trpC, tyrA, thyA, uraA, dapA, dapB, dapD, dapE, dapF, flhD, metB, metC, proAB, and thil auxotroph.
- the engineered bacteria have more than one auxotrophy, for example, they may be a AthyA and AdapA auxotroph.
- the genetically engineered bacterium provided herein further comprises a kill switch circuit, such as any of the kill switch circuits provided herein.
- the genetically engineered bacteria further comprise one or more genes encoding one or more recombinase(s) under the control of an inducible promoter and an inverted toxin sequence.
- the genetically engineered bacteria further comprise one or more genes encoding an anti-toxin.
- the engineered bacteria further comprise one or more genes encoding one or more recombinase(s) under the control of an inducible promoter and one or more inverted excision genes, wherein the excision gene(s) encode an enzyme that deletes an essential gene.
- the genetically engineered bacteria further comprise one or more genes encoding an antitoxin.
- the engineered bacteria further comprise one or more genes encoding a toxin under the control of a promoter having a TetR repressor binding site and a gene encoding the TetR under the control of an inducible promoter that is induced by arabinose, such as P ar aBAD-
- the genetically engineered bacteria further comprise one or more genes encoding an anti-toxin.
- the genetically engineered bacterium is an auxotroph comprising a gene encoding a phenylalanine-metabolizing enzyme and further comprises a kill switch circuit, such as any of the kill switch circuits described herein.
- the gene or gene cassette for producing the phenylalanine-metabolizing enzyme is present on a plasmid in the bacterium and operatively linked on the plasmid to the promoter that is induced under low-oxygen or anaerobic conditions.
- the gene or gene cassette for producing the phenylalanine-metabolizing enzyme is present in the bacterial chromosome and is operatively linked in the chromosome to the promoter that is induced under low-oxygen or anaerobic conditions.
- compositions comprising the genetically engineered bacteria of the invention may be used to treat, manage, ameliorate, and/or prevent diseases associated with hyperphenylalaninemia, e.g., PKU.
- Pharmaceutical compositions of the invention comprising one or more genetically engineered bacteria, alone or in combination with prophylactic agents, therapeutic agents, and/or and pharmaceutically acceptable carriers are provided.
- the pharmaceutical composition comprises one species, strain, or subtype of bacteria that are engineered to comprise the genetic modifications described herein.
- the pharmaceutical composition comprises two or more species, strains, and/or subtypes of bacteria that are each engineered to comprise the genetic modifications described herein.
- compositions described herein may be formulated in a conventional manner using one or more physiologically acceptable carriers comprising excipients and auxiliaries, which facilitate processing of the active ingredients into compositions for pharmaceutical use.
- physiologically acceptable carriers comprising excipients and auxiliaries, which facilitate processing of the active ingredients into compositions for pharmaceutical use.
- the pharmaceutical compositions are subjected to tabletting, lyophilizing, direct compression, conventional mixing, dissolving, granulating, levigating, emulsifying, encapsulating, entrapping, or spray drying to form tablets, granulates, nanoparticles, nanocapsules, microcapsules, microtablets, pellets, or powders, which may be enterically coated or uncoated. Appropriate formulation depends on the route of administration.
- the genetically engineered bacteria described herein may be formulated into pharmaceutical compositions in any suitable dosage form (e.g., liquids, capsules, sachet, hard capsules, soft capsules, tablets, enteric coated tablets, suspension powders, granules, or matrix sustained release formations for oral administration) and for any suitable type of administration (e.g., oral, topical, injectable, immediate-release, pulsatile-release, delayed-release, or sustained release).
- Suitable dosage amounts for the genetically engineered bacteria may range from about 10 5 to 10 12 bacteria, e.g., approximately 10 5 bacteria, approximately 10 6 bacteria, approximately 10 7 bacteria, approximately 10 8 bacteria, approximately 10 9 bacteria, approximately 10 10 bacteria, approximately 10 11 bacteria, or approximately 10 11 bacteria.
- the composition may be administered once or more daily, weekly, or monthly.
- the composition may be administered before, during, or following a meal.
- the composition may be administered once or more daily, weekly, or monthly.
- the composition may be administered before, during, or following a meal.
- the pharmaceutical composition is administered before the subject eats a meal. In one embodiment, the pharmaceutical composition is administered currently with a meal. In one embodiment, the pharmaceutical composition is administered after the subject eats a meal.
- the genetically engineered bacteria may be formulated into
- compositions comprising one or more pharmaceutically acceptable carriers, thickeners, diluents, buffers, buffering agents, surface active agents, neutral or cationic lipids, lipid complexes, liposomes, penetration enhancers, carrier compounds, and other pharmaceutically acceptable carriers or agents.
- pharmaceutically acceptable carriers such as thickeners, diluents, buffers, buffering agents, surface active agents, neutral or cationic lipids, lipid complexes, liposomes, penetration enhancers, carrier compounds, and other pharmaceutically acceptable carriers or agents.
- composition may include, but is not limited to, the addition of calcium bicarbonate, sodium bicarbonate, calcium phosphate, various sugars and types of starch, cellulose derivatives, gelatin, vegetable oils, polyethylene glycols, and surfactants, including, for example, polysorbate 20.
- the genetically engineered bacteria of the invention may be formulated in a solution of sodium bicarbonate, e.g., 1 molar solution of sodium bicarbonate (to buffer an acidic cellular environment, such as the stomach, for example).
- the genetically engineered bacteria may be administered and formulated as neutral or salt forms.
- Pharmaceutically acceptable salts include those formed with anions such as those derived from
- the genetically engineered bacteria disclosed herein may be any genetically engineered bacteria.
- viscous to semi-solid or solid forms comprising a carrier or one or more excipients compatible with topical application and having a dynamic viscosity greater than water are employed.
- Suitable formulations include, but are not limited to, solutions, suspensions, emulsions, creams, ointments, powders, liniments, salves, etc., which may be sterilized or mixed with auxiliary agents (e.g., preservatives, stabilizers, wetting agents, buffers, or salts) for influencing various properties, e.g., osmotic pressure.
- auxiliary agents e.g., preservatives, stabilizers, wetting agents, buffers, or salts
- suitable topical dosage forms include sprayable aerosol preparations wherein the active ingredient in combination with a solid or liquid inert carrier, is packaged in a mixture with a pressurized volatile (e.g., a gaseous propellant, such as freon) or in a squeeze bottle.
- a pressurized volatile e.g., a gaseous propellant, such as freon
- the pharmaceutical composition comprising the recombinant bacteria of the invention may be formulated as a hygiene product.
- the hygiene product may be an antibacterial formulation, or a fermentation product such as a fermentation broth.
- Hygiene products may be, for example, shampoos, conditioners, creams, pastes, lotions, and lip balms.
- the genetically engineered bacteria disclosed herein may be any genetically engineered bacteria.
- Pharmacological compositions for oral use can be made using a solid excipient, optionally grinding the resulting mixture, and processing the mixture of granules, after adding suitable auxiliaries if desired, to obtain tablets or dragee cores.
- Suitable excipients include, but are not limited to, fillers such as sugars, including lactose, sucrose, mannitol, or sorbitol; cellulose compositions such as maize starch, wheat starch, rice starch, potato starch, gelatin, gum tragacanth, methyl cellulose, hydroxypropylmethyl-cellulose, sodium carbomethylcellulose; and/or physiologically acceptable polymers such as polyvinylpyrrolidone (PVP) or polyethylene glycol (PEG). Disintegrating agents may also be added, such as cross-linked polyvinylpyrrolidone, agar, alginic acid or a salt thereof such as sodium alginate.
- fillers such as sugars, including lactose, sucrose, mannitol, or sorbitol
- cellulose compositions such as maize starch, wheat starch, rice starch, potato starch, gelatin, gum tragacanth, methyl cellulose, hydroxypropylmethyl-cellulose, sodium carbo
- Tablets or capsules can be prepared by conventional means with pharmaceutically acceptable excipients such as binding agents (e.g., pregelatinised maize starch, polyvinylpyrrolidone, hydroxypropyl methylcellulose,
- binding agents e.g., pregelatinised maize starch, polyvinylpyrrolidone, hydroxypropyl methylcellulose,
- carboxymethylcellulose polyethylene glycol, sucrose, glucose, sorbitol, starch, gum, kaolin, and tragacanth
- fillers e.g., /actose, microcrystalline cellulose, or calcium hydrogen phosphate
- lubricants e.g., calcium, aluminum, zinc, stearic acid
- disintegrants e.g., starch, potato starch, sodium starch glycolate, sugars, cellulose derivatives, silica powders
- wetting agents e.g., sodium lauryl sulphate
- a coating shell may be present, and common membranes include, but are not limited to, polylactide, polyglycolic acid, polyanhydride, other biodegradable polymers, alginate- polylysine-alginate (APA), alginate-polymethylene-co-guanidine-alginate (A-PMCG- A), hydroymethylacrylate-methyl methacrylate (HEMA-MMA), multilayered HEMA- MMA-MAA, polyacrylonitrilevinylchloride (PAN-PVC), acrylonitrile/sodium methallyl sulfonate (AN-69), polyethylene glycol/poly
- PEG/PD5/PDMS pentamethylcyclopentasiloxane/polydimethylsiloxane
- PDMAAm poly N,N- dimethyl acrylamide
- siliceous encapsulates cellulose sulphate/sodium alginate/polymethylene-co-guanidine (CS/A/PMCG), cellulose acetate phthalate, calcium alginate, k-carrageenan-locust bean gum gel beads, gellan-xanthan beads, poly(lactide-co-glycolides), carrageenan, starch poly-anhydrides, starch
- polymethacrylates polyamino acids, and enteric coating polymers.
- the genetically engineered bacteria are enterically coated for release into the gut or a particular region of the gut, for example, the large intestine.
- the typical pH profile from the stomach to the colon is about 1-4 (stomach), 5.5-6 (duodenum), 7.3-8.0 (ileum), and 5.5-6.5 (colon).
- the pH profile may be modified.
- the coating is degraded in specific pH environments in order to specify the site of release. In some embodiments, at least two coatings are used. In some embodiments, the outside coating and the inside coating are degraded at different pH levels.
- Liquid preparations for oral administration may take the form of solutions, syrups, suspensions, or a dry product for constitution with water or other suitable vehicle before use.
- Such liquid preparations may be prepared by conventional means with pharmaceutically acceptable agents such as suspending agents (e.g., sorbitol syrup, cellulose derivatives, or hydrogenated edible fats); emulsifying agents (e.g., lecithin or acacia); non-aqueous vehicles (e.g., almond oil, oily esters, ethyl alcohol, or fractionated vegetable oils); and preservatives (e.g., methyl or propyl-p- hydroxybenzoates or sorbic acid).
- suspending agents e.g., sorbitol syrup, cellulose derivatives, or hydrogenated edible fats
- emulsifying agents e.g., lecithin or acacia
- non-aqueous vehicles e.g., almond oil, oily esters, ethyl alcohol, or fractionated
- the preparations may also contain buffer salts, flavoring, coloring, and sweetening agents as appropriate.
- Preparations for oral administration may be suitably formulated for slow release, controlled release, or sustained release of the genetically engineered bacteria described herein.
- the genetically engineered bacteria of the disclosure may be formulated in a composition suitable for administration to pediatric subjects. As is well known in the art, children differ from adults in many aspects, including different rates of gastric emptying, pH, gastrointestinal permeability, etc. (Ivanovska et al., 2014). Moreover, pediatric formulation acceptability and preferences, such as route of administration and taste attributes, are critical for achieving acceptable pediatric compliance.
- the composition suitable for administration to pediatric subjects may include easy-to-swallow or dissolvable dosage forms, or more palatable compositions, such as compositions with added flavors, sweeteners, or taste blockers.
- a composition suitable for administration to pediatric subjects may also be suitable for administration to adults.
- the composition suitable for administration to pediatric subjects may include a solution, syrup, suspension, elixir, powder for reconstitution as suspension or solution, dispersible/effervescent tablet, chewable tablet, gummy candy, lollipop, freezer pop, troche, chewing gum, oral thin strip, orally disintegrating tablet, sachet, soft gelatin capsule, sprinkle oral powder, or granules.
- the composition is a gummy candy, which is made from a gelatin base, giving the candy elasticity, desired chewy consistency, and longer shelf-life.
- the gummy candy may also comprise sweeteners or flavors.
- the composition suitable for administration to pediatric subjects may include a flavor.
- flavor is a substance (liquid or solid) that provides a distinct taste and aroma to the formulation. Flavors also help to improve the palatability of the formulation. Flavors include, but are not limited to, strawberry, vanilla, lemon, grape, bubble gum, and cherry.
- the genetically engineered bacteria may be orally administered, for example, with an inert diluent or an assimilable edible carrier.
- the compound may also be enclosed in a hard or soft shell gelatin capsule, compressed into tablets, or incorporated directly into the subject's diet.
- the compounds may be incorporated with excipients and used in the form of ingestible tablets, buccal tablets, troches, capsules, elixirs, suspensions, syrups, wafers, and the like.
- the pharmaceutical composition comprising the recombinant bacteria of the invention may be a comestible product, for example, a food product.
- the food product is milk, concentrated milk, fermented milk (yogurt, sour milk, frozen yogurt, lactic acid bacteria-fermented beverages), milk powder, ice cream, cream cheeses, dry cheeses, soybean milk, fermented soybean milk, vegetable-fruit juices, fruit juices, sports drinks, confectionery, candies, infant foods (such as infant cakes), nutritional food products, animal feeds, or dietary supplements.
- the food product is a fermented food, such as a fermented dairy product.
- the fermented dairy product is yogurt.
- the fermented dairy product is cheese, milk, cream, ice cream, milk shake, or kefir.
- the recombinant bacteria of the invention are combined in a preparation containing other live bacterial cells intended to serve as probiotics.
- the food product is a beverage.
- the beverage is a fruit juice-based beverage or a beverage containing plant or herbal extracts.
- the food product is a jelly or a pudding.
- Other food products suitable for administration of the recombinant bacteria of the invention are well known in the art. See, e.g., US 2015/0359894 and US 2015/0238545, the entire contents of each of which are expressly incorporated herein by reference.
- the pharmaceutical composition of the invention is injected into, sprayed onto, or sprinkled onto a food product, such as bread, yogurt, or cheese.
- the composition is formulated for intraintestinal administration, intrajejunal administration, intraduodenal administration, intraileal administration, gastric shunt administration, or intracolic administration, via
- compositions may also be formulated in rectal compositions such as suppositories or retention enemas, using, e.g., conventional suppository bases such as cocoa butter or other glycerides.
- rectal compositions such as suppositories or retention enemas
- the compositions may be suspensions, solutions, or emulsions in oily or aqueous vehicles, and may contain suspending, stabilizing and/or dispersing agents.
- the genetically engineered bacteria described herein may be
- Pressurized aerosol dosage units may be determined by providing a valve to deliver a metered amount.
- Capsules and cartridges e.g., of gelatin
- a powder mix of the compound and a suitable powder base such as lactose or starch.
- the genetically engineered bacteria may be administered and formulated as depot preparations. Such long acting formulations may be administered by implantation or by injection, including intravenous injection, subcutaneous injection, local injection, direct injection, or infusion.
- the compositions may be formulated with suitable polymeric or hydrophobic materials (e.g., as an emulsion in an acceptable oil) or ion exchange resins, or as sparingly soluble derivatives (e.g., as a sparingly soluble salt).
- Single dosage forms may be in a liquid or a solid form.
- Single dosage forms may be administered directly to a patient without modification or may be diluted or reconstituted prior to administration.
- a single dosage form may be administered in bolus form, e.g., single injection, single oral dose, including an oral dose that comprises multiple tablets, capsule, pills, etc.
- a single dosage form may be administered over a period of time, e.g., by infusion.
- Single dosage forms of the pharmaceutical composition may be prepared by portioning the pharmaceutical composition into smaller aliquots, single dose containers, single dose liquid forms, or single dose solid forms, such as tablets, granulates, nanoparticles, nanocapsules, microcapsules, microtablets, pellets, or powders, which may be enterically coated or uncoated.
- a single dose in a solid form may be reconstituted by adding liquid, typically sterile water or saline solution, prior to administration to a patient.
- the composition can be delivered in a controlled release or sustained release system. In one embodiment, a pump may be used to achieve controlled or sustained release.
- polymeric materials can be used to achieve controlled or sustained release of the therapies of the present disclosure (see, e.g., U.S. Patent No. 5,989,463).
- examples of polymers used in sustained release formulations include, but are not limited to, poly(2-hydroxy ethyl methacrylate), poly(methyl methacrylate), poly(acrylic acid), poly(ethylene-co-vinyl acetate), poly(methacrylic acid), polyglycolides (PLG), polyanhydrides, poly(N- vinyl pyrrolidone), poly(vinyl alcohol), polyacrylamide, poly(ethylene glycol), polylactides (PLA), poly(lactide-co-glycolides) (PLGA), and polyorthoesters.
- the polymer used in a sustained release formulation may be inert, free of leachable impurities, stable on storage, sterile, and biodegradable.
- a controlled or sustained release system can be placed in proximity of the prophylactic or therapeutic target, thus requiring only a fraction of the systemic dose. Any suitable technique known to one of skill in the art may be used.
- Dosage regimens may be adjusted to provide a therapeutic response. Dosing can depend on several factors, including severity and responsiveness of the disease, route of administration, time course of treatment (days to months to years), and time to amelioration of the disease. For example, a single bolus may be administered at one time, several divided doses may be administered over a predetermined period of time, or the dose may be reduced or increased as indicated by the therapeutic situation. The specification for the dosage is dictated by the unique characteristics of the active compound and the particular therapeutic effect to be achieved. Dosage values may vary with the type and severity of the condition to be alleviated. For any particular subject, specific dosage regimens may be adjusted over time according to the individual need and the professional judgment of the treating clinician. Toxicity and therapeutic efficacy of compounds provided herein can be determined by standard pharmaceutical procedures in cell culture or animal models. For example, LD 50 , ED 50 , EC50, and IC50 may be determined, and the dose ratio between toxic and therapeutic effects
- compositions that exhibit toxic side effects may be used, with careful modifications to minimize potential damage to reduce side effects. Dosing may be estimated initially from cell culture assays and animal models. The data obtained from in vitro and in vivo assays and animal studies can be used in formulating a range of dosage for use in humans.
- the ingredients are supplied either separately or mixed together in unit dosage form, for example, as a dry lyophilized powder or water-free concentrate in a hermetically sealed container such as an ampoule or sachet indicating the quantity of active agent. If the mode of administration is by injection, an ampoule of sterile water for injection or saline can be provided so that the ingredients may be mixed prior to administration.
- the pharmaceutical compositions may be packaged in a hermetically sealed container such as an ampoule or sachet indicating the quantity of the agent.
- a hermetically sealed container such as an ampoule or sachet indicating the quantity of the agent.
- one or more of the pharmaceutical compositions is supplied as a dry sterilized lyophilized powder or water-free concentrate in a hermetically sealed container and can be reconstituted ⁇ e.g., with water or saline) to the appropriate concentration for administration to a subject.
- one or more of the prophylactic or therapeutic agents or pharmaceutical compositions is supplied as a dry sterile lyophilized powder in a hermetically sealed container stored between 2° C and 8° C and administered within 1 hour, within 3 hours, within 5 hours, within 6 hours, within 12 hours, within 24 hours, within 48 hours, within 72 hours, or within one week after being reconstituted.
- Cryoprotectants can be included for a lyophilized dosage form, principally 0-10% sucrose (optimally 0.5-1.0%).
- Other suitable cryoprotectants include trehalose and lactose.
- Suitable bulking agents include glycine and arginine, either of which can be included at a concentration of 0-0.05%, and polysorbate-80 (optimally included at a concentration of 0.005-0.01%)).
- Additional surfactants include but are not limited to polysorbate 20 and BRIJ surfactants.
- the pharmaceutical composition may be prepared as an injectable solution and can further comprise an agent useful as an adjuvant, such as those used to increase absorption or dispersion, e.g., hyaluronidase.
- Another aspect of the invention provides methods of treating a disease associated with hyperphenylalaninemia or symptom(s) associated with
- hyperphenylalaninemia is selected from the group consisting of: phenylketonuria, classical or typical phenylketonuria, atypical phenylketonuria, permanent mild hyperphenylalaninemia, nonphenylketonuric hyperphenylalaninemia, phenylalanine hydroxylase deficiency, cofactor deficiency, dihydropteridine reductase deficiency, tetrahydropterin synthase deficiency, and Segawa's disease.
- hyperphenylalaninemia is secondary to other conditions, e.g., liver diseases.
- the invention provides methods for reducing, ameliorating, or eliminating one or more symptom(s) associated with these diseases, including but not limited to neurological deficits, mental retardation, encephalopathy, epilepsy, eczema, reduced growth, microcephaly, tremor, limb spasticity, and/or hypopigmentation.
- the subject to be treated is a human patient.
- the genetically engineered bacteria are capable of metabolizing phenylalanine in the diet in order to treat a disease or disorder associated with hyperphenylalaninemia, e.g., PKU.
- the genetically engineered bacteria are delivered simultaneously with dietary protein.
- the genetically engineered bacteria are not delivered simulaneously with dietary protein. Studies have shown that pancreatic and other glandular secretions into the intestine contain high levels of proteins, enzymes, and polypeptides, and that the amino acids produced as a result of their catabolism are reabsorbed back into the blood in a process known as "enterorecirculation" (Chang, 2007; Sarkissian et al., 1999).
- high intestinal levels of phenylalanine may be partially independent of food intake, and are available for breakdown by PAL.
- the genetically engineered bacteria and dietary protein are delivered after a period of fasting or phenylalanine-restricted dieting.
- a patient suffering from hyperphenylalaninemia may be able to resume a substantially normal diet, or a diet that is less restrictive than a phenylalanine-free diet.
- the genetically engineered bacteria may be capable of metabolizing phenylalanine from additional sources, e.g., the blood, in order to treat a disease associated with
- hyperphenylalaninemia e.g., PKU.
- the genetically engineered bacteria need not be delivered simultaneously with dietary protein, and a phenylalanine gradient is generated, e.g., from blood to gut, and the genetically engineered bacteria metabolize phenylalanine and reduce phenylalaninemia.
- the method may comprise preparing a pharmaceutical composition with at least one genetically engineered species, strain, or subtype of bacteria described herein, and administering the pharmaceutical composition to a subject in a
- the genetically engineered bacteria of the invention are administered orally, e.g., in a liquid suspension. In some embodiments, the genetically engineered bacteria of the invention are lyophilized in a gel cap and administered orally. In some embodiments, the genetically engineered bacteria of the invention are administered via a feeding tube or gastric shunt. In some embodiments, the genetically engineered bacteria of the invention are administered rectally, e.g., by enema. In some embodiments, the genetically engineered bacteria of the invention are administered topically, intraintestinally, intrajejunally,
- intraduodenally intraileally, and/or intracolically.
- the pharmaceutical composition described herein is administered to reduce phenylalanine levels in a subject.
- the methods of the present disclosure reduce the phenylalanine levels in a subject by at least about 10%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, or more as compared to levels in an untreated or control subject. In some embodiments, reduction is measured by comparing the phenylalanine level in a subject before and after administration of the pharmaceutical composition. In some
- the method of treating or ameliorating hyperphenylalaninemia allows one or more symptoms of the condition or disorder to improve by at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, or more.
- phenylalanine levels in the subject may be measured in a biological sample, such as blood, serum, plasma, urine, peritoneal fluid, cerebrospinal fluid, fecal matter, intestinal mucosal scrapings, a sample collected from a tissue, and/or a sample collected from the contents of one or more of the following: the stomach, duodenum, jejunum, ileum, cecum, colon, rectum, and anal canal.
- the methods may include administration of the compositions of the invention to reduce phenylalanine.
- the methods may include administration of the compositions of the invention to reduce phenylalanine to undetectable levels in a subject.
- the methods may include administration of the compositions of the invention to reduce phenylalanine concentrations to undetectable levels, or to less than about 1%, 2%, 5%, 10%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 75%), or 80%) of the subject's phenylalanine levels prior to treatment.
- the genetically engineered bacteria are E. coli Nissle.
- the genetically engineered bacteria may be destroyed, e.g., by defense factors in the gut or blood serum (Sonnenborn et al., 2009) or by activation of a kill switch, several hours or days after administration.
- the pharmaceutical composition comprising the genetically engineered bacteria may be re-administered at a
- Nissle residence in vivo in mice is shown in Fig. 38.
- the genetically engineered bacteria are not destroyed within hours or days after administration and may propagate and colonize the gut.
- the methods of the invention may comprise administration of the pharmaceutical composition alone or in combination with one or more additional therapeutic agents.
- the pharmaceutical composition is administered in conjunction with the cofactor tetrahydrobiopterin ⁇ e.g.,
- glycomacropeptides a probiotic ⁇ e.g., VSL3
- an enzyme ⁇ e.g., pegylated-PAL
- other agents used in the treatment of phenylketonuria Al Hafid and Christodoulou, 2015.
- the genetically engineered bacteria are administered in combination with one or more recombinantly produced PME enzymes, e.g. recombinant PAL, LAAD or PAH.
- the recombinant enzymes are further formulated for improved stability and/or delivery.
- the one or more PME enzyme administered in combination with the genetically engineered bacteria is peggylated.
- the one or more PME enzyme administered in combination with the genetically engineered bacteria is delivered as a fusion protein.
- a non-limiting example of such a fusion protein is a fusion between a PME and a transduction domain for uptake into cells.
- the one or more PME enzyme administered in combination with the genetically engineered bacteria is formulated in a nanoparticle.
- a nanoparticle is a dextran sulfate/chitosan PME nanoparticle.
- the one or more PME enzyme administered in combination with the genetically engineered bacteria is delivered as a PME microsphere.
- a microsphere is a barium alginate PME microsphere.
- the one or more PME enzyme administered in combination with the genetically engineered bacteria is delivered as amorphous silica PME particles.
- the genetically engineered bacteria are administered in combination with PAL. In some embodiments, the genetically engineered bacteria are administered in combination with PAH. In some embodiments, the genetically engineered bacteria are administered in combination with LAAD. In some embodiments, the genetically engineered bacteria are administered in combination with PAL and PAH. In some embodiments, the genetically engineered bacteria are administered in combination with PAL and LAAD. In some embodiments, the genetically engineered bacteria are administered in combination with PAH and LAAD. In some embodiments, the genetically engineered bacteria are administered in combination with PAL, PAH, and LAAD.
- the genetically engineered bacteria are administered in combination with pegylated PAL. In some embodiments, the genetically engineered bacteria are administered in combination with pegylated PAH. In some embodiments, the genetically engineered bacteria are administered in combination with pegylated LAAD. In some embodiments, the genetically engineered bacteria are administered in combination with a PAL fusion protein, e.g., a cell penetrating peptide. In some embodiments, the genetically engineered bacteria are administered in combination with a PAH fusion protein, e.g., a cell penetrating peptide.
- the genetically engineered bacteria are administered in combination with a LAAD fusion protein, e.g., a cell penetrating peptide. In some embodiments, the genetically engineered bacteria are administered in combination with PAL- nanoparticles. In some embodiments, the genetically engineered bacteria are
- the genetically engineered bacteria are administered in combination with LAAD
- the genetically engineered bacteria are any suitable bacteria.
- the genetically engineered bacteria are any suitable bacteria.
- the genetically engineered bacteria are administered in combination with PAL-microspheres. In some embodiments, the genetically engineered bacteria are administered in combination with PAH- microspheres. In some embodiments, the genetically engineered bacteria are administered in combination with LAAD-microspheres. In some embodiments, the genetically engineered bacteria are administered in combination with PAL-silica particles. In some embodiments, the genetically engineered bacteria are administered in combination with PAH-silica particles. In some embodiments, the genetically engineered bacteria are administered in combination with LAAD-silica particles.
- a recombinant enzyme replacement therapy or substitution therapy e.g. PAL, PAH, and/or LAAD is administered without the genetically engineered bacteria.
- the one or more PME administered is PAL.
- PAL is modified as described in Sakissian et al., 2011, Mol Genet Metab. 2011 Nov; 104(3): 249-254, the contents of which is herein incorporated by reference in its entirety.
- the PAL is Av- p.C503S/p.C565S/p.F18A PAL.
- the PAL is PEG-Av- p.C503S/p.C565S/p.F18A PAL.
- the PAL is PEGylated. In one embodiment, the pegylated PAL is from Anabaena variabilis. In one embodiment, the pegylated PAL is from Photorhabdus luminescens. In some embodiments, the one or more PME administered is PAH. In one embodiment, PAH is human PAH. In some embodiments, the one or more PME administered is LAAD. In one embodiment, the LAAD protein administered is derived from Proteus mirabilis. In some embodiments, the one or more PME administered in combination with PAL and PAH. In some embodiments, the one or more PME administered is PAL and LAAD. In some embodiments, the one or more PME administered is PAH and LAAD. In some embodiments, the one or more PME administered is PAL, PAH, and LAAD. In some embodiments, the one or more PME administered is PAL, PAH, and LAAD. In some embodiments, the one or more PME administered is PAL, PAH, and LAAD.
- the recombinant enzymes are further formulated for improved stability and/or delivery.
- the one or more PME enzyme administered is peggylated.
- the one or more PME enzyme administered is delivered as a fusion protein.
- a non-limiting example of such a fusion protein is a fusion between a PME and a transduction domain for uptake into cells.
- a non-limiting example of such transduction domain or cell penetrating peptide is the TAT peptide.
- the one or more PME enzyme administered is formulated in a nanoparticle.
- a non-limiting example of such a nanoparticle is a dextran sulfate/chitosan PME nanoparticle.
- the one or more PME enzyme administered is delivered as a PME microsphere.
- a microsphere is a barium alginate PME microsphere.
- the one or more PME enzyme administered is delivered as amorphous silica PME particles.
- pegylated PAL is administered.
- pegylated LAAD is administered.
- peggylated LAAD from Proteus mirabilis is administered.
- pegylated PAH is administered.
- a PAL fusion protein e.g., with a cell penetrating peptide
- a LAAD fusion protein e.g., with a cell penetrating peptide
- a PAH fusion protein e.g., with a cell penetrating peptide
- PAL- nanoparticles are administered.
- PAH-nanoparticles are administered.
- LAAD-nanoparticles are administered.
- PAL-microspheres are administered.
- PAH- microspheres are administered.
- LAAD-microspheres are administered.
- PAL-silica particles are administered.
- PAH-silica particles are administered.
- LAAD- silica particles are administered.
- the PME e.g., PAH, PAL, and/or LAAD is formulated with aprotinin, e.g., 40 mg/ml aprotinin.
- the PMEs are delivered as gene therapy.
- a CRISPR technology is used.
- a gene therapy vector is used to deliver the one or more PME, e.g., PAL, LAAD, and/or PAH.
- Gene therapy vectors are known in the art and include, but are not limited to, retroviral vectors, adenoviral vectors, adeno-associated viral vectors. Alternatively, formulated or naked PME gene DNA or RNA can be delivered.
- the agent(s) should be compatible with the genetically engineered bacteria of the invention, e.g., the agent(s) must not interfere with or kill the bacteria.
- the pharmaceutical composition is administered with food. In alternate embodiments, the pharmaceutical composition is administered before or after eating food.
- the pharmaceutical composition may be administered in combination with one or more dietary modifications, e.g., low-phenylalanine diet.
- the dosage of the pharmaceutical composition and the frequency of administration may be selected based on the severity of the symptoms and the progression of the disease. The appropriate therapeutically effective dose and/or frequency of administration can be selected by a treating clinician.
- kits comprising the
- the kit can include one or more other elements including, but not limited to: instructions for use; other reagents, e.g., a label, an additional therapeutic agent; devices or materials for measuring phenylalanine levels, or levels of other molecules or metabolites associated with hyperphenylalaninemia, in a subject; devices or other materials for preparing the pharmaceutical composition of the invention for administration; and devices or other materials for administration to a subject.
- Instructions for use can include guidance for therapeutic application, such as suggested dosages and/or modes of administration, e.g., in a patient with
- the kit can further contain at least one additional therapeutic agent, and/or one or more additional genetically engineered bacterial strains of the invention, formulated as appropriate, in one or more separate pharmaceutical preparations.
- the kit is used for administration of the pharmaceutical composition to a subject. In some embodiments, the kit is used for administration of the pharmaceutical composition, alone or in combination with one or more additional therapeutic agents, to a subject. In some embodiments, the kit is used for measuring phenylalanine levels (e.g., blood phenylalanine levels) in a subject before, during, or after administration of the pharmaceutical composition to the subject. In certain embodiments, the kit is used for administration and/or re-administration of the pharmaceutical composition, alone or in combination with one or more additional therapeutic agents, when blood phenylalanine levels are increased or abnormally high.
- phenylalanine levels e.g., blood phenylalanine levels
- a diagnostic signal of hyperphenylalaninemia is a blood phenylalanine level of at least 2 mg/dL, at least 4 mg/dL, at least 6 mg/dL, at least 8 mg/dL, at least 10 mg/dL, at least 12 mg/dL, at least 14 mg/dL, at least 16 mg/dL, at least 18 mg/dL, at least 20 mg/dL, or at least 25 mg/dL.
- Table 20 shows non-limiting examples of target degradation rates, based on levels of phenylalanine on average in classical PKU patients.
- the genetically engineered bacteria achieve a target degradation rate of about 0.15 to about 8.01 ⁇ 1/10 9 CFUs/hr. In some embodiments, the genetically engineered bacteria achieve a target degradation rate of about 0.15 to about 2 ⁇ 1/10 9 CFUs/hr. In some embodiments, the genetically engineered bacteria achieve a target degradation rate of about 0.6 to about 8.01 ⁇ /10 9 CFUs/hr. In some embodiments, the genetically engineered bacteria achieve a target degradation rate of about 0.2 to about 2.67 ⁇ 1/10 9 CFUs/hr.
- the genetically engineered bacteria achieve a target degradation rate of about 0.15 to about 0.6 ⁇ 1/10 9 CFUs/hr. In some embodiments, the genetically engineered bacteria achieve a target degradation rate of about 0.22 to about 0.9 ⁇ 1/10 9 CFUs/hr. In some embodiments, the genetically engineered bacteria achieve a target degradation rate of about 0.3 to about 1.21 ⁇ /10 9 CFUs/hr. In some embodiments, the genetically engineered bacteria achieve a target degradation rate of about 0.54 to about 2.16 ⁇ 1/10 9 CFUs/hr. In some embodiments, the genetically engineered bacteria achieve a target degradation rate of about 1.13 to about 4.53 ⁇ 1/10 9 CFUs/hr.
- the genetically engineered bacteria achieve a target degradation rate of about 1.84 to about 7.38 ⁇ /10 9 CFUs/hr. In some embodiments, the genetically engineered bacteria achieve a target degradation rate of about 1.61 to about 6.43 ⁇ 1/10 9 CFUs/hr. In some embodiments, the genetically engineered bacteria achieve a target degradation rate of about 2 to about 8.01 ⁇ /10 9 CFUs/hr.
- the genetically engineered bacteria achieve a target degradation rate of about 0.1 to about 1 ⁇ 1/10 9 CFUs/hr. In some embodiments,
- the genetically engineered bacteria achieve a target degradation rate of about 1 to about 2 ⁇ 1/10 9 CFUs/hr. In some embodiments, the genetically engineered bacteria achieve a target degradation rate of about 2 to about 3 ⁇ 1/10 9 CFUs/hr. In some embodiments, the genetically engineered bacteria achieve a target degradation rate of about 3 to about 4 ⁇ 1/10 9 CFUs/hr. In some embodiments, the genetically engineered bacteria achieve a target degradation rate of about 4 to about 5 ⁇ 1/10 9 CFUs/hr. In some embodiments, the genetically engineered bacteria achieve a target degradation rate of about 5 to about 6 ⁇ 1/10 9 CFUs/hr.
- the genetically engineered bacteria achieve a target degradation rate of about 6 to about 7 ⁇ /10 9 CFUs/hr. In some embodiments, the genetically engineered bacteria achieve a target degradation rate of about 7 to about 8 ⁇ 1/10 9 CFUs/hr.
- the genetically engineered bacteria achieve a target reduction rate of less than 0.15 ⁇ 1/10 9 CFUs/hr. In some embodiments, the genetically engineered bacteria achieve a target degradation rate of greater than 8.01 ⁇ /10 9 CFUs/hr.
- the genetically engineered bacteria achieve a target reduction of between about 178 mg and 2382 mg. In some embodiments, the genetically engineered bacteria achieve a target reduction of 1.08 mmol to 14.42 mmol. In some embodiments, the reduction is less than 1.08 mmol. In some embodiments, the reduction is greater than 14.42 mmol.
- target reduction and target degradation rates are based on classical PKU phenylalanine levels. In some embodiments, the target reduction and target degradation rates are based on phenylalanine levels observed in mild PKU. In some embodiments, target reduction and target degradation rates are based on phenylalanine levels observed in mild hyperphenylalaninemia. Treatment In Vivo
- the genetically engineered bacteria of the invention may be evaluated in vivo, e.g., in an animal model.
- Any suitable animal model of a disease or condition associated with hyperphenylalaninemia may be used ⁇ see, e.g., Sarkissian et al., 1999).
- the animal model is a mouse model of PKU.
- the mouse model of PKU is an PAH mutant BTBR mouse (BTBR- Pah enu2 , Jackson Laboratories).
- the mouse model contains a chemically (ENU)-induced homozygous missense mutation (T835C) in exon 7 of the Pah gene, which results in a phenylalanine to serine substitution at amino acid 263 (F263S).
- This residue is located in the active site of the PAH enzyme, as shown by crystal structure analysis, and results in the complete loss of PAH activity.
- these mutant mice demonstrate a 10- to 20-fold increase in serum phenylalanine levels compared to unaffected controls.
- the genetically engineered bacteria of the invention may be administered to the animal, e.g., by oral gavage, and treatment efficacy is determined, e.g., by measuring blood phenylalanine and/or cinnamate before and after treatment.
- treatment efficacy is determined, e.g., by measuring blood phenylalanine and/or cinnamate before and after treatment.
- residence time of the genetically engineered bacteria within the GI tract may be shorter than residence time in humans.
- the animal may be sacrificed, and tissue samples may be collected and analyzed.
- pharmacokinetics and pharmacodynamic studies may be conducted in non-human primates to determine any potential toxicities arising from administration of the genetically engineered bacteria, the pharmacokinetics and pharmacodynamics of the genetically engineered bacteria. Non-limiting examples of such studies are described in Examples 30 and 31.
- the genetically engineered bacteria expressing LAAD can be specifically detected in the feces and differentiated from other E. coli strains.
- a Phenylalanine Deaminase Test "Phenylalanine Agar Slant" can be used for this purpose. Phenylalanine agar used to determine whether the microbe can use phenylalanine and convert it to phenyl pyruvate. When the test chemicals are added to the tube containing the sample on the phenylalanine agar, phenylpyruvate is converted to a green compound, indicating a positive test. Wild type E. coli does not produce phenylpyruvate, since they do not encode an enzyme, which can produce
- the genetically engineered bacteria can be differentiated from other bacterial species which are able to produce phenylpyruvate by PCR-based tests known in the art.
- species specific sequences can be amplified.
- universal PCR that amplifies conserved regions in various bacteria is ideal to detect any pathogen in screening of specimens.
- the conserved region of the 16S rRNA gene can be used as a target gene for the universal PCR; the 16S rRNA gene contains species-specific regions by which a large number of bacterial species can be
- the Phenylalanine Deaminase Test can be used to detect the genetically engineered bacteria in a feces sample.
- PCR-based tests can be conducted to differentiate the genetically engineered bacteria from other bacterial species.
- a genetically engineered strain may be improved upon by using screening and selection methods, e.g., to increase PME enzymatic activity or to increase the ability of a strain to take up phenylalanine.
- the screen serves to generate a bacterial strain with improved PME activity.
- the screen serves to generate a bacterial strain which has improved phenylalanine uptake ability.
- the screen may identify a bacterial strain with both improved PME activity and enhanced substrate import. Non- limiting examples of methods of screening which can be used are described herein.
- ALE Adaptive laboratory evolution
- An auxotroph is a strain incapable of synthesizing an essential metabolite and must therefore have the metabolite provided in the media to grow. In this scenario, by making an auxotroph and passaging it on decreasing amounts of the metabolite, the resulting dominant strains should be more capable of obtaining and incorporating this essential metabolite.
- a strain capable of high-affinity capture of said amino acid can be evolved via ALE.
- the strain is grown in varying concentrations of the auxotrophic amino acid, until a minimum concentration to support growth is established. The strain is then passaged at that concentration, and diluted into lowering concentrations of the amino acid at regular intervals. Over time, cells that are most competitive for the amino acid - at growth-limiting concentrations - will come to dominate the population. These strains will likely have mutations in their amino acid-transporters resulting in increased ability to import the essential and limiting amino acid.
- a strain can be evolved that not only can more efficiently import the upstream metabolite, but also convert the metabolite into the essential downstream metabolite.
- These strains will also evolve mutations to increase import of the upstream metabolite, but may also contain mutations which increase expression or reaction kinetics of downstream enzymes, or that reduce competitive substrate utilization pathways.
- a metabolite innate to the microbe was made essential via mutational auxotrophy and selection was applied with growth-limiting supplementation of the endogenous metabolite.
- phenotypes capable of consuming non-native compounds can be evolved by tying their consumption to the production of an essential compound. For example, if a gene from a different organism is isolated which can produce an essential compound or a precursor to an essential compound this gene can be recombinantly introduced and expressed in the heterologous host. This new host strain will now have the ability to synthesize an essential nutrient from a previously non-metabolizable substrate.
- a similar ALE process can be applied by creating an auxotroph incapable of converting an immediately downstream metabolite and selecting in growth-limiting amounts of the non-native compound with concurrent expression of the recombinant enzyme. This will result in mutations in the transport of the non-native substrate, expression and activity of the heterologous enzyme and expression and activity of downstream native enzymes. It should be emphasized that the key requirement in this process is the ability to tether the consumption of the non-native metabolite to the production of a metabolite essential to growth.
- the cells should be diluted, isolated on solid media and assayed for growth phenotypes matching that of the culture flask. Best performers from those selected are then prepped for genomic DNA and sent for whole genome sequencing. Sequencing with reveal mutations occurring around the genome capable of providing improved phenotypes, but will also contain silent mutations (those which provide no benefit but do not detract from desired phenotype). In cultures evolved in the presence of NTG or other chemical mutagen, there will be significantly more silent, background mutations. If satisfied with the best performing strain in its current state, the user can proceed to application with that strain. Otherwise the contributing mutations can be deconvoluted from the evolved strain by
- the ALE method can be used to identify genetically engineered bacteria with improved phenylalanine uptake.
- Toxic phenylalanine analogs exert their mechanism of action (MO A) by being incorporated into cellular protein, causing cell death.
- MO A mechanism of action
- These compounds such as paralog p-fluoro-DL-phenylalanine and ortholog o-fluoro-DL-phenylalanine have utility in an untargeted approach to select PAL enzymes with increased activity. Assuming that these toxic compounds can be metabolized by PAL into a non-toxic metabolite, rather than being incorporated into cellular protein, genetically engineered bacteria which have improved phenylalanine degradation activity can tolerate higher levels of these compounds, and can be screened for and selected on this basis.
- aeruginosa requires a novel CRP/F R-r elated transcriptional regulator, DNR, in addition to A R. FEBS Lett. 1995 Aug 28;371(l):73-76. PMID: 7664887;
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Genetics & Genomics (AREA)
- General Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- Medicinal Chemistry (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- Microbiology (AREA)
- General Engineering & Computer Science (AREA)
- Biotechnology (AREA)
- Biomedical Technology (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Mycology (AREA)
- Epidemiology (AREA)
- Biophysics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Immunology (AREA)
- Plant Pathology (AREA)
- Physics & Mathematics (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Obesity (AREA)
- Hematology (AREA)
- Diabetes (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Enzymes And Modification Thereof (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (38)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP16728448.8A EP3294760B1 (en) | 2015-05-13 | 2016-05-13 | Bacteria engineered to reduce hyperphenylalaninemia |
| JP2017559428A JP6843768B2 (ja) | 2015-05-13 | 2016-05-13 | 高フェニルアラニン血症を低減させるように操作された細菌 |
| EP16724834.3A EP3294757B1 (en) | 2015-05-13 | 2016-05-13 | Bacteria engineered to treat a disease or disorder |
| NZ737318A NZ737318B2 (en) | 2016-05-13 | Bacteria engineered to reduce hyperphenylalaninemia | |
| PCT/US2016/032565 WO2016183532A1 (en) | 2015-05-13 | 2016-05-13 | Bacteria engineered to treat a disease or disorder |
| IL296538A IL296538A (en) | 2015-05-13 | 2016-05-13 | A genetically engineered bacterium to lower hyperphenylamine |
| EP21156322.6A EP3882259B1 (en) | 2015-05-13 | 2016-05-13 | Bacteria engineered to reduce hyperphenylalaninemia |
| PL16728448T PL3294760T3 (pl) | 2015-05-13 | 2016-05-13 | Zmodyfikowane bakterie do redukowania hiperfenyloalaninemii |
| US15/319,564 US9889164B2 (en) | 2014-12-05 | 2016-05-13 | Bacteria engineered to treat a disease or disorder |
| AU2016262569A AU2016262569B9 (en) | 2015-05-13 | 2016-05-13 | Bacteria engineered to reduce hyperphenylalaninemia |
| ES16728448T ES2881384T3 (es) | 2015-05-13 | 2016-05-13 | Bacterias manipuladas para reducir la hiperfenilalaninemia |
| US15/301,324 US10195234B2 (en) | 2015-05-13 | 2016-05-13 | Bacteria engineered to reduce hyperphenylalaninemia |
| CA2985819A CA2985819A1 (en) | 2015-05-13 | 2016-05-13 | Bacteria engineered to reduce hyperphenylalaninemia |
| BR112017024384A BR112017024384A2 (pt) | 2015-05-13 | 2016-05-13 | bactérias modificadas para reduzir hiperfenilalaninemia |
| US15/775,936 US11618894B2 (en) | 2015-11-16 | 2016-11-16 | Bacteria engineered to reduce hyperphenylalaninemia |
| EP22167588.7A EP4095150A1 (en) | 2015-11-16 | 2016-11-16 | Bacteria engineered to reduce hyperphenylalaninemia |
| PCT/US2016/062369 WO2017087580A1 (en) | 2015-11-16 | 2016-11-16 | Bacteria engineered to reduce hyperphenylalaninemia |
| EP16810138.4A EP3377518B1 (en) | 2015-11-16 | 2016-11-16 | Bacteria engineered to reduce hyperphenylalaninemia |
| AU2016356684A AU2016356684C1 (en) | 2015-11-16 | 2016-11-16 | Bacteria engineered to reduce hyperphenylalaninemia |
| PL16810138.4T PL3377518T3 (pl) | 2015-11-16 | 2016-11-16 | Bakterie modyfikowane do celów zmniejszenia hiperfenyloalaninemii |
| CA3005451A CA3005451C (en) | 2015-11-16 | 2016-11-16 | Bacteria engineered to reduce hyperphenylalaninemia |
| ES16810138T ES2925049T3 (es) | 2015-11-16 | 2016-11-16 | Bacterias manipuladas para reducir la hiperfenilalaninemia |
| JP2018526505A JP6993970B2 (ja) | 2015-11-16 | 2016-11-16 | 高フェニルアラニン血症を低減させるように操作された細菌 |
| US16/069,199 US20190282628A1 (en) | 2016-01-11 | 2017-01-11 | Recombinant bacteria engineered to treat diseases and disorders associated with amino acid metabolism and methods of use thereof |
| PCT/US2017/013074 WO2017123676A1 (en) | 2016-01-11 | 2017-01-11 | Recombinant bacteria engineered to treat diseases and disorders associated with amino acid metabolism and methods of use thereof |
| IL255616A IL255616B2 (en) | 2015-05-13 | 2017-11-12 | Bacteria engineered to reduce hyperphenylalaninemia |
| ZA2017/07678A ZA201707678B (en) | 2015-05-13 | 2017-11-13 | Bacteria engineered to reduce hyperphenylalaninemia |
| US15/852,762 US10933102B2 (en) | 2015-05-13 | 2017-12-22 | Bacteria engineered to treat a disease or disorder |
| US17/124,661 US11883439B2 (en) | 2015-05-13 | 2020-12-17 | Bacteria engineered to treat a disease or disorder |
| AU2021212141A AU2021212141B2 (en) | 2015-05-13 | 2021-08-06 | Bacteria engineered to reduce hyperphenylalaninemia |
| JP2021200761A JP7245312B2 (ja) | 2015-11-16 | 2021-12-10 | 高フェニルアラニン血症を低減させるように操作された細菌 |
| AU2022201838A AU2022201838B2 (en) | 2015-11-16 | 2022-03-16 | Bacteria engineered to reduce hyperphenylalaninemia |
| US18/068,004 US20240076645A1 (en) | 2015-11-16 | 2022-12-19 | Bacteria engineered to reduce hyperphenylalaninemia |
| JP2023037499A JP7494345B2 (ja) | 2015-11-16 | 2023-03-10 | 高フェニルアラニン血症を低減させるように操作された細菌 |
| US18/537,897 US20240382536A1 (en) | 2015-05-13 | 2023-12-13 | Bacteria engineered to treat a disease or disorder |
| JP2024083082A JP7813312B2 (ja) | 2015-11-16 | 2024-05-22 | 高フェニルアラニン血症を低減させるように操作された細菌 |
| AU2024278562A AU2024278562A1 (en) | 2015-05-13 | 2024-12-18 | Bacteria engineered to reduce hyperphenylalaninemia |
| AU2025202726A AU2025202726A1 (en) | 2015-11-16 | 2025-04-17 | Bacteria engineered to reduce hyperphenylalaninemia |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201562161137P | 2015-05-13 | 2015-05-13 | |
| US62/161,137 | 2015-05-13 | ||
| US201562256052P | 2015-11-16 | 2015-11-16 | |
| US62/256,052 | 2015-11-16 |
Related Parent Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2016/020530 Continuation-In-Part WO2016141108A1 (en) | 2014-12-05 | 2016-03-02 | Bacteria engineered to treat diseases that benefit from reduced gut inflammation and/or tightened gut mucosal barrier |
Related Child Applications (5)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US14/960,333 Continuation-In-Part US9487764B2 (en) | 2014-12-05 | 2015-12-04 | Bacteria engineered to treat diseases associated with hyperammonemia |
| PCT/US2016/020530 Continuation-In-Part WO2016141108A1 (en) | 2014-12-05 | 2016-03-02 | Bacteria engineered to treat diseases that benefit from reduced gut inflammation and/or tightened gut mucosal barrier |
| US15/154,934 Continuation-In-Part US10610546B2 (en) | 2014-12-05 | 2016-05-13 | Bacteria engineered to reduce hyperphenylalaninemia |
| PCT/US2016/062369 Continuation-In-Part WO2017087580A1 (en) | 2015-11-16 | 2016-11-16 | Bacteria engineered to reduce hyperphenylalaninemia |
| US15/775,936 Continuation-In-Part US11618894B2 (en) | 2015-11-16 | 2016-11-16 | Bacteria engineered to reduce hyperphenylalaninemia |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2016183531A1 true WO2016183531A1 (en) | 2016-11-17 |
Family
ID=56117975
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2016/032562 Ceased WO2016183531A1 (en) | 2014-12-05 | 2016-05-13 | Bacteria engineered to reduce hyperphenylalaninemia |
Country Status (12)
| Country | Link |
|---|---|
| US (6) | US10610546B2 (cg-RX-API-DMAC7.html) |
| EP (2) | EP3882259B1 (cg-RX-API-DMAC7.html) |
| JP (3) | JP6843768B2 (cg-RX-API-DMAC7.html) |
| AU (3) | AU2016262569B9 (cg-RX-API-DMAC7.html) |
| BR (1) | BR112017024384A2 (cg-RX-API-DMAC7.html) |
| CA (1) | CA2985819A1 (cg-RX-API-DMAC7.html) |
| ES (1) | ES2881384T3 (cg-RX-API-DMAC7.html) |
| IL (2) | IL296538A (cg-RX-API-DMAC7.html) |
| PL (1) | PL3294760T3 (cg-RX-API-DMAC7.html) |
| SG (1) | SG10202003100XA (cg-RX-API-DMAC7.html) |
| WO (1) | WO2016183531A1 (cg-RX-API-DMAC7.html) |
| ZA (1) | ZA201707678B (cg-RX-API-DMAC7.html) |
Cited By (16)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2017087580A1 (en) * | 2015-11-16 | 2017-05-26 | Synlogic, Inc. | Bacteria engineered to reduce hyperphenylalaninemia |
| WO2018191715A3 (en) * | 2017-04-14 | 2018-12-06 | Synthetic Genomics, Inc. | Polypeptides with type v crispr activity and uses thereof |
| WO2018237198A1 (en) | 2017-06-21 | 2018-12-27 | Synlogic Operating Company, Inc. | BACTERIA FOR THE TREATMENT OF DISORDERS |
| US10195234B2 (en) | 2015-05-13 | 2019-02-05 | Synlogic Operating Company, Inc. | Bacteria engineered to reduce hyperphenylalaninemia |
| WO2019104759A1 (zh) * | 2017-11-30 | 2019-06-06 | 江南大学 | 一种热稳定性提高的l-氨基酸脱氨酶突变体及其构建方法 |
| WO2020223345A1 (en) | 2019-04-29 | 2020-11-05 | Antipov Eugene | Enumeration of genetically engineered microorganisms by live cell counting techniques |
| JP2021505197A (ja) * | 2017-12-05 | 2021-02-18 | バイオピーエルエックス,インコーポレイティド | 微生物感染を防ぐための方法および組成物 |
| WO2021144473A2 (en) | 2020-01-17 | 2021-07-22 | Université Catholique de Louvain | Genetically modified bacterium with altered envelop integrity and uses thereof |
| WO2021188819A1 (en) * | 2020-03-20 | 2021-09-23 | Synlogic Operating Company, Inc. | Microorganisms engineered to reduce hyperphenylalaninemia |
| WO2022120028A2 (en) | 2020-12-02 | 2022-06-09 | Synlogic Operating Company, Inc. | Engineered microorganisms |
| US11458172B2 (en) | 2017-09-08 | 2022-10-04 | New Portal Limited | Nucleic acid systems that enable bacteria to specifically target solid tumors via glucose-dependent viability |
| WO2023165521A1 (zh) * | 2022-03-02 | 2023-09-07 | 和度生物技术(上海)有限公司 | 一种用于治疗高苯丙氨酸血症的工程微生物及其用途 |
| US20230332164A1 (en) * | 2020-09-30 | 2023-10-19 | Synlogic Operating Company, Inc. | Bacteria engineered to secrete active proteins |
| US11845964B2 (en) | 2014-12-05 | 2023-12-19 | Synlogic Operating Company, Inc. | Bacteria engineered to treat diseases associated with hyperammonemia |
| EP3294757B1 (en) * | 2015-05-13 | 2023-12-27 | Synlogic Operating Company, Inc. | Bacteria engineered to treat a disease or disorder |
| US12491236B2 (en) | 2020-07-07 | 2025-12-09 | New Portal Limited | Genetically engineered live bacteria and methods of constructing the same |
Families Citing this family (33)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| MA39819A (fr) | 2014-04-01 | 2017-02-08 | Rubius Therapeutics Inc | Méthodes et compositions d'immunomodulation |
| US20160206666A1 (en) | 2014-12-22 | 2016-07-21 | Synlogic, Inc. | Bacteria engineered to treat diseases that benefit from reduced gut inflammation and/or tighten gut mucosal barrier |
| EP3711488A1 (en) | 2015-05-06 | 2020-09-23 | Snipr Technologies Limited | Altering microbial populations & modifying microbiota |
| US11883439B2 (en) | 2015-05-13 | 2024-01-30 | Synlogic Operating Company, Inc. | Bacteria engineered to treat a disease or disorder |
| US11685925B2 (en) | 2015-10-30 | 2023-06-27 | Synlogic Operating Company, Inc. | Bacteria engineered to treat diseases that benefit from reduced gut inflammation and/or tightened gut mucosal barrier |
| US9988624B2 (en) | 2015-12-07 | 2018-06-05 | Zymergen Inc. | Microbial strain improvement by a HTP genomic engineering platform |
| US11208649B2 (en) | 2015-12-07 | 2021-12-28 | Zymergen Inc. | HTP genomic engineering platform |
| US11566238B2 (en) | 2016-12-15 | 2023-01-31 | The Board Of Trustees Of The Leland Stanford Junior University | Compositions and methods for modulating growth of a genetically modified gut bacterial cell |
| US11384358B2 (en) | 2017-03-29 | 2022-07-12 | President And Fellows Of Harvard College | Method of regulating gene expression in a cell |
| US10849938B2 (en) | 2017-09-13 | 2020-12-01 | ZBiotics Company | Gene expression system for probiotic microorganisms |
| US12331320B2 (en) | 2018-10-10 | 2025-06-17 | The Research Foundation For The State University Of New York | Genome edited cancer cell vaccines |
| US12421518B2 (en) | 2018-12-10 | 2025-09-23 | Tenza, Inc. | Methods and compositions for treating hyperoxaluria |
| WO2020132017A1 (en) * | 2018-12-20 | 2020-06-25 | University Of South Carolina | Pharmabiotic treatments for metabolic disorders |
| CA3142608A1 (en) | 2019-06-04 | 2020-12-10 | Cocoon Biotech Inc. | Silk-based products, formulations, and methods of use |
| JP2022537214A (ja) * | 2019-06-21 | 2022-08-24 | ギンゴー バイオワークス, インコーポレイテッド | メープルシロップ尿症(msud)の処置のおける使用のための酵素の生合成 |
| CN110257291B (zh) * | 2019-06-25 | 2021-07-23 | 北京大学 | 一株耐受镍离子毒性的无色杆菌及其应用 |
| CA3156035A1 (en) | 2019-09-27 | 2021-04-01 | Intrexon Actobiotics Nv D/B/A Precigen Actobio | Treatment of celiac disease |
| JP2023501539A (ja) | 2019-11-12 | 2023-01-18 | アクティム・セラピューティクス・インコーポレイテッド | 免疫刺激細菌デリバリープラットフォーム、および治療用産物のデリバリーのためのその使用 |
| US20230105474A1 (en) * | 2020-02-25 | 2023-04-06 | Synlogic Operating Company, Inc. | Recombinant bacteria engineered to treat diseases associated with uric acid and methods of use thereof |
| WO2021207647A1 (en) * | 2020-04-09 | 2021-10-14 | Computational International LLC | Small molecule drugs as targeted therapeutics |
| WO2022006424A2 (en) * | 2020-07-02 | 2022-01-06 | The Regents Of The University Of Californa | Persistent memory t-cell responses to cancer and infectious-disease antigens by manipulation of amino acid-catabolism pathways |
| IL300447A (en) | 2020-08-12 | 2023-04-01 | Actym Therapeutics Inc | Bacteria-based ingredients that stimulate the immune system, treatments and platforms for delivering RNA |
| IL302604A (en) * | 2020-11-10 | 2023-07-01 | Palena Therapeutics Inc | Epitope-Encapsulated Random Peptide (EERP) Preparations for the Treatment of Immune-Mediated Conditions and Methods of Use |
| CN112501098B (zh) * | 2020-12-11 | 2023-01-03 | 上海陶宇晟生物技术有限责任公司 | 具有降解苯丙氨酸能力的工程益生菌 |
| CN116847860A (zh) | 2020-12-31 | 2023-10-03 | 同生运营公司 | 经工程化以减轻高苯丙氨酸血症的微生物 |
| CN112662606A (zh) * | 2021-01-06 | 2021-04-16 | 中国科学院分子植物科学卓越创新中心 | 用于治疗苯丙酮尿症的工程益生菌 |
| CN112662607A (zh) * | 2021-01-07 | 2021-04-16 | 上海陶宇晟生物技术有限责任公司 | 具备表面展示苯丙氨酸解氨酶的工程益生菌 |
| JP2024526149A (ja) * | 2021-06-24 | 2024-07-17 | ロンザ・グリーンウッド・エルエルシー | 消化管への活性物質の投与を制御する方法 |
| WO2023086796A2 (en) | 2021-11-09 | 2023-05-19 | Actym Therapeutics, Inc. | Immunostimulatory bacteria for converting macrophages into a phenotype amenable to treatment, and companion diagnostic for identifying subjects for treatment |
| CN114717172B (zh) * | 2022-03-21 | 2022-09-23 | 江南大学 | 合成l-缬氨酸的大肠杆菌及其构建方法与应用 |
| GB202209518D0 (en) | 2022-06-29 | 2022-08-10 | Snipr Biome Aps | Treating & preventing E coli infections |
| CN116463362B (zh) * | 2023-06-15 | 2023-09-19 | 中国中医科学院中药研究所 | 一种细胞分裂抑制剂的制备方法 |
| WO2025170927A1 (en) * | 2024-02-06 | 2025-08-14 | The Cleveland Clinic Foundation | Kynurenine responsive bacteria and cancer therapies |
Citations (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5589168A (en) | 1991-04-08 | 1996-12-31 | Unilever Patent Holdings B.V. | Probiotic |
| US5989463A (en) | 1997-09-24 | 1999-11-23 | Alkermes Controlled Therapeutics, Inc. | Methods for fabricating polymer-based controlled release devices |
| US6203797B1 (en) | 1998-01-06 | 2001-03-20 | Stephen C. Perry | Dietary supplement and method for use as a probiotic, for alleviating the symptons associated with irritable bowel syndrome |
| US20030166191A1 (en) | 1998-12-02 | 2003-09-04 | Timothy Gardner | Bistable genetic toggle switch |
| US6835376B1 (en) | 1999-03-11 | 2004-12-28 | Nestec S.A. | Lactobacillus paracasei strain for preventing diarrhea caused by pathogenic bacteria |
| US7731976B2 (en) | 2003-08-29 | 2010-06-08 | Cobb And Company, Llp | Treatment of irritable bowel syndrome using probiotic composition |
| WO2013192543A2 (en) * | 2012-06-22 | 2013-12-27 | Phytogene, Inc. | Enzymes and methods for styrene synthesis |
| WO2014018832A1 (en) * | 2012-07-27 | 2014-01-30 | University Of North Texas | Genetically modified probiotic for the treatment of phenylketonuria (pku) disease |
| WO2014066945A1 (en) * | 2012-11-01 | 2014-05-08 | The Sydney Children's Hospital Network (Randwick & Westmead) | Genetically-modified probiotic for treatment of phenylketonuria |
Family Cites Families (42)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN1154845A (zh) | 1996-09-09 | 1997-07-23 | 首都医学院附属北京红十字朝阳医院 | 能表达活性苯丙氨酸脱氨酶的基因工程菌口服制剂 |
| JP4682454B2 (ja) | 2000-06-28 | 2011-05-11 | 味の素株式会社 | 新規変異型n−アセチルグルタミン酸合成酵素及びl−アルギニンの製造法 |
| AUPQ899700A0 (en) | 2000-07-25 | 2000-08-17 | Borody, Thomas Julius | Probiotic recolonisation therapy |
| DK1383897T3 (da) | 2001-05-03 | 2006-10-30 | Vlaams Interuniv Inst Biotech | Selv-containing Lactococcus-stamme |
| US7314974B2 (en) | 2002-02-21 | 2008-01-01 | Monsanto Technology, Llc | Expression of microbial proteins in plants for production of plants with improved properties |
| JP4452914B2 (ja) | 2003-09-08 | 2010-04-21 | 味の素株式会社 | 新規トランスポータタンパク質 |
| EP2080769A3 (en) | 2004-07-02 | 2010-12-01 | Metanomics GmbH | Process for the production of fine chemicals |
| WO2006034373A2 (en) | 2004-09-17 | 2006-03-30 | Biomarin Pharmaceutical Inc. | Variants and chemically-modified variants of phenylalanine ammonia-lyase |
| ZA200704766B (en) | 2004-11-30 | 2008-09-25 | Aeras Global Tb Vaccine Found | Bacterial packaging strains useful for generation and production of recombinant double-stranded RNA nucleocapsids and uses thereof |
| GB0501540D0 (en) | 2005-01-25 | 2005-03-02 | Univ Leeds | Controlled production and delivery of biologically active agents by gut bacteria |
| EP2886658A1 (en) | 2005-03-10 | 2015-06-24 | BASF Enzymes LLC | Lyase enzymes, nucleic acids encoding them and methods for making and using them |
| WO2008118176A2 (en) | 2006-06-02 | 2008-10-02 | Verenium Corporation | Lase enzymes, nucleic acids encoding them and methods for making and using them |
| TW200819540A (en) | 2006-07-11 | 2008-05-01 | Genelux Corp | Methods and compositions for detection of microorganisms and cells and treatment of diseases and disorders |
| US9084434B2 (en) | 2006-09-27 | 2015-07-21 | Little Calumet Holdings Llc | Probiotic oral dosage forms |
| US20100297249A1 (en) | 2007-07-05 | 2010-11-25 | North-West University | Enhancement of the efficacy of therapeutic proteins |
| CN101586111B (zh) * | 2008-05-22 | 2012-03-07 | 北京三元基因工程有限公司 | 一种活性乳酸乳球菌制品的制备方法 |
| EP3181682B1 (en) | 2008-09-29 | 2021-04-21 | Intrexon Actobiotics NV | Reduced colonization of microbes at the mucosa |
| MX2012001508A (es) | 2009-08-04 | 2013-05-30 | Evogene Ltd | Polinucleotidos y polipeptidos aislados, y metodos para utilizarlos para mejorar la tolerancia al estres abiotico, rendimiento, tasa de crecimiento, vigor, biomasa, contenido de aceite y/o eficacia en el uso de nitrogeno de las plantas. |
| WO2011080505A2 (en) | 2009-12-28 | 2011-07-07 | Bigdna Ltd | Method of growing phage for commercial use |
| BR112012022054A2 (pt) | 2010-03-02 | 2015-09-15 | Functional Technologies Corp | microorganismo transformado, método de redução de asparagina durante o preparo ou processamento de alimento, médtodo de redução de acrilamidia em um produto alimentício, e, produto alimentício |
| US8129170B1 (en) | 2010-12-06 | 2012-03-06 | E.I. Du Pont De Nemours And Company | Recombinant bacteria having the ability to metabolize sucrose |
| EP2655624B1 (en) | 2010-12-23 | 2017-11-29 | Biogen MA Inc. | Linker peptides and polypeptides comprising same |
| US9017961B2 (en) * | 2012-03-05 | 2015-04-28 | E.I. Du Pont De Nemours And Company | Recombinant bacteria comprising novel sucrose transporters |
| FR2990699B1 (fr) | 2012-05-21 | 2016-02-05 | Agronomique Inst Nat Rech | Cassettes d'expression procaryotes regulees par le stress |
| CN105144204B (zh) | 2012-12-13 | 2018-02-27 | 麻省理工学院 | 基于重组酶的逻辑与存储系统 |
| JP6283040B2 (ja) | 2013-03-07 | 2018-02-21 | ザ ジェネラル ホスピタル コーポレイション | 細菌によるポリペプチド送達のための組成物および方法 |
| NZ713396A (en) | 2013-04-18 | 2020-06-26 | Codexis Inc | Engineered phenylalanine ammonia lyase polypeptides |
| US9688967B2 (en) | 2014-12-05 | 2017-06-27 | Synlogic, Inc. | Bacteria engineered to treat diseases associated with hyperammonemia |
| SG11201704543XA (en) * | 2014-12-05 | 2017-07-28 | Synlogic Inc | Bacteria engineered to treat diseases associated with hyperammonemia |
| WO2016183532A1 (en) | 2015-05-13 | 2016-11-17 | Synlogic, Inc. | Bacteria engineered to treat a disease or disorder |
| ES2881384T3 (es) | 2015-05-13 | 2021-11-29 | Synlogic Operating Co Inc | Bacterias manipuladas para reducir la hiperfenilalaninemia |
| JP6799010B2 (ja) | 2015-05-28 | 2020-12-09 | エヴォルヴァ エスアー.Evolva Sa. | フェニルプロパノイドおよびフェニルプロパノイド誘導体の生合成 |
| AU2016276973B2 (en) * | 2015-06-10 | 2022-09-01 | Synlogic Operating Company, Inc. | Bacteria engineered to treat disorders involving the catabolism of a branched chain amino acid |
| WO2016210373A2 (en) | 2015-06-24 | 2016-12-29 | Synlogic, Inc. | Recombinant bacteria engineered for biosafety, pharmaceutical compositions, and methods of use thereof |
| US20170216370A1 (en) | 2015-07-31 | 2017-08-03 | Synlogic, Inc. | Bacteria engineered to treat disorders involving propionate catabolism |
| ES2925049T3 (es) | 2015-11-16 | 2022-10-13 | Synlogic Operating Co Inc | Bacterias manipuladas para reducir la hiperfenilalaninemia |
| WO2017216704A1 (en) | 2016-06-13 | 2017-12-21 | Benson Hill Biosystems, Inc. | Increasing plant growth and yield by using a phenylalanine ammonia lyase sequence |
| CN111655841A (zh) | 2017-06-21 | 2020-09-11 | 同生运营公司 | 用于治疗紊乱的细菌 |
| JP2021531749A (ja) | 2018-07-12 | 2021-11-25 | コデクシス, インコーポレイテッド | 操作されたフェニルアラニンアンモニアリアーゼポリペプチド |
| BR112022018571A2 (pt) | 2020-03-20 | 2022-11-01 | Synlogic Operating Co Inc | Microrganismos manipulados para reduzir a hiperfenilalaninemia |
| CN116847860A (zh) | 2020-12-31 | 2023-10-03 | 同生运营公司 | 经工程化以减轻高苯丙氨酸血症的微生物 |
| WO2023044479A1 (en) | 2021-09-17 | 2023-03-23 | Synlogic Operating Company, Inc. | Methods for reducing hyperphenylalaninemia |
-
2016
- 2016-05-13 ES ES16728448T patent/ES2881384T3/es active Active
- 2016-05-13 IL IL296538A patent/IL296538A/en unknown
- 2016-05-13 EP EP21156322.6A patent/EP3882259B1/en active Active
- 2016-05-13 SG SG10202003100XA patent/SG10202003100XA/en unknown
- 2016-05-13 EP EP16728448.8A patent/EP3294760B1/en active Active
- 2016-05-13 CA CA2985819A patent/CA2985819A1/en active Pending
- 2016-05-13 WO PCT/US2016/032562 patent/WO2016183531A1/en not_active Ceased
- 2016-05-13 US US15/154,934 patent/US10610546B2/en active Active
- 2016-05-13 US US15/301,324 patent/US10195234B2/en active Active
- 2016-05-13 BR BR112017024384A patent/BR112017024384A2/pt not_active Application Discontinuation
- 2016-05-13 US US15/319,564 patent/US9889164B2/en active Active
- 2016-05-13 JP JP2017559428A patent/JP6843768B2/ja active Active
- 2016-05-13 AU AU2016262569A patent/AU2016262569B9/en active Active
- 2016-05-13 PL PL16728448T patent/PL3294760T3/pl unknown
- 2016-09-08 US US15/260,211 patent/US9943555B2/en active Active
-
2017
- 2017-11-12 IL IL255616A patent/IL255616B2/en unknown
- 2017-11-13 ZA ZA2017/07678A patent/ZA201707678B/en unknown
- 2017-12-22 US US15/852,762 patent/US10933102B2/en active Active
-
2020
- 2020-02-12 US US16/788,458 patent/US12409195B2/en active Active
-
2021
- 2021-02-24 JP JP2021027597A patent/JP7245271B2/ja active Active
- 2021-08-06 AU AU2021212141A patent/AU2021212141B2/en active Active
-
2023
- 2023-03-10 JP JP2023037515A patent/JP7592777B2/ja active Active
-
2024
- 2024-12-18 AU AU2024278562A patent/AU2024278562A1/en active Pending
Patent Citations (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5589168A (en) | 1991-04-08 | 1996-12-31 | Unilever Patent Holdings B.V. | Probiotic |
| US5989463A (en) | 1997-09-24 | 1999-11-23 | Alkermes Controlled Therapeutics, Inc. | Methods for fabricating polymer-based controlled release devices |
| US6203797B1 (en) | 1998-01-06 | 2001-03-20 | Stephen C. Perry | Dietary supplement and method for use as a probiotic, for alleviating the symptons associated with irritable bowel syndrome |
| US20030166191A1 (en) | 1998-12-02 | 2003-09-04 | Timothy Gardner | Bistable genetic toggle switch |
| US6835376B1 (en) | 1999-03-11 | 2004-12-28 | Nestec S.A. | Lactobacillus paracasei strain for preventing diarrhea caused by pathogenic bacteria |
| US7731976B2 (en) | 2003-08-29 | 2010-06-08 | Cobb And Company, Llp | Treatment of irritable bowel syndrome using probiotic composition |
| WO2013192543A2 (en) * | 2012-06-22 | 2013-12-27 | Phytogene, Inc. | Enzymes and methods for styrene synthesis |
| WO2014018832A1 (en) * | 2012-07-27 | 2014-01-30 | University Of North Texas | Genetically modified probiotic for the treatment of phenylketonuria (pku) disease |
| WO2014066945A1 (en) * | 2012-11-01 | 2014-05-08 | The Sydney Children's Hospital Network (Randwick & Westmead) | Genetically-modified probiotic for treatment of phenylketonuria |
Non-Patent Citations (89)
| Title |
|---|
| "Artificial Cells: Biotechnology, Nanomedicine, Regenerative Medicine, Blood Substitutes, Bioencapsulation, and Cell/Stem Cell Therapy", 2007, WORLD SCIENTIFIC PUBLISHING, article "Use of Enzyme Artificial Cells for Genetic Enzyme Defects", pages: 147 - 159 |
| "Remington's Pharmaceutical Sciences", 2012, MACK PUBLISHING CO |
| "Remington's Pharmaceutical Sciences", MACK PUBLISHING CO. |
| "The Atlas of Protein Sequence and Structure 5", 1978, NATIONAL BIOMEDICAL RESEARCH FOUNDATION |
| AL HAFID N; CHRISTODOULOU J.: "Phenylketonuria: a review of current and future treatments.", TRANSL PEDIATR., vol. 4, no. 4, October 2015 (2015-10-01), pages 304 - 317 |
| ALTENHOEFER ET AL.: "The probiotic Escherichia coli strain Nissle 1917 interferes with invasion of human intestinal epithelial cells by different enteroinvasive bacterial pathogens.", FEMS IMMUNOL MED MICROBIOL, vol. 40, no. 3, 9 April 2004 (2004-04-09), pages 223 - 229 |
| ANDERSEN ET AL.: "Uracil uptake in Escherichia coli K-12: isolation of uraA mutants and cloning of the gene.", J BACTERIOL., vol. 177, no. 8, April 1995 (1995-04-01), pages 2008 - 2013 |
| ARAI ET AL.: "Expression of the nir and nor genes for denitrification of Pseudomonas aeruginosa requires a novel CRP/FNR-related transcriptional regulator, DNR, in addition to ANR.", FEBS LETT., vol. 371, no. 1, 28 August 1995 (1995-08-28), pages 73 - 76 |
| ARGOS, EMBO J., vol. 8, 1989, pages 779 - 785 |
| ARTHUR ET AL.: "Intestinal inflammation targets cancer-inducing activity of the microbiota", SCIENCE, vol. 338, no. 6103, 5 October 2012 (2012-10-05), pages 120 - 123 |
| BAEK ET AL.: "Expression and characterization of a second L-amino acid deaminase isolated from Proteus mirabilis in Escherichia coli", JOURNAL OF BASIC MICROBIOLOGY, vol. 51, 2011, pages 129 - 135 |
| CALLURA ET AL.: "Tracking, Tuning and terminating microbial physiology using synthetic riboregulators.", PROC NATL ACAD SCI USA., vol. 27, no. 36, 2010, pages 15898 - 15903 |
| CASTIGLIONE ET AL.: "The transcription factor DNR from Pseudomonas aeruginosa specifically requires nitric oxide and haem for the activation of a target promoter in Escherichia coli.", MICROBIOLOGY., vol. 155, September 2009 (2009-09-01), pages 2838 - 2844 |
| CHEN X ET AL: "High-level Expression of Phenylalanine Ammonia-lyase in Lactococcus lactis via Synthesized Sequence Based on Bias Codons", CHINESE JOURNAL OF BIOTECHNOLOGY,, vol. 22, no. 2, 1 March 2006 (2006-03-01), pages 187 - 190, XP022857531, ISSN: 1872-2075, [retrieved on 20060301], DOI: 10.1016/S1872-2075(06)60022-8 * |
| CLARKSON ET AL.: "Diaminopimelic acid and lysine auxotrophs of Pseudomonas aeruginosa 8602", J GEN MICROBIOL., vol. 66, no. 2, May 1971 (1971-05-01), pages 161 - 169 |
| CUEVAS-RAMOS ET AL.: "Escherichia coli induces DNA damage in vivo and triggers genomic instability in mammalian cells", PROC NATL ACAD SCI USA., vol. 107, no. 25, 22 June 2010 (2010-06-22), pages 11537 - 11542 |
| DANINO ET AL.: "Programmable probiotics for detection of cancer in urine.", SCI TRANSL MED, vol. 7, no. 289, 27 May 2015 (2015-05-27), pages 289RA84 |
| DEUTSCHER.: "The mechanisms of carbon catabolite repression in bacteria.", CURR OPIN MICROBIOL., vol. 11, no. 2, April 2008 (2008-04-01), pages 87 - 93 |
| DINLEYICI ET AL.: "Saccharomyces boulardii CNCM 1-745 in different clinical conditions", EXPERT OPIN BIOL THER, vol. 14, no. 11, November 2014 (2014-11-01), pages 1593 - 1609 |
| DOBBELAERE ET AL.: "Evaluation of nutritional status and pathophysiology of growth retardation in patients with phenylketonuria", J INHERIT METAB DIS., vol. 26, no. 1, 2003, pages 1 - 11 |
| EIGLMEIER ET AL.: "Molecular genetic analysis of FNR-dependent promoters.", MOL MICROBIOL., vol. 3, no. 7, July 1989 (1989-07-01), pages 869 - 878 |
| ESTREM ET AL.: "Identification of an UP element consensus sequence for bacterial promoters", PROC NATL ACAD SCI USA., vol. 95, no. 17, 18 August 1998 (1998-08-18), pages 9761 - 9766 |
| GALIMAND ET AL.: "Positive FNR-like control of anaerobic arginine degradation and nitrate respiration in Pseudomonas aeruginosa", J BACTERIOL., vol. 173, no. 5, March 1991 (1991-03-01), pages 1598 - 1606 |
| GARDNER ET AL.: "Construction of a genetic toggle switch in Escherichia coli", NATURE, vol. 403, 2000, pages 339 - 342 |
| GERDES ET AL.: "Essential genes on metabolic maps", CURR OPIN BIOTECHNOL, vol. 17, no. 5, 2006, pages 448 - 456 |
| GERDES ET AL.: "Essential genes on metabolic maps.", CURR OPIN BIOTECHNOL., vol. 17, no. 5, October 2006 (2006-10-01), pages 448 - 456 |
| GILBERT ET AL.: "Molecular cloning of the phenylalanine ammonia lyase gene from Rhodosporidium toruloides in Escherichia coli K-12", J BACTERIOL, vol. 161, no. 1, January 1985 (1985-01-01), pages 314 - 320 |
| GORKE B; STIILKE J.: "Carbon catabolite repression in bacteria: many ways to make the most out of nutrients.", NAT REV MICROBIOL., vol. 6, no. 8, August 2008 (2008-08-01), pages 613 - 624 |
| HASEGAWA ET AL.: "Activation of a consensus FNR-dependent promoter by DNR of Pseudomonas aeruginosa in response to nitrite.", FEMS MICROBIOL LETT., vol. 166, no. 2, 15 September 1998 (1998-09-15), pages 213 - 217 |
| HE ET AL.: "Noninvasive measurement of anatomic structure and intraluminal oxygenation in the gastrointestinal tract of living mice with spatial and spectral EPR imaging", PROC NATL ACAD SCI USA., vol. 96, no. 8, 13 April 1999 (1999-04-13), pages 4586 - 4591 |
| HOEKS ET AL.: "Adult issues in phenylketonuria.", NETH J MED., vol. 67, no. 1, January 2009 (2009-01-01), pages 2 - 7 |
| HOEREN ET AL.: "Sequence and expression of the gene encoding the respiratory nitrous-oxide reductase from Paracoccus denitrificans", EUR J BIOCHEM., vol. 218, no. 1, 15 November 1993 (1993-11-15), pages 49 - 57 |
| HOSSEINI ET AL.: "Propionate as a health-promoting microbial metabolite in the human gut", NUTR REV., vol. 69, no. 5, May 2011 (2011-05-01), pages 245 - 258 |
| HOU ET AL., APPL MICROBIOL BIOTECHNOL., vol. 99, no. 20, October 2015 (2015-10-01), pages 8391 - 8402 |
| HOU ET AL.: "Production of phenylpyruvic acid from L-phenylalanine using an L-amino acid deaminase from Proteus mirabilis: comparison of enzymatic and whole-cell biotransformation approaches", APPL MICROBIOL TECHNOL., vol. 99, no. 20, October 2015 (2015-10-01), pages 8391 - 8402 |
| ISABELLA ET AL.: "Deep sequencing-based analysis of the anaerobic stimulon in Neisseria gonorrhoeae", BMC GENOMICS, vol. 12, 20 January 2011 (2011-01-20), pages 51 |
| IVANOVSKA ET AL.: "Pediatric drug formulations: a review of challenges and progress", PEDIATRICS, vol. 134, no. 2, August 2014 (2014-08-01), pages 361 - 372 |
| J. CHRISTODOULOU ET AL: "Abstr. 166. Enzyme substitution therapy for phenylketonuria delivered orally using a genetically modified probiotic: proof of principle.", 62ND ANNUAL MEETING OF THE AMERICAN SOCIETY OF HUMAN GENETICS, 6-10 NOVEMBER 2012, SAN FRANCISCO, vol. 62, 8 November 2012 (2012-11-08) - 10 November 2012 (2012-11-10), US, pages 1 - 1, XP055264422 * |
| KANG T S ET AL: "Converting an injectable protein therapeutic into an oral form: Phenylalanine ammonia lyase for phenylketonuria", MOLECULAR GENETICS AND METABOLISM, ACADEMIC PRESS, AMSTERDAM, NL, vol. 99, no. 1, 1 January 2010 (2010-01-01), pages 4 - 9, XP026802464, ISSN: 1096-7192, [retrieved on 20090911] * |
| KOBE ET AL.: "Regulation and crystallization of phosphorylated and dephosphorylated forms of truncated dimeric phenylalanine hydroxylase.", PROTEIN SCI., vol. 6, no. 6, June 1997 (1997-06-01), pages 1352 - 1357 |
| KWOK ET AL.: "Nucleotide sequence of a full-length complementary DNA clone and amino acid sequence of human phenylalanine hydroxylase", BIOCHEMISTRY, vol. 24, no. 3, 29 January 1985 (1985-01-29), pages 556 - 561 |
| LEE, D.-H.; FEIST, A. M.; BARRETT, C. L.; PALSSON, B. 0.: "Cumulative Number of Cell Divisions as a Meaningful Timescale for Adaptive Laboratory Evolution of Escherichia coli.", PLOS ONE, vol. 6, 2011, pages E26172 |
| LEONARD JV: "Inborn Metabolic Diseases", 2006, SPRINGER MEDIZIN VERLAG, article "Disorders of the urea cycle and related enzymes", pages: 263 - 272 |
| LIU JINGZHONG ET AL: "Study on a novel strategy to treatment of phenylketonuria", ARTIFICIAL CELLS, BLOOD SUBSTITUTES, AND IMMOBILIZATION BIOTECHNOLOGY, MARCEL DEKKER INC, US, vol. 30, no. 4, 1 January 2002 (2002-01-01), pages 243 - 257, XP009172887, ISSN: 1073-1199 * |
| LONGO ET AL.: "Phase 1 Trial of Subcutaneous rAvPAL-PEG in Subjects with Phenylketonuria.", LANCET., vol. 384, no. 9937, 5 July 2014 (2014-07-05), pages 37 - 44 |
| LOPEZ G; ANDERSON JC.: "Synthetic Auxotrophs with Ligand-Dependent Essential Genes for a BL21(DE3) Biosafety Strain.", CS SYNTH BIOL., vol. 4, no. 12, 18 December 2015 (2015-12-18), pages 1279 - 1286 |
| LOPEZ; ANDERSON: "Synthetic Auxotrophs with Ligand-Dependent Essential Genes for a BL21 (DE3) Biosafety Strain", ACS SYNTH BIOL, vol. 4, no. 12, 2015, pages 1279 - 1286 |
| MACDONALD ET AL., BIOCHEM CELL BIOL, vol. 85, 2007, pages 273 - 282 |
| MACLEOD ET AL.: "Nutritional Management of Phenylketonuria.", ANN NESTLE ENG., vol. 68, no. 2, June 2010 (2010-06-01), pages 58 - 69 |
| MEADOW ET AL.: "Biosynthesis of diaminopimelic acid and lysine in Escherichia coli", BIOCHEM J., vol. 72, no. 3, July 1959 (1959-07-01), pages 396 - 400 |
| MILLER: "Experiments in Molecular Genetics", 1972, COLD SPRING HARBOR LABORATORY PRESS |
| MILTON H. SAIER, JR.: "Protein Secretion Systems in Gram-Negative Bacteria Gram-negative bacteria possess many protein secretion-membrane insertion systems that apparently evolved independently", MICROBE, vol. 1, no. 9, 2006 |
| MOFFITT ET AL.: "Discovery of two cyanobacterial phenylalanine ammonia lyases: kinetic and structural characterization", BIOCHEMISTRY, vol. 46, no. 4, 30 January 2007 (2007-01-30), pages 1004 - 1012 |
| MOORE ET AL.: "Regulation of FNR dimerization by subunit charge repulsion", J BIOL CHEM., vol. 281, no. 44, 3 November 2006 (2006-11-03), pages 33268 - 33275 |
| NOUGAYREDE ET AL.: "Escherichia coli induces DNA double-strand breaks in eukaryotic cells.", SCIENCE, vol. 313, no. 5788, 11 August 2006 (2006-08-11), pages 848 - 851 |
| OLIER ET AL.: "Genotoxicity of Escherichia coli Nissle 1917 strain cannot be dissociated from its probiotic activity.", GUT MICROBES., vol. 3, no. 6, November 2012 (2012-11-01), pages 501 - 509 |
| PELMONT J ET AL.: "L-amino acid oxidases of Proteus mirabilis: general properties", BIOCHIMIE, vol. 54, 1972, pages 1359 - 1374 |
| PI ET AL.: "Cloning and sequencing of the pheP gene, which encodes the phenylalanine-specific transport system of Escherichia coli.", J BACTERIOL, vol. 173, no. 12, June 1991 (1991-06-01), pages 3622 - 3629 |
| PI ET AL.: "Functional consequences of changing proline residues in the phenylalanine-specific permease of Escherichia coli", J BACTERIOL., vol. 180, no. 21, November 1998 (1998-11-01), pages 5515 - 5519 |
| PI ET AL.: "Topology of the phenylalanine-specific permease of Escherichia coli", J BACTERIOL., vol. 178, no. 9, May 1996 (1996-05-01), pages 2650 - 2655 |
| PURCELL ET AL.: "Towards a whole-cell modeling approach for synthetic biology.", CHAOS, vol. 23, no. 2, June 2013 (2013-06-01), pages 025112 |
| RAY ET AL.: "The effects of mutation of the anr gene on the aerobic respiratory chain of Pseudomonas aeruginosa.", FEMS MICROBIOL LETT., vol. 156, no. 2, 15 November 1997 (1997-11-15), pages 227 - 232 |
| REISTER ET AL.: "Complete genome sequence of the Gram-negative probiotic Escherichia coli strain Nissle 1917", J BIOTECHNOL., vol. 187, 10 October 2014 (2014-10-10), pages 106 - 107 |
| REMBACKEN ET AL.: "Non-pathogenic Escherichia coli versus mesalazine for the treatment of ulcerative colitis: a randomised trial.", LANCET, vol. 354, no. 9179, 21 August 1999 (1999-08-21), pages 635 - 639 |
| SAKISSIAN ET AL., MOL GENET METAB., vol. 104, no. 3, November 2011 (2011-11-01), pages 249 - 254 |
| SALMON ET AL.: "Global gene expression profiling in Escherichia coli K12. The effects of oxygen availability and FNR", J BIOL CHEM., vol. 278, no. 32, 8 August 2003 (2003-08-08), pages 29837 - 29855 |
| SARKISSIAN CHRISTINEH N ET AL: "A different approach to treatment of phenylketonuria: Phenylalanine degradation with recombinant phenylalanine ammonia lyase", vol. 96, no. 5, 2 March 1999 (1999-03-02), pages 2339 - 2344, XP002525651, ISSN: 0027-8424, Retrieved from the Internet <URL:http://www.pnas.org/content/96/5/2339.full> [retrieved on 20160809], DOI: 10.1073/PNAS.96.5.2339 * |
| SARKISSIAN ET AL.: "A different approach to treatment of phenylketonuria: phenylalanine degradation with recombinant phenylalanine ammonia lyase", PROC NATL ACAD SCI USA., vol. 96, no. 5, 2 March 1999 (1999-03-02), pages 2339 - 2344 |
| SARKISSIAN ET AL.: "Quantitation of phenylalanine and its trans-cinnamic, benzoic and hippuric acid metabolites in biological fluids in a single GC-MS analysis", J MASS SPECTROM., vol. 42, no. 6, June 2007 (2007-06-01), pages 811 - 817 |
| SAT ET AL.: "The Escherichia coli mazEF suicide module mediates thymineless death", J BACTERIOL., vol. 185, no. 6, March 2003 (2003-03-01), pages 1803 - 1807 |
| SAWERS.: "Identification and molecular characterization of a transcriptional regulator from Pseudomonas aeruginosa P AO 1 exhibiting structural and functional similarity to the FNR protein of Escherichia coli.", MOL MICROBIOL., vol. ;5, no. 6, June 1991 (1991-06-01), pages 1469 - 1481 |
| SCHULTZ.: "Clinical use of E. coli Nissle 1917 in inflammatory bowel disease", INFLAMM BOWEL DIS., vol. 14, no. 7, July 2008 (2008-07-01), pages 1012 - 1018 |
| SILHAVY, T. J.; KAHNE, D.; WALKER, S.: "The bacterial cell envelope.", COLD SPRING HARB PERSPECT BIOL, vol. 2, 2010, pages A000414 |
| SONNENBORN ET AL.: "The non-pathogenic Escherichia coli strain Nissle 1917 - features of a versatile probiotic.", MICROBIAL ECOLOGY IN HEALTH AND DISEASE., vol. 21, 2009, pages 122 - 158 |
| STEELE, FED PROC., vol. 45, no. 7, June 1986 (1986-06-01), pages 2060 - 2064 |
| TRUNK ET AL.: "Anaerobic adaptation in Pseudomonas aeruginosa: definition of the Anr and Dnr regulons.", ENVIRON MICROBIOL., vol. 12, no. 6, June 2010 (2010-06-01), pages 1719 - 1733 |
| UKENA ET AL.: "Probiotic Escherichia coli Nissle 1917 inhibits leaky gut by enhancing mucosal integrity.", PLOS ONE., vol. 2, no. 12, 12 December 2007 (2007-12-12), pages E1308 |
| UNDEN ET AL.: "Alternative respiratory pathways of Escherichia coli: energetics and transcriptional regulation in response to electron acceptors.", BIOCHIM BIOPHYS ACTA, vol. 1320, no. 3, 4 July 1997 (1997-07-04), pages 217 - 234 |
| VOCKLEY ET AL.: "Phenylalanine hydroxylase deficiency: diagnosis and management guideline", GENET MED., vol. 16, no. 2, February 2014 (2014-02-01), pages 188 - 200 |
| WANNER ET AL.: "The phenylalanine ammonia-lyase gene family in Arabidopsis thaliana", PLANT MOL BIOL., vol. 27, no. 2, January 1995 (1995-01-01), pages 327 - 338 |
| WILLIAMS ET AL.: "The gene stlA encodes a phenylalanine ammonia-lyase that is involved in the production of a stilbene antibiotic in Photorhabdus luminescens TT01", MICROBIOLOGY, vol. 151, August 2005 (2005-08-01), pages 2543 - 2550 |
| WINTELER ET AL.: "The homologous regulators ANR of Pseudomonas aeruginosa and FNR of Escherichia coli have overlapping but distinct specificities for anaerobically inducible promoters.", MICROBIOLOGY., vol. 142, March 1996 (1996-03-01), pages 685 - 693 |
| WRIGHT ET AL.: "GeneGuard: A Modular Plasmid System Designed for Biosafety", ACS SYNTH BIOL, vol. 4, no. 3, 2015, pages 307 - 316 |
| WRIGHT ET AL.: "GeneGuard: A Modular Plasmid System Designed for Biosafety.", ACS SYNTH BIOL, vol. 4, no. 3, 20 March 2015 (2015-03-20), pages 307 - 316 |
| WU ET AL.: "Direct regulation of the natural competence regulator gene tfoX by cyclic AMP (cAMP) and cAMP receptor protein in Vibrios.", SCI REP, vol. 5, 7 October 2015 (2015-10-07), pages 14921 |
| XIANG L; MOORE BS.: "Biochemical characterization of a prokaryotic phenylalanine ammonia lyase", J BACTERIOL., vol. 187, no. 12, June 2005 (2005-06-01), pages 4286 - 4289 |
| ZHANG R; LIN Y.: "DEG 5.0, a database of essential genes in both prokaryotes and eukaryotes", NUCLEIC ACIDS RES., vol. 37, January 2009 (2009-01-01), pages D455 - D458 |
| ZHANG; LIN: "DEG 5.0, a database of essential genes in both prokaryotes and eukaryotes", NUCL ACIDS RES, vol. 37, 2009, pages D455 - D458 |
| ZIMMERMANN ET AL.: "Anaerobic growth and cyanide synthesis of Pseudomonas aeruginosa depend on anr, a regulatory gene homologous with fnr of Escherichia coli.", MOL MICROBIOL., vol. 5, no. 6, June 1991 (1991-06-01), pages 1483 - 1490 |
Cited By (44)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11845964B2 (en) | 2014-12-05 | 2023-12-19 | Synlogic Operating Company, Inc. | Bacteria engineered to treat diseases associated with hyperammonemia |
| US10610546B2 (en) | 2015-05-13 | 2020-04-07 | Synlogic Operating Company Inc. | Bacteria engineered to reduce hyperphenylalaninemia |
| EP3294757B1 (en) * | 2015-05-13 | 2023-12-27 | Synlogic Operating Company, Inc. | Bacteria engineered to treat a disease or disorder |
| US10195234B2 (en) | 2015-05-13 | 2019-02-05 | Synlogic Operating Company, Inc. | Bacteria engineered to reduce hyperphenylalaninemia |
| US12409195B2 (en) | 2015-05-13 | 2025-09-09 | Synlogic Operating Company, Inc. | Bacteria engineered to reduce hyperphenylalaninemia |
| US11618894B2 (en) | 2015-11-16 | 2023-04-04 | Synlogic Operating Company, Inc. | Bacteria engineered to reduce hyperphenylalaninemia |
| AU2016356684B2 (en) * | 2015-11-16 | 2021-12-16 | Synlogic Operating Company, Inc. | Bacteria engineered to reduce hyperphenylalaninemia |
| WO2017087580A1 (en) * | 2015-11-16 | 2017-05-26 | Synlogic, Inc. | Bacteria engineered to reduce hyperphenylalaninemia |
| EP4095150A1 (en) * | 2015-11-16 | 2022-11-30 | Synlogic Operating Company, Inc. | Bacteria engineered to reduce hyperphenylalaninemia |
| AU2016356684C1 (en) * | 2015-11-16 | 2022-11-10 | Synlogic Operating Company, Inc. | Bacteria engineered to reduce hyperphenylalaninemia |
| AU2022201838B2 (en) * | 2015-11-16 | 2025-01-23 | Synlogic Operating Company, Inc. | Bacteria engineered to reduce hyperphenylalaninemia |
| WO2018191715A3 (en) * | 2017-04-14 | 2018-12-06 | Synthetic Genomics, Inc. | Polypeptides with type v crispr activity and uses thereof |
| IL271085B2 (en) * | 2017-06-21 | 2024-07-01 | Synlogic Operating Co Inc | Bacteria for the treatment of disorders |
| IL271085B1 (en) * | 2017-06-21 | 2024-03-01 | Synlogic Operating Co Inc | Bacteria for the treatment of disorders |
| JP2025087727A (ja) * | 2017-06-21 | 2025-06-10 | シンロジック オペレーティング カンパニー インコーポレイテッド | 障害の処置のための細菌 |
| JP2020525012A (ja) * | 2017-06-21 | 2020-08-27 | シンロジック オペレーティング カンパニー インコーポレイテッド | 障害の処置のための細菌 |
| US20200172857A1 (en) * | 2017-06-21 | 2020-06-04 | Synlogic Operating Company, Inc. | Bacteria for the treatment of disorders |
| US11879123B2 (en) | 2017-06-21 | 2024-01-23 | Synlogic Operating Company, Inc. | Bacteria for the treatment of disorders |
| JP7358245B2 (ja) | 2017-06-21 | 2023-10-10 | シンロジック オペレーティング カンパニー インコーポレイテッド | 障害の処置のための細菌 |
| US12545886B2 (en) | 2017-06-21 | 2026-02-10 | Synlogic Operating Company, Inc. | Bacteria for the treatment of disorders |
| AU2018290278B2 (en) * | 2017-06-21 | 2022-12-15 | Synlogic Operating Company, Inc. | Bacteria for the treatment of disorders |
| WO2018237198A1 (en) | 2017-06-21 | 2018-12-27 | Synlogic Operating Company, Inc. | BACTERIA FOR THE TREATMENT OF DISORDERS |
| JP7639056B2 (ja) | 2017-06-21 | 2025-03-04 | シンロジック オペレーティング カンパニー インコーポレイテッド | 障害の処置のための細菌 |
| JP2023123506A (ja) * | 2017-06-21 | 2023-09-05 | シンロジック オペレーティング カンパニー インコーポレイテッド | 障害の処置のための細菌 |
| CN111655841A (zh) * | 2017-06-21 | 2020-09-11 | 同生运营公司 | 用于治疗紊乱的细菌 |
| US11696931B2 (en) | 2017-09-08 | 2023-07-11 | New Portal Limited | Bacteria for targeting tumors and treating cancer |
| US11458172B2 (en) | 2017-09-08 | 2022-10-04 | New Portal Limited | Nucleic acid systems that enable bacteria to specifically target solid tumors via glucose-dependent viability |
| US12042517B2 (en) | 2017-09-08 | 2024-07-23 | New Portal Limited | Nucleic acid systems that enable bacteria to specifically target solid tumors via glucose-dependent viability |
| WO2019104759A1 (zh) * | 2017-11-30 | 2019-06-06 | 江南大学 | 一种热稳定性提高的l-氨基酸脱氨酶突变体及其构建方法 |
| JP2024075688A (ja) * | 2017-12-05 | 2024-06-04 | バイオピーエルエックス,インコーポレイティド | 微生物感染を防ぐための方法および組成物 |
| US12163135B2 (en) | 2017-12-05 | 2024-12-10 | BioPlx, Inc. | Methods and compositions to prevent microbial infection |
| JP7460531B2 (ja) | 2017-12-05 | 2024-04-02 | バイオピーエルエックス,インコーポレイティド | 微生物感染を防ぐための方法および組成物 |
| JP2021505197A (ja) * | 2017-12-05 | 2021-02-18 | バイオピーエルエックス,インコーポレイティド | 微生物感染を防ぐための方法および組成物 |
| WO2020223345A1 (en) | 2019-04-29 | 2020-11-05 | Antipov Eugene | Enumeration of genetically engineered microorganisms by live cell counting techniques |
| US20220257732A1 (en) * | 2019-04-29 | 2022-08-18 | Synlogic Operating Company, Inc. | Enumeration of genetically engineered microorganisms by live cell counting techniques |
| WO2021144473A2 (en) | 2020-01-17 | 2021-07-22 | Université Catholique de Louvain | Genetically modified bacterium with altered envelop integrity and uses thereof |
| WO2021188819A1 (en) * | 2020-03-20 | 2021-09-23 | Synlogic Operating Company, Inc. | Microorganisms engineered to reduce hyperphenylalaninemia |
| US12171790B2 (en) | 2020-03-20 | 2024-12-24 | Synlogic Operating Company, Inc. | Microorganisms engineered to reduce hyperphenylalaninemia |
| US11766463B2 (en) | 2020-03-20 | 2023-09-26 | Synlogic Operating Company, Inc. | Microorganisms engineered to reduce hyperphenylalaninemia |
| US12491236B2 (en) | 2020-07-07 | 2025-12-09 | New Portal Limited | Genetically engineered live bacteria and methods of constructing the same |
| US20230332164A1 (en) * | 2020-09-30 | 2023-10-19 | Synlogic Operating Company, Inc. | Bacteria engineered to secrete active proteins |
| WO2022120028A2 (en) | 2020-12-02 | 2022-06-09 | Synlogic Operating Company, Inc. | Engineered microorganisms |
| WO2022120028A3 (en) * | 2020-12-02 | 2022-07-07 | Synlogic Operating Company, Inc. | Engineered microorganisms |
| WO2023165521A1 (zh) * | 2022-03-02 | 2023-09-07 | 和度生物技术(上海)有限公司 | 一种用于治疗高苯丙氨酸血症的工程微生物及其用途 |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| AU2021212141B2 (en) | Bacteria engineered to reduce hyperphenylalaninemia | |
| US20240076645A1 (en) | Bacteria engineered to reduce hyperphenylalaninemia | |
| WO2017123592A1 (en) | Bacteria engineered to treat disorders associated with bile salts | |
| WO2017075485A1 (en) | Bacteria engineered to treat disorders in which trimethylamine (tma) is detrimental | |
| AU2021220882A1 (en) | Recombinant bacteria engineered to treat diseases associated with methionine metabolism and methods of use thereof | |
| HK40085223A (en) | Bacteria engineered to reduce hyperphenylalaninemia | |
| CA3005451C (en) | Bacteria engineered to reduce hyperphenylalaninemia |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 15301324 Country of ref document: US |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 16728448 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2985819 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 11201709291Y Country of ref document: SG |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 255616 Country of ref document: IL |
|
| ENP | Entry into the national phase |
Ref document number: 2017559428 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2016728448 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2016262569 Country of ref document: AU Date of ref document: 20160513 Kind code of ref document: A |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112017024384 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 112017024384 Country of ref document: BR Kind code of ref document: A2 Effective date: 20171113 |
|
| WWG | Wipo information: grant in national office |
Ref document number: 737318 Country of ref document: NZ |