WO2016018665A1 - Apoe mimetic peptides and higher potency to clear plasma cholesterol - Google Patents

Apoe mimetic peptides and higher potency to clear plasma cholesterol Download PDF

Info

Publication number
WO2016018665A1
WO2016018665A1 PCT/US2015/041162 US2015041162W WO2016018665A1 WO 2016018665 A1 WO2016018665 A1 WO 2016018665A1 US 2015041162 W US2015041162 W US 2015041162W WO 2016018665 A1 WO2016018665 A1 WO 2016018665A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
peptide
mimicking
amino
lrrlrrrllr
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2015/041162
Other languages
English (en)
French (fr)
Inventor
Gattadahalli M. Anantharamaiah
Dennis Goldberg
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
UAB Research Foundation
LipimetiX Development LLC
Original Assignee
UAB Research Foundation
LipimetiX Development LLC
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by UAB Research Foundation, LipimetiX Development LLC filed Critical UAB Research Foundation
Priority to CA2954475A priority Critical patent/CA2954475C/en
Priority to US17/748,682 priority patent/USRE50320E1/en
Priority to BR112017001860-8A priority patent/BR112017001860A2/pt
Priority to IL250302A priority patent/IL250302B/en
Priority to US15/329,735 priority patent/US10653747B2/en
Priority to JP2017505143A priority patent/JP7081923B2/ja
Priority to EP15826625.4A priority patent/EP3189069B1/en
Priority to MX2017001432A priority patent/MX383117B/es
Priority to CN201580041913.0A priority patent/CN107074923B/zh
Priority to AU2015298263A priority patent/AU2015298263B2/en
Publication of WO2016018665A1 publication Critical patent/WO2016018665A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/1703Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • A61K38/1709Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/06Antihyperlipidemics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/10Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/775Apolipopeptides

Definitions

  • cardiovascular disease is the leading cause of death in both men and women.
  • causative factors are implicated in the development of cardiovascular disease including hereditary predisposition to the disease, gender, lifestyle factors such as smoking and diet, age, hypertension, and hyperlipidemia, including hypercholesterolemia.
  • hyperlipidemia and hypercholesteremia provide a significant risk factor associated with atherosclerosis.
  • Atherosclerosis is associated with an inflammatory response caused by the accumulation of low-density lipoprotein (LDL) molecules in blood vessels. It can be asymptomatic for years. Atherosclerosis causes hardening and narrowing of blood vessels. There are several treatments for atherosclerosis, such as lifestyle change, medication and medical procedures. Statins are a well-known treatment for atherosclerosis. Statins have proven to reduce cardiac risk however the withdrawal of statin therapy abrogrates the protective effect (Heeschen et al. Circulation.105: 1446-1452, 2002).
  • compositions and methods disclosed herein provide an atherosclerosis therapy with sustained therapeutic effects even after the treatment is withdrawn.
  • ApoE apolipoprotein E
  • ApoE-mimicking peptides comprising a receptor binding domain of ApoE and a lipid-associating peptide, wherein the synthetic ApoE-mimicking peptide comprises an acetylated amino hexanoic acid (Ac -Aha).
  • synthetic ApoE-mimicking peptides comprising a receptor binding domain of ApoE and a lipid-associating peptide, wherein the synthetic ApoE- mimicking peptide comprises an Ac-Aha, wherein the Ac -Aha can be at the N-terminus of the peptide.
  • the synthetic ApoE-mimicking peptides comprising a receptor binding domain of ApoE and a lipid-associating peptide, wherein the synthetic ApoE- mimicking peptide comprises an Ac-Aha, wherein the lipid-associating peptide comprises a class A amphipathic -helical domain.
  • the class A amphipathic -helical domain can be DWLKAFYDKVAEKLKEAF (SEQ ID NO:5), DWLRAFYDKVAEKLREAF (SEQ ID NO:618), DWLRALYDKVAEKLREAL (SEQ ID NO:619),
  • DLLRALYDKVAEKLREAW (SEQ ID NO: 620), or FAEKLKEAVKDYFAKLWD (SEQ ID O:616).
  • synthetic ApoE-mimicking peptides comprising a receptor binding domain of ApoE and a lipid-associating peptide, wherein the synthetic ApoE- mimicking peptide comprises an Ac-Aha, wherein the receptor binding domain of ApoE can be covalently linked to the lipid-associating peptide.
  • synthetic ApoE-mimicking peptides comprising a receptor binding domain of ApoE and a lipid-associating peptide, wherein the synthetic ApoE- mimicking peptide comprises an Ac-Aha, wherein said apolipoprotein E is from a species selected from the group consisting of human, mouse, rabbit, monkey, rat, bovine, pig and dog.
  • synthetic ApoE-mimicking peptides comprising a receptor binding domain of ApoE and a lipid-associating peptide, wherein the synthetic ApoE- mimicking peptide comprises an Ac-Aha, wherein said synthetic peptide is protected using an amide group at the C-terminus.
  • synthetic ApoE-mimicking peptides comprising a receptor binding domain of ApoE and a lipid-associating peptide, wherein the synthetic ApoE- mimicking peptide comprises an Ac -Aha, wherein the receptor binding domain of ApoE is LRKLRKRLLR (SEQ ID NO:4), LRRLRRRLLR (SEQ ID NO: 11), LRKMRKRLMR (SEQ ID NO:7), or RLTRKRGLK (SEQ ID NO: 13).
  • the receptor binding domain of ApoE is LRKLRKRLLR (SEQ ID NO:4), LRRLRRRLLR (SEQ ID NO: 11), LRKMRKRLMR (SEQ ID NO: 7), RLTRKRGLK (SEQ ID NO: 13), LRRMRRRLMR (SEQ ID NO: 621), or RLTRRRGK (SEQ ID
  • synthetic ApoE-mimicking peptides comprising a receptor binding domain of ApoE and a lipid-associating peptide, wherein the synthetic ApoE- mimicking peptide comprises an Ac -Aha, wherein the synthetic ApoE-mimicking peptide can be Ac-Aha-hE 18 A-NH 2 or Ac-Aha-[R]hE18A-NH 2 .
  • lipid-associating peptide comprising a receptor binding domain of ApoE and a lipid-associating peptide, wherein the synthetic ApoE-mimicking peptide comprises a fatty acid moiety, ⁇ -amino fatty acid moiety, or an acetylated ⁇ -amino fatty acid moiety.
  • ⁇ -amino fatty acid moiety can be inserted between the lipid-associating peptide and the receptor binding domain of apoE.
  • lipid-associating peptides comprising a receptor binding domain of ApoE and a lipid-associating peptide
  • the synthetic ApoE-mimicking peptide comprises a fatty acid moiety, ⁇ -amino fatty acid moiety, or an acetylated ⁇ -amino fatty acid moiety
  • the lipid-associating peptide comprises a class A amphipathic- helical domain.
  • the class A amphipathic-helical domain is
  • DWLKAFYDKVAEKLKEAF (SEQ ID NO:5), DWLRAFYDKVAEKLREAF (SEQ ID NO:618), DWLRALYDKVAEKLREAL (SEQ ID NO:619), DLLRALYDKVAEKLREAW (SEQ ID NO:620), or FAEKLKEAVKDYFAKLWD (SEQ ID NO:616).
  • lipid-associating peptides comprising a receptor binding domain of ApoE and a lipid-associating peptide
  • the synthetic ApoE-mimicking peptide comprises a fatty acid moiety, ⁇ -amino fatty acid moiety, or an acetylated ⁇ -amino fatty acid moiety
  • the lipid-associating peptide comprises a class A amphipathic- helical domain
  • the receptor binding domain of ApoE can be covalently linked to the lipid-associating peptide.
  • apolipoprotein E can be from a species selected from the group consisting of human, mouse, rabbit, monkey, rat, bovine, pig and dog.
  • lipid-associating peptide comprising a receptor binding domain of ApoE and a lipid-associating peptide, wherein the synthetic ApoE-mimicking peptide comprises a fatty acid moiety, ⁇ -amino fatty acid moiety, or an acetylated ⁇ -amino fatty acid moiety, wherein said synthetic peptide is protected using an amide group at the C- terminus.
  • RNA binding domain of ApoE can be LRKLRKRLLR (SEQ ID NO:4), LRRLRRRLLR (SEQ ID NO: 11), LRKMRKRLMR (SEQ ID NO:7), or RLTRKRGLK (SEQ ID NO: 13).
  • the receptor binding domain of ApoE can also be, but is not limited to, LRKLRKRFFR (SEQ ID NO: 12), LRKLPKRLLR (SEQ ID NO: 8),
  • LRNVRKRLVR (SEQ ID NO:9), MRKLRKRVLR (SEQ ID NO: 10), LRRLRRRLLR (SEQ ID NO: 11), LRKLRKRFFR (SEQ ID NO: 12), LRKLRKRLLR (SEQ ID NO:4), or
  • lipid-associating peptide comprising a receptor binding domain of ApoE and a lipid-associating peptide
  • the synthetic ApoE-mimicking peptide comprises a fatty acid moiety, ⁇ -amino fatty acid moiety, or an acetylated ⁇ -amino fatty acid moiety
  • the receptor binding domain of ApoE can be LRKLRKRLLR (SEQ ID NO:4), LRRLRRRLLR (SEQ ID NO: 11), LRKMRKRLMR (SEQ ID NO:7), RLTRKRGLK (SEQ ID NO: 13), LRRMRRRLMR (SEQ ID NO:621), or RLTRRRGK (SEQ ID NO:22).
  • RNA molecules comprising a receptor binding domain of ApoE and a lipid-associating peptide
  • the synthetic ApoE-mimicking peptide comprises a fatty acid moiety, ⁇ -amino fatty acid moiety, or an acetylated ⁇ -amino fatty acid moiety
  • the synthetic ApoE-mimicking peptide can be: butanoyl- LRRLRRRLLR-DWLKAFYDKVAEKLKEAF-NH 2 (SEQ ID NO: 623); hexanoyl- LRRLRRRLLR-DWLKAFYDKVAEKLKEAF-NH 2 (SEQ ID NO: 624); octanoyl- LRRLRRRLLR-DWLKAFYDKVAEKLKEAF-NH 2 (SEQ ID NO: 625); decanoyl- LRRLRRRLLR-DWLKAFYDK
  • EPA indicates a moiety derived from 5,8,1 1, 14, 17-eicosapentaenoic acid
  • DHA indicates a moiety derived from 4,7, 10, 13, 16, 19-docosahexaenoic acid.
  • synthetic ApoE-mimicking peptides comprising a receptor binding domain of ApoE and a lipid-associating peptide
  • the synthetic ApoE-mimicking peptide comprises a fatty acid moiety derived from a natural oil or fat, e.g. fish oil
  • the synthetic ApoE-mimicking peptide can be: (fish oil)-LRRLRRRLLR- DWLKAFYDKVAEKLKEAF-NH 2 (SEQ ID NO: 647).
  • (fish oil) indicates that the fatty acids in fish oil, including, but not limited to, fish oil components such as EPA and DHA, are linked to linked to the peptide LRRLRRRLLR (SEQ ID NO: 11).
  • the synthetic ApoE-mimicking peptide is a mixture of peptides comprising fatty acid groups derived from the fish oil used to prepare them.
  • synthetic ApoE-mimicking peptides comprising a receptor binding domain of ApoE and a lipid-associating peptide
  • the synthetic ApoE-mimicking peptide comprises a fatty acid moiety, ⁇ -amino fatty acid moiety, or an acetylated ⁇ -amino fatty acid moiety
  • the synthetic ApoE-mimicking peptide can be: 4-amino-butanoyl- LRRLRRRLLR-DWLKAFYDKVAEKLKEAF-NH 2 (SEQ ID NO: 648); 6-amino- hexanoyl-LRRLRRRLLR-DWLKAFYDKVAEKLKEAF-NH 2 (SEQ ID NO: 649); 8- amino-octanoyl-LRRLRRRLLR-DWLKAFYDKVAEKLKEAF-NH 2 (SEQ ID NO: 650); 10-amino-decano
  • compositions comprising any one of the herein disclosed synthetic ApoE-mimicking peptides and a pharmaceutically acceptable carrier.
  • Disclosed are methods comprising administering any one of the disclosed synthetic ApoE-mimicking peptides to a subject, whereby plasma LDL, plasma VLDL, or both, are affected.
  • Disclosed are methods comprising administering any one of the disclosed synthetic ApoE-mimicking peptides to a subject, whereby plasma LDL, plasma VLDL, or both, are affected, wherein the synthetic apolipoprotein E-mimicking peptide is administered as a composition comprising the synthetic apolipoprotein E-mimicking peptide and a pharmaceutically acceptable carrier.
  • ApoE-mimicking peptides to a subject, whereby plasma LDL, plasma VLDL, or both, are affected, wherein binding of LDL to a cell of the subject is enhanced.
  • ApoE-mimicking peptides to a subject, whereby plasma LDL, plasma VLDL, or both, are affected, wherein degradation of LDL by a cell of the subject is increased.
  • ApoE-mimicking peptides to a subject, whereby plasma LDL, plasma VLDL, or both, are affected, wherein LDL cholesterol in the subject is lowered.
  • ApoE-mimicking peptides to a subject, whereby plasma LDL, plasma VLDL, or both, are affected, wherein binding of VLDL to a cell of the subject is enhanced.
  • ApoE-mimicking peptides to a subject, whereby plasma LDL, plasma VLDL, or both, are affected, wherein degradation of VLDL by a cell of the subject is increased.
  • ApoE-mimicking peptides to a subject, whereby plasma LDL, plasma VLDL, or both, are affected, wherein VLDL cholesterol in the subject is lowered.
  • Disclosed are methods comprising administering any one of the disclosed synthetic ApoE-mimicking peptides to a subject, whereby plasma LDL, plasma VLDL, or both, are affected, wherein total plasma concentration of cholesterol in the subject is lowered.
  • Disclosed are methods comprising administering any one of the disclosed synthetic ApoE-mimicking peptides to a subject, whereby plasma LDL, plasma VLDL, or both, are affected, wherein said synthetic apolipoprotein E-mimicking peptide is administered in an amount of about 0.01 mg/kg to about 12 mg/kg.
  • Disclosed are methods comprising administering any one of the disclosed synthetic ApoE-mimicking peptides to a subject, whereby plasma LDL, plasma VLDL, or both, are affected, wherein the subject has coronary artery disease, rheumatoid arthritis, diabetes, Alzheimer's disease, peripheral artery disease (PAD), cerebral vascular disease, diabetes- derived cardiovascular diseases , macular degeneration, congestive heart failure, and/or systemic lupus.
  • a subject has coronary artery disease, rheumatoid arthritis, diabetes, Alzheimer's disease, peripheral artery disease (PAD), cerebral vascular disease, diabetes- derived cardiovascular diseases , macular degeneration, congestive heart failure, and/or systemic lupus.
  • Also disclosed are methods of reducing plasma cholesterol comprising
  • composition comprising any one of the disclosed synthetic apolipoprotein E-mimicking peptides.
  • Disclosed are methods of reducing plasma cholesterol comprising administering to a subject an effective amount of a composition comprising any one of the disclosed synthetic apolipoprotein E-mimicking peptides, wherein the synthetic apolipoprotein E-mimicking peptide is administered as a composition comprising the synthetic apolipoprotein E- mimicking peptide and a pharmaceutically acceptable carrier.
  • Disclosed are methods of reducing plasma cholesterol comprising administering to a subject an effective amount of a composition comprising any one of the disclosed synthetic apolipoprotein E-mimicking peptides, wherein binding of LDL to a cell of the subject is enhanced.
  • Disclosed are methods of reducing plasma cholesterol comprising administering to a subject an effective amount of a composition comprising any one of the disclosed synthetic apolipoprotein E-mimicking peptides, wherein degradation of LDL by a cell of the subject is increased.
  • Disclosed are methods of reducing plasma cholesterol comprising administering to a subject an effective amount of a composition comprising any one of the disclosed synthetic apolipoprotein E-mimicking peptides, wherein LDL cholesterol in the subject is lowered.
  • Disclosed are methods of reducing plasma cholesterol comprising administering to a subject an effective amount of a composition comprising any one of the disclosed synthetic apolipoprotein E-mimicking peptides, wherein binding of VLDL to a cell of the subject is enhanced.
  • Disclosed are methods of reducing plasma cholesterol comprising administering to a subject an effective amount of a composition comprising any one of the disclosed synthetic apolipoprotein E-mimicking peptides, wherein degradation of VLDL by a cell of the subject is increased.
  • Disclosed are methods of reducing plasma cholesterol comprising administering to a subject an effective amount of a composition comprising any one of the disclosed synthetic apolipoprotein E-mimicking peptides, wherein VLDL cholesterol in the subject is lowered.
  • Disclosed are methods of reducing plasma cholesterol comprising administering to a subject an effective amount of a composition comprising any one of the disclosed synthetic apolipoprotein E-mimicking peptides, wherein total plasma concentration of cholesterol in the subject is lowered.
  • Disclosed are methods of reducing plasma cholesterol comprising administering to a subject an effective amount of a composition comprising any one of the disclosed synthetic apolipoprotein E-mimicking peptides, wherein said synthetic apolipoprotein E-mimicking peptide is administered in an amount of about 0.01 mg/kg to about 12 mg/kg.
  • Disclosed are methods of reducing plasma cholesterol comprising administering to a subject an effective amount of a composition comprising any one of the disclosed synthetic apolipoprotein E-mimicking peptides, wherein the subject has coronary artery disease, rheumatoid arthritis, diabetes, Alzheimer's disease, PAD, cerebral vascular disease, diabetes- derived cardiovascular diseases , macular degeneration, congestive heart failure, and/or systemic lupus.
  • Also disclosed are methods of treating atherosclerosis comprising administering to a subject an effective amount of a composition comprising any one of the disclosed synthetic apolipoprotein E-mimicking peptides.
  • Disclosed are methods of treating atherosclerosis comprising administering to a subject an effective amount of a composition comprising any one of the disclosed synthetic apolipoprotein E-mimicking peptides, wherein the synthetic apolipoprotein E-mimicking peptide is administered as a composition comprising the synthetic apolipoprotein E- mimicking peptide and a pharmaceutically acceptable carrier.
  • Disclosed are methods of treating atherosclerosis comprising administering to a subject an effective amount of a composition comprising any one of the disclosed synthetic apolipoprotein E-mimicking peptides, wherein binding of LDL to a cell of the subject is enhanced.
  • Disclosed are methods of treating atherosclerosis comprising administering to a subject an effective amount of a composition comprising any one of the disclosed synthetic apolipoprotein E-mimicking peptides, wherein degradation of LDL by a cell of the subject is increased.
  • Disclosed are methods of treating atherosclerosis comprising administering to a subject an effective amount of a composition comprising any one of the disclosed synthetic apolipoprotein E-mimicking peptides, wherein LDL cholesterol in the subject is lowered.
  • Disclosed are methods of treating atherosclerosis comprising administering to a subject an effective amount of a composition comprising any one of the disclosed synthetic apolipoprotein E-mimicking peptides, wherein binding of VLDL to a cell of the subject is enhanced.
  • Disclosed are methods of treating atherosclerosis comprising administering to a subject an effective amount of a composition comprising any one of the disclosed synthetic apolipoprotein E-mimicking peptides, wherein degradation of VLDL by a cell of the subject is increased.
  • Disclosed are methods of treating atherosclerosis comprising administering to a subject an effective amount of a composition comprising any one of the disclosed synthetic apolipoprotein E-mimicking peptides, wherein VLDL cholesterol in the subject is lowered.
  • Disclosed are methods of treating atherosclerosis comprising administering to a subject an effective amount of a composition comprising any one of the disclosed synthetic apolipoprotein E-mimicking peptides, wherein total plasma concentration of cholesterol in the subject is lowered.
  • Disclosed are methods of treating atherosclerosis comprising administering to a subject an effective amount of a composition comprising any one of the disclosed synthetic apolipoprotein E-mimicking peptides, wherein said synthetic apolipoprotein E-mimicking peptide is administered in an amount of about 0.01 mg/kg to about 12 mg/kg.
  • Disclosed are methods of treating atherosclerosis comprising administering to a subject an effective amount of a composition comprising any one of the disclosed synthetic apolipoprotein E-mimicking peptides, wherein the subject has coronary artery disease, rheumatoid arthritis, diabetes, Alzheimer's disease, PAD, cerebral vascular disease, diabetes- derived cardiovascular diseases , macular degeneration, congestive heart failure, and/or systemic lupus.
  • Disclosed are methods for treating a subject with a Lipid Disorder the method comprising administering to the subject an effective amount of any one of the disclosed synthetic apolipoprotein E-mimicking peptides, or a composition thereof, wherein the synthetic apolipoprotein E-mimicking peptide is administered as a composition comprising the synthetic apolipoprotein E-mimicking peptide and a pharmaceutically acceptable carrier.
  • Disclosed are methods for treating a subject with a Lipid Disorder the method comprising administering to the subject an effective amount of any one of the disclosed synthetic apolipoprotein E-mimicking peptides, or a composition thereof, wherein degradation of LDL by a cell of the subject is increased.
  • methods for treating a subject with a Lipid Disorder the method comprising administering to the subject an effective amount of any one of the disclosed synthetic apolipoprotein E-mimicking peptides, or a composition thereof, wherein LDL cholesterol in the subject is lowered.
  • Disclosed are methods for treating a subject with a Lipid Disorder the method comprising administering to the subject an effective amount of any one of the disclosed synthetic apolipoprotein E-mimicking peptides, or a composition thereof, wherein the lipid disorder is coronary artery disease, rheumatoid arthritis, diabetes, Alzheimer's disease, PAD, cerebral vascular disease, diabetes-derived cardiovascular diseases, macular degeneration, congestive heart failure, and/or systemic lupus.
  • dosing regimens comprising at least one treatment cycle followed by a rest phase, wherein the treatment cycle comprises administering an effective amount of any of the disclosed Apo E-mimicking peptides to allow for a sustained therapeutic effect after withdrawal of the Apo E-mimicking peptide, wherein the Apo E- mimicking peptide is not administered during the rest phase.
  • the treatment cycle comprises administration of an effective amount of the Apo E-mimicking peptide once a week for three months.
  • the treatment cycle comprises administration of an effective amount of the Apo E-mimicking peptide once every two weeks for up to 12 weeks.
  • dosing regimens comprising at least one treatment cycle followed by a rest phase, wherein the treatment cycle comprises administering an effective amount of any of the disclosed Apo E-mimicking peptides to allow for a sustained therapeutic effect after withdrawal of the Apo E-mimicking peptide, wherein the Apo E-mimicking peptide is not administered during the rest phase, wherein the dosing regimen further comprises a second treatment cycle after the rest phase.
  • Also disclosed are methods of treating acute coronary syndrome (ACS) comprising administering to a subject an effective amount of any of the disclosed Apo E-mimicking peptides for at least one treatment cycle, wherein the treatment cycle comprises administering an effective amount of an Apo E-mimicking peptide to allow for a sustained therapeutic effect after withdrawal of the Apo E-mimicking peptide, wherein the treatment cycle is followed by a rest phase, wherein Apo E-mimicking peptide is not administered during the rest phase.
  • ACS acute coronary syndrome
  • ACS acute coronary syndrome
  • the treatment cycle comprises administering an effective amount of an Apo E-mimicking peptide to allow for a sustained therapeutic effect after withdrawal of the Apo E-mimicking peptide, wherein the treatment cycle is followed by a rest phase, wherein Apo E-mimicking peptide is not administered during the rest phase, wherein the rest phase is at least four weeks.
  • ACS acute coronary syndrome
  • the treatment cycle comprises administering an effective amount of an Apo E-mimicking peptide to allow for a sustained therapeutic effect after withdrawal of the Apo E-mimicking peptide, wherein the treatment cycle is followed by a rest phase, wherein Apo E-mimicking peptide is not administered during the rest phase, further comprising a second treatment cycle after the rest phase.
  • the second treatment cycle can be administered after a four week rest phase.
  • the second treatment cycle can be administered one year from the beginning of the initial treatment cycle.
  • ACS acute coronary syndrome
  • the treatment cycle comprises administering an effective amount of an Apo E-mimicking peptide to allow for a sustained therapeutic effect after withdrawal of the Apo E-mimicking peptide, wherein the treatment cycle is followed by a rest phase, wherein Apo E-mimicking peptide is not administered during the rest phase, further comprising a second treatment cycle after the rest phase, wherein an ACS therapeutic other than an Apo E-mimicking peptide is administered during the rest phase.
  • ACS acute coronary syndrome
  • ACS acute coronary syndrome
  • the treatment cycle comprises administering an effective amount of an Apo E-mimicking peptide to allow for a sustained therapeutic effect after withdrawal of the Apo E-mimicking peptide, wherein the treatment cycle is followed by a rest phase, wherein Apo E-mimicking peptide is not administered during the rest phase, further comprising a second treatment cycle after the rest phase, wherein an ACS therapeutic other than an Apo E-mimicking peptide is administered during the rest phase, wherein the ACS therapeutic other than an Apo E-mimicking peptide is a conventional LDL lowering therapy or HDL elevating therapy.
  • the conventional LDL lowering therapy can be a statin.
  • the HDL elevating therapy can be an Apo Al elevating drug, a CETP inhibitor, a phospholipase A2 inhibitor, an Apo Al Milano, or an Apo Al mimetic.
  • ACS acute coronary syndrome
  • the treatment cycle comprises administering an effective amount of an Apo E-mimicking peptide to allow for a sustained therapeutic effect after withdrawal of the Apo E-mimicking peptide, wherein the treatment cycle is followed by a rest phase, wherein Apo E-mimicking peptide is not administered during the rest phase, further comprising a second treatment cycle after the rest phase, wherein an ACS therapeutic other than an Apo E-mimicking peptide is administered during the rest phase, wherein the ACS therapeutic other than an Apo E-mimicking peptide is a conventional LDL lowering therapy or HDL elevating therapy, wherein the treatment cycle comprises administration of an effective amount of an Apo E-mimicking peptide once a week for three months.
  • monoclonal antibodies are also disclosed.
  • synthetic ApoE-mimicking peptides comprising a receptor binding domain of ApoE and a lipid-associating peptide, wherein the synthetic ApoE- mimicking peptide comprises an Ac -AHA, wherein the receptor binding domain of apolipoprotein E is scrambled.
  • synthetic apolipoprotein E-mimicking peptides consisting of a receptor binding domain of apolipoprotein E and a lipid-associating peptide, wherein receptor binding domain is covalently linked to said lipid-associating peptide, wherein both the receptor binding domain of apolipoprotein E and the lipid-associating peptide are scrambled.
  • FIG. 1 describes several strategies used to develop a highly effective peptide.
  • FIGs. 2A-2G shows the comparative analytical HPLC profiles of the indicated ApoE mimetic peptide analogs. Chromatography was carried out as follows: C-18 column - 250 x 4.6 mm; mobile phase was a gradient of 30-70% acetonitrile in water over 35 minutes (with 0.1% TFA).
  • the baseline level is the relative plasma cholesterol level at the time of dose administration.
  • the time points show the plasma cholesterol levels at the indicated times following a single dose administration.
  • a single dose was administered using a saline vehicle.
  • FIG. 4 shows the comparative analytical HPLC profiles of three active ApoE mimetic peptide analogs. Chromatography was carried out as follows: C-18 column - 250 x 4.6 mm; mobile phase was a gradient of 30-70% acetonitrile in water over 12 minutes (with 0.1% TFA).
  • FIGs. 5A-5B shows representative data for the effect of three active ApoE mimetic peptide analogs in reducing plasma cholesterol (% reduction) at a dose level was either 50 ⁇ g (FIG. 5A) or a dose level was either 100 ⁇ g (FIG. 5B).
  • the data show that AC-Aha-[R]hE18A-NH 2 is highly effective in reducing plasma cholesterol in ApoE-null mice at both 50 and 100 ⁇ g/mouse.
  • FIG. 6 shows a model for CH 3 -(CH 2 ) n -CO-(apoE mimetic peptide) molecules to more avidly attach to a lipid particle than an apoE mimetic peptide that does not comprise an alkyl carboxyl moiety, and thus provides a model for enhanced hepatic clearance.
  • FIG. 7 is a table showing experimental design.
  • ApoE-null mice were dosed with the peptides Ac-hel8A-NH 2 (AEM-28), Ac-[R]hel8A-NH 2 (AEM-28(R)), or Ac-Aha- [R]hel 8A-NH 2 (AES-21), in saline via tail vein injection at a concentration of lOOug/mouse.
  • Blood was collected via a cheek bleed at pre-dose, and at 1, 6 and 24 hours post dose. Serum samples can be analyzed for total serum cholesterol (using Waco total cholesterol kit).
  • FIGs. 8A and 8B are graphs showing total cholesterol (mg/dL) versus time (FIG. 8A) and total cholesterol (% of pre-dose) versus time (FIG. 8B), respectively.
  • FIG. 9 is a table showing the results from the mouse injections described in Figure 8.
  • FIG. 10 is a table showing the results of total serum cholesterol (as % of pre-dose level).
  • FIG. 11 shows an experimental design. ApoE-null mice were dosed with AC- hE18A-NH2 (AEM-28), AC-[R]hE18A-NH2 (AEM-28(R)), or AC-Aha-[R]hel 8A-NH2 (AES2-21), in saline via tail vein injection at a concentration of 50 ⁇ g/mouse. Blood was collected via a cheek bleed at pre-dose, and at 1, 6 and 24 hours post dose. Serum samples will be analyzed for total serum cholesterol (using a total cholesterol kit (Wako Chemicals USA, Inc., Richmond, VA)).
  • FIGs. 12A and 12B are graphs showing total cholesterol (mg/dL) vs time and total cholesterol (% of pre-dose) vs time, respectively.
  • AEM-28 saline indicates the peptide AC-hE18A-NH2
  • AEM- 28(R) saline indicates the peptide AC-[R]hE18A-NH2
  • AES2-21 indicates the peptide AC-Aha-[R]hel8A-NH2.
  • FIG. 13 is a table showing raw cholesterol values.
  • FIG. 14 is a table showing % of pre-dose cholesterol.
  • FIG. 15 shows representative data for the plasma triglyceride profile in a sucrose- fed rat model.
  • the data show that following two weeks of a diet containing 65% (w/v) sucrose there was an increase in triglyceride levels.
  • the study was carried out in male Sprague-Dawley rats.
  • FIG. 16 show representative data for the effect of disclosed synthetic apolipoprotein E-mimicking peptides on triglyceride levels in rats fed a high sucrose (65% (w/v)) diet for two weeks at the indicated times post-administration of the indicated peptide (in saline vehicle) or control (saline) via a single dose (via intravenous tail vein injection).
  • Control indicates rats administered administered saline
  • AEM-28 indicates rats administered (i.v. via tail vein) 5 mg/kg of the peptide Ac-hE18A-NH 2
  • R-AEM-28 indicates rats administered (i.v.
  • FIG. 17 show representative data for the effect of disclosed synthetic apolipoprotein E-mimicking peptides on triglyceride levels in rats fed a high sucrose (65% (w/v)) diet for two weeks at 48 h post-dosing with the indicated peptide or control (saline).
  • “Saline” indicates rats administered administered (i.v. via tail vein) saline;
  • “AEM-28” indicates rats administered (i.v. via tail vein) 5 mg/kg of the peptide Ac-hE18A-NH 2 ;
  • R-AEM-28 indicates rats administered (i.v.
  • FIG. 18 show representative data for the effect of disclosed synthetic apolipoprotein E-mimicking peptides on plasm cholesterol levels in rats fed a high sucrose (65% (w/v)) diet for two weeks at 48 h post-dosing with the indicated peptide or control (saline).
  • “Saline” indicates rats administered administered (i.v. via tail vein) saline;
  • “AEM-28” indicates rats administered (i.v. via tail vein) 5 mg/kg of the peptide Ac-hE18A-NH 2 ;
  • R-AEM-28 indicates rats administered (i.v.
  • FIG. 19 show representative data for the effect of disclosed synthetic apolipoprotein E-mimicking peptides on plasma glucose levels in rats at 48 h post-dosing with the indicated peptide (in saline vehicle) or control (saline).
  • the rats had been fed a high sucrose (65% (w/v)) diet for two weeks prior to peptide injection.
  • “Saline” indicates rats administered administered (i.v. via tail vein) saline
  • AEM-28 indicates rats administered (i.v. via tail vein) 5 mg/kg of the peptide AC-I1EI 8A-NH 2
  • R-AEM-28 indicates rats administered (i.v.
  • FIGs. 20A-20E shows representative analytical HPLC profiles for the indicated disclosed synthetic apolipoprotein E-mimicking peptides comprising a fatty acid moiety. Chromatography was carried out as follows: C-18 Vydac column - 250 x 4.6 mm; mobile phase was a gradient of water/acetonitrile (0.1% TFA), 35-70% in 12 minutes.
  • FIG. 21 shows representative data for the effect of for disclosed synthetic apolipoprotein E-mimicking peptides comprising a fatty acid moiety on plasma cholesterol levels (% reduction in plasma cholesterol).
  • the peptides administered in this study were dialyzed following synthesis without further HPLC purification. Baseline levels are the plasma cholesterol levels at the time of peptide administration. All peptides were administered via intravenous tail vein injection.
  • FIG. 22 shows representative data for the effect of for disclosed synthetic apolipoprotein E-mimicking peptides comprising a fatty acid moiety on plasma cholesterol levels.
  • the study was otherwise carried out as described for FIG. 21.
  • the indicated times are the times post-administration of a single 50 ⁇ g dose via intravenous tail vein injection.
  • FIG. 23 shows representative data for the effect of for disclosed synthetic apolipoprotein E-mimicking peptides comprising a fatty acid moiety on plasma cholesterol levels.
  • the study was otherwise carried out as described for FIG. 21.
  • the indicated times are the times post-administration of a single 50 ⁇ g dose via intravenous tail vein injection.
  • FIG. 24 show representative dose response data for the effect of myristoyl- LRRLRRRLLR- 18A-NH2 (i.e., myristoyl-LRRLRRRLLR-DWLKAFYDKVAEKLKEAF- NH2 (SEQ ID NO: 628)) on plasma cholesterol levels.
  • FIG. 25 show representative dose response data for the effect of myristoyl- LRRLRRRLLR- 18A-NH2 (i.e., myristoyl-LRRLRRRLLR-DWLKAFYDKVAEKLKEAF- NH2 (SEQ ID NO: 628)) on plasma cholesterol levels.
  • FIG. 26 shows data from the study described for FIG. 25 replotted in terms of maximum percent decrease in plasma cholesterol (at 5 hr) versus dose level ⁇ g). The data are show as closed circles with the line the result of a hyperbolic curve fit to the data.
  • FIG. 27 shows data from the study described for FIG. 25 replotted in terms of the percent decrease in plasma cholesterol at 24 hr versus dose level ⁇ g). The data are show as closed circles with the line the result of a hyperbolic curve fit to the data.
  • FIG. 28 show representative dose response data for the effect of octanoyl- LRRLRRRLLR- 18A-NH2 (i.e., octanoyl-LRRLRRRLLR-DWLKAFYDKVAEKLKEAF- NH2 (SEQ ID NO: 625)) on plasma cholesterol levels (mg/dL).
  • FIG. 29 show representative dose response data for the effect of octanoyl- LRRLRRRLLR- 18A-NH2 (i.e., octanoyl-LRRLRRRLLR-DWLKAFYDKVAEKLKEAF- NH2 (SEQ ID NO: 625)) on plasma cholesterol levels (percent of baseline plasma cholesterol levels).
  • the baseline level is the plasma cholesterol level at the time of the peptide administration.
  • the indicated doses were administered via intravenous tail vein injection.
  • FIG. 30 shows data from the study described for FIGs. 28-29 replotted in terms of maximum percent decrease in plasma cholesterol (at 5 hr) versus dose level ⁇ g). The data are show as closed circles with the line the result of a hyperbolic curve fit to the data.
  • FIG. 31 shows data from the study described for FIGs. 28-29 replotted in terms of the percent decrease in plasma cholesterol at 24 hr versus dose level ⁇ g). The data are show as closed circles with the line the result of a hyperbolic curve fit to the data.
  • Ranges may be expressed herein as from “about” one particular value, and/or to "about” another particular value.
  • the term “about” is used herein to mean approximately, in the region of, roughly, or around.
  • the term “about” modifies that range by extending the boundaries above and below the numerical values set forth.
  • the term “about” is used herein to modify a numerical value above and below the stated value by a variance of 20%.
  • another embodiment includes from the one particular value and/or to the other particular value.
  • values are expressed as approximations, by use of the antecedent "about,” it will be understood that the particular value forms another embodiment. It will be further understood that the endpoints of each of the ranges are significant both in relation to the other endpoint, and independently of the other endpoint.
  • amino acid sequence refers to a list of abbreviations, letters, characters or words representing amino acid residues.
  • the amino acid abbreviations used herein are conventional one letter codes for the amino acids and are expressed as follows: A, alanine; C, cysteine; D aspartic acid; E, glutamic acid; F, phenylalanine; G, glycine; H histidine; I isoleucine; K, lysine; L, leucine; M, methionine; N, asparagine; P, proline; Q, glutamine; R, arginine; S, serine; T, threonine; V, valine; W, tryptophan; and Y, tyrosine.
  • a residue of a chemical species refers to the moiety that is the resulting product of the chemical species in a particular reaction scheme or subsequent formulation or chemical product, regardless of whether the moiety is actually obtained from the chemical species.
  • an ethylene glycol residue in a polyester refers to one or more -OCH 2 CH 2 0- units in the polyester, regardless of whether ethylene glycol was used to prepare the polyester.
  • a sebacic acid residue in a polyester refers to one or more -CO(CH 2 ) 8 CO- moieties in the polyester, regardless of whether the residue is obtained by reacting sebacic acid or an ester thereof to obtain the polyester.
  • Peptide refers to any peptide, oligopeptide, polypeptide, gene product, expression product, or protein.
  • a peptide is comprised of consecutive amino acids.
  • the term “peptide” encompasses naturally occurring or synthetic molecules.
  • Apo E mimetic is interchangeable with apolipoprotein-E mimicking peptide.
  • Apo E mimetics are peptides that are related to, characteristic of, or mimic Apo E.
  • Apo E mimetics include Apo E peptides (i.e. peptides derived from full length Apo E).
  • reverse oriented refers to a peptide, or a portion of the peptide, has a reverse amino acid sequence as compared to a non-reverse oriented peptide (i.e., the original sequence is read (or written) from right to left).
  • a non-reverse oriented peptide i.e., the original sequence is read (or written) from right to left.
  • reverse analog or a peptide having its reverse sequence is as follows: EDCBA.
  • EDCBA In a dual domain peptide for example, Ac-hE-18A-NH2, either the hE sequence is read from right to left or the 18A sequence is read from right to left.
  • LRKLRKRLLR- DWLKAFYDKVAEKLKEAF (SEQ ID NO: l) can be RLLRKRLKRL- DWLKAFYDKVAEKLKEAF (SEQ ID NO:2) or LRKLRKRLLR- FAEKLKEAVKDYFAKLWD (SEQ ID NO:3).
  • a “dual-domain peptide”, a “dual-domain synthetic peptide”, or a “dual-domain Apo E mimicking peptide” is meant to mean a peptide comprising a lipid- associating peptide/domain and a receptor binding peptide/domain.
  • a "single-domain peptide”, a “single-domain synthetic peptide”, or a “single-domain Apo E mimicking peptide” is meant to mean a peptide comprising either a lipid-associating peptide/domain or a receptor binding peptide/domain, but not both.
  • domain switched As used herein "domain switched”, “switched domain”, or “switched” peptide is meant to mean that the lipid-associating peptide is covalently linked to the receptor binding domain of apolipoprotein E such that the lipid-associating peptide is at the N-terminus of the synthetic apolipoprotein E-mimicking peptide.
  • the peptide 18A-hE is exemplary of a domain switched peptide.
  • “scrambled” “scrambled version”, or “scrambled peptide” is meant to mean that the composition of the amino acid sequence is the same as the unscrambled peptide, however the sequence of the amino acids is altered thus rendering the peptide unable to form either an a-amphipathic helix or does not possess lipid associating (or HSPG associating) properties. However, in some cases, as described in this invention, the scrambled peptide remains able to form a different helical structure, such as a ⁇ -helix.
  • the scrambled version of the peptide could have the amino acid sequence DEABC.
  • Scrambled peptides are often denoted as having a "Sc" prior to the portion of the peptide that is scrambled.
  • Sc-hE-18A denoted that the hE portion of the peptide is scrambled.
  • sample is meant to mean an animal; a tissue or organ from an animal; a cell (either within a subject, taken directly from a subject, or a cell maintained in culture or from a cultured cell line); a cell lysate (or lysate fraction) or cell extract; or a solution containing one or more molecules derived from a cell or cellular material (e.g. a polypeptide or nucleic acid), which is assayed as described herein.
  • a sample may also be any body fluid or excretion (for example, but not limited to, blood, urine, stool, saliva, tears, bile) that contains cells or cell components.
  • subject refers to the target of administration, e.g. an animal.
  • the subject of the disclosed methods can be a vertebrate, such as a mammal.
  • the subject can be a human.
  • the term does not denote a particular age or sex.
  • Subject can be used interchangeably with “individual” or "patient”.
  • module is meant to mean to alter, by increasing or decreasing.
  • lipid binding domain E and “lipid-associating peptide” are used interchangeably. As used herein, both terms can mean the lipid binding domain of
  • isolated polypeptide or “purified polypeptide” is meant to mean a polypeptide (or a fragment thereof) that is substantially free from the materials with which the polypeptide is normally associated in nature.
  • the polypeptides of the invention, or fragments thereof can be obtained, for example, by extraction from a natural source (for example, a mammalian cell), by expression of a recombinant nucleic acid encoding the polypeptide (for example, in a cell or in a cell-free translation system), or by chemically synthesizing the polypeptide.
  • polypeptide fragments may be obtained by any of these methods, or by cleaving full length proteins and/or polypeptides.
  • 18A when used in the context of a peptide or peptide sequence refers to the peptide DWLKAFYDKVAEKLKEAF (SEQ ID NO:5).
  • the peptide sequence can occur as an isolated peptide, or as a sequence within a larger peptide sequence.
  • hE when used in the context of a peptide or peptide sequence refers to the peptide LRKLRKRLLR (SEQ ID NO:4).
  • the peptide sequence can occur as an isolated peptide, or as a sequence within a larger peptide sequence.
  • the peptide sequence can occur as an isolated peptide, or as a sequence within a larger peptide sequence.
  • aliphatic includes both saturated and unsaturated, straight chain (i.e., unbranched) or branched aliphatic hydrocarbons, which are optionally substituted with one or more functional groups.
  • aliphatic is intended herein to include, but is not limited to, alkyl, alkenyl, alkynyl moieties.
  • alkyl includes straight and branched alkyl groups.
  • lower alkyl is used to indicate those alkyl groups (substituted, unsubstituted, branched or unbranched) having about 1-6 carbon atoms.
  • Substituted alkyl refers to alkyl groups that are substituted with one or more functional groups. Substituents include, but are not limited to, any of the substituents mentioned below, i.e., the substituents recited below resulting in the formation of a stable compound.
  • alkenyl denotes a monovalent group derived from a hydrocarbon moiety having at least one carbon-carbon double bond by the removal of a single hydrogen atom.
  • C n As defined herein, "C n ,” where "n” is an integer, describes a hydrocarbon molecule or fragment (e.g., an alkyl group) wherein “n” denotes the number of carbon atoms in the fragment or molecule.
  • fatty acid is meant to encompass a mono carboxylic acid having an aliphatic chain ("tail"), wherein said aliphatic chain may be either saturated, mono- unsaturated (having one unsaturated bond anywhere on the aliphatic chain) or poly unsaturated (having at least two unsaturated bonds anywhere on the aliphatic chain).
  • An unsaturated bond on the aliphatic chain may be a double (in the cis and/or trans
  • the length of the aliphatic chain (being either saturated, monounsaturated or polyunsaturated) of a fatty acid may vary between 8 and 32 carbon atoms.
  • Fatty acids may be derived from a natural source (either an animal or plant source), synthetic source or semi-synthetic source.
  • fatty acid includes saturated fatty acids, which do not contain any double or triple bonds in the hydrocarbon chain.
  • Saturated fatty acids include, but are not limited to propionic acid (C3) (by way of example, C3 indicates propionic acid has 3 carbon atoms in its hydrocarbon chain; the number of carbon atoms in the hydrocarbon chain of other example fatty acids is denoted in analogous fashion herein), butyric acid (C4), valeric acid (C5), caproic acid (C6), enanthic acid (C7), caprylic acid (C8), pelargonic acid (C9), capric acid (CIO), undecylic acid (CI 1), lauric acid (C12), tridecylic acid (C13), myristic acid (CI 4), pentadecylic acid (CI 5), palmitic acid (CI 6), margaric acid (CI 7), stearic acid (CI 8), isostearic acid (CI 8), nonadecy
  • C3 propionic acid
  • fatty acid also includes monounsaturated fatty acids, which contain one double or triple bond in the hydrocarbon chain, and polyunsaturated fatty acids, which contain more than one double and/or triple bond in the hydrocarbon chain.
  • Such acids include, but are not limited to the omega 3, omega 6, omega 9 fatty acids, other fatty acids such as myristoleic and palmitoleic acid and conjugated fatty acids.
  • Examples of monounsaturated and polyunsaturated fatty acids include but are not limited to, (a) omega 3 fatty acids, such as hexadecatrienoic acid (C16:3); (by way of example, C16:3 indicates hexadecatrienoic acid has 16 carbon atoms in its hydrocarbon chain and 3 double bonds; the number of carbon atoms and double bonds in the hydrocarbon chain of other example unsaturated fatty acids is denoted in analogous fashion herein), alpha linolenic acid (CI 8:3) and eicosapentanoic acid (20:5), (b) omega 6 fatty acids, such as linoleic acid (18:2), docosadienoic acid (C22:2), arachidonic acid (C20:4) and tetracosatetraenoic acid (C24:5), (c) omega 9 fatty acids, such as oleic acid (C18: l), eicosenoic acid (C20: l
  • fatty acid also includes branched fatty acids.
  • branched fatty acids include, but are not limited to, monomethyl branched fatty acids, such as 14-methyl pentadecanoic acid, 6-methyl caprylic acid, 4-methyl-3-pentenoic acid, (pyroterebic acid), 2-methyl-2E-butenoic acid (tiglic acid), 2-methyl-2Z-butenoic acid (angelic acid), multimethyl branched acids, isoprenoid fatty acids (vittatalactone, all-trans- retinoic acid), branched methoxy fatty acids and hydroxy and other fatty acids such as 2- hydroxyoctanoic acid and 4-oxopentanoic acid (levulinic acid).
  • monomethyl branched fatty acids such as 14-methyl pentadecanoic acid, 6-methyl caprylic acid, 4-methyl-3-pentenoic acid, (pyroterebic acid), 2-methyl-2E-butenoic acid (tiglic acid), 2-methyl-2Z-buten
  • fatty acid also includes mixtures comprising fatty acids such as natural oils or fats which may comprise components that are not fatty acids.
  • Natural oils or fats understood to comprise mixtures of fatty acids include, but are not limited to, animal fats, soya bean oil, coconut oil, palm oil, palm kernel oil, rapeseed oil, cottonseed oil, linseed oil, sunflower oil, fish oil, algae oil, and the like.
  • ⁇ -amino-fatty acid refers to fatty acids which feature an amino group at the distal carbon of the hydrocarbon chain thereof.
  • the ⁇ -amino-fatty acid moieties that are used in the context of the present invention can be saturated or unsaturated hydrocarbon chains. These moieties have a carboxylic group at one end of the hydrocarbon chain and an amine group at the other.
  • the hydrocarbon chain connecting the carboxylic and amine groups in such an ⁇ -amino-fatty acid moiety typically has from 3 to 32 carbon atoms.
  • Exemplary ⁇ -amino-fatty acids include, without limitation, 4-amino-butyric acid, 6- amino-caproic acid, 8-amino-caprylic acid, 10-amino-capric acid (10-amino-decanoic acid), 12-amino-lauric acid (12-amino-dodecanoic acid), 14-amino-myristic acid (14-amino- tetradecanoic acid), 14-amino-myristoleic acid, 16-amino-palmitic acid (16-amino- hexadecanoic acid), 18-amino-stearic acid, 18-amino-oleic acid, 16-amino-palmitoleic acid, 18-amino-linoleic acid, 18-amino-linolenic acid and 20-amino-arachidonic acid.
  • Dosing regimen refers to at least one treatment cycle followed by at least one rest phase.
  • a dosing regimen can include more than one treatment cycle and more than one rest phase.
  • a dosing regimen can be a three month treatment cycle followed by a one year rest phase.
  • Another example can be a six month treatment cycle followed by a six month rest phase and then a three month treatment cycle followed by a one year rest phase.
  • Dose or “dosage” as used herein refers to a specific quantity of a therapeutic agent, such as an Apo E mimetic, that is taken at specific times.
  • treat is meant to mean administer one of the disclosed
  • compositions to a subject such as a human or other mammal (for example, an animal model), that has atherosclerosis, in order to prevent or delay a worsening of the effects of the disease or condition, or to partially or fully reverse the effects of the disease.
  • prevent is meant to mean minimize the chance that a subject who has an increased susceptibility for developing atherosclerosis will develop atherosclerosis.
  • treatment cycle refers to the administration of Apo E mimetics for an established period of time.
  • a treatment cycle includes a wide range of dosages of Apo E mimetics as well as different lengths of time for administering the Apo E mimetics.
  • a treatment cycle can be a three month period wherein an Apo E mimetic is administered twice a week for the three month period.
  • an effective amount is meant to mean a sufficient amount of the composition or Apo E mimetic to provide the desired effect.
  • an effective amount of an Apo E mimetic can be an amount that provides a therapeutic affect and provides sustained therapeutic effects after withdrawal of the treatment.
  • An effective amount of an Apo E mimetic is an amount that is able to cause a benefit illustrated by a decrease in atherosclerosis, a decrease in artery wall stiffness, a decrease in isolated systolic
  • sustained therapeutic effect is a therapeutic effect that persists after the therapeutic has been withdrawn. For example, the sustained therapeutic effect is maintained even after the acute cholesterol lowering effect is gone.
  • Rapid phase refers to a period of time wherein an Apo E mimetic is not administered.
  • Atherosclerotic burden is the amount of atherosclerosis in the arteries of a patient. This may include the coronary, carotid, peripheral and other arteries.
  • the atheroma may be complex lesions with a smooth muscle and collagen containing fibrous cap, areas of calcification, cholesterol crystals and cholesterol laden macrophages (foam cells) and/or less complex and more unstable lesions with less calcification and a thinner fibrous cap, and more foam cells and cholesterol (unstable lesions).
  • the unstable lesions may intrude into the lumen of the artery or expand away from the lumen of the artery.
  • lipid disorder is meant to mean when a subject has an excess of lipids or increased inflammatory lipids in their blood.
  • Lipids include, but are not limited to lipids such as ox-LDL (i.e., oxidized PAPC (1-palmitoyl 2-arachidonyl phophyatidyl choline)). Oxidation of PAPC or PLPC, the lipid components of LDL, produce oxidized lipids. Having a lipid disorder can make one more likely to develop inflammatory disease such as atherosclerosis and heart disease. Lipid disorders can be caused by genetic predispositions or diet.
  • lipoprotein or lipoproteins
  • lipoproteins is meant to mean a biochemical assembly that contains both proteins and lipids.
  • the lipids or their derivatives may be covalently or non-covalently bound to the proteins.
  • Many enzymes, transporters, structural proteins, antigens, adhesins, and toxins are lipoproteins. Examples include the high density and low density lipoproteins of the blood, the transmembrane proteins of the mitochondrion and the chloroplast, and bacterial lipoproteins
  • high-density lipoprotein is meant to mean a class of lipoproteins, varying somewhat in their size (8-11 nm in diameter), that can transport cholesterol.
  • HDL cholesterol is cholesterol that is associated with HDLs. About one-fourth to one-third of blood cholesterol is carried by high-density lipoprotein (HDL).
  • HDL cholesterol is known as "good” cholesterol, because high levels of HDL seem to protect against heart attack.
  • Low levels of HDL (less than 40 mg/dL in men and less than 50 mg/dL in women) also increase the risk of heart disease. Medical experts think that HDL tends to carry cholesterol away from the arteries and back to the liver, where it is passed from the body. Some experts believe that that HDL removes excess cholesterol from arterial plaque, thus slowing its buildup
  • VLDL very Low Density Lipoproteins
  • LDL low density lipoprotein
  • low-density lipoprotein or “LDL” is meant to mean a lipoprotein that varies in size (approx. 22 nm) and can contain a changing number of triglycerides and cholesteryl esters they actually have a mass and size distribution.
  • Each native LDL particle contains a single apolipoproteinB-100 molecule (Apo B-100, a protein with 4536 amino acid amino acid residues) and a phospholipid coat that circles the triglycerides and cholesteryl esters, keeping them soluble in the aqueous environment.
  • LDL is commonly referred to as bad cholesterol.
  • LDL cholesterol is cholesterol that is associated with LDLs.
  • LDL cholesterol When too much LDL cholesterol circulates in the blood, it can slowly build up in the inner walls of the arteries that feed the heart and brain. Together with other substances, it can form plaque, a thick, hard deposit that can narrow the arteries and make them less flexible. This condition is known as atherosclerosis. If a clot forms and blocks a narrowed artery, then heart attack or stroke can result.
  • Cholesterol cannot dissolve in the blood. It has to be transported to and from the cells by carriers called lipoproteins. LDLs and HDLs along with triglyceride-rich lipoproteins (VLDL) and Lp(a) cholesterol, make up your total cholesterol count, which can be determined through a blood test.
  • VLDL triglyceride-rich lipoproteins
  • Lp(a) cholesterol make up your total cholesterol count, which can be determined through a blood test.
  • nucleic acid refers to a naturally occurring or synthetic oligonucleotide or polynucleotide, whether DNA or RNA or DNA-RNA hybrid, single- stranded or double-stranded, sense or antisense, which is capable of hybridization to a complementary nucleic acid by Watson-Crick base-pairing.
  • Nucleic acids of the invention can also include nucleotide analogs (e.g., BrdU), and non-phosphodiester internucleoside linkages (e.g., peptide nucleic acid (PNA) or thiodiester linkages).
  • nucleic acids can include, without limitation, DNA, RNA, cDNA, gDNA, ssDNA, dsDNA or any combination thereof
  • apolipoprotein E-mimicking peptides or Apo E mimetics Disclosed are apolipoprotein E-mimicking peptides or Apo E mimetics. Non- limiting examples of the Apo E-mimicking peptides are provided herein.
  • the Apo E- mimicking peptides can be single domain or dual domain peptides. Compositions containing the Apo E-mimicking peptides are also disclosed.
  • lipid-associating peptides comprising a receptor binding domain of ApoE and a lipid-associating peptide, wherein the synthetic ApoE-mimicking peptide comprises an Ac-Aha, wherein the Ac -Aha is at the N-terminus of the peptide.
  • the Aha can be inserted between the lipid-associating peptide comprises a class A amphipathic -helical domain.
  • lipid-associating peptides comprising a receptor binding domain of ApoE and a lipid-associating peptide, wherein the synthetic ApoE-mimicking peptide comprises an Ac-Aha, wherein the lipid-associating peptide comprises a class A amphipathic -helical domain.
  • the class A amphipathic -helical domain is DWLKAFYDKVAEKLKEAF (SEQ ID NO:5), DWLRAFYDKVAEKLREAF (SEQ ID NO:618), DWLRALYDKVAEKLREAL (SEQ ID NO:619), DLLRALYDKVAEKLREAW (SEQ ID NO:620), or FAEKLKEAVKDYFAKLWD (SEQ ID NO:616).
  • [0145] Disclosed are synthetic ApoE-mimicking peptides comprising a receptor binding domain of ApoE and a lipid-associating peptide, wherein the synthetic ApoE-mimicking peptide comprises an Ac-Aha, wherein the lipid-associating peptide comprises a class A amphipathic -helical domain, wherein the receptor binding domain of ApoE can be covalently linked to the lipid-associating peptide.
  • apolipoprotein E can be from a species selected from the group consisting of human, mouse, rabbit, monkey, rat, bovine, pig and dog.
  • LRKLRKRLLR SEQ ID NO:4
  • LRRLRRRLLR SEQ ID NO: 11
  • LRKMRKRLMR SEQ ID NO: 7
  • RLTRKRGLK SEQ ID NO: 13
  • the receptor binding domain of ApoE can also be, but is not limited to, LRKLRKRFFR (SEQ ID NO:4), LRKLPKRLLR (SEQ ID NO:8), LRNVRKRLVR (SEQ ID NO:9), MRKLRKRVLR (SEQ ID NO: 10),
  • LRRLRRRLLR SEQ ID NO: 11
  • LRKLRKRFFR SEQ ID NO: 12
  • LRKLRKRLLR SEQ ID NO:4
  • LRKMRKRLMR SEQ ID NO:7
  • LRKLRKRLLR SEQ ID NO:4
  • LRRLRRRLLR SEQ ID NO: 11
  • LRKMRKRLMR SEQ ID NO: 7
  • RLTRKRGLK SEQ ID NO: 13
  • LRRMRRRLMR SEQ ID NO: 621
  • RLTRRRGK RLTRRRGK
  • [0150] Disclosed are synthetic ApoE-mimicking peptides comprising a receptor binding domain of ApoE and a lipid-associating peptide, wherein the synthetic ApoE-mimicking peptide comprises an Ac-Aha, wherein the synthetic ApoE-mimicking peptide can be Ac- Aha-hE18A-NH 2 or Ac-Aha-[R]hE18A-NH 2 .
  • the ApoE-mimicking peptide of Ac-Aha- hE18A-NH 2 is Ac-Aha-LRKLRKRLLR-DWLKAFYDKVAEKLKEAF-NH 2 (SEQ ID NO: l).
  • the ApoE-mimicking peptide of Ac-Aha-[R]hE18A-NH 2 is Ac-Aha- LRRLRRRLLR-DWLKAFYDKVAEKLKEAF-NH 2 . (SEQ ID NO:662)
  • lipid-associating peptide comprising a receptor binding domain of ApoE and a lipid-associating peptide, wherein the synthetic ApoE-mimicking peptide comprises a fatty acid moiety, ⁇ -amino fatty acid moiety, or an acetylated ⁇ -amino fatty acid moiety.
  • ⁇ -amino fatty acid moiety can be inserted between the lipid-associating peptide comprises a class A
  • amphipathic -helical domain amphipathic -helical domain.
  • lipid-associating peptides comprising a receptor binding domain of ApoE and a lipid-associating peptide
  • the synthetic ApoE-mimicking peptide comprises a fatty acid moiety, ⁇ -amino fatty acid moiety, or an acetylated ⁇ -amino fatty acid moiety
  • the lipid-associating peptide comprises a class A amphipathic- helical domain.
  • the class A amphipathic-helical domain is
  • DWLKAFYDKVAEKLKEAF (SEQ ID NO:5), DWLRAFYDKVAEKLREAF (SEQ ID NO:618), DWLRALYDKVAEKLREAL (SEQ ID NO:619), DLLRALYDKVAEKLREAW (SEQ ID NO:620), or FAEKLKEAVKDYFAKLWD (SEQ ID NO:616).
  • [0154] Disclosed are synthetic ApoE-mimicking peptides comprising a receptor binding domain of ApoE and a lipid-associating peptide, wherein the synthetic ApoE-mimicking peptide comprises a fatty acid moiety, ⁇ -amino fatty acid moiety, or an acetylated ⁇ -amino fatty acid moiety, wherein the lipid-associating peptide comprises a class A amphipathic- helical domain, wherein the receptor binding domain of ApoE can be covalently linked to the lipid-associating peptide.
  • apolipoprotein E can be from a species selected from the group consisting of human, mouse, rabbit, monkey, rat, bovine, pig and dog.
  • [0156] Disclosed are synthetic ApoE-mimicking peptides comprising a receptor binding domain of ApoE and a lipid-associating peptide, wherein the synthetic ApoE-mimicking peptide comprises a fatty acid moiety, ⁇ -amino fatty acid moiety, or an acetylated ⁇ -amino fatty acid moiety, wherein said synthetic peptide is protected using an amide group at the C- terminus.
  • RNA binding domain of ApoE can be LRKLRKRLLR (SEQ ID NO:4), LRRLRRRLLR (SEQ ID NO: 11), LRKMRKRLMR (SEQ ID NO:7), or RLTRKRGLK (SEQ ID NO: 13).
  • the receptor binding domain of ApoE can also be, but is not limited to, LRKLRKRFFR (SEQ ID NO:4), LRKLPKRLLR (SEQ ID NO:8),
  • LRNVRKRLVR (SEQ ID NO:9), MRKLRKRVLR (SEQ ID NO: 10), LRRLRRRLLR (SEQ ID NO: 11), LRKLRKRFFR (SEQ ID NO: 12), LRKLRKRLLR (SEQ ID NO:4), or
  • lipid-associating peptide comprising a receptor binding domain of ApoE and a lipid-associating peptide
  • the synthetic ApoE-mimicking peptide comprises a fatty acid moiety, ⁇ -amino fatty acid moiety, or an acetylated ⁇ -amino fatty acid moiety
  • the receptor binding domain of ApoE can be LRKLRKRLLR (SEQ ID NO:4), LRRLRRRLLR (SEQ ID NO: 11), LRKMRKRLMR (SEQ ID NO:7), RLTRKRGLK (SEQ ID NO: 13), LRRMRRRLMR (SEQ ID NO:621), or RLTRRRGK (SEQ ID NO:622).
  • synthetic ApoE-mimicking peptides comprising a receptor binding domain of ApoE and a lipid-associating peptide, wherein the synthetic ApoE-mimicking peptide comprises a fatty acid moiety, ⁇ -amino fatty acid moiety, or an acetylated ⁇ -amino fatty acid moiety, wherein the synthetic ApoE-mimicking peptide can be: butanoyl-
  • LRRLRRRLLR-DWLKAFYDKVAEKLKEAF-NH 2 (SEQ ID NO: 638); erucoyl- LRRLRRRLLR-DWLKAFYDKVAEKLKEAF-NH 2 (SEQ ID NO: 6239); cetoleoyl- LRRLRRRLLR-DWLKAFYDKVAEKLKEAF-NH 2 (SEQ ID NO: 640); nervonoyl- LRRLRRRLLR-DWLKAFYDKVAEKLKEAF-NH 2 (SEQ ID NO: 641); adrenoyl- LRRLRRRLLR-DWLKAFYDKVAEKLKEAF-NH 2 (SEQ ID NO: 642); a-linolenoyl- LRRLRRRLLR-DWLKAFYDKVAEKLKEAF-NH 2 (SEQ ID NO: 643); ⁇ -linolenoyl- LRRLRRRLLR-DWLKAFYDKVA
  • EPA indicates a moiety derived from 5,8, 11, 14, 17- eicosapentaenoic acid
  • DHA indicates a moiety derived from 4,7, 10, 13,16, 19- docosahexaenoic acid.
  • [0160] Disclosed are synthetic ApoE-mimicking peptides comprising a receptor binding domain of ApoE and a lipid-associating peptide, wherein the synthetic ApoE-mimicking peptide comprises a fatty acid moiety derived from a natural oil or fat, e.g. fish oil, wherein the synthetic ApoE-mimicking peptide can be: (fish oil)-LRRLRRRLLR- DWLKAFYDKVAEKLKEAF-NH 2 (SEQ ID NO:663).
  • (fish oil) indicates that the fatty acids in fish oil, including, but not limited to, fish oil components such as EPA and DHA, are linked to linked to the peptide LRRLRRRLLR (SEQ ID NO: 11).
  • the synthetic ApoE-mimicking peptide is a mixture of peptides comprising fatty acid groups derived from the fish oil used to prepare them.
  • the synthetic ApoE-mimicking peptide can be any of the disclosed peptides comprising a fatty acid.
  • the synthetic ApoE-mimicking peptide can be any of the disclosed peptides comprising an acetylated fatty acid.
  • synthetic apolipoprotein E-mimicking peptide consisting of: a receptor binding domain of apolipoprotein E and a lipid-associating peptide, wherein receptor binding domain is covalently linked to said lipid-associating peptide, wherein both the receptor binding domain of apolipoprotein E and the lipid-associating peptide are scrambled.
  • Examples of scrambled receptor binding domains of ApoE and scrambled lipid-associating peptides are provided below.
  • Apolipoprotein E-mimicking peptides have both direct cholesterol lowering effects by providing an alternative ligand for receptors on the liver to clear atherogenic
  • Apolipoprotein B containing lipoproteins (LDL, VLDL, and ⁇ -VLDL), and direct beneficial effects on the artery wall.
  • LDL, VLDL, and ⁇ -VLDL lipoproteins
  • New, more effective methods of imaging coronary atherosclerosis allow for direct measurement of benefits to the artery wall (Van Velzen, et al. Hellenic J Cardiol 50: 245-263, 2009).
  • the Apo E-mimicking peptides can enhance the removal of cholesterol from the artery wall, working in conjunction with HDL, increasing the formation of lipid poor pre -HDL that accept cholesterol from macrophages.
  • the Apo E-mimicking peptides can stimulate macrophage-mediated clearance of dead and dying cells in the artery wall (efferocytosis), improve the quality of HDL by increasing PON-1 levels and bringing down plasma lipid hydroperoxide levels, decrease macrophage content in atherosclerotic lesions resulting in more stable lesions, and decrease inflammation in the artery wall.
  • the Apo E-mimicking peptides reduce the size of atherosclerotic lesions more rapidly than apoA-I mimetic peptides and more rapidly than the statins (HMG-CoA reductase inhibitors). Atherosclerotic lesion regression persists in Apo E-mimicking peptides treated animals even when cholesterol levels are the same as in saline treated animals. Thus, the effects cannot be simply explained by cholesterol lowering.
  • Apolipoprotein E plays an important role in the metabolism of triglyceride- rich lipoproteins, such as very low density lipoprotein (VLDL) and chylomicrons.
  • Apolipoprotein E mediates the high affinity binding of Apo E-containing lipoproteins to the low density lipoprotein (LDL) receptor (Apo B, E receptor) and the members of its gene family, including LDL receptor related protein (LRP), very low density lipoprotein receptor (VLDLR) and the Apo E2 receptor (Apo E2R) (Mahley, R. W., (1988) Science 240, 622- 630).
  • LRP LDL receptor related protein
  • VLDLR very low density lipoprotein receptor
  • Apo E2R Apo E2 receptor
  • the 22 kDa amino terminal domain has been shown by X- ray crystallographic studies to be a 4-helix bundle (Wilson, C, et al. Science 1991 ;252: 1817- 1822) and to contain a positively-charged receptor binding domain.
  • VLDL very low-density lipoprotein
  • the apolipoprotein must associate with the lipoprotein surface; this is enabled by the C-terminal amphipathic helical region. If the 4-helix bundle that contains the positively charged receptor-binding domain does not open up on the lipoprotein surface, then the VLDL is defective in binding to receptors.
  • the positively charged arginine (Arg)-rich cluster domain of the Apo E and the C-terminal amphipathic helical domain are both required for the enhanced uptake of atherogenic Apo E-containing lipoproteins.
  • Apo E is secreted as a 299 amino acid residue protein with a molecular weight of 34,200. Based on thrombin cleavage of Apo E into two fragments, a two-domain hypothesis was initially suggested to explain the fact that the C-terminal region of Apo E (192-299) is essential for its binding to hypertriglyceridemic VLDL and the N-terminal 22 kDa domain (1- 191), binds to the LDL-R (Bradley, W. A., et al, (1986) J. Lipid Res. 27, 40-48).
  • a minimal arginine-rich Apo E receptor binding domain (141-150) was sufficient to enhance low density lipoprotein (LDL) and very low density lipoprotein (VLDL) uptake and clearance when covalently linked to a class A amphipathic helix
  • LDL low density lipoprotein
  • VLDL very low density lipoprotein
  • a peptide was synthesized in which the receptor binding domain of human Apo E, LRKLRKRLLR (SEQ ID NO:4) (hApo E[141-150] also referred to as "hE"), was linked to 18A, a well characterized high affinity lipid-associating peptide
  • hApo E[141-150]-18A also referred to as "hE-18A”
  • hE-18A also referred to as "hE-18A”
  • U.S. Patent No. 6,506,880 which is hereby incorporated by reference in its entirety for its teaching of specific Apo E mimetics and their uses.
  • Also synthesized was an end protected analog of hE-18A, denoted Ac-hE18A-NH2.
  • LRKMRKRLMR (SEQ ID NO:7)-18A (also referred to as "mE18A"), whereby the receptor binding domain of human Apo E was modified to substitute arginine (R) residues for lysine (K) residues at positions 143 and 146 (LRRLRRRLLR; SEQ ID NO: 11) and whereby the receptor binding domain of mouse Apo E (LRKMRKRLMR; SEQ ID NO: 7), were linked to 18A, respectively.
  • the effect of the dual character peptides on the uptake and degradation of human LDL/VLDL by cells was then determined.
  • LRP LDL receptor related protein
  • the disclosed peptides can be linked to a fatty acid moiety, an ⁇ -amino fatty acid moiety, or an acetylated ⁇ -amino fatty acid moiety.
  • the fatty acid moiety, the ⁇ -amino fatty acid moiety, or the acetylated ⁇ -amino fatty acid moiety is linked to a disclosed peptide via the N-terminal amino group of the peptide.
  • the linkage between the fatty acid moiety, the ⁇ -amino fatty acid moiety, or the acetylated ⁇ -amino fatty acid moiety and the N-terminal amino group of the peptide has the a structure represented by the following formulas, respectively: wherein A is an aliphatic group have 2-32 carbon atoms..
  • the aliphatic group is an alkyl group.
  • the aliphatic group comprises 0-3 double bonds.
  • the aliphatic group is an alkenyl group.
  • the fatty acid moiety linked to the disclosed peptide is derived from a purified fatty acid. In a still further aspect, the fatty acid moiety linked to the disclosed peptide is derived from a saturated fatty acid. In a yet further aspect, the fatty acid moiety linked to the disclosed peptide is derived from an unsaturated fatty acid. In an even further aspect, the unsaturated fatty acid is a polyunsaturated fatty acid with two or more double bonds.
  • the synthetic ApoE-mimicking peptide comprises a fatty acid moiety.
  • Exemplary fatty acids from which a fatty acid moiety is derived include, without limitation, butyric acid, caproic acid, caprylic acid, capric acid, decanoic acid, lauric acid, myristic acid, palmitic acid, pentadecanoic acid, stearic acid, arachidic acid, behenic acid, erucic acid, lignoceric acid, margaric acid, myristoleic acid, palmitoleic acid, oleic acid, gadoleic acid, ricinoleic acid, vaccenic acid, linoleic acid, linolenic acid, alpha-linolenic acid, gamma-linolenic acid, licanic acid, margaroleic acid, arachidic acid, gadoleic acid, nervonic acid, arachidonic acid, docosapentaenoic (DPA), eicosapentaenoic acid (EPA),
  • DPA do
  • DHA docosahexaenoic acid
  • Exemplary saturated fatty acids include, but are not limited to, propanoic acid, butanoic acid, pentanoic acid, hexanoic acid, heptanoic acid, octanoic acid, nonanoic acid, decanoic acid, undecanoic acid, dodecanoic acid, tridecanoic acid, tetradecanoic acid, pentadecanoic acid, hexadecanoic acid, heptadecanoic acid, octadecanoic acid, nonadecanoic acid, eicosanoic acid, heneicosanoic acid, docosanoic acid, tricosanoic acid, tetracosanoic acid, pentacosanoic acid, hexacosanoic acid, heptacosanoic acid, octacosanoic acid, nonacosanoic acid, triacont
  • Exemplary unsaturated fatty acids include, but are not limited to, myristoleic acid, palmitoleic acid, sapienic acid, oleic acid, linoleic acid, a-linolenic acid, arachidonic acid, eicosapentaenoic acid (EPA), erucic acid, docosahexaenoic acid (DHA), and
  • the fatty acid moiety linked to the disclosed peptide is derived from an unpurified fatty acid or mixture of fatty acids such as natural oil or fat.
  • a natural oil or fat is a heterogeneous mixture of generally hydrophobic compounds comprising one or more fatty acids.
  • the fatty acid source may comprise a natural oil or fat, such as (but not limited to) animal fats, biological oils, or vegetable oils such as soya bean oil, coconut oil, palm oil, palm kernel oil, rapeseed oil, cottonseed oil, linseed oil, sunflower oil, fish oil, algae oil, and the like.
  • the natural oil or fat is one that contains or is enriched for one or more omega-3 fatty acids, for example, marine oil, for example, fish oil, krill oil and algae oil. Any oil containing DHA and/or EPA can be used.
  • the natural oil or fat contains at least 70% or about 70%, by weight, DHA, for example, at least 75% or about 75%, at least 80% or about 80%, at least 85% or about 85%, or at least 90% or about 90%, by weight, DHA.
  • the natural oil or fat contains between 5% or about 5% and 15% or about 15% EPA, for example, 5, 6, 7, 8, 9, 10, 1 1, 12, 13, 14 or 15%, by weight, EPA.
  • the natural oil or fat contains not more than 10% or about 10% EPA or less than 10% or about 10%, EPA.
  • the fatty acid moiety is derived from an omega-3 fatty acid.
  • omega-3 polyunsaturated fatty acid(s) or “omega-3 fatty acid” refers to a family of unsaturated fatty carboxylic acids that have in common a carbon-carbon bond in the n-3 position (i.e., the third bond from the methyl end of the molecule). Typically, they contain from about 16 to about 24 carbon atoms and from three to six carbon-carbon double bonds. Omega-3 polyunsaturated fatty acids can be found in nature, and these natural omega- 3 polyunsaturated fatty acids frequently have all of their carbon-carbon double bonds in the cis-configuration.
  • omega-3 fatty acids include, but are not limited to, 7,10, 13- hexadecatrienoic acid (sometimes abbreviated as 16:3 (n-3)); 9, 12, 15-octadecatetrienoic acid (a-linolenic acid (ALA), 18:3 (n-3)); 6,9,12, 15-octadecatetraenoic acid (stearidonic acid (STD), 18:4 (n-3)); 1 1, 14, 17-eicosatrienoic acid (eicosatrienoic acid (ETE), 20:3 (n-3)); 8, 11,14,17-eicosatetraenoic acid (eicosatetraenoic acid (ETA), 20:4 (n-3)); 5,8, 1 1, 14, 17- eicosapentaenoic acid (eicosapentaenoic acid (EPA), (20:5 (n-3)); 7, 10, 13, 16,19- docosapentaenoic acid (docosap
  • a fatty acid comprises a chain length between C6 and C24, CIO and C24, CIO and C28, or CIO and C32, including synthetic fatty acids with odd carbon numbers.
  • a fatty acid comprises a chain length selected from the group consisting of: CIO, C12, C14, C16, C18, C20, C20, C22 and C24.
  • the fatty acid has a chain length selected from the group consisting of CI 4, CI 6 and CI 8.
  • the fatty acid has a chain length selected from the group consisting of C13, C15 and C17.
  • the fatty acid has between 4 and 28 carbons.
  • the fatty acid aliphatic chain comprises 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, or 32 carbon atoms.
  • the fatty acid is a naturally-occurring fatty acid.
  • the fatty acid is a short chain fatty acid (e.g., less than six carbons), a medium chain fatty acid (e.g., 6-12 carbons), long chain fatty acids (e.g., longer than 12 carbons), or a very long chain fatty acid (e.g., longer than 22 carbons).
  • the fatty acid is an unsaturated fatty acid in the cis configuration.
  • the fatty acid is an unsaturated fatty acid in the trans configuration.
  • the synthetic ApoE-mimicking peptide comprises a ⁇ -amino fatty acid moiety.
  • Exemplary ⁇ -amino-fatty acid moieties are derived from ⁇ -amino-fatty acids including, without limitation, 4-amino-butyric acid, 6-amino-caproic acid, 8-amino-caprylic acid, 10-amino-capric acid (10-amino-decanoic acid), 12-amino-lauric acid (12-amino- dodecanoic acid), 14-amino-myristic acid (14-amino-tetradecanoic acid), 14-amino- myristoleic acid, 16-amino-palmitic acid (16-amino-hexadecanoic acid), 18-amino-stearic acid, 18-amino-oleic acid, 16-amino-palmitoleic acid, 18-amino-linoleic acid, 18-amino- linolenic acid and 20-amino-arachidonic acid.
  • the ⁇ -amino-fatty acids including
  • the ⁇ -amino fatty acid moiety is 4-amino-butanoyl, 6-amino- caproyl, 8-amino-octanoyl, 10-amino-decanoyl, 12-amino-lauroyl, 14-amino-myristoyl, 14- amino-myristoleoyl, 16-amino-palmiteoyl, 18-amino-stearoyl, 18-amino-oleoyl, 16-amino- palmitoleoyl, 18-amino-linoleoyl, 18-amino-linolenoyl, or 20-amino-arachidonoyl.
  • ⁇ -amino fatty acid moiety is 6-amino-caproyl (or alternatively referred to as 6- amino hexanoyl).
  • the ⁇ -amino-fatty acid moiety is derived from a ⁇ -amino-fatty acid having the structure:
  • A is an aliphatic group have 2-32 carbon atoms.
  • the aliphatic group is an alkyl group.
  • the aliphatic group comprises 0-3 double bonds.
  • the aliphatic group is an alkenyl group.
  • A is -(CH 2 ) 5 -.
  • the ⁇ -amino-fatty acid moiety is linked to the peptide via the N- terminal amino group of the peptide, and following linking to the peptide, the ⁇ -amino-fatty acid moiety has the structure:
  • A is an aliphatic group have 2-32 carbon atoms.
  • the aliphatic group is an alkyl group.
  • the aliphatic group comprises 0-3 double bonds.
  • the aliphatic group is an alkenyl group.
  • A is -(CH 2 ) 5 -.
  • the synthetic ApoE-mimicking peptide comprises an acetylated ⁇ -amino fatty acid moiety.
  • the disclosed peptides can be linked any of the disclosed ⁇ -amino-fatty acids, and then further comprise an acetyl moiety on the ⁇ -amino group.
  • the ⁇ -amino-fatty acid moiety is linked to the peptide via the N- terminal amino group of the peptide, and following linking to the peptide, the ⁇ -amino group is acetylated, and the ⁇ -amino-fatty acid moiety has the structure:
  • A is an aliphatic group have 2-32 carbon atoms.
  • the aliphatic group is an alkyl group.
  • the aliphatic group comprises 0-3 double bonds.
  • the aliphatic group is an alkenyl group.
  • A is -(CH 2 ) 5 -.
  • fatty acids from which the fatty acid moiety is derived are commercially available and can be prepared by different chemical methods (Recent Developments in the Synthesis of Fatty Acid Derivatives, Editors: Knothe G and Derksen JTB, AOCS Press 1999, ISBN 1-893997-00-6.)
  • the single-domain synthetic Apo E mimetics can consist of a receptor binding domain of Apo E or a lipid- associating peptide.
  • the receptor binding domain peptide for the synthetic Apo E mimetics can be a human receptor binding domain peptide of Apo E.
  • receptor binding domain peptide of the disclosed synthetic Apo E mimetics can comprise the amino acid sequence of LRKLRKRLLR, LRRLRRRLLR, or LRKLRKRFFR.
  • the receptor binding domain peptide of such synthetic Apo E mimetics can also be from a species selected from the group consisting of mouse, rabbit, monkey, rat, bovine, pig and dog.
  • the receptor binding domain peptide for the synthetic Apo E mimetics can also be the LDL receptor (LDLR) binding domain of apolipoprotein B (ApoB).
  • the LDL receptor (LDLR) binding domain of ApoB can have the sequence RLTRKRGLK.
  • ApoB- 100 is a 550,000 Da glycoprotein with nine amino acids (3359-3367) serving as the binding domain for the LDL receptor (Segrest et al, J. Lipid. Res. 42, pp. 1346-1367 (2001)).
  • LDL Upon binding to LDLR in clathrin coated pits, LDL is internalized via endocytosis and moves into the endosome where a drop in pH causes the receptor to dissociate from the LDL.
  • LDL receptor (LDLR) binding domain of ApoB when used with the disclosed peptides can also be altered and/or modified as described throughout this application for Apo E.
  • LDL receptor (LDLR) binding domain of ApoB can be used with the disclosed lipid- associating peptides, wherein the LDL receptor (LDLR) binding domain of ApoB is covalently linked to said lipid-associating peptide.
  • the LDL receptor (LDLR) binding domain of ApoB can be scrambled, reverse-oriented, can be part of a domain switched peptide as described below.
  • Lipid-associating peptides can be used alone or in combination with the Apo E- mimicking peptides.
  • the lipid associating peptide for these synthetic Apo E mimetics can be, but are not limited to, class A amphipathic helical peptides, class A amphipathic helical peptide mimetics of apoA-I having aromatic or aliphatic residues in the non-polar face, small peptides including pentapeptides, tetrapeptides, tripeptides, dipeptides and pairs of amino acids, Apo- J (G* peptides), and peptide mimetics, e.g., as described below.
  • the lipid-associating peptides for use in the disclosed methods include class A amphipathic helical peptides, e.g. as described in U.S. Pat. No. 6,664,230, and PCT Publications WO 02/15923 and WO 2004/034977. It was discovered that peptides comprising a class A amphipathic helix (“class A peptides”), are capable of mitigating one or more symptoms of atherosclerosis as well as treating other disorders.
  • Class A peptides are characterized by formation of an a-helix that produces a segregation of polar and non-polar residues thereby forming a polar and a nonpolar face with the positively charged residues residing at the polar-nonpolar interface and the negatively charged residues residing at the center of the polar face (see, e.g., Anantharamaiah (1986) Meth. Enzymol, 128: 626-668). It is noted that the fourth exon of apo A-I, when folded into 3.667 residues/turn produces a class A amphipathic helical structure.
  • One class A peptide designated 18A (see, e.g., Anantharamaiah (1986) Meth.
  • Enzymol, 128: 626-668) was modified as described herein to produce peptides orally administrable and highly effective at inhibiting or preventing one or more symptoms of atherosclerosis and/or other indications described herein. Without being bound by a particular theory, it is believed that the disclosed peptides can act in vivo by picking up seeding molecule(s) that mitigate oxidation of LDL.
  • a number of these class A peptides were made including, the peptide designated 4F, D4F, 5F, and D5F, and the like.
  • Various class A peptides inhibited lesion development in atherosclerosis-susceptible mice and rabbits.
  • the peptides show varying, but significant degrees of efficacy in mitigating one or more symptoms of the various pathologies described herein. A number of such peptides are illustrated in Table 2.
  • NMA-E-W-F-K-A-F-Y-E-K-V-A-E-K-F-K-E-A-F-NH 2 SEQ ID NO: 104
  • NMA-A-F-Y-D-K-V-A-E-K-F-K-E-A-F-NH 2 SEQ ID NO: 105)
  • NMA-E-W-L-K-A-F-Y-E-K-V-F-E-K-F-K-E-F-NH 2 (SEQ ID NO: 1 10)
  • NMA N-Methyl Anthranilyl
  • the peptides include variations of 4F (D-W-F-K-A-F-Y-D-K-V- A-E-K-F-K-E-A-F (SEQ ID NO: 16) in Table 2), also known as L-4F, where all residues are L form amino acids) or D-4F where one or more residues are D form amino acids).
  • 4F D-W-F-K-A-F-Y-D-K-V- A-E-K-F-K-E-A-F (SEQ ID NO: 16) in Table 2
  • L-4F L-4F, where all residues are L form amino acids
  • D-4F where one or more residues are D form amino acids
  • the C-terminus, and/or N-terminus, and/or internal residues can be blocked with one or more blocking groups as described herein.
  • peptides of Table 2 are illustrated with an acetyl group or an N- methylanthranilyl group protecting the amino terminus and an amide group protecting the carboxyl terminus, any of these protecting groups may be eliminated and/or substituted with another protecting group as described herein.
  • the peptides can comprise one or more D-form amino acids as described herein. In certain aspects, every amino acid (e.g., every
  • enantiomeric amino acid of the peptides of Table 2 is a D-form amino acid.
  • Table 2 is not fully inclusive.
  • other suitable class A amphipathic helical peptides can routinely be produced (e.g., by conservative or semi-conservative substitutions (e.g., D replaced by E), extensions, deletions, and the like).
  • one embodiment utilizes truncations of any one or more of peptides shown herein (e.g., peptides identified as 2F, 3F, 3F 14 , 4F, 5F, 6F, or 7F— in Table 2).
  • A-F-Y-D-K-V-A-E-K-L-K-E-A-F (amino acids 5-18 of SEQ ID NO:5) illustrates a peptide comprising 14 amino acids from the C-terminus of 18A comprising one or more D amino acids, while others illustrate other truncations.
  • Longer peptides are also suitable. Such longer peptides may entirely form a class A amphipathic helix, or the class A amphipathic helix (helices) can form one or more domains of the peptide.
  • this invention contemplates multimeric versions of the peptides (e.g., concatamers).
  • the peptides illustrated herein can be coupled together (directly or through a linker (e.g., a carbon linker, or one or more amino acids) with one or more intervening amino acids).
  • Illustrative polymeric peptides include 18A-Pro- 18A and the peptides in the following table (Table 2B), in certain embodiments comprising one or more D amino acids, more preferably with every amino acid a D amino acid as described herein and/or having one or both termini protected.
  • modified class A amphipathic helix peptides incorporate one or more aromatic residues at the center of the nonpolar face, e.g., 3F Clt , (as present in 4F), or with one or more aliphatic residues at the center of the nonpolar face, e.g., 3F lK , see, e.g., Table 3.
  • the central aromatic residues on the nonpolar face of the peptide 3F Clt due to the presence of ⁇ electrons at the center of the nonpolar face can allow water molecules to penetrate near the hydrophobic lipid alkyl chains of the peptide-lipid complex, which in turn would enable the entry of reactive oxygen species (such as lipid hydroperoxides) shielding them from the cell surface.
  • the peptides with aliphatic residues at the center of the nonpolar face e.g., 3F lK , can act similarly but not quite as effectively as 3F Clt .
  • the peptides can convert pro-inflammatory HDL to anti-inflammatory HDL or make anti-inflammatory HDL more anti-inflammatory, and/or decrease LDL- induced monocyte chemotactic activity generated by artery wall cells equal to or greater than D4F or other peptides shown in Table 2.
  • Class A amphipathic helical peptides that have an amino acid composition identical to one or more of the class A amphipathic helical peptides described above.
  • this invention contemplates peptides having an amino acid composition identical to 4F.
  • this invention includes active agents that comprise a peptide that consists of 18 amino acids, where the 18 amino acids consist of 3 alanines (A), 2 aspartates (D), 2 glutamates (E), 4 phenylalanines (F), 4 lysines (K), 1 valine (V), 1 tryptophan (W), and 1 tyrosine (Y); and where the peptide forms a class A amphipathic helix; and protects a phospholipid against oxidation by an oxidizing agent.
  • the peptides comprise least one "D" amino acid residue; and in certain embodiments, the peptides comprise all "D: form amino acid residues. A variety of such peptides are illustrated in Table 4.
  • Table 4 provides the sequences and identifier names for representative 18 amino acid length class A amphipathic helical peptides with the amino acid composition comprising 3 alanines (A), 2 aspartates (D), 2 glutamates (E), 4 phenylalanines (F), 4 lysines (K), 1 valine (V), 1 tryptophan (W), and 1 tyrosine (Y).
  • Lipid-associating peptides can comprise a peptide that is 18 amino acids in length and forms a class A amphipathic helix where the peptide has the amino acid composition 2 aspartates, 2 glutamates, 4 lysines, 1 tryptophan, 1 tyrosine, no more than one leucine, no more than 1 valine, no less than 1 and no more than 3 alanines, and with 3 to 6 amino acids from the group: phenylalanine, alpha- naphthalanine, beta-naphthalanine, histidine, and contains either 9 or 10 amino acids on the polar face in a helical wheel representation of the class A amphipathic helix including 4 amino acids with positive charge at neutral pH with two of the positively charged residues residing at the interface between the polar and non-polar faces and with two of the four positively charged residues on the polar face that are contiguous and on the non-polar face two of the amino acid residues from the group: phenylalanine
  • the acidic amino acids are glutamic acid rather than having two aspartic acids and two glutamic acids.
  • the lipid associating peptide can be 18A, wherein each of the acidic amino acids of 18A are Glu residues.
  • Class Y amphipathic helical peptides are known to those of skill in the art (see, e.g., Segrest et al. (1992) J. Lipid Res. 33 : 141-166; Oram and Heinecke (2005) Physiol Rev. 85: 1343-1372, and the like). These peptides include, but are not limited to, an 18 amino acid peptide that forms a class A amphipathic helix or a class Y amphipathic helix described by formula I:
  • D X X K Y X X D K X Y D K X K D Y X (SEQ ID NO:367) (I) where the D's are independently Asp or Glu; the Ks are independently Lys or Arg; the Xs are independently Leu, nor Leu, Val, He, Trp, Phe, Tyr, ⁇ -Nal, or a-Nal and all X residues are on the non-polar face (e.g., when viewed in a helical wheel diagram) except for one that can be on the polar face between two K residues; the Y's are independently Ala, His, Ser, Gin, Asn, or Thr non-polar face (e.g., when viewed in a helical wheel diagram) and the Y's are independently one Ala on the polar face, one His, one Ser, one Gin one Asn, or one Thr on the polar face (e.g., when viewed in a helical wheel diagram), where no more than two K
  • peptides of this kind which include peptides with histidine, and/or alpha- and/or beta-napthalanine are shown in Table 5. Reverse (retro-), inverse, retro-inverso-, and circularly permuted forms of these peptides are also contemplated.
  • Rev3F-2 Ac- -LFEKFAEAFKDYVAKWKD-NH2 (SEQ ID NO:488)
  • RevR4-3F-2 Ac- -LFERF AEAFKD YVAKWKD -NH2 (SEQ ID NO:489)
  • RevR15-3F-2 Ac- -LFEKFAEAFKDYVARWKD-NH2 (SEQ ID NO:491)
  • RevR17-3F-2 Ac- -LFEKFAEAFKDYVAKWRD-NH2 (SEQ ID NO:492)
  • R2-4F-2 Ac- -DRWKAVYDKFAEAFKEFF-NH2 (SEQ ID NO:547)
  • R4-4F-2 Ac- -DKWRAVYDKFAEAFKEFF-NH2 (SEQ ID NO:548)
  • R9-4F-2 Ac- -DKWKAVYDRFAEAFKEFF-NH2 (SEQ ID NO: 549)
  • R14-4F-2 Ac- -DKWKAVYDKFAEAFREFF-NH2 (SEQ ID NO:550)
  • Rev4F-2 Ac- -FFEKFAEAFKDYVAKWKD-NH2 (SEQ ID NO:551)
  • Rev-R4-4F-2 Ac- -FFERFAEAFKDYVAKWKD-NH2 (SEQ ID NO:554)
  • Rev-R10-4F-2 Ac- -EFERFAEAFRDYVAKWKD-NH2 (SEQ ID NO:555)
  • Rev-R15-4F-2 Ac- -FFEKFAEAFKDYVARWKD-NH2 (SEQ ID NO:556)
  • Rev-R17-4F-2 Ac- -FFERFAEAFKDYVAKWRD-NH2 (SEQ ID NO:557)
  • any of the peptides described herein can comprise non-natural amino acids in addition to or instead of the corresponding the natural amino acids identified herein.
  • Such modifications include, but are not limited to acetylation, amidation, formylation, methylation, sulfation, and the like.
  • Illustrative non-natural amino acids include, but are not limited to Ornithine, norleucine, norvaline, N-methylvaline, 6-N-methyllysine, N- methylisoleucine, N-methylglycine, sarcosine, inosine, allo-isoleucine, isodesmolysine, 4- hydroxyproline, 3-hydroxyproline, allo-hydroxy lysine, hydoxylisine, N-ethylasparagine, N- ethylglycine, 2,3-diaminopropionic acid, 2,2'-diaminopropionic acid, desmosine, 2,4- diaminobutyric acid, 2-aminopimelic acid, 3-aminoisobutyric acid, 2-aminoisobutyric acid, 2- aminoheptanoic acid, 6-aminocaproic acid, 4-aminobutyric acid, 2-aminobutyric acid, beta- alanine, 3-
  • this invention contemplates particularly the use of modified lysines.
  • modifications include, but are not limited to, biotin modification of epsilon lysines and/or methylation of the epsilon lysines.
  • Illustrative peptide comprising epsilon methylated lysines include, but are not limited to: Ac-D-W-F-K(eCH 3 ) 2 -A-F-Y-D-K(eCFI 3 ) 2 - V-A-E-K(eCH 3 )- 2 -F-K(eCH 3 )2-E-A-F-NH(CH 3 )2 (SEQ ID NO:573) and: Ac- DWFK(eCH 3 ) 2 AFYDK(eCH 3 ) 2 VAEK(eCH 3 ) 2 FK(eCH 3 ) 2 EAF-NH(CH 3 ) (SEQ ID NO:574).
  • Other modified amino acids include but are not limited to ornithine analogs and
  • homoaminoalanine analogs instead of (CH 2 ) 4 — NH 2 for Lys it can be ⁇ (CH 2 ) 2 ⁇ NH 2 for Haa and ⁇ (CH 2 )3 ⁇ NH 2 for Orn] and the like. It is noted that these modifications are illustrative and not intended to be limiting. Illustrative 4F analogues that possess modified amino acids are shown in Table 6.
  • Dual domain peptides are also disclosed. Dual domain peptides can be synthetic Apo E-mimicking peptides, consisting of a combination of the disclosed receptor binding domains of apolipoprotein E and the disclosed lipid-associating peptides, wherein said receptor binding domain is covalently linked to said lipid-associating peptide.
  • Non-limiting examples of the disclosed synthetic Apo E- mimicking peptides are provided in Table 7.
  • the disclosed synthetic Apo E-mimicking peptides can also be N-terminally protected using acetyl and amino groups.
  • Table 7 provides non-limiting representative examples of the disclosed synthetic Apo E-mimicking peptides comprising a dual domain.
  • lipid-associating peptide consisting of a combination of the disclosed receptor binding domains of apolipoprotein E and the disclosed lipid-associating peptides, wherein said receptor binding domain is covalently linked to said lipid-associating peptide in a domain switched orientation to those described above and in Table 7.
  • the lipid-associating peptide is covalently linked to the receptor binding domain of apolipoprotein E such that the lipid-associating peptide is at the N-terminus of the synthetic apolipoprotein E-mimicking peptide.
  • Table 8 provides non-limiting examples of the disclosed synthetic Apo E mimetics comprising a combination of the disclosed receptor binding domains of apolipoprotein E and the disclosed lipid-associating peptides, wherein said receptor binding domain is covalently linked to said lipid-associating peptide in a domain switched orientation.
  • the disclosed domain switched synthetic Apo E mimetics can also be N-terminally protected using acetyl and amino groups.
  • synthetic Apo E-mimicking peptides consisting of a combination of the disclosed receptor binding domains of apolipoprotein E and the disclosed lipid- associating peptides, wherein said receptor binding domain is covalently linked to said lipid- associating peptide in a reversed orientation.
  • synthetic Apo E- mimicking peptides consisting of a combination of the disclosed receptor binding domains of apolipoprotein E and the disclosed lipid-associating peptides, wherein either the sequence of the receptor binding domain or the sequence of the lipid-associating peptide or both sequences are in the reversed orientation.
  • Table 9 provides non-limiting examples of the disclosed synthetic Apo E-mimicking peptides comprising a combination of the disclosed receptor binding domains of apolipoprotein E and the disclosed lipid-associating peptides, wherein said receptor binding domain is covalently linked to said lipid-associating peptide in a reversed orientation.
  • synthetic Apo E-mimicking peptides consisting of: a receptor binding domain of apolipoprotein E and a lipid-associating peptide, wherein said receptor binding domain is covalently linked to said lipid-associating peptide, wherein the receptor binding domain of apolipoprotein E is scrambled.
  • a synthetic apolipoprotein E-mimicking peptide consisting of: a receptor binding domain of
  • apolipoprotein E comprising the amino acid sequence of D-W-L-K-A-F-V-Y-D-K-V-F-K- L-K-E-F-F (SEQ ID NO:69); and a lipid-associating peptide, wherein said receptor binding domain is covalently linked to said lipid-associating peptide.
  • synthetic Apo E-mimicking peptides consisting of: a receptor binding domain of apolipoprotein B and a lipid-associating peptide, wherein said receptor binding domain is covalently linked to said lipid-associating peptide, wherein the receptor binding domain of apolipoprotein B is scrambled.
  • a synthetic Apo E- mimicking peptides comprising: a lipid binding domain of apolipoprotein E comprising the amino acid sequence of E-W-L-K-A-F-V-Y-E-K-V-F-K-L-K-E-F-F (SEQ ID NO: 70) and a receptor binding domain peptide, wherein said lipid binding domain is covalently linked to said receptor binding domain peptide.
  • Table 10 provides non-limiting examples of the disclosed scrambled synthetic Apo E mimetics comprising a receptor binding domain of apolipoprotein E and a lipid-associating peptide, wherein said receptor binding domain is covalently linked to said lipid-associating peptide, wherein the receptor binding domain of apolipoprotein E is scrambled.
  • the disclosed scrambled synthetic Apo E mimetics can also be N-terminally and C- terminally protected using acetyl and amide groups.
  • the disclosed scrambled synthetic Apo E mimetics can also be reverse-oriented as described above,
  • Any suitable linker can be used in accordance with the present invention.
  • One particularly preferred non-peptide linkage is -CH 2 NH— .
  • Such peptide mimetics may have significant advantages over polypeptide embodiments, including, for example: more economical production, greater chemical stability, enhanced pharmacological properties (half-life, absorption, potency, efficacy, etc.), reduced antigenicity, and others.
  • the linker is a cleavable linker.
  • cleavable linkers include protease cleavable peptide linkers, nuclease sensitive nucleic acid linkers, lipase sensitive lipid linkers, glycosidase sensitive carbohydrate linkers, pH sensitive linkers, hypoxia sensitive linkers, photo-cleavable linkers, heat-labile linkers, enzyme cleavable linkers (e.g., esterase cleavable linker), ultrasound-sensitive linkers, x-ray cleavable linkers, etc.
  • protease cleavable peptide linkers include protease cleavable peptide linkers, nuclease sensitive nucleic acid linkers, lipase sensitive lipid linkers, glycosidase sensitive carbohydrate linkers, pH sensitive linkers, hypoxia sensitive linkers, photo-cleavable linkers, heat-labile linkers, enzyme cleavable linkers (e.g., este
  • the receptor binding domain or the lipid-associating peptide can be modified or altered as described above.
  • the receptor binding domain or the lipid-associating peptide can be mutated, scrambled, and/or reverse-oriented. Any other modifications or alterations disclosed herein for the dual-domain polypeptides can also be used for the single- domain peptides.
  • peptides disclosed herein are also contemplated.
  • scrambled peptides can also be reverse-oriented, or can be in a switched orientation.
  • reverse-oriented peptides can be in a switched orientation. All other combinations of the disclosed peptides are also contemplated.
  • Non- limiting examples of the peptides have been described herein (see Tables 1-5, for example).
  • the term “analog” is used interchangeably with "variant” and “derivative.”
  • variants and derivatives are well understood to those of skill in the art and can involve amino acid sequence modifications. Such, amino acid sequence modifications typically fall into one or more of three classes: substantial; insertional; or deletional variants.
  • Insertions include amino and/or carboxyl terminal fusions as well as intrasequence insertions of single or multiple amino acid residues. Insertions ordinarily are smaller insertions than those of amino or carboxyl terminal fusions, for example, on the order of one to four residues.
  • These variants ordinarily are prepared by site-specific mutagenesis of nucleotides in the DNA encoding the protein, thereby producing DNA encoding the variant, and thereafter expressing the DNA in recombinant cell culture. Techniques for making substitution mutations at predetermined sites in DNA having a known sequence are well known, for example Ml 3 primer mutagenesis and PCR mutagenesis. Amino acid substitutions are typically of single residues, but can occur at a number of different locations at once.
  • substitutions, deletions, insertions or any combination thereof may be combined to arrive at a final derivative or analog.
  • Substitutional variants are those in which at least one residue has been removed and a different residue inserted in its place. Such substitutions generally are made in accordance with Tables 1 1 and 12 and are referred to as conservative substitutions.
  • substitutions that are less conservative than those in Table 11, i.e., selecting residues that differ more significantly in their effect on maintaining (a) the structure of the polypeptide backbone in the area of the substitution, for example as a sheet or helical conformation, (b) the charge or hydrophobicity of the molecule at the target site, or (c) the bulk of the side chain.
  • substitutions which in general are expected to produce the greatest changes in the protein properties are those in which: (a) the hydrophilic residue, e.g.
  • seryl or threonyl is substituted for (or by) a hydrophobic residue, e.g., leucyl, isoleucyl, phenylalanyl, valyl or alanyl; Tryptophan, Tyrosinyl (b) a cysteine or proline is substituted for (or by) any other residue; (c) a residue having an electropositive side chain, e.g., lysyl, arginyl, or hystidyl, is substituted for (or by) an electronegative residue, e.g.
  • variants and derivatives of the disclosed proteins herein are to define them in terms of homology/identity to specific known sequences.
  • variants of synthetic Apo E mimetics and other proteins or peptides herein disclosed which have at least, 70% or at least 75% or at least 80% or at least 85% or at least 90% or at least 95% homology to the synthetic Apo E mimetics specifically recited herein.
  • Those of skill in the art readily understand how to determine the homology of two proteins.
  • polypeptides can be modified by either natural processes, such as post- translational processing, or by chemical modification techniques which are well known in the art. Modifications can occur anywhere in the polypeptide, including the peptide backbone, the amino acid side-chains and the amino or carboxyl termini. The same type of modification can be present in the same or varying degrees at several sites in a given polypeptide. Also, a given polypeptide can have many types of modifications.
  • Modifications include, without limitation, acetylation, acylation, ADP-ribosylation, amidation, covalent cross-linking or cyclization, covalent attachment of flavin, covalent attachment of a heme moiety, covalent attachment of a nucleotide or nucleotide derivative, covalent attachment of a lipid or lipid derivative, covalent attachment of a phosphytidylinositol, disulfide bond formation, demethylation, formation of cysteine or pyroglutamate, formylation, gamma-carboxylation, glycosylation, GPI anchor formation, hydroxylation, iodination, methylation, myristolyation, oxidation, pegylation, proteolytic processing, phosphorylation, prenylation, racemization, selenoylation, sulfation, and transfer-RNA mediated addition of amino acids to protein such as arginylation.
  • Variants can also include peptidomimetics.
  • peptidomimetic means a mimetic of a function of a protein which includes some alteration of the normal peptide chemistry.
  • Peptidomimetics typically are short sequences of amino acids that in biological properties mimic one or more function(s) of a particular protein. Peptide analogs enhance some property of the original peptide, such as increases stability, increased efficacy, enhanced delivery, increased half-life, etc. Methods of making peptidomimetics based upon a known polypeptide sequence is described, for example, in U.S. Patent Nos. 5,631,280; 5,612,895; and 5,579,250.
  • peptidomimetics can involve the incorporation of a non- amino acid residue with non-amide linkages at a given position.
  • One embodiment of the present invention is a peptidomimetic wherein the compound has a bond, a peptide backbone or an amino acid component replaced with a suitable mimic.
  • unnatural amino acids which may be suitable amino acid mimics include ⁇ -alanine, L-a- amino butyric acid, L-y-amino butyric acid, L-a-amino isobutyric acid, L-e-amino caproic acid, 7-amino heptanoic acid, L-aspartic acid, L-glutamic acid, ⁇ - ⁇ -Boc-N-a-CBZ-L-lysine, ⁇ - ⁇ -Boc-N-a-Fmoc-L-lysine, L-methionine sulfone, L-norleucine, L-norvaline, N-a-Boc-N- 5CBZ-L-ornithine, ⁇ - ⁇ -Boc-N-a-CBZ-L-ornithine, Boc-p-nitro-L-phenylalanine, Boc- hydroxyproline, and Boc-L-thioproline.
  • nucleic acids that can encode those polypeptide sequences are also disclosed. This would include all degenerate sequences related to a specific polypeptide sequence, i.e. all nucleic acids having a sequence that encodes one particular polypeptide sequence as well as all nucleic acids, including degenerate nucleic acids, encoding the disclosed variants and derivatives of the protein sequences. Thus, while each particular nucleic acid sequence may not be written out herein, it is understood that each and every sequence is in fact disclosed and described herein through the disclosed polypeptide sequences.
  • the disclosed compositions can comprise an acetyl group followed by a protecting group.
  • the protecting group can be, but is not limited to, a fatty acid.
  • the fatty acids can be saturated, unsaturated or essential fatty acids.
  • Fatty acids can include but are not limited to DHA, EPA, linoleic acid, or any other saturated amino acid such as myristic acid.
  • the various compositions described herein may be shown with no protecting groups, in certain embodiments (e.g., particularly for oral administration), they can bear one, two, three, four, or more protecting groups.
  • the protecting groups can be coupled to the C- and/or N-terminus of the peptide(s) and/or to one or more internal residues comprising the peptide(s) (e.g., one or more R-groups on the constituent amino acids can be blocked).
  • any of the peptides described herein can bear, e.g., an acetyl group protecting the amino terminus and/or an amide group protecting the carboxyl terminus.
  • an acetyl group protecting the amino terminus
  • an amide group protecting the carboxyl terminus.
  • One example of such a "dual protected peptide" is Ac-
  • LRKLRKRLLRDWLKAFYDKVAEKLKEAF-NH 2 (SEQ ID NO: 1) with blocking groups), either or both of these protecting groups can be eliminated and/or substituted with another protecting group as described herein.
  • blockage, particularly of the amino and/or carboxyl termini of the subject peptides of this invention can improve oral delivery and can also increase serum half-life.
  • a wide number of protecting groups are suitable for this purpose.
  • Such groups include, but are not limited to acetyl, amide, and alkyl groups with acetyl and alkyl groups being particularly preferred for N-terminal protection and amide groups being preferred for carboxyl terminal protection.
  • the protecting groups can include, but are not limited to alkyl chains as in fatty acids, propeonyl, formyl, and others.
  • Carboxyl protecting groups include amides, esters, and ether-forming protecting groups can also be used.
  • an acetyl group can be used to protect the amino terminus and an amide group can be used to protect the carboxyl terminus.
  • Additional blocking groups include alkyl groups of various lengths, e.g., groups having the formula: CH 3 (CH 2 ) n CO where n ranges from about 1 to about 20, preferably from about 1 to about 16 or 18, more preferably from about 3 to about 13, and most preferably from about 3 to about 10.
  • the protecting groups include, but are not limited to alkyl chains as in fatty acids, propeonyl, formyl, and others.
  • carboxyl protecting groups can include amides, esters, and ether-forming protecting groups. These blocking groups can enhance the helix-forming tendencies of the peptides.
  • Blocking groups can include alkyl groups of various lengths, e.g., groups having the formula: CH 3 (CH 2 ) n CO where n ranges from about 3 to about 20, preferably from about 3 to about 16, more preferably from about 3 to about 13, and most preferably from about 3 to about 10.
  • Other protecting groups include, but are not limited to Fmoc, t-butoxycarbonyl (t- BOC), 9-fluoreneacetyl group, 1-fluorenecarboxylic group, 9-florenecarboxylic group, 9- fluorenone- 1 -carboxylic group, benzyloxycarbonyl, Xanthyl (Xan), Trityl (Trt), 4- methyltrityl (Mtt), 4-methoxytrityl (Mmt), 4-methoxy-2,3,6-trimethyl-benzenesulphonyl (Mtr), Mesitylene-2-sulphonyl (Mts), 4,4-dimethoxybenzhydryl (Mbh),Tosyl (Tos),
  • Protecting/blocking groups are well known to those of skill as are methods of coupling such groups to the appropriate residue(s) comprising the peptides of this invention (see, e.g., Greene et al., (1991) Protective Groups in Organic Synthesis, 2nd ed., John Wiley & Sons, Inc. Somerset, N.J.). For example, acetylation can be accomplished during the synthesis when the peptide is on the resin using acetic anhydride. Amide protection can be achieved by the selection of a proper resin for the synthesis.
  • compositions disclosed herein can also comprise one or more D-form (dextro rather than levo) amino acids as described herein.
  • D-form amino acids for example, at least two enantiomeric amino acids, at least 4 enantiomeric amino acids or at least 8 or 10 enantiomeric amino acids can be in the "D" form amino acids.
  • every other, or even every amino acid (e.g., every enantiomeric amino acid) of the peptides described herein is a D-form amino acid.
  • At least 50% of the enantiomeric amino acids can be "D” form, at least 80% of the enantiomeric amino acids are “D” form, at least 90%, or even all of the enantiomeric amino acids can be in the "D” form amino acids.
  • FMOC-Aha can be added to the growing chain as the last amino acid using the normal amino acid chain extension procedure (use of HOBt+DCC or HBTU as condensing agents). After the removal of the FMOC group using 20% piperidine in DMF, the NH2 can be acetylated using either excess of acetic anhydride under basic conditions or by condensing acetic acid using amino acid condensing agents used for peptide chain elongation.
  • compositions comprising any of the synthetic ApoE- mimicking peptides disclosed herein and a pharmaceutically acceptable carrier.
  • a material or carrier that would be selected to minimize any degradation of the active ingredient and to minimize any adverse side effects in the subject, as would be well known to one of skill in the art.
  • carriers include dimyristoylphosphatidyl (DMPC), phosphate buffered saline or a multivesicular liposome.
  • DMPC dimyristoylphosphatidyl
  • PG:PC:Cholesterol:peptide or PC:peptide can be used as carriers in this invention.
  • Other suitable pharmaceutically acceptable carriers and their formulations are described in Remington: The Science and Practice of Pharmacy (19th ed.) ed. A.R. Gennaro, Mack Publishing Company, Easton, PA 1995.
  • an appropriate amount of pharmaceutically-acceptable salt is used in the formulation to render the formulation isotonic.
  • the pharmaceutically-acceptable carrier include, but are not limited to, saline, Ringer's solution and dextrose solution.
  • the pH of the solution can be from about 5 to about 8, or from about 7 to about 7.5.
  • Further carriers include sustained release preparations such as semi-permeable matrices of solid hydrophobic polymers containing the composition, which matrices are in the form of shaped articles, e.g., films, stents (which are implanted in vessels during an angioplasty procedure), liposomes or microparticles. It will be apparent to those persons skilled in the art that certain carriers may be more preferable depending upon, for instance, the route of administration and
  • compositions being administered are typically administered. These most typically would be standard carriers for administration of drugs to humans, including solutions such as sterile water, saline, and buffered solutions at physiological pH.
  • compositions can also include carriers, thickeners, diluents, buffers, preservatives and the like, as long as the intended activity of the polypeptide, peptide, nucleic acid, vector of the invention is not compromised.
  • Pharmaceutical compositions may also include one or more active ingredients (in addition to the composition of the invention) such as antimicrobial agents, anti-inflammatory agents, anesthetics, and the like.
  • composition may be administered in a number of ways depending on whether local or systemic treatment is desired, and on the area to be treated.
  • Preparations of parenteral administration include sterile aqueous or non-aqueous solutions, suspensions, and emulsions.
  • non-aqueous solvents are propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable organic esters such as ethyl oleate.
  • Aqueous carriers include water, alcoholic/aqueous solutions, emulsions or suspensions, including saline and buffered media.
  • Parenteral vehicles include sodium chloride solution, Ringer's dextrose, dextrose and sodium chloride, lactated Ringer's, or fixed oils.
  • Intravenous vehicles include fluid and nutrient replenishers, electrolyte replenishers (such as those based on Ringer's dextrose), and the like. Preservatives and other additives may also be present such as, for example, antimicrobials, anti-oxidants, chelating agents, and inert gases and the like.
  • Formulations for optical administration may include ointments, lotions, creams, gels, drops, suppositories, sprays, liquids and powders.
  • Conventional pharmaceutical carriers, aqueous, powder or oily bases, thickeners and the like may be necessary or desirable.
  • compositions for oral administration include powders or granules, suspensions or solutions in water or non-aqueous media, capsules, sachets, or tablets. Thickeners, flavorings, diluents, emulsifiers, dispersing aids, or binders may be desirable.
  • compositions may potentially be administered as a pharmaceutically acceptable acid- or base- addition salt, formed by reaction with inorganic acids such as hydrochloric acid, hydrobromic acid, perchloric acid, nitric acid, thiocyanic acid, sulfuric acid, and phosphoric acid, and organic acids such as formic acid, acetic acid, propionic acid, glycolic acid, lactic acid, pyruvic acid, oxalic acid, malonic acid, succinic acid, maleic acid, and fumaric acid, or by reaction with an inorganic base such as sodium hydroxide, ammonium hydroxide, potassium hydroxide, and organic bases such as mon-, di-, trialkyl and aryl amines and substituted ethanolamines.
  • inorganic acids such as hydrochloric acid, hydrobromic acid, perchloric acid, nitric acid, thiocyanic acid, sulfuric acid, and phosphoric acid
  • organic acids such as formic acid, acetic acid, propionic acid, glyco
  • the ApoE-mimicking peptide can be a synthetic ApoE-mimicking peptide comprising a receptor binding domain of ApoE and a lipid-associating peptide, wherein the synthetic ApoE-mimicking peptide comprises an Ac -Aha.
  • the synthetic ApoE- mimicking peptide can be Ac-Aha-hE18A-NH 2 or Ac-Aha-[R]hE18A-NH 2 .
  • Disclosed are methods comprising administering any one of the disclosed synthetic ApoE-mimicking peptides to a subject, whereby plasma LDL, plasma VLDL, or both, are affected, wherein the synthetic ApoE-mimicking peptide is administered as a composition comprising the synthetic ApoE-mimicking peptide and a pharmaceutically acceptable carrier.
  • Disclosed are methods comprising administering any one of the disclosed synthetic ApoE-mimicking peptides to a subject, whereby plasma LDL, plasma VLDL, or both, are affected, wherein binding of LDL to a cell of the subject is enhanced.
  • Disclosed are methods comprising administering any one of the disclosed synthetic ApoE-mimicking peptides to a subject, whereby plasma LDL, plasma VLDL, or both, are affected, wherein degradation of LDL by a cell of the subject is increased.
  • Disclosed are methods comprising administering any one of the disclosed synthetic ApoE-mimicking peptides to a subject, whereby plasma LDL, plasma VLDL, or both, are affected, wherein LDL cholesterol in the subject is lowered.
  • ApoE-mimicking peptides to a subject, whereby plasma LDL, plasma VLDL, or both, are affected, wherein binding of VLDL to a cell of the subject is enhanced.
  • ApoE-mimicking peptides to a subject, whereby plasma LDL, plasma VLDL, or both, are affected, wherein degradation of VLDL by a cell of the subject is increased.
  • ApoE-mimicking peptides to a subject, whereby plasma LDL, plasma VLDL, or both, are affected, wherein VLDL cholesterol in the subject is lowered.
  • Disclosed are methods comprising administering any one of the disclosed synthetic ApoE-mimicking peptides to a subject, whereby plasma LDL, plasma VLDL, or both, are affected, wherein total plasma concentration of cholesterol in the subject is lowered.
  • Disclosed are methods comprising administering any one of the disclosed synthetic ApoE-mimicking peptides to a subject, whereby plasma LDL, plasma VLDL, or both, are affected, wherein said synthetic ApoE-mimicking peptide is administered in an amount of about 0.01 mg/kg to about 20 mg/kg.
  • concentration of the ApoE-mimicking peptide can be 0.01, 0.1, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1, 12, 13, 14, 15, 16, 17, 18, 19, 20 mg/kg, or any range in between.
  • Disclosed are methods comprising administering any one of the disclosed synthetic ApoE-mimicking peptides to a subject, whereby plasma LDL, plasma VLDL, or both, are affected, wherein the subject has coronary artery disease, rheumatoid arthritis, systemic lupus, diabetes, Alzheimer's disease, PAD, cerebral vascular disease, diabetes-derived cardiovascular diseases , macular degeneration, and/or congestive heart failure, or bacterial infections.
  • the ApoE-mimicking peptide can be a synthetic ApoE- mimicking peptide comprising a receptor binding domain of ApoE and a lipid-associating peptide, wherein the synthetic ApoE-mimicking peptide comprises an Ac -Aha.
  • the synthetic ApoE-mimicking peptide can be Ac-Aha-hE18A-NH2 or Ac-Aha-[R]hE18A- NH 2 .
  • Disclosed are methods of reducing plasma cholesterol comprising administering to a subject an effective amount of a composition comprising any one of the disclosed synthetic ApoE-mimicking peptides, wherein the synthetic ApoE-mimicking peptide is administered as a composition comprising the synthetic ApoE-mimicking peptide and a pharmaceutically acceptable carrier.
  • Disclosed are methods of reducing plasma cholesterol comprising administering to a subject an effective amount of a composition comprising any one of the disclosed synthetic ApoE-mimicking peptides, wherein binding of LDL to a cell of the subject is enhanced.
  • Disclosed are methods of reducing plasma cholesterol comprising administering to a subject an effective amount of a composition comprising any one of the disclosed synthetic ApoE-mimicking peptides, wherein degradation of LDL by a cell of the subject is increased.
  • Disclosed are methods of reducing plasma cholesterol comprising administering to a subject an effective amount of a composition comprising any one of the disclosed synthetic ApoE-mimicking peptides, wherein LDL cholesterol in the subject is lowered.
  • Disclosed are methods of reducing plasma cholesterol comprising administering to a subject an effective amount of a composition comprising any one of the disclosed synthetic ApoE-mimicking peptides, wherein binding of VLDL to a cell of the subject is enhanced.
  • Disclosed are methods of reducing plasma cholesterol comprising administering to a subject an effective amount of a composition comprising any one of the disclosed synthetic ApoE-mimicking peptides, wherein degradation of VLDL by a cell of the subject is increased.
  • Disclosed are methods of reducing plasma cholesterol comprising administering to a subject an effective amount of a composition comprising any one of the disclosed synthetic
  • ApoE-mimicking peptides wherein VLDL cholesterol in the subject is lowered.
  • Disclosed are methods of reducing plasma cholesterol comprising administering to a subject an effective amount of a composition comprising any one of the disclosed synthetic
  • ApoE-mimicking peptides wherein total plasma concentration of cholesterol in the subject is lowered.
  • Disclosed are methods of reducing plasma cholesterol comprising administering to a subject an effective amount of a composition comprising any one of the disclosed synthetic ApoE-mimicking peptides, wherein said synthetic ApoE-mimicking peptide is administered in an amount of about 0.01 mg/kg to about 20 mg/kg.
  • concentration of the ApoE-mimicking peptide can be 0.01, 0.1, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1, 12, 13, 14, 15, 16, 17, 18, 19, 20 mg/kg, or any range in between.
  • Disclosed are methods of reducing plasma cholesterol comprising administering to a subject an effective amount of a composition comprising any one of the disclosed synthetic ApoE-mimicking peptides, wherein the subject has coronary artery disease, rheumatoid arthritis, systemic lupus, diabetes, Alzheimer's disease, PAD, cerebral vascular disease, diabetes-derived cardiovascular diseases , macular degeneration, and/or congestive heart failure.
  • the ApoE-mimicking peptide can be a synthetic ApoE- mimicking peptide comprising a receptor binding domain of ApoE and a lipid-associating peptide, wherein the synthetic ApoE-mimicking peptide comprises an Ac -Aha.
  • the synthetic ApoE-mimicking peptide can be Ac-Aha-hE18A-NH2 or Ac-Aha-[R]hE18A- NH 2 .
  • Disclosed are methods of treating atherosclerosis comprising administering to a subject an effective amount of a composition comprising any one of the disclosed synthetic ApoE-mimicking peptides, wherein the synthetic ApoE-mimicking peptide is administered as a composition comprising the synthetic ApoE-mimicking peptide and a pharmaceutically acceptable carrier.
  • Disclosed are methods of treating atherosclerosis comprising administering to a subject an effective amount of a composition comprising any one of the disclosed synthetic ApoE-mimicking peptides, wherein binding of LDL to a cell of the subject is enhanced.
  • Disclosed are methods of treating atherosclerosis comprising administering to a subject an effective amount of a composition comprising any one of the disclosed synthetic ApoE-mimicking peptides, wherein degradation of LDL by a cell of the subject is increased.
  • Disclosed are methods of treating atherosclerosis comprising administering to a subject an effective amount of a composition comprising any one of the disclosed synthetic ApoE-mimicking peptides, wherein LDL cholesterol in the subject is lowered.
  • Disclosed are methods of treating atherosclerosis comprising administering to a subject an effective amount of a composition comprising any one of the disclosed synthetic ApoE-mimicking peptides, wherein binding of VLDL to a cell of the subject is enhanced.
  • Disclosed are methods of treating atherosclerosis comprising administering to a subject an effective amount of a composition comprising any one of the disclosed synthetic ApoE-mimicking peptides, wherein degradation of VLDL by a cell of the subject is increased.
  • Disclosed are methods of treating atherosclerosis comprising administering to a subject an effective amount of a composition comprising any one of the disclosed synthetic
  • ApoE-mimicking peptides wherein VLDL cholesterol in the subject is lowered.
  • Disclosed are methods of treating atherosclerosis comprising administering to a subject an effective amount of a composition comprising any one of the disclosed synthetic
  • ApoE-mimicking peptides wherein total plasma concentration of cholesterol in the subject is lowered.
  • Disclosed are methods of treating atherosclerosis comprising administering to a subject an effective amount of a composition comprising any one of the disclosed synthetic ApoE-mimicking peptides, wherein said synthetic ApoE-mimicking peptide is administered in an amount of about 0.01 mg/kg to about 20 mg/kg.
  • concentration of the ApoE-mimicking peptide can be 0.01, 0.1, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1, 12, 13, 14, 15, 16, 17, 18, 19, 20 mg/kg, or any range in between.
  • Disclosed are methods of treating atherosclerosis comprising administering to a subject an effective amount of a composition comprising any one of the disclosed synthetic ApoE-mimicking peptides, wherein the subject has coronary artery disease, rheumatoid arthritis, systemic lupus, diabetes, Alzheimer's disease, PAD, cerebral vascular disease, diabetes-derived cardiovascular diseases , macular degeneration, and/or congestive heart failure.
  • the ApoE-mimicking peptide can be a synthetic ApoE- mimicking peptide comprising a receptor binding domain of ApoE and a lipid-associating peptide, wherein the synthetic ApoE-mimicking peptide comprises an Ac -Aha.
  • the synthetic ApoE-mimicking peptide can be Ac-Aha-hE18A-NH2 or Ac-Aha-[R]hE18A- NH 2 .
  • Disclosed are methods of treating a subject with a lipid disorder comprising administering to the subject an effective amount of any one of the disclosed ApoE-mimicking peptides or a composition thereof, wherein the synthetic ApoE-mimicking peptide is administered as a composition comprising the synthetic ApoE-mimicking peptide and a pharmaceutically acceptable carrier.
  • Disclosed are methods of treating a subject with a lipid disorder comprising administering to the subject an effective amount of any one of the disclosed ApoE-mimicking peptides or a composition thereof, wherein binding of LDL to a cell of the subject is enhanced.
  • Disclosed are methods of treating a subject with a lipid disorder comprising administering to the subject an effective amount of any one of the disclosed ApoE-mimicking peptides or a composition thereof, wherein degradation of LDL by a cell of the subject is increased.
  • Disclosed are methods of treating a subject with a lipid disorder comprising administering to the subject an effective amount of any one of the disclosed ApoE-mimicking peptides or a composition thereof, wherein LDL cholesterol in the subject is lowered.
  • Disclosed are methods of treating a subject with a lipid disorder comprising administering to the subject an effective amount of any one of the disclosed ApoE-mimicking peptides or a composition thereof, wherein binding of VLDL to a cell of the subject is enhanced.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Organic Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Zoology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Immunology (AREA)
  • Epidemiology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Biochemistry (AREA)
  • Marine Sciences & Fisheries (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Toxicology (AREA)
  • Cardiology (AREA)
  • Diabetes (AREA)
  • Hematology (AREA)
  • Obesity (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Vascular Medicine (AREA)
  • Urology & Nephrology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
PCT/US2015/041162 2014-07-31 2015-07-20 Apoe mimetic peptides and higher potency to clear plasma cholesterol Ceased WO2016018665A1 (en)

Priority Applications (10)

Application Number Priority Date Filing Date Title
CA2954475A CA2954475C (en) 2014-07-31 2015-07-20 Apoe mimetic peptides and higher potency to clear plasma cholesterol
US17/748,682 USRE50320E1 (en) 2014-07-31 2015-07-20 APOE mimetic peptides and higher potency to clear plasma cholesterol
BR112017001860-8A BR112017001860A2 (pt) 2014-07-31 2015-07-20 peptídeo sintético, composição farmacêutica, métodos, regime de dosagem, e, anticorpo monoclonal
IL250302A IL250302B (en) 2014-07-31 2015-07-20 Apoe mimetic peptides and higher potency to clear plasma cholesterol
US15/329,735 US10653747B2 (en) 2014-07-31 2015-07-20 ApoE mimetic peptides and higher potency to clear plasma cholesterol
JP2017505143A JP7081923B2 (ja) 2014-07-31 2015-07-20 アポe模倣ペプチド及び血漿コレステロールを取り除くためのより高い効果
EP15826625.4A EP3189069B1 (en) 2014-07-31 2015-07-20 Apoe mimetic peptides and higher potency to clear plasma cholesterol
MX2017001432A MX383117B (es) 2014-07-31 2015-07-20 Péptidos miméticos de la apoe y mayor potencia para depurar el colesterol en plasma.
CN201580041913.0A CN107074923B (zh) 2014-07-31 2015-07-20 Apoe模拟肽及对清除血浆胆固醇的较高效力
AU2015298263A AU2015298263B2 (en) 2014-07-31 2015-07-20 ApoE mimetic peptides and higher potency to clear plasma cholesterol

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201462031585P 2014-07-31 2014-07-31
US62/031,585 2014-07-31

Publications (1)

Publication Number Publication Date
WO2016018665A1 true WO2016018665A1 (en) 2016-02-04

Family

ID=55218188

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2015/041162 Ceased WO2016018665A1 (en) 2014-07-31 2015-07-20 Apoe mimetic peptides and higher potency to clear plasma cholesterol

Country Status (10)

Country Link
US (2) USRE50320E1 (enExample)
EP (1) EP3189069B1 (enExample)
JP (2) JP7081923B2 (enExample)
CN (1) CN107074923B (enExample)
AU (1) AU2015298263B2 (enExample)
BR (1) BR112017001860A2 (enExample)
CA (1) CA2954475C (enExample)
IL (1) IL250302B (enExample)
MX (1) MX383117B (enExample)
WO (1) WO2016018665A1 (enExample)

Cited By (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2996706A4 (en) * 2013-03-14 2017-01-18 UAB Research Foundation Apolipoprotein mimetics and uses thereof
WO2017120568A1 (en) * 2016-01-08 2017-07-13 Lipimetix Development, Inc. Apoe mimetic peptide compositions
WO2018190896A1 (en) 2017-04-13 2018-10-18 Lipimetix Development, Inc. Apoe mimetic peptide compositions
WO2019199976A1 (en) 2018-04-11 2019-10-17 Lipimetix Development, Inc. Apoe mimetic peptide compositions
CN110545836A (zh) * 2017-01-24 2019-12-06 马克雷根有限公司 用载脂蛋白模拟物治疗与年龄有关的黄斑变性和其他眼部疾病
US10653747B2 (en) 2014-07-31 2020-05-19 Uab Research Foundation ApoE mimetic peptides and higher potency to clear plasma cholesterol
US11331295B2 (en) 2015-10-14 2022-05-17 Massachusetts Eye And Ear Infirmary High-dose statins for age-related macular degeneration
WO2023215838A1 (en) * 2022-05-05 2023-11-09 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Short apolipoprotein e mimetic peptides and methods of use
US12152086B2 (en) 2018-11-08 2024-11-26 Saitama University Liposome binding peptide, construct for manufacturing the liposome binding peptide, and liposome
WO2025147594A1 (en) * 2024-01-04 2025-07-10 University Of Florida Research Foundation, Incorporated Peptides and method of use in preparing nanodiscs

Families Citing this family (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN111617232B (zh) * 2020-06-04 2023-04-18 安域生物科技(杭州)有限公司 一类ApoE受体蛋白短肽阻断剂在阿尔茨海默病的应用
CN114940711B (zh) * 2021-10-25 2023-05-12 中山大学 载脂蛋白a-i模拟肽及其应用
EP4712998A1 (en) * 2023-05-17 2026-03-25 The Medical College of Wisconsin Dual-domain peptide for depleting hmgb1 from the circulation via liver hspg system

Citations (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0045665A1 (en) 1980-08-06 1982-02-10 Aktiebolaget Hässle Enzyme inhibitors
US5391377A (en) 1990-10-19 1995-02-21 Cortecs Limited Biphasic release formations for lipophilic acids
US5579250A (en) 1990-12-14 1996-11-26 Balaji; Vitukudi N. Method of rational drug design based on AB initio computer simulation of conformational features of peptides
US5631280A (en) 1995-03-29 1997-05-20 Merck & Co., Inc. Inhibitors of farnesyl-protein transferase
WO2002015923A1 (en) 2000-08-24 2002-02-28 The Regents Of The University Of California Orally administered peptides to ameliorate atherosclerosis
US6506880B2 (en) 1998-03-17 2003-01-14 The Uab Research Foundation Synthetic peptides that enhance atherogenic lipoprotein uptake and lower plasma cholesterol
WO2004034977A2 (en) 2002-10-16 2004-04-29 The Regents Of The University Of California Orally administered peptides synergize statin activity
US20100286025A1 (en) * 2007-08-28 2010-11-11 Anantharamaiah Gattadahalli M Synthetic apolipoprotein e mimicking polypeptides and methods of use

Family Cites Families (370)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3687808A (en) 1969-08-14 1972-08-29 Univ Leland Stanford Junior Synthetic polynucleotides
US3767040A (en) 1971-03-01 1973-10-23 Minnesota Mining & Mfg Pressure-sensitive polyurethane adhesives
US4155913A (en) 1973-02-08 1979-05-22 Hoffmann-La Roche Inc. Thienotriazolodiazepine derivatives
US4342566A (en) 1980-02-22 1982-08-03 Scripps Clinic & Research Foundation Solid phase anti-C3 assay for detection of immune complexes
US4469863A (en) 1980-11-12 1984-09-04 Ts O Paul O P Nonionic nucleic acid alkyl and aryl phosphonates and processes for manufacture and use thereof
HU185263B (en) 1981-06-12 1984-12-28 Richter Gedeon Vegyeszet Process for producing peptides effective on the immuncontroll analogous with the tp5
US5023243A (en) 1981-10-23 1991-06-11 Molecular Biosystems, Inc. Oligonucleotide therapeutic agent and method of making same
US4476301A (en) 1982-04-29 1984-10-09 Centre National De La Recherche Scientifique Oligonucleotides, a process for preparing the same and their application as mediators of the action of interferon
JPS5927900A (ja) 1982-08-09 1984-02-14 Wakunaga Seiyaku Kk 固定化オリゴヌクレオチド
FR2540122B1 (fr) 1983-01-27 1985-11-29 Centre Nat Rech Scient Nouveaux composes comportant une sequence d'oligonucleotide liee a un agent d'intercalation, leur procede de synthese et leur application
US4605735A (en) 1983-02-14 1986-08-12 Wakunaga Seiyaku Kabushiki Kaisha Oligonucleotide derivatives
US4948882A (en) 1983-02-22 1990-08-14 Syngene, Inc. Single-stranded labelled oligonucleotides, reactive monomers and methods of synthesis
US4824941A (en) 1983-03-10 1989-04-25 Julian Gordon Specific antibody to the native form of 2'5'-oligonucleotides, the method of preparation and the use as reagents in immunoassays or for binding 2'5'-oligonucleotides in biological systems
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US4587044A (en) 1983-09-01 1986-05-06 The Johns Hopkins University Linkage of proteins to nucleic acids
US5118802A (en) 1983-12-20 1992-06-02 California Institute Of Technology DNA-reporter conjugates linked via the 2' or 5'-primary amino group of the 5'-terminal nucleoside
US5118800A (en) 1983-12-20 1992-06-02 California Institute Of Technology Oligonucleotides possessing a primary amino group in the terminal nucleotide
CH661438A5 (it) 1984-04-09 1987-07-31 Seuref Ag Composizioni farmaceutiche ad azione antianossica e metabolica cerebrale.
US4643988A (en) 1984-05-15 1987-02-17 Research Corporation Amphipathic peptides
US5550111A (en) 1984-07-11 1996-08-27 Temple University-Of The Commonwealth System Of Higher Education Dual action 2',5'-oligoadenylate antiviral derivatives and uses thereof
FR2567892B1 (fr) 1984-07-19 1989-02-17 Centre Nat Rech Scient Nouveaux oligonucleotides, leur procede de preparation et leurs applications comme mediateurs dans le developpement des effets des interferons
US5430136A (en) 1984-10-16 1995-07-04 Chiron Corporation Oligonucleotides having selectably cleavable and/or abasic sites
US5258506A (en) 1984-10-16 1993-11-02 Chiron Corporation Photolabile reagents for incorporation into oligonucleotide chains
US5367066A (en) 1984-10-16 1994-11-22 Chiron Corporation Oligonucleotides with selectably cleavable and/or abasic sites
US4828979A (en) 1984-11-08 1989-05-09 Life Technologies, Inc. Nucleotide analogs for nucleic acid labeling and detection
US4897355A (en) 1985-01-07 1990-01-30 Syntex (U.S.A.) Inc. N[ω,(ω-1)-dialkyloxy]- and N-[ω,(ω-1)-dialkenyloxy]-alk-1-yl-N,N,N-tetrasubstituted ammonium lipids and uses therefor
FR2575751B1 (fr) 1985-01-08 1987-04-03 Pasteur Institut Nouveaux nucleosides de derives de l'adenosine, leur preparation et leurs applications biologiques
US5166315A (en) 1989-12-20 1992-11-24 Anti-Gene Development Group Sequence-specific binding polymers for duplex nucleic acids
US5405938A (en) 1989-12-20 1995-04-11 Anti-Gene Development Group Sequence-specific binding polymers for duplex nucleic acids
US5034506A (en) 1985-03-15 1991-07-23 Anti-Gene Development Group Uncharged morpholino-based polymers having achiral intersubunit linkages
US5185444A (en) 1985-03-15 1993-02-09 Anti-Gene Deveopment Group Uncharged morpolino-based polymers having phosphorous containing chiral intersubunit linkages
US5235033A (en) 1985-03-15 1993-08-10 Anti-Gene Development Group Alpha-morpholino ribonucleoside derivatives and polymers thereof
US4762779A (en) 1985-06-13 1988-08-09 Amgen Inc. Compositions and methods for functionalizing nucleic acids
IL79289A (en) 1985-07-05 1992-01-15 Whitehead Biomedical Inst Introduction and expression of foreign genetic material into keratinocytes using a recombinant retrovirus
US4980286A (en) 1985-07-05 1990-12-25 Whitehead Institute For Biomedical Research In vivo introduction and expression of foreign genetic material in epithelial cells
US5317098A (en) 1986-03-17 1994-05-31 Hiroaki Shizuya Non-radioisotope tagging of fragments
US4877611A (en) 1986-04-15 1989-10-31 Ribi Immunochem Research Inc. Vaccine containing tumor antigens and adjuvants
JPS638396A (ja) 1986-06-30 1988-01-14 Wakunaga Pharmaceut Co Ltd ポリ標識化オリゴヌクレオチド誘導体
US4946778A (en) 1987-09-21 1990-08-07 Genex Corporation Single polypeptide chain binding molecules
US5834185A (en) 1986-10-28 1998-11-10 Johns Hopkins University Formation of triple helix complexes of single stranded nucleic acids using nucleoside oligomers which comprise pyrimidine analogs, triple helix complexes formed thereby and oligomers used in their formation
US5276019A (en) 1987-03-25 1994-01-04 The United States Of America As Represented By The Department Of Health And Human Services Inhibitors for replication of retroviruses and for the expression of oncogene products
US5264423A (en) 1987-03-25 1993-11-23 The United States Of America As Represented By The Department Of Health And Human Services Inhibitors for replication of retroviruses and for the expression of oncogene products
US4904582A (en) 1987-06-11 1990-02-27 Synthetic Genetics Novel amphiphilic nucleic acid conjugates
EP0366685B1 (en) 1987-06-24 1994-10-19 Howard Florey Institute Of Experimental Physiology And Medicine Nucleoside derivatives
US5585481A (en) 1987-09-21 1996-12-17 Gen-Probe Incorporated Linking reagents for nucleotide probes
US5188897A (en) 1987-10-22 1993-02-23 Temple University Of The Commonwealth System Of Higher Education Encapsulated 2',5'-phosphorothioate oligoadenylates
US4924624A (en) 1987-10-22 1990-05-15 Temple University-Of The Commonwealth System Of Higher Education 2,',5'-phosphorothioate oligoadenylates and plant antiviral uses thereof
US5525465A (en) 1987-10-28 1996-06-11 Howard Florey Institute Of Experimental Physiology And Medicine Oligonucleotide-polyamide conjugates and methods of production and applications of the same
DE3738460A1 (de) 1987-11-12 1989-05-24 Max Planck Gesellschaft Modifizierte oligonukleotide
US5843708A (en) 1988-01-05 1998-12-01 Ciba-Geigy Corporation Chimeric antibodies
US5082830A (en) 1988-02-26 1992-01-21 Enzo Biochem, Inc. End labeled nucleotide probe
JPH03503894A (ja) 1988-03-25 1991-08-29 ユニバーシィティ オブ バージニア アランミ パテンツ ファウンデイション オリゴヌクレオチド n‐アルキルホスホラミデート
NZ229004A (en) 1988-05-19 1993-09-27 Immunobiology Res Inst Inc Tetrapeptides having t cell helper acitivity
US5278302A (en) 1988-05-26 1994-01-11 University Patents, Inc. Polynucleotide phosphorodithioates
US5109124A (en) 1988-06-01 1992-04-28 Biogen, Inc. Nucleic acid probe linked to a label having a terminal cysteine
US5216141A (en) 1988-06-06 1993-06-01 Benner Steven A Oligonucleotide analogs containing sulfur linkages
US5175273A (en) 1988-07-01 1992-12-29 Genentech, Inc. Nucleic acid intercalating agents
US5294533A (en) 1988-07-05 1994-03-15 Baylor College Of Medicine Antisense oligonucleotide antibiotics complementary to the macromolecular synthesis operon, methods of treating bacterial infections and methods for identification of bacteria
US5262536A (en) 1988-09-15 1993-11-16 E. I. Du Pont De Nemours And Company Reagents for the preparation of 5'-tagged oligonucleotides
US5866701A (en) 1988-09-20 1999-02-02 The Board Of Regents For Northern Illinois University Of Dekalb HIV targeted hairpin ribozymes
US5512439A (en) 1988-11-21 1996-04-30 Dynal As Oligonucleotide-linked magnetic particles and uses thereof
US5176996A (en) 1988-12-20 1993-01-05 Baylor College Of Medicine Method for making synthetic oligonucleotides which bind specifically to target sites on duplex DNA molecules, by forming a colinear triplex, the synthetic oligonucleotides and methods of use
US5457183A (en) 1989-03-06 1995-10-10 Board Of Regents, The University Of Texas System Hydroxylated texaphyrins
US5599923A (en) 1989-03-06 1997-02-04 Board Of Regents, University Of Tx Texaphyrin metal complexes having improved functionalization
US5168053A (en) 1989-03-24 1992-12-01 Yale University Cleavage of targeted RNA by RNAase P
US5624824A (en) 1989-03-24 1997-04-29 Yale University Targeted cleavage of RNA using eukaryotic ribonuclease P and external guide sequence
US5391723A (en) 1989-05-31 1995-02-21 Neorx Corporation Oligonucleotide conjugates
US4958013A (en) 1989-06-06 1990-09-18 Northwestern University Cholesteryl modified oligonucleotides
US5473039A (en) 1989-08-18 1995-12-05 The Scripps Research Institute Polypeptide analogs of apolipoprotein E, diagnostic systems and methods using the analogs
US5451463A (en) 1989-08-28 1995-09-19 Clontech Laboratories, Inc. Non-nucleoside 1,3-diol reagents for labeling synthetic oligonucleotides
US5134066A (en) 1989-08-29 1992-07-28 Monsanto Company Improved probes using nucleosides containing 3-dezauracil analogs
US5770576A (en) 1989-08-30 1998-06-23 Cytran, Inc. Pharmaceutical dipeptide compositions and methods of use thereof: systemic toxicity
US5254469A (en) 1989-09-12 1993-10-19 Eastman Kodak Company Oligonucleotide-enzyme conjugate that can be used as a probe in hybridization assays and polymerase chain reaction procedures
US5591722A (en) 1989-09-15 1997-01-07 Southern Research Institute 2'-deoxy-4'-thioribonucleosides and their antiviral activity
US5399676A (en) 1989-10-23 1995-03-21 Gilead Sciences Oligonucleotides with inverted polarity
US5264562A (en) 1989-10-24 1993-11-23 Gilead Sciences, Inc. Oligonucleotide analogs with novel linkages
US5264564A (en) 1989-10-24 1993-11-23 Gilead Sciences Oligonucleotide analogs with novel linkages
DE69034150T2 (de) 1989-10-24 2005-08-25 Isis Pharmaceuticals, Inc., Carlsbad 2'-Modifizierte Oligonukleotide
US5292873A (en) 1989-11-29 1994-03-08 The Research Foundation Of State University Of New York Nucleic acids labeled with naphthoquinone probe
US5177198A (en) 1989-11-30 1993-01-05 University Of N.C. At Chapel Hill Process for preparing oligoribonucleoside and oligodeoxyribonucleoside boranophosphates
JP2507895B2 (ja) 1989-12-19 1996-06-19 工業技術院長 リボザイムの新規合成系
US5130302A (en) 1989-12-20 1992-07-14 Boron Bilogicals, Inc. Boronated nucleoside, nucleotide and oligonucleotide compounds, compositions and methods for using same
US5486603A (en) 1990-01-08 1996-01-23 Gilead Sciences, Inc. Oligonucleotide having enhanced binding affinity
US5480869A (en) 1990-01-09 1996-01-02 The Regents Of The University Of California Anti-inflammatory peptide analogs and treatment to inhibit vascular leakage in injured tissues
US5681941A (en) 1990-01-11 1997-10-28 Isis Pharmaceuticals, Inc. Substituted purines and oligonucleotide cross-linking
US5670633A (en) 1990-01-11 1997-09-23 Isis Pharmaceuticals, Inc. Sugar modified oligonucleotides that detect and modulate gene expression
US5578718A (en) 1990-01-11 1996-11-26 Isis Pharmaceuticals, Inc. Thiol-derivatized nucleosides
US5587361A (en) 1991-10-15 1996-12-24 Isis Pharmaceuticals, Inc. Oligonucleotides having phosphorothioate linkages of high chiral purity
US5459255A (en) 1990-01-11 1995-10-17 Isis Pharmaceuticals, Inc. N-2 substituted purines
US5646265A (en) 1990-01-11 1997-07-08 Isis Pharmceuticals, Inc. Process for the preparation of 2'-O-alkyl purine phosphoramidites
DE69120146T2 (de) 1990-01-12 1996-12-12 Cell Genesys Inc Erzeugung xenogener antikörper
AU7579991A (en) 1990-02-20 1991-09-18 Gilead Sciences, Inc. Pseudonucleosides and pseudonucleotides and their polymers
US5214136A (en) 1990-02-20 1993-05-25 Gilead Sciences, Inc. Anthraquinone-derivatives oligonucleotides
US5321131A (en) 1990-03-08 1994-06-14 Hybridon, Inc. Site-specific functionalization of oligodeoxynucleotides for non-radioactive labelling
US5470967A (en) 1990-04-10 1995-11-28 The Dupont Merck Pharmaceutical Company Oligonucleotide analogs with sulfamate linkages
GB9009980D0 (en) 1990-05-03 1990-06-27 Amersham Int Plc Phosphoramidite derivatives,their preparation and the use thereof in the incorporation of reporter groups on synthetic oligonucleotides
ES2116977T3 (es) 1990-05-11 1998-08-01 Microprobe Corp Soportes solidos para ensayos de hibridacion de acidos nucleicos y metodos para inmovilizar oligonucleotidos de modo covalente.
AU662885B2 (en) 1990-06-07 1995-09-21 Scripps Research Institute, The APO AI polypeptides, antibodies, and immunoassays
US5869641A (en) 1990-06-11 1999-02-09 Nexstar Pharmaceuticals, Inc. High affinity nucleic acid ligands of CD4
US5543293A (en) 1990-06-11 1996-08-06 Nexstar Pharmaceuticals, Inc. DNA ligands of thrombin
US6030776A (en) 1990-06-11 2000-02-29 Nexstar Pharmaceuticals, Inc. Parallel SELEX
US5864026A (en) 1990-06-11 1999-01-26 Nexstar Pharmaceuticals, Inc. Systematic evolution of ligands by exponential enrichment: tissue selex
US5731424A (en) 1990-06-11 1998-03-24 Nexstar Pharmaceuticals, Inc. High affinity TGFβ nucleic acid ligands and inhibitors
US6001988A (en) 1990-06-11 1999-12-14 Nexstar Pharmaceuticals, Inc. High affinity nucleic acid ligands to lectins
US5795721A (en) 1990-06-11 1998-08-18 Nexstar Pharmaceuticals, Inc. High affinity nucleic acid ligands of ICP4
US5846713A (en) 1990-06-11 1998-12-08 Nexstar Pharmaceuticals, Inc. High affinity HKGF nucleic acid ligands and inhibitors
US5476766A (en) 1990-06-11 1995-12-19 Nexstar Pharmaceuticals, Inc. Ligands of thrombin
US5580737A (en) 1990-06-11 1996-12-03 Nexstar Pharmaceuticals, Inc. High-affinity nucleic acid ligands that discriminate between theophylline and caffeine
US5780228A (en) 1990-06-11 1998-07-14 Nexstar Pharmaceuticals, Inc. High affinity nucleic acid ligands to lectins
US5503978A (en) 1990-06-11 1996-04-02 University Research Corporation Method for identification of high affinity DNA ligands of HIV-1 reverse transcriptase
US5861254A (en) 1997-01-31 1999-01-19 Nexstar Pharmaceuticals, Inc. Flow cell SELEX
US5660985A (en) 1990-06-11 1997-08-26 Nexstar Pharmaceuticals, Inc. High affinity nucleic acid ligands containing modified nucleotides
US6011020A (en) 1990-06-11 2000-01-04 Nexstar Pharmaceuticals, Inc. Nucleic acid ligand complexes
US5723289A (en) 1990-06-11 1998-03-03 Nexstar Pharmaceuticals, Inc. Parallel selex
US5135917A (en) 1990-07-12 1992-08-04 Nova Pharmaceutical Corporation Interleukin receptor expression inhibiting antisense oligonucleotides
US5677437A (en) 1990-07-27 1997-10-14 Isis Pharmaceuticals, Inc. Heteroatomic oligonucleoside linkages
US5623070A (en) 1990-07-27 1997-04-22 Isis Pharmaceuticals, Inc. Heteroatomic oligonucleoside linkages
US5218105A (en) 1990-07-27 1993-06-08 Isis Pharmaceuticals Polyamine conjugated oligonucleotides
US5610289A (en) 1990-07-27 1997-03-11 Isis Pharmaceuticals, Inc. Backbone modified oligonucleotide analogues
US5541307A (en) 1990-07-27 1996-07-30 Isis Pharmaceuticals, Inc. Backbone modified oligonucleotide analogs and solid phase synthesis thereof
US5688941A (en) 1990-07-27 1997-11-18 Isis Pharmaceuticals, Inc. Methods of making conjugated 4' desmethyl nucleoside analog compounds
JPH0874B2 (ja) 1990-07-27 1996-01-10 アイシス・ファーマシューティカルス・インコーポレーテッド 遺伝子発現を検出および変調するヌクレアーゼ耐性、ピリミジン修飾オリゴヌクレオチド
US5138045A (en) 1990-07-27 1992-08-11 Isis Pharmaceuticals Polyamine conjugated oligonucleotides
US5602240A (en) 1990-07-27 1997-02-11 Ciba Geigy Ag. Backbone modified oligonucleotide analogs
US5608046A (en) 1990-07-27 1997-03-04 Isis Pharmaceuticals, Inc. Conjugated 4'-desmethyl nucleoside analog compounds
US5489677A (en) 1990-07-27 1996-02-06 Isis Pharmaceuticals, Inc. Oligonucleoside linkages containing adjacent oxygen and nitrogen atoms
US5618704A (en) 1990-07-27 1997-04-08 Isis Pharmacueticals, Inc. Backbone-modified oligonucleotide analogs and preparation thereof through radical coupling
US5245022A (en) 1990-08-03 1993-09-14 Sterling Drug, Inc. Exonuclease resistant terminally substituted oligonucleotides
MY107332A (en) 1990-08-03 1995-11-30 Sterling Drug Inc Compounds and methods for inhibiting gene expression.
US5177196A (en) 1990-08-16 1993-01-05 Microprobe Corporation Oligo (α-arabinofuranosyl nucleotides) and α-arabinofuranosyl precursors thereof
US5512667A (en) 1990-08-28 1996-04-30 Reed; Michael W. Trifunctional intermediates for preparing 3'-tailed oligonucleotides
DE69133557D1 (de) 1990-08-29 2007-03-15 Pharming Intellectual Pty Bv Homologe rekombination in säugetier-zellen
US5214134A (en) 1990-09-12 1993-05-25 Sterling Winthrop Inc. Process of linking nucleosides with a siloxane bridge
US5561225A (en) 1990-09-19 1996-10-01 Southern Research Institute Polynucleotide analogs containing sulfonate and sulfonamide internucleoside linkages
JPH06505704A (ja) 1990-09-20 1994-06-30 ギリアド サイエンシズ,インコーポレイテッド 改変ヌクレオシド間結合
US5432272A (en) 1990-10-09 1995-07-11 Benner; Steven A. Method for incorporating into a DNA or RNA oligonucleotide using nucleotides bearing heterocyclic bases
US5271941A (en) 1990-11-02 1993-12-21 Cho Chung Yoon S Antisense oligonucleotides of human regulatory subunit RI.sub.α of cAMP-dependent protein kinases
KR930702373A (ko) 1990-11-08 1993-09-08 안토니 제이. 페이네 합성 올리고누클레오티드에 대한 다중 리포터(Reporter)그룹의 첨합
US5683874A (en) 1991-03-27 1997-11-04 Research Corporation Technologies, Inc. Single-stranded circular oligonucleotides capable of forming a triplex with a target sequence
US5714331A (en) 1991-05-24 1998-02-03 Buchardt, Deceased; Ole Peptide nucleic acids having enhanced binding affinity, sequence specificity and solubility
US5719262A (en) 1993-11-22 1998-02-17 Buchardt, Deceased; Ole Peptide nucleic acids having amino acid side chains
US5539082A (en) 1993-04-26 1996-07-23 Nielsen; Peter E. Peptide nucleic acids
US6028186A (en) 1991-06-10 2000-02-22 Nexstar Pharmaceuticals, Inc. High affinity nucleic acid ligands of cytokines
DE4216134A1 (de) 1991-06-20 1992-12-24 Europ Lab Molekularbiolog Synthetische katalytische oligonukleotidstrukturen
US5371241A (en) 1991-07-19 1994-12-06 Pharmacia P-L Biochemicals Inc. Fluorescein labelled phosphoramidites
US5571799A (en) 1991-08-12 1996-11-05 Basco, Ltd. (2'-5') oligoadenylate analogues useful as inhibitors of host-v5.-graft response
US5565332A (en) 1991-09-23 1996-10-15 Medical Research Council Production of chimeric antibodies - a combinatorial approach
EP0538194B1 (de) 1991-10-17 1997-06-04 Novartis AG Bicyclische Nukleoside, Oligonukleotide, Verfahren zu deren Herstellung und Zwischenprodukte
US5594121A (en) 1991-11-07 1997-01-14 Gilead Sciences, Inc. Enhanced triple-helix and double-helix formation with oligomers containing modified purines
US5484908A (en) 1991-11-26 1996-01-16 Gilead Sciences, Inc. Oligonucleotides containing 5-propynyl pyrimidines
AU3222793A (en) 1991-11-26 1993-06-28 Gilead Sciences, Inc. Enhanced triple-helix and double-helix formation with oligomers containing modified pyrimidines
SE9103701D0 (sv) 1991-12-13 1991-12-13 Kabi Pharmacia Ab Apolipoprotein
US5359044A (en) 1991-12-13 1994-10-25 Isis Pharmaceuticals Cyclobutyl oligonucleotide surrogates
US5700922A (en) 1991-12-24 1997-12-23 Isis Pharmaceuticals, Inc. PNA-DNA-PNA chimeric macromolecules
US5595726A (en) 1992-01-21 1997-01-21 Pharmacyclics, Inc. Chromophore probe for detection of nucleic acid
US5565552A (en) 1992-01-21 1996-10-15 Pharmacyclics, Inc. Method of expanded porphyrin-oligonucleotide conjugate synthesis
US5652094A (en) 1992-01-31 1997-07-29 University Of Montreal Nucleozymes
FR2687679B1 (fr) 1992-02-05 1994-10-28 Centre Nat Rech Scient Oligothionucleotides.
US5633360A (en) 1992-04-14 1997-05-27 Gilead Sciences, Inc. Oligonucleotide analogs capable of passive cell membrane permeation
US5310764A (en) 1992-05-08 1994-05-10 Steven Baranowitz Treatment of age related macular degeneration with beta-carotene
US5693535A (en) 1992-05-14 1997-12-02 Ribozyme Pharmaceuticals, Inc. HIV targeted ribozymes
US5989906A (en) 1992-05-14 1999-11-23 Ribozyme Pharmaceuticals, Inc. Method and reagent for inhibiting P-glycoprotein (mdr-1-gene)
US6017756A (en) 1992-05-14 2000-01-25 Ribozyme Pharmaceuticals, Inc. Method and reagent for inhibiting hepatitis B virus replication
US5972699A (en) 1992-05-14 1999-10-26 Ribozyme Pharmaceuticals, Inc. Method and reagent for inhibiting herpes simplex virus replication
US5646020A (en) 1992-05-14 1997-07-08 Ribozyme Pharmaceuticals, Inc. Hammerhead ribozymes for preferred targets
US5610054A (en) 1992-05-14 1997-03-11 Ribozyme Pharmaceuticals, Inc. Enzymatic RNA molecule targeted against Hepatitis C virus
US5434257A (en) 1992-06-01 1995-07-18 Gilead Sciences, Inc. Binding compentent oligomers containing unsaturated 3',5' and 2',5' linkages
JPH07507554A (ja) 1992-06-12 1995-08-24 エヌ・ブイ・イノゲネテイクス・エス・エイ 新規ペプチドおよびタンパク質,それらの調製方法,ならびにコレステロール受容体としてのそれらの使用
EP0577558A2 (de) 1992-07-01 1994-01-05 Ciba-Geigy Ag Carbocyclische Nukleoside mit bicyclischen Ringen, Oligonukleotide daraus, Verfahren zu deren Herstellung, deren Verwendung und Zwischenproduckte
AU672018B2 (en) 1992-07-02 1996-09-19 Sankyo Company Limited Looped, hairpin ribozyme
US5272250A (en) 1992-07-10 1993-12-21 Spielvogel Bernard F Boronated phosphoramidate compounds
US5344822A (en) 1992-08-12 1994-09-06 The Rogosin Institute Methods useful in endotoxin prophylaxis and therapy
AU672028B2 (en) 1992-08-14 1996-09-19 Shino-Test Corporation Peptides containing respective amino acid sequences selected from among those of lipoprotein(a) and apolipoprotein(a), antibodies respectively recognizing these amino acid sequences, and method of assaying with these antibodies
US5646042A (en) 1992-08-26 1997-07-08 Ribozyme Pharmaceuticals, Inc. C-myb targeted ribozymes
US6042828A (en) 1992-09-07 2000-03-28 Kyowa Hakko Kogyo Co., Ltd. Humanized antibodies to ganglioside GM2
US5652138A (en) 1992-09-30 1997-07-29 The Scripps Research Institute Human neutralizing monoclonal antibodies to human immunodeficiency virus
US5891684A (en) 1992-10-15 1999-04-06 Ribozyme Pharmaceuticals, Inc. Base-modified enzymatic nucleic acid
US5811300A (en) 1992-12-07 1998-09-22 Ribozyme Pharmaceuticals, Inc. TNF-α ribozymes
US5612215A (en) 1992-12-07 1997-03-18 Ribozyme Pharmaceuticals, Inc. Stromelysin targeted ribozymes
JP3401005B2 (ja) 1992-12-11 2003-04-28 ユニバーシティ オブ フロリダ 有害生物の防除のための材料および方法
US5721138A (en) 1992-12-15 1998-02-24 Sandford University Apolipoprotein(A) promoter and regulatory sequence constructs and methods of use
US5574142A (en) 1992-12-15 1996-11-12 Microprobe Corporation Peptide linkers for improved oligonucleotide delivery
AU6088094A (en) 1993-01-15 1994-08-15 General Hospital Corporation, The Rna assays using rna binary probes and ribozyme ligase
US5786138A (en) 1993-01-29 1998-07-28 Board Of Supervisors Of Louisiana State University And Agricultural And Mechanical College Hyperstabilizing antisense nucleic acid binding agents
US5476925A (en) 1993-02-01 1995-12-19 Northwestern University Oligodeoxyribonucleotides including 3'-aminonucleoside-phosphoramidate linkages and terminal 3'-amino groups
US5340614A (en) 1993-02-11 1994-08-23 Minnesota Mining And Manufacturing Company Methods of polymer impregnation
GB9304618D0 (en) 1993-03-06 1993-04-21 Ciba Geigy Ag Chemical compounds
CA2159631A1 (en) 1993-03-30 1994-10-13 Sanofi Acyclic nucleoside analogs and oligonucleotide sequences containing them
HU9501974D0 (en) 1993-03-31 1995-09-28 Sterling Winthrop Inc Oligonucleotides with amide linkages replacing phosphodiester linkages
DE4311944A1 (de) 1993-04-10 1994-10-13 Degussa Umhüllte Natriumpercarbonatpartikel, Verfahren zu deren Herstellung und sie enthaltende Wasch-, Reinigungs- und Bleichmittelzusammensetzungen
CA2164288A1 (en) 1993-06-04 1994-12-22 Barbara Ensoli Method for treating kaposi's sarcoma with antisense oligonucleotides
US6180377B1 (en) 1993-06-16 2001-01-30 Celltech Therapeutics Limited Humanized antibodies
US5962426A (en) 1993-06-25 1999-10-05 Yale University Triple-helix forming oligonucleotides for targeted mutagenesis
ATE227342T1 (de) 1993-09-02 2002-11-15 Ribozyme Pharm Inc Enzymatische nukleiksaüre die nicht-nukleotide enthaltet
US5502177A (en) 1993-09-17 1996-03-26 Gilead Sciences, Inc. Pyrimidine derivatives for labeled binding partners
EP2319513A1 (en) 1993-09-20 2011-05-11 Abbott Respiratory LLC Nicotinic acid compositons for treating hyperlipidemia and related methods therefor
US5861288A (en) 1993-10-18 1999-01-19 Ribozyme Pharmaceuticals, Inc. Catalytic DNA
US5616466A (en) 1993-11-05 1997-04-01 Cantor; Glenn H. Ribozyme-mediated inhibition of bovine leukemia virus
US5578716A (en) 1993-12-01 1996-11-26 Mcgill University DNA methyltransferase antisense oligonucleotides
US5457187A (en) 1993-12-08 1995-10-10 Board Of Regents University Of Nebraska Oligonucleotides containing 5-fluorouracil
US5446137B1 (en) 1993-12-09 1998-10-06 Behringwerke Ag Oligonucleotides containing 4'-substituted nucleotides
US5712384A (en) 1994-01-05 1998-01-27 Gene Shears Pty Ltd. Ribozymes targeting retroviral packaging sequence expression constructs and recombinant retroviruses containing such constructs
US5641754A (en) 1994-01-10 1997-06-24 The Board Of Regents Of The University Of Nebraska Antisense oligonucleotide compositions for selectively killing cancer cells
US5519134A (en) 1994-01-11 1996-05-21 Isis Pharmaceuticals, Inc. Pyrrolidine-containing monomers and oligomers
US5639647A (en) 1994-03-29 1997-06-17 Ribozyme Pharmaceuticals, Inc. 2'-deoxy-2'alkylnucleotide containing nucleic acid
US5631359A (en) 1994-10-11 1997-05-20 Ribozyme Pharmaceuticals, Inc. Hairpin ribozymes
US6773719B2 (en) 1994-03-04 2004-08-10 Esperion Luv Development, Inc. Liposomal compositions, and methods of using liposomal compositions to treat dislipidemias
US5746223A (en) 1996-10-11 1998-05-05 Williams; Kevin Jon Method of forcing the reverse transport of cholesterol from a body part to the liver while avoiding harmful disruptions of hepatic cholesterol homeostasis
US5869248A (en) 1994-03-07 1999-02-09 Yale University Targeted cleavage of RNA using ribonuclease P targeting and cleavage sequences
US5596091A (en) 1994-03-18 1997-01-21 The Regents Of The University Of California Antisense oligonucleotides comprising 5-aminoalkyl pyrimidine nucleotides
US5627053A (en) 1994-03-29 1997-05-06 Ribozyme Pharmaceuticals, Inc. 2'deoxy-2'-alkylnucleotide containing nucleic acid
US5625050A (en) 1994-03-31 1997-04-29 Amgen Inc. Modified oligonucleotides and intermediates useful in nucleic acid therapeutics
US5635599A (en) 1994-04-08 1997-06-03 The United States Of America As Represented By The Department Of Health And Human Services Fusion proteins comprising circularly permuted ligands
US5683902A (en) 1994-05-13 1997-11-04 Northern Illinois University Human papilloma virus inhibition by a hairpin ribozyme
US5595873A (en) 1994-05-13 1997-01-21 The Scripps Research Institute T. thermophila group I introns that cleave amide bonds
US5580967A (en) 1994-05-13 1996-12-03 The Scripps Research Institute Optimized catalytic DNA-cleaving ribozymes
US5525711A (en) 1994-05-18 1996-06-11 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Pteridine nucleotide analogs as fluorescent DNA probes
US5650316A (en) 1994-06-06 1997-07-22 Research Development Foundation Uses of triplex forming oligonucleotides for the treatment of human diseases
US5998193A (en) 1994-06-24 1999-12-07 Gene Shears Pty., Ltd. Ribozymes with optimized hybridizing arms, stems, and loops, tRNA embedded ribozymes and compositions thereof
US5633133A (en) 1994-07-14 1997-05-27 Long; David M. Ligation with hammerhead ribozymes
US5597696A (en) 1994-07-18 1997-01-28 Becton Dickinson And Company Covalent cyanine dye oligonucleotide conjugates
EP0775204A1 (en) 1994-08-09 1997-05-28 Novartis AG Antitumor antisense oligonucleotides
US5580731A (en) 1994-08-25 1996-12-03 Chiron Corporation N-4 modified pyrimidine deoxynucleotides and oligonucleotide probes synthesized therewith
US5597909A (en) 1994-08-25 1997-01-28 Chiron Corporation Polynucleotide reagents containing modified deoxyribose moieties, and associated methods of synthesis and use
US5688670A (en) 1994-09-01 1997-11-18 The General Hospital Corporation Self-modifying RNA molecules and methods of making
AU7954794A (en) 1994-09-12 1996-03-29 City Of Hope Modulation of drug radiation resistant genes
US5595973A (en) 1994-09-12 1997-01-21 Biomeasure Incorporated Protection of hemopoietic cells during chemotherapy or radiotherapy
US5599706A (en) 1994-09-23 1997-02-04 Stinchcomb; Dan T. Ribozymes targeted to apo(a) mRNA
US5856103A (en) 1994-10-07 1999-01-05 Board Of Regents The University Of Texas Method for selectively ranking sequences for antisense targeting
JPH08113591A (ja) 1994-10-14 1996-05-07 Taiho Yakuhin Kogyo Kk オリゴヌクレオチド及びこれを有効成分とする制癌剤
US5807718A (en) 1994-12-02 1998-09-15 The Scripps Research Institute Enzymatic DNA molecules
US5683873A (en) 1995-01-13 1997-11-04 Innovir Laboratories, Inc. EGS-mediated inactivation of target RNA
US5631146A (en) 1995-01-19 1997-05-20 The General Hospital Corporation DNA aptamers and catalysts that bind adenosine or adenosine-5'-phosphates and methods for isolation thereof
US5994320A (en) 1995-02-06 1999-11-30 Regents Of The University Of Minnesota Antisense oligonucleotides and methods for treating central nervous system tumors
US6107457A (en) 1995-02-16 2000-08-22 Board Of Regents, The University Of Texas System Bcr-Abl directed compositions and uses for inhibiting Philadelphia chromosome stimulated cell growth
IT1275862B1 (it) 1995-03-03 1997-10-24 Consiglio Nazionale Ricerche Trascritto antisenso associato ad alcuni tipi di cellule tumorali ed oligodeossinucleotidi sintetici utili nella diagnosi e nel trattamento
SE9500778D0 (sv) 1995-03-03 1995-03-03 Pharmacia Ab Process for producing a protein
US5770715A (en) 1995-03-22 1998-06-23 Toagosei Co., Ltd. Hammerhead-like nucleic acid analogues and their synthesis
US6130364A (en) 1995-03-29 2000-10-10 Abgenix, Inc. Production of antibodies using Cre-mediated site-specific recombination
US6013443A (en) 1995-05-03 2000-01-11 Nexstar Pharmaceuticals, Inc. Systematic evolution of ligands by exponential enrichment: tissue SELEX
US5646031A (en) 1995-05-16 1997-07-08 Northern Illinois University SArMV and sCYMVI hairpin ribozymes
US6113898A (en) 1995-06-07 2000-09-05 Idec Pharmaceuticals Corporation Human B7.1-specific primatized antibodies and transfectomas expressing said antibodies
US6040296A (en) 1995-06-07 2000-03-21 East Carolina University Specific antisense oligonucleotide composition & method for treatment of disorders associated with bronchoconstriction and lung inflammation
US5910408A (en) 1995-06-07 1999-06-08 The General Hospital Corporation Catalytic DNA having ligase activity
US5693773A (en) 1995-06-07 1997-12-02 Hybridon Incorporated Triplex-forming antisense oligonucleotides having abasic linkers targeting nucleic acids comprising mixed sequences of purines and pyrimidines
US6020130A (en) 1995-06-07 2000-02-01 Nexstar Pharmaceuticals, Inc. Nucleic acid ligands that bind to and inhibit DNA polymerases
US6410690B1 (en) 1995-06-07 2002-06-25 Medarex, Inc. Therapeutic compounds comprised of anti-Fc receptor antibodies
US6717031B2 (en) 1995-06-07 2004-04-06 Kate Dora Games Method for selecting a transgenic mouse model of alzheimer's disease
US5877021A (en) 1995-07-07 1999-03-02 Ribozyme Pharmaceuticals, Inc. B7-1 targeted ribozymes
AU6846396A (en) 1995-08-14 1997-03-12 Massachusetts Institute Of Technology Gear throttle as a nucleation device in a continuous microcellular extrusion system
BR9610390A (pt) 1995-09-09 1999-07-06 Hoffmann La Roche O uso de uma tienotriazolodiazepina para aumentar os níveis da apoliproteína a-i
NO953680D0 (no) 1995-09-18 1995-09-18 Hans Prydz Cellesyklusenzymer
AU7286696A (en) 1995-10-13 1997-05-07 F. Hoffmann-La Roche Ag Antisense oligomers
CZ154898A3 (cs) 1995-11-21 1998-09-16 Icn Pharmaceuticals, Inc. Oligonukleotidy pro inhibici růstu nádorů zprostředkovaných IL-8 a receptorem IL-8
US5998203A (en) 1996-04-16 1999-12-07 Ribozyme Pharmaceuticals, Inc. Enzymatic nucleic acids containing 5'-and/or 3'-cap structures
CN1215994A (zh) 1996-02-15 1999-05-05 国家健康学会 对治疗rsv感染有效的rna酶l激活剂和反义寡核苷酸
US5877162A (en) 1996-03-14 1999-03-02 Innovir Laboratories, Inc. Short external guide sequences
US5912014A (en) 1996-03-15 1999-06-15 Unigene Laboratories, Inc. Oral salmon calcitonin pharmaceutical products
CN1109047C (zh) 1996-03-29 2003-05-21 D·博菲利 作为胆固醇和其它脂类摄取抑制剂的两亲分子
US6200955B1 (en) 1996-06-11 2001-03-13 Commonwealth Biotechnologies, Inc. Heparin binding peptides
US5877153A (en) 1996-06-11 1999-03-02 Commonwealth Biotechnologies Inc. Heparin-binding peptides
US5792613A (en) 1996-06-12 1998-08-11 The Curators Of The University Of Missouri Method for obtaining RNA aptamers based on shape selection
ZA975891B (en) 1996-07-05 1998-07-23 Combimatrix Corp Electrochemical solid phase synthesis of polymers
US5955590A (en) 1996-07-15 1999-09-21 Worcester Foundation For Biomedical Research Conjugates of minor groove DNA binders with antisense oligonucleotides
SE9603068D0 (sv) 1996-08-23 1996-08-23 Pharmacia & Upjohn Ab Process for purifying a protein
US6156727A (en) 1996-09-05 2000-12-05 Uab Research Foundation Anti-atherosclerotic peptides and a transgenic mouse model of antherosclerosis
SE9603303D0 (sv) 1996-09-11 1996-09-11 Pharmacia & Upjohn Ab Process for purifying a protein
US5874566A (en) 1996-10-25 1999-02-23 Hisamitsu Pharmaceutical Co. Inc. Il-15 triplex oligonucleotides
US6051698A (en) 1997-06-06 2000-04-18 Janjic; Nebojsa Vascular endothelial growth factor (VEGF) nucleic acid ligand complexes
US6555651B2 (en) 1997-10-09 2003-04-29 The Trustees Of Columbia University In The City Of New York Ligand binding site of rage and uses thereof
US6046004A (en) 1997-02-27 2000-04-04 Lorne Park Research, Inc. Solution hybridization of nucleic acids with antisense probes having modified backbones
ES2239801T3 (es) 1997-04-02 2005-10-01 The Brigham And Women's Hospital, Inc. Uso de un agente para disminuir el riesgo de enfermedad cardiovascular.
US6696545B1 (en) 1997-04-11 2004-02-24 Sangstat Medical Corporation Cytomodulating lipophilic peptides for modulating immune system activity and inhibiting inflammation
DE69805697T3 (de) 1997-04-24 2006-11-30 Chemoxal S.A. Desinfizierende und fungizide Zusammensetzung auf der Basis von Peressigsäure und einem Aminoxid
US6635623B1 (en) 1997-06-13 2003-10-21 Baylor College Of Medicine Lipoproteins as nucleic acid vectors
EP1002232A4 (en) 1997-07-15 2004-05-26 Bioprobes Inc DETERMINATION OF ALCOHOL CONSUMPTION USING SIALIC ACID / APO J
JPH1142091A (ja) 1997-07-25 1999-02-16 Toagosei Co Ltd アンチセンス核酸化合物
US6383808B1 (en) 2000-09-11 2002-05-07 Isis Pharmaceuticals, Inc. Antisense inhibition of clusterin expression
DE19736591A1 (de) 1997-08-22 1999-02-25 Peter Prof Dr Hegemann Verfahren zum Herstellen von Nukleinsäurepolymeren
US5800758A (en) 1997-09-16 1998-09-01 Kimberly-Clark Worldwide, Inc. Process for making microporous films with improved properties
US6004925A (en) 1997-09-29 1999-12-21 J. L. Dasseux Apolipoprotein A-I agonists and their use to treat dyslipidemic disorders
US6037323A (en) 1997-09-29 2000-03-14 Jean-Louis Dasseux Apolipoprotein A-I agonists and their use to treat dyslipidemic disorders
US6518412B1 (en) 1997-09-29 2003-02-11 Jean-Louis Dasseux Gene therapy approaches to supply apolipoprotein A-I agonists and their use to treat dyslipidemic disorders
US6046166A (en) 1997-09-29 2000-04-04 Jean-Louis Dasseux Apolipoprotein A-I agonists and their use to treat dyslipidemic disorders
US6287590B1 (en) 1997-10-02 2001-09-11 Esperion Therapeutics, Inc. Peptide/lipid complex formation by co-lyophilization
US6673768B1 (en) 1997-10-16 2004-01-06 Board Of Regents, The University Of Texas System Transgenic animal models for cardiac hypertrophy and methods of use thereof (treating)
CA2248762A1 (en) 1997-10-22 1999-04-22 University Technologies International, Inc. Antisense oligodeoxynucleotides regulating expression of tnf-.alpha.
US6191151B1 (en) 1997-11-12 2001-02-20 Howard M. Zik Therapy for herpes neurological viral conditions utilizing 1,4-dihydropyridine calcium channel blockers
US20030077641A1 (en) 1998-03-11 2003-04-24 Laskowitz Daniel T. Methods of suppressing microglial activation and systemic inflammatory responses
US6303619B1 (en) 1998-03-12 2001-10-16 University Of Virginia Meta-substituted acidic 8-phenylxanthine antagonists of A3 human adenosine receptors
WO1999047566A1 (en) 1998-03-17 1999-09-23 The Uab Research Foundation Synthetic peptides that enhance ldl uptake
US6846636B1 (en) 1998-05-15 2005-01-25 American National Red Cross Methods and compositions for HDL holoparticle uptake receptor
US6019739A (en) 1998-06-18 2000-02-01 Baxter International Inc. Minimally invasive valve annulus sizer
US6007995A (en) 1998-06-26 1999-12-28 Isis Pharmaceuticals Inc. Antisense inhibition of TNFR1 expression
PT1974747E (pt) 1998-08-11 2012-09-05 Biogen Idec Inc Terapias de combinação para linfomas de células b compreendendo a administração de anticorpo anti-cd20
ES2543819T3 (es) 1998-11-09 2015-08-24 Biogen Inc. Tratamiento de neoplasias hematológicas asociadas con células tumorales circulantes utilizando anticuerpo quimérico dirigido contra CD20
US6228989B1 (en) 1998-11-13 2001-05-08 The Regents Of The University Of California Peptide substrates phosphorylated by P21-activated protein kinase
WO2000034469A1 (en) 1998-12-11 2000-06-15 The Research Foundation Of State University Of New York At Albany Compositions and methods for altering cell migration
US6013522A (en) 1999-02-23 2000-01-11 Isis Pharmaceuticals Inc. Antisense inhibition of human Smad1 expression
US7544772B2 (en) 2001-06-26 2009-06-09 Biomarck Pharmaceuticals, Ltd. Methods for regulating inflammatory mediators and peptides useful therein
US6410802B1 (en) 1999-04-01 2002-06-25 Esperion Therapeutics, Inc. Methods for synthesizing ether compounds and intermediates therefor
US6849714B1 (en) 1999-05-17 2005-02-01 Conjuchem, Inc. Protection of endogenous therapeutic peptides from peptidase activity through conjugation to blood components
US6887470B1 (en) 1999-09-10 2005-05-03 Conjuchem, Inc. Protection of endogenous therapeutic peptides from peptidase activity through conjugation to blood components
GB9911689D0 (en) 1999-05-19 1999-07-21 Medical Res Council Refolding method
US6025198A (en) 1999-06-25 2000-02-15 Isis Pharmaceuticals Inc. Antisense modulation of Ship-2 expression
US6033910A (en) 1999-07-19 2000-03-07 Isis Pharmaceuticals Inc. Antisense inhibition of MAP kinase kinase 6 expression
US6727063B1 (en) 1999-09-10 2004-04-27 Millennium Pharmaceuticals, Inc. Single nucleotide polymorphisms in genes
EP1226231A4 (en) 1999-11-02 2003-07-09 Human Genome Sciences Inc 19 HUMANE SECRETIED PROTEINS
EP1110958A1 (en) 1999-12-20 2001-06-27 Ucb, S.A. Alpha-arylethylpiperazine derivatives as neurokinin antagonists
US6514523B1 (en) 2000-02-14 2003-02-04 Ottawa Heart Institute Research Corporation Carrier particles for drug delivery and process for preparation
US6596544B1 (en) 2000-03-31 2003-07-22 The Regents Of The University Of California Functional assay of high-density lipoprotein
AU2001249762B2 (en) 2000-03-31 2006-03-30 The Regents Of The University Of California A functional assay of high-density lipoprotein
US6436703B1 (en) 2000-03-31 2002-08-20 Hyseq, Inc. Nucleic acids and polypeptides
US20030040505A1 (en) 2000-03-31 2003-02-27 The Regents Of The University Of California Synthetic phospholipids to ameliorate atherosclerosis and other inflammatory conditions
US6444681B1 (en) 2000-06-09 2002-09-03 The Ohio State University Research Foundation Methods and compositions for treating Raynaud's Phenomenon and scleroderma
US6680203B2 (en) 2000-07-10 2004-01-20 Esperion Therapeutics, Inc. Fourier transform mass spectrometry of complex biological samples
AU7705601A (en) 2000-07-25 2002-02-05 Merck & Co Inc N-substituted indoles useful in the treatment of diabetes
US7166578B2 (en) 2000-08-24 2007-01-23 The Regents Of The University Of California Orally administered peptides synergize statin activity
US7144862B2 (en) 2000-08-24 2006-12-05 The Regents Of The University Of California Orally administered peptides to ameliorate atherosclerosis
US8568766B2 (en) 2000-08-24 2013-10-29 Gattadahalli M. Anantharamaiah Peptides and peptide mimetics to treat pathologies associated with eye disease
US7723303B2 (en) 2000-08-24 2010-05-25 The Regents Of The University Of California Peptides and peptide mimetics to treat pathologies characterized by an inflammatory response
US7148197B2 (en) 2000-08-24 2006-12-12 The Regents Of The University Of California Orally administered small peptides synergize statin activity
EP1186299A1 (en) 2000-09-12 2002-03-13 Universitair Medisch Centrum Utrecht The diagnosis, prevention, and/or succesful treatment of atherosclerosis, infectious diseases, and disturbances in the immune system
US20040122091A1 (en) 2000-10-11 2004-06-24 Esperion Therapeutics, Inc. Sulfoxide and bis-sulfoxide compounds and compositions for cholesterol management and related uses
JP2004531459A (ja) 2000-10-11 2004-10-14 エスペリオン セラピューティクス,インコーポレイテッド コレステロールマネージメント用スルホキシドおよびビススルホキシド化合物ならびに組成物および関連する使用
CN1894195A (zh) 2000-10-11 2007-01-10 埃斯佩里安医疗公司 用于控制胆固醇以及相关用途的醚化合物以及组合物
CN101426763A (zh) 2000-10-11 2009-05-06 埃斯佩里安医疗公司 用于胆固醇治疗和相关应用的硫化物和二硫化物化合物和组合物
CA2425311C (en) 2000-10-11 2011-06-14 Esperion Therapeutics, Inc. Ketone compounds and compositions for cholesterol management and related uses
US6982348B2 (en) 2001-01-26 2006-01-03 Takeda Pharmaceutical Company Limited Aminoethanol derivatives
JP2002226457A (ja) 2001-02-02 2002-08-14 Ajinomoto Co Inc 新規シスチン誘導体及び炎症因子活性化抑制剤
US6815426B2 (en) 2001-02-16 2004-11-09 E. I. Du Pont De Nemours And Company Angiogenesis-inhibitory tripeptides, compositions and their methods of use
US7217785B2 (en) 2001-05-09 2007-05-15 The Regents Of The University Of California Cysteine-containing peptides having antioxidant properties
US6858580B2 (en) 2001-06-04 2005-02-22 Nobex Corporation Mixtures of drug-oligomer conjugates comprising polyalkylene glycol, uses thereof, and methods of making same
CA2817619A1 (en) 2001-06-08 2002-12-08 Abbott Laboratories (Bermuda) Ltd. Methods of administering anti-tnf.alpha. antibodies
PL372925A1 (en) 2001-09-28 2005-08-08 Esperion Therapeutics Inc. Prevention and treatment of restenosis by local administration of drug
US20030125260A1 (en) 2001-10-31 2003-07-03 Fortuna Haviv Tetra-and pentapeptides having antiangiogenic activity
US7470659B2 (en) 2001-12-07 2008-12-30 The Regents Of The University Of California Methods to increase reverse cholesterol transport in the retinal pigment epithelium (RPE) and Bruch's membrane (BM)
US20050154046A1 (en) 2004-01-12 2005-07-14 Longgui Wang Methods of treating an inflammatory-related disease
US7582670B2 (en) 2001-12-13 2009-09-01 Natrogen Therapeutics, Inc. Methods of treating an inflammatory-related disease
US7108868B2 (en) 2002-03-22 2006-09-19 Unigen Pharmaceuticals, Inc. Isolation of a dual cox-2 and 5-lipoxygenase inhibitor from acacia
US6930085B2 (en) 2002-04-05 2005-08-16 The Regents Of The University Of California G-type peptides to ameliorate atherosclerosis
AU2003221733A1 (en) 2002-04-17 2003-11-03 University Of Florida Research Foundation, Inc. Improved raav vectors
WO2004009776A2 (en) 2002-07-19 2004-01-29 Abbott Biotechnology Ltd. TREATMENT OF TNFα RELATED DISORDERS
DK1539157T3 (da) 2002-09-18 2013-10-07 Univ Pennsylvania Fremgangsmåde til hæmning af choroidal neovaskularisering
US20040152769A1 (en) 2002-11-09 2004-08-05 Ekwuribe Nnochiri Nkem Modified carbamate-containing prodrugs and methods of synthesizing same
CA2514303C (en) 2002-11-13 2012-09-18 The Uab Research Foundation Synthetic single domain polypeptides mimicking apolipoprotein e and methods of use
AU2003291206A1 (en) 2002-12-04 2004-06-23 Agennix Incorporated Lactoferrin in the reduction of circulating cholesterol, vascular inflammation, atherosclerosis and cardiovascular disease
EP1594437A2 (en) 2003-02-04 2005-11-16 University of Connecticut Health Center Immunogenic cd91 ligand-antigenic molecule complexes and fusion proteins
US20050070996A1 (en) 2003-04-08 2005-03-31 Dinh Thomas Q. Drug-eluting stent for controlled drug delivery
US7291590B2 (en) 2003-06-12 2007-11-06 Queen's University At Kingston Compositions and methods for treating atherosclerosis
WO2005030243A1 (en) 2003-09-26 2005-04-07 Bristol Myers Squibb Company Arginyl-glutamine dipeptide for treatment of pathological vascular proliferation
ES2381551T3 (es) 2003-12-05 2012-05-29 The Cleveland Clinic Foundation Marcadores de riesgo para enfermedad cardiovascular
KR101185609B1 (ko) 2004-07-16 2012-09-24 트러스티즈 오브 터프츠 칼리지 아포리포단백질 a1 미메틱 및 이의 용도
EP1789035A2 (en) 2004-08-11 2007-05-30 The Regents of the University of California-San Francisco Orally administered small peptides synergize statin activity
US7947645B2 (en) 2004-09-02 2011-05-24 Cognosci, Inc. APO E analogs and methods for their use
AU2005287004B2 (en) 2004-09-16 2011-03-17 The Regents Of The University Of California G-type peptides and other agents to ameliorate atherosclerosis and other pathologies
KR20070089996A (ko) 2004-12-06 2007-09-04 더 리전트 오브 더 유니버시티 오브 캘리포니아 세동맥의 구조 및 기능의 개선 방법
US7427662B2 (en) 2005-02-01 2008-09-23 Baord Of Supervisors Of Louisiana State University And Agricultural And Mechanical College Inhibition of angiogenesis and destruction of angiogenic vessels by apolipoprotein A-I and high density lipoprotein
MX2007013430A (es) 2005-04-29 2008-03-19 Univ California Peptidos y peptidos mimeticos para tratar patologias caracterizadas por una respuesta inflamatoria.
US20080293639A1 (en) 2005-04-29 2008-11-27 The Regents Of The University Of California Peptides and peptide mimetics to treat pathologies characterized by an inflammatory response
US20070071756A1 (en) 2005-09-26 2007-03-29 Peyman Gholam A Delivery of an agent to ameliorate inflammation
WO2008143679A2 (en) 2006-06-01 2008-11-27 Verenium Corporation Nucleic acids and proteins and methods for making and using them
AU2007284801A1 (en) 2006-08-08 2008-02-21 The Regents Of The University Of Californina Salicylanilides enhance oral delivery of therapeutic peptides
CN101568420B (zh) * 2006-12-28 2014-06-25 大成普拉斯株式会社 金属和树脂的复合体及其制造方法
EP2195331B1 (en) 2007-08-28 2013-11-20 Uab Research Foundation Synthetic apolipoprotein e mimicking polypeptides and methods of use
WO2011085110A1 (en) 2010-01-06 2011-07-14 Cognosci, Inc. Apoe peptide dimers and uses thereof
US20160002315A1 (en) 2013-03-14 2016-01-07 Uab Research Foundation Apolipoprotein mimetics and uses thereof
JP2017505143A (ja) 2014-02-10 2017-02-16 アンプテック ゲゼルシャフト ミット ベシュレンクテル ハフツング インコーテッドrna
WO2016018665A1 (en) 2014-07-31 2016-02-04 Uab Research Foundation Apoe mimetic peptides and higher potency to clear plasma cholesterol
CA2959021C (en) 2014-08-22 2021-01-26 Corning Optical Communications LLC Optical fiber cable with print protective outer surface profile

Patent Citations (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0045665A1 (en) 1980-08-06 1982-02-10 Aktiebolaget Hässle Enzyme inhibitors
US5391377A (en) 1990-10-19 1995-02-21 Cortecs Limited Biphasic release formations for lipophilic acids
US5579250A (en) 1990-12-14 1996-11-26 Balaji; Vitukudi N. Method of rational drug design based on AB initio computer simulation of conformational features of peptides
US5612895A (en) 1990-12-14 1997-03-18 Balaji; Vitukudi N. Method of rational drug design based on ab initio computer simulation of conformational features of peptides
US5631280A (en) 1995-03-29 1997-05-20 Merck & Co., Inc. Inhibitors of farnesyl-protein transferase
US6506880B2 (en) 1998-03-17 2003-01-14 The Uab Research Foundation Synthetic peptides that enhance atherogenic lipoprotein uptake and lower plasma cholesterol
WO2002015923A1 (en) 2000-08-24 2002-02-28 The Regents Of The University Of California Orally administered peptides to ameliorate atherosclerosis
US6664230B1 (en) 2000-08-24 2003-12-16 The Regents Of The University Of California Orally administered peptides to ameliorate atherosclerosis
WO2004034977A2 (en) 2002-10-16 2004-04-29 The Regents Of The University Of California Orally administered peptides synergize statin activity
US20100286025A1 (en) * 2007-08-28 2010-11-11 Anantharamaiah Gattadahalli M Synthetic apolipoprotein e mimicking polypeptides and methods of use

Non-Patent Citations (40)

* Cited by examiner, † Cited by third party
Title
"Posttranslational Covalent Modification of Proteins", 1983, ACADEMIC PRESS, pages: 1 - 12
"Proteins - Structure and Molecular Properties", 1993, FREEMAN AND COMPANY
"Recent Developments in the Synthesis of Fatty Acid Derivatives", 1999, AOCS PRESS
ALMQUIST ET AL., J MED. CHEM., vol. 23, 1980, pages 1392 - 1398
ANANTHARAMAIAH, METH. ENZYMOL, vol. 128, 1986, pages 626 - 668
BRADLEY, W. A. ET AL., J. LIPID RES., vol. 27, 1986, pages 40 - 48
DYER, C. A. ET AL., J. BIOL. CHEM., vol. 266, 1991, pages 15009 - 15015
GOLDSTEIN ET AL., ANN. REV. CELL BIOL., vol. 1, 1985, pages 1 - 39
GOODMANGILMAN: "The Pharmacological Basis of Therapeutics", 2005, MCGRAW-HILL PUBLISHING CO.
GREENE ET AL.: "Protective Groups in Organic Synthesis", 1991, JOHN WILEY & SONS, INC.
HANN, J CHEMSOC PERKIN TRANS, vol. I, 1982, pages 307 - 314
HEESCHEN ET AL., CIRCULATION, vol. 105, 2002, pages 1446 - 1452
HERBERT ET AL.: "15", PHARMACEUT. RES., 1998, pages 357
HOLLADAY ET AL., TETRAHEDRON LETT, vol. 24, 1983, pages 4401 - 4404
HRUBY, LIFE SCI., vol. 31, 1982, pages 189 - 199
HUDSON ET AL., INT J PEPTPROT RES, 1979, pages 177 - 185
JENNINGS-WHITE ET AL., TETRAHEDRON LETT., vol. 23, 1982, pages 2533
JOHNSON ET AL., NATURE MED., vol. 2, 1996, pages 795
MAHLEY, R. W., SCIENCE, vol. 240, 1988, pages 622 - 630
MAHLEY, R.W. ET AL., J. LIPID RES., vol. 40, 1999, pages 622 - 630
MORLEY, TRENDS PHARM SCI, 1980, pages 463 - 468
ORAMHEINECKE, PHYSIOL REV., vol. 85, 2005, pages 1343 - 1372
PALGUNACHARI ET AL., ARTERIOSCLEROSIS, THROMBOSIS, & VASCULAR BIOL., vol. 16, 1996, pages 328 - 338
RAIL, S. C., JR. ET AL., PNAS USA, vol. 79, 1982, pages 4696 - 4700
REMINGTON: "The Science and Practice of Pharmacy", 1995, MACK PUBLISHING COMPANY
See also references of EP3189069A4
SEGREST ET AL., J. LIPID. RES., vol. 42, 2001, pages 1346 - 1367
SEGREST, J. LIPID RES., vol. 33, 1992, pages 141 - 166
SHIMONO, H. N. ET AL., EUR. J. CLIN. INVEST., vol. 90, 1992, pages 2084 - 2991
SPANGENBERG ET AL., BIOCHEM. BIOPHYS. ACTA, vol. 1349, 1997, pages 109 - 121
SPARROW ET AL., BIOCHEMISTRY, vol. 31, no. 4, 1992, pages 1065 - 8
SPATOLA ET AL., LIFE SCI, vol. 38, 1986, pages 1243 - 1249
SPATOLA, CHEMISTRY AND BIOCHEMISTRY OF AMINO ACIDS, PEPTIDES, AND PROTEINS, 1983, pages 267
SPATOLA: "Vega Data", PEPTIDE BACKBONE MODIFICATIONS, vol. 1, no. 3, 1983
TAM ET AL.: "Interaction of a recombinant form of apolipoprotein[a] with human fibroblasts and with the human hepatoma cell line HepG2 .", J LIPID RES, vol. 37, no. 3, March 1997 (1997-03-01), pages 518 - 533, XP055390454 *
TRACY, BIOTECHNOL. PROG., vol. 14, 1998, pages 108
VAN VELZEN ET AL., HELLENIC J CARDIOL, vol. 50, 2009, pages 245 - 263
WILSON, C. ET AL., SCIENCE, vol. 252, 1991, pages 1817 - 1822
YAMADA ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 86, 1989, pages 665 - 669
ZHANG, S. H. ET AL., SCIENCE, vol. 258, 1992, pages 468 - 471

Cited By (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2996706A4 (en) * 2013-03-14 2017-01-18 UAB Research Foundation Apolipoprotein mimetics and uses thereof
US10653747B2 (en) 2014-07-31 2020-05-19 Uab Research Foundation ApoE mimetic peptides and higher potency to clear plasma cholesterol
USRE50320E1 (en) 2014-07-31 2025-03-04 Uab Research Foundation APOE mimetic peptides and higher potency to clear plasma cholesterol
US11331295B2 (en) 2015-10-14 2022-05-17 Massachusetts Eye And Ear Infirmary High-dose statins for age-related macular degeneration
US11744817B2 (en) 2015-10-14 2023-09-05 Massachusetts Eye And Ear Infirmary High-dose statins for age-related macular degeneration
WO2017120568A1 (en) * 2016-01-08 2017-07-13 Lipimetix Development, Inc. Apoe mimetic peptide compositions
CN110545836A (zh) * 2017-01-24 2019-12-06 马克雷根有限公司 用载脂蛋白模拟物治疗与年龄有关的黄斑变性和其他眼部疾病
WO2018190896A1 (en) 2017-04-13 2018-10-18 Lipimetix Development, Inc. Apoe mimetic peptide compositions
WO2019199976A1 (en) 2018-04-11 2019-10-17 Lipimetix Development, Inc. Apoe mimetic peptide compositions
US12152086B2 (en) 2018-11-08 2024-11-26 Saitama University Liposome binding peptide, construct for manufacturing the liposome binding peptide, and liposome
WO2023215838A1 (en) * 2022-05-05 2023-11-09 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Short apolipoprotein e mimetic peptides and methods of use
WO2025147594A1 (en) * 2024-01-04 2025-07-10 University Of Florida Research Foundation, Incorporated Peptides and method of use in preparing nanodiscs

Also Published As

Publication number Publication date
JP2021006529A (ja) 2021-01-21
JP2017528437A (ja) 2017-09-28
AU2015298263A1 (en) 2017-03-16
US20170209537A1 (en) 2017-07-27
US10653747B2 (en) 2020-05-19
JP7081923B2 (ja) 2022-06-07
EP3189069B1 (en) 2024-10-23
CN107074923A (zh) 2017-08-18
IL250302B (en) 2022-07-01
CA2954475C (en) 2023-05-16
CN107074923B (zh) 2021-08-03
AU2015298263B2 (en) 2020-05-14
IL250302A0 (en) 2017-03-30
CA2954475A1 (en) 2016-02-04
EP3189069A1 (en) 2017-07-12
BR112017001860A2 (pt) 2018-02-27
USRE50320E1 (en) 2025-03-04
MX2017001432A (es) 2017-05-09
EP3189069A4 (en) 2018-03-07
MX383117B (es) 2025-03-13
JP7095037B2 (ja) 2022-07-04

Similar Documents

Publication Publication Date Title
US10653747B2 (en) ApoE mimetic peptides and higher potency to clear plasma cholesterol
US8048851B2 (en) Peptides and peptide mimetics to treat pathologies characterized by an inflammatory response
JP6772317B2 (ja) アポリポタンパク質模倣体及びその使用
US20100227825A1 (en) Peptides and peptide mimetics to treat cancer
JP2006312650A (ja) アテローム性動脈硬化症を改善する経口投与ペプチド
US11827690B2 (en) ApoC-II mimetic peptides
S. Getz et al. HDL apolipoprotein-related peptides in the treatment of atherosclerosis and other inflammatory disorders
JP2007534612A (ja) 高コレステロール血症の治療のためのコレステロール逆輸送メディエータ
HK1242718A1 (en) Apoe mimetic peptides and higher potency to clear plasma cholesterol
HK1242718B (zh) Apoe模拟肽及对清除血浆胆固醇的较高效力

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 15826625

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2954475

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 250302

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: 15329735

Country of ref document: US

ENP Entry into the national phase

Ref document number: 2017505143

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: MX/A/2017/001432

Country of ref document: MX

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112017001860

Country of ref document: BR

REEP Request for entry into the european phase

Ref document number: 2015826625

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2015826625

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2015298263

Country of ref document: AU

Date of ref document: 20150720

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 112017001860

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20170130