WO2011130434A2 - Antibodies that bind human cd27 and uses thereof - Google Patents
Antibodies that bind human cd27 and uses thereof Download PDFInfo
- Publication number
- WO2011130434A2 WO2011130434A2 PCT/US2011/032355 US2011032355W WO2011130434A2 WO 2011130434 A2 WO2011130434 A2 WO 2011130434A2 US 2011032355 W US2011032355 W US 2011032355W WO 2011130434 A2 WO2011130434 A2 WO 2011130434A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- antibody
- chain variable
- variable region
- nos
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2878—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/18—Growth factors; Growth regulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/30—Macromolecular organic or inorganic compounds, e.g. inorganic polyphosphates
- A61K47/42—Proteins; Polypeptides; Degradation products thereof; Derivatives thereof, e.g. albumin, gelatin or zein
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K49/00—Preparations for testing in vivo
- A61K49/06—Nuclear magnetic resonance [NMR] contrast preparations; Magnetic resonance imaging [MRI] contrast preparations
- A61K49/08—Nuclear magnetic resonance [NMR] contrast preparations; Magnetic resonance imaging [MRI] contrast preparations characterised by the carrier
- A61K49/10—Organic compounds
- A61K49/14—Peptides, e.g. proteins
- A61K49/16—Antibodies; Immunoglobulins; Fragments thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/16—Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/12—Drugs for disorders of the urinary system of the kidneys
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P15/00—Drugs for genital or sexual disorders; Contraceptives
- A61P15/08—Drugs for genital or sexual disorders; Contraceptives for gonadal disorders or for enhancing fertility, e.g. inducers of ovulation or of spermatogenesis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
- A61P17/06—Antipsoriatics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/04—Drugs for skeletal disorders for non-specific disorders of the connective tissue
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P21/00—Drugs for disorders of the muscular or neuromuscular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P21/00—Drugs for disorders of the muscular or neuromuscular system
- A61P21/04—Drugs for disorders of the muscular or neuromuscular system for myasthenia gravis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/10—Antimycotics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P33/00—Antiparasitic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/08—Antiallergic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P5/00—Drugs for disorders of the endocrine system
- A61P5/14—Drugs for disorders of the endocrine system of the thyroid hormones, e.g. T3, T4
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P5/00—Drugs for disorders of the endocrine system
- A61P5/38—Drugs for disorders of the endocrine system of the suprarenal hormones
- A61P5/40—Mineralocorticosteroids, e.g. aldosterone; Drugs increasing or potentiating the activity of mineralocorticosteroids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
- A61P7/04—Antihaemorrhagics; Procoagulants; Haemostatic agents; Antifibrinolytic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
- A61P7/06—Antianaemics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/475—Growth factors; Growth regulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/732—Antibody-dependent cellular cytotoxicity [ADCC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/734—Complement-dependent cytotoxicity [CDC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/74—Inducing cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/75—Agonist effect on antigen
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
Definitions
- CD27 which binds CD70 and belongs to the tumor necrosis factor receptor (TNF-R) superfamily (Ranheim EA, et al, Blood. 1995 June 15;85(12):3556-65).
- TNF-R tumor necrosis factor receptor
- CD27 typically exists as a glycosylated, type I transmembrane protein, frequently in the form of homodimers with a disulfide bridge linking the two monomers. The disulfide bridge is in the extracellular domain close to the membrane (Camerini et al., J Immunol. 147:3165-69 (1991).
- CD27 may also be expressed in a soluble form (see, e.g., van Oers MH, et al, Blood. 1993 Dec l;82(l l):3430-6 and Loenen WA, et al, Eur. J. Immunol. 22:447, 1992).
- Cross-linking the CD27 antigen on T cells provides a costimulatory signal that, in concert with T-cell receptor crosslinking, can induce T-cell proliferation and cellular immune activation.
- CD27 is expressed on mature thymocytes, on most CD4+ and CD8+ peripheral blood T cells, natural killer cells and B cells (Kobata T, et al, Proc. Natl. Acad. Sci. U S A. 1995 Nov 21 ;92(24): 11249-53). CD27 is also highly expressed on B cell non- Hodgkin's lymphomas and B cell chronic lymphocytic leukemias (Ranheim EA, et al, Blood. 1995 Jun 15;85(12):3556-65).
- CD27 protein soluble CD27 protein
- CMV cytomegalovirus
- sarcoidosis sarcoidosis
- multiple sclerosis multiple sclerosis
- B-cell chronic lymphocytic leukemia Loenen WA, et al, Eur. J. Immunol. 22:447, 1992.
- the present invention provides inter alia isolated anti-CD27 antibodies having particular functional properties which can be linked with advantageous and desirable therapeutic effects.
- anti-CD27 monoclonal antibodies capable of up-regulating T cell mediated immune responses ⁇ e.g., as evidenced by inducement or enhancement of antigen-specific T cell responses), which are particularly well-suited for combination with vaccine therapies, have been generated and characterized by way of the present invention.
- agonist anti-CD27 antibodies can enhance the immune response against cancers or infectious diseases by combination with active vaccination, or by enhancing endogenous immune responses. Such antibodies may also directly or indirectly induce cytokine expression.
- anti-CD27 antibodies that down-regulate T cell mediated immune responses, which are particularly well-suited for treating immune disorders, such as graft rejection, allergy and autoimmune diseases, have been generated and characterized.
- anti-CD27 antibodies that inhibit growth of CD27 expressing cells by direct cell killing mechanisms ⁇ e.g., antibody dependent cell-mediated cytotoxicity (ADCC) and/or complement dependent cellular cytotoxicity (CDCC)), which are particularly effective in treating a wide variety of diseases involving cell proliferation ⁇ e.g., cancers), have been generated and characterized.
- ADCC antibody dependent cell-mediated cytotoxicity
- CDC complement dependent cellular cytotoxicity
- the anti-CD27 antibodies of the present invention exhibit one or more of the following properties:
- (c) induces specific complement mediated cytotoxicity (CDC) of CD27 expressing cells of at least 10% at an antibody concentration of 3 ⁇ g/ml and approximately 6% rabbit serum complement;
- (d) induces antibody dependent cell-mediated cytotoxicity (ADCC) specific lysis of CD27 expressing cells of at least 10% at an antibody concentration of 3 ⁇ g/ml and ratio of effector: target cells of 75: 1 ;
- ADCC antibody dependent cell-mediated cytotoxicity
- (k) blocks binding of sCD70 to CD27 by at least about 70% at an antibody concentration of 10 ⁇ g/ml and reduces or inhibits T-cell activity when not capable of binding to, or having reduced binding to Fc receptors;
- the antibodies of the invention exhibit combinations of these functional properties.
- the invention provides anti-CD27 antibodies that induce and/or enhance an immune response (e.g., a T cell mediated immune response).
- the antibodies inhibit the binding of CD70 to CD27 on cells.
- Particular antibodies having these combinations of properties include mAb 1F5 comprising heavy and/or light chain variable regions sequences comprising SEQ ID NOs: 37 and/or 43, respectively).
- the antibodies do not inhibit the binding of CD70 to CD27 on cells.
- Particular antibodies having these combinations of properties include mAb 3H8 comprising heavy and/or light chain variable regions sequences comprising SEQ ID NOs: 7 and/or 13, respectively, or 7and/or 19, respectively).
- Such anti-CD27 antibodies also can be linked to a second molecule (e.g., as a bispecific molecule) having a binding specificity which is different from the antibody, such as a T cell receptor (e.g., CD3, CD25, CD137, CD154J, or an Fc receptor (e.g., FcyRI (CD64), FcyRIIA (CD32), FcyRIIB l (CD32), FcyRIIB2 (CD32), FcyRIIIA (CD 16a), FcyRIIIB (CD16b), FcsRI, FcsRII (CD23), FcaRI (CD89), Fca ⁇ R, and FcRn), or an NK receptor (e.g. CD56), or a B cell receptor (e.g. CD19, CD20).
- a T cell receptor e.g., CD3, CD25, CD137, CD154J
- an Fc receptor e.g., FcyRI (CD64), FcyRIIA
- Antibodies intended to be used for induction or enhancement of immune responses according to the present invention may have a functional Fc domain permitting binding to Fc receptors, and may include a mutated Fc domain having increased levels of binding to Fc receptors.
- the invention provides anti-CD27 antibodies that down- regulate T cell mediated immune responses by inhibiting the binding of CD27 to CD70 on cells which express these proteins.
- the antibodies inhibit the binding of soluble CD70 (sCD70) to CD27 expressing cells by at least about 70%.
- sCD70 soluble CD70
- Particular antibodies falling within this class include, e.g., mAb comprising heavy and/or light chain variable regions sequences comprising SEQ ID NOs:37 and/or 43 (mAb 1F5), SEQ ID NOs: 49 and/or 55 (mAb 1H8), or SEQ ID NOs: 103 and/or 109 (mAb 3H12).
- the invention provides anti-CD27 antibodies that induce or enhance effector cell function (e.g., cell killing via either ADCC and/or
- the antibody induces at least about 30% specific lysis of CD27 expressing cells via ADCC at an antibody concentration of 10 ⁇ g/ml and/or induces at least about 30%CDC of CD27 expressing cells at a concentration of 10 ⁇ g/ml.
- Particular antibodies falling within this class exhibiting ADCC effector function include, e.g., (e.g., mAb comprising heavy and/or light chain variable region sequences comprising SEQ ID NOs: 61 and/or 67 (mAb 1G5), SEQ ID NOs: 85 and/or 91, 85 and/or 97
- the antibody also inhibits binding of CD70 to CD27 on cells.
- antibodies having these combinations of functions include, e.g., (e.g., mAb comprising heavy and/or light chain variable regions sequences comprising SEQ ID NOs: 37 and/or 43(mAb 1F5), SEQ ID NOs: 49 and/or 55 (mAb 1H8), SEQ ID NOs: 103 and/or 109 (mAb 3H12).
- the antibody induces ADCC and/or CDC as described above, but does not inhibit binding of CD70 to CD27 on cells.
- Particular antibodies having these features include, e.g., mAb comprising heavy and/or light chain variable regions sequences comprising SEQ ID NOs: 61 and/or 67 (mAb 1G5), SEQ ID NOs: 85 and/or 91, 85 and/or 97 (mAb 3A10), SEQ ID NOs:7 and/or 13, 7 and/or 19 (mAb 3H8).
- Anti-CD27 antibodies capable of inducing or enhancing effector cell function can also be constructed to include an Fc region which suitably contributes a binding specificity for a specific Fc receptor (e.g., FcyRI (CD64), FcyRIIA (CD32),
- FcyRIIB l (CD32) , FcyRIIB2 (CD32), FcyRIIIA (CD16a), FcyRIIIB (CD16b), FcsRI, FcsRII (CD23), FcaRI (CD89), Fca ⁇ R, and FcRn).
- a method for enhancing an immune response against an antigen in a subject in need thereof by administering to the subject: i) an anti-CD27 antibody and ii) an antigen, wherein the anti-CD27 antibody is administered separately from and before the antigen is administered.
- the anti-CD27 antibody may be any anti-CD27 antibody.
- the anti-CD27 antibody may be any anti-CD27 antibody.
- the anti-CD27 antibody may be administered at least 2 hours before the antigen, for example at least 12 hours before the antigen, suitably at least 24 hours before the antigen, at least 48 hours before the antigen or at least 72 hours before the antigen,
- TLR agonist is a TLR3 agonist.
- the TLR agonist is a TLR3 agonist , for example but not limited to Poly IC:LC.
- CD27 expressing cells include any and all cells that express CD27, including, but not limited to B cells, NK cells and T cells.
- the CD27 expressing cells include cancer cell lines such as Jurkat cells, Raji cells, Ramos cells and Daudi cells.
- the CD27 expressing cells are tumor cells or cancer cells.
- CD27 expressing cells include B cells, NK cells, and T cells inlcuding T cells that are found infiltrating tumors, also called tumor infiltrating lymphocytes.
- Particular antibodies of the invention comprise heavy and light chain variable regions that utilize particular human germlines, i.e., are encoded by the germline genes, but include genetic rearrangements and mutations, e.g., somatic mutations, which occur during antibody maturation.
- the heavy chain variable region of the antibodies of the present invention is derived from a human germline 3-7 or 3-33 gene.
- the light chain variable region of the antibody is derived from a human germline 3-20, 3- 11, 24, 1D- 16, or 1-13 gene.
- the heavy chain variable region of the antibody is derived from a human germline VH 3-7 or VH 3-33 gene and the light chain variable region of the antibody is derived from a human germline VK 3-20, V K 3- 11, V K ID- 16, or V K 1-13 gene.
- VH 3-33 germline sequence is provided (Genbank Accession No AAP44382) as follows: 1 vqlvesgggv vqpgrslrls caasgftfst ygmhwvrqap gkglewvaii wfdgsntyya
- VH 3-7 germline sequence is provided (Genbank Accession No AAP44389) as follows:
- the heavy chain variable region CDR3 sequence is selected from the group consisting of SEQ ID NOs: 10, 28, 40, 52, 64, 76, 88, 106, and conservative sequence modifications thereof (e.g., conservative amino acid substitutions).
- the antibodies may further include a light chain variable region CDR3 sequence selected from the group consisting of SEQ ID NOs: 16, 22, 34, 46, 58, 70, 82, 94, 100, 112, and conservative sequence modifications thereof.
- the heavy chain CDR2 and CDR1 sequences are selected from SEQ ID NOs: 9, 27, 39, 51, 63, 75, 87, 105, and SEQ ID NOs: 8, 26, 38, 50, 62, 74, 86, 104, respectively, and conservative sequence modifications thereof.
- the light chain CDR2 and CDR1 sequences are selected from SEQ ID NOs: 15, 21, 33, 45, 57, 69, 81, 93, 99, 111, and SEQ ID NOs: 14, 20, 32, 44, 56, 68, 80, 92, 98, 110, respectively, and conservative sequence modifications thereof.
- the invention provides an isolated antibody that binds CD27 and includes heavy and light chain variable region CDR1, CDR2 and CDR3 sequences selected from the group consisting of: (i) a heavy chain variable region CDR1 comprising SEQ ID NO: 38
- a heavy chain variable region CDR2 comprising SEQ ID NO: 39
- a heavy chain variable region CDR3 comprising SEQ ID NO: 40
- a light chain variable region CDRl comprising SEQ ID NO: 44;
- a light chain variable region CDR2 comprising SEQ ID NO: 45;
- a light chain variable region CDR3 comprising SEQ ID NO: 46; or conservative sequence modifications thereof; a heavy chain variable region CDRl comprising SEQ ID NO: 50; a heavy chain variable region CDR2 comprising SEQ ID NO: 51; a heavy chain variable region CDR3 comprising SEQ ID NO: 52; a light chain variable region CDRl comprising SEQ ID NO: 56;
- a light chain variable region CDR2 comprising SEQ ID NO: 57;
- a light chain variable region CDR3 comprising SEQ ID NO: 58; or conservative sequence modifications thereof;
- a heavy chain variable region CDRl comprising SEQ ID NO: 104 a heavy chain variable region CDR2 comprising SEQ ID NO: 105 a heavy chain variable region CDR3 comprising SEQ ID NO: 106 a light chain variable region CDRl comprising SEQ ID NO: 110; a light chain variable region CDR2 comprising SEQ ID NO: 111; a light chain variable region CDR3 comprising SEQ ID NO: 112; or conservative sequence modifications thereof; a heavy chain variable region CDRl comprising SEQ ID NO: 86; a heavy chain variable region CDR2 comprising SEQ ID NO: 87; a heavy chain variable region CDR3 comprising SEQ ID NO: 88; a light chain variable region CDRl comprising SEQ ID NO: 92 or 98; a light chain variable region CDR2 comprising SEQ ID NO: 93 or 99; a light chain variable region CDR3 comprising SEQ ID NO: 94 or 100; conservative sequence modifications thereof; (v) a heavy chain variable region CDRl
- a heavy chain variable region CDR2 comprising SEQ ID NO: 27 a heavy chain variable region CDR3 comprising SEQ ID NO: 28 a light chain variable region CDRl comprising SEQ ID NO: 32; a light chain variable region CDR2 comprising SEQ ID NO: 33;
- a light chain variable region CDR3 comprising SEQ ID NO: 34; or conservative sequence modifications thereof; a heavy chain variable region CDR1 comprising SEQ ID NO: 74; a heavy chain variable region CDR2 comprising SEQ ID NO: 75; a heavy chain variable region CDR3 comprising SEQ ID NO: 76; a light chain variable region CDR1 comprising SEQ ID NO: 80;
- a light chain variable region CDR2 comprising SEQ ID NO: 81;
- a light chain variable region CDR3 comprising SEQ ID NO: 82; or conservative sequence modifications thereof;
- a heavy chain variable region CDR2 comprising SEQ ID NO: 9;
- a heavy chain variable region CDR3 comprising SEQ ID NO: 10; a light chain variable region CDR1 comprising SEQ ID NO: 14 or 20 a light chain variable region CDR2 comprising SEQ ID NO: 15 or 21 a light chain variable region CDR3 comprising SEQ ID NO: 16 or 22 or conservative sequence modifications thereof; and
- a heavy chain variable region CDR1 comprising SEQ ID NO: 62; a heavy chain variable region CDR2 comprising SEQ ID NO: 63; a heavy chain variable region CDR3 comprising SEQ ID NO: 64; a light chain variable region CDR1 comprising SEQ ID NO: 68;
- a light chain variable region CDR2 comprising SEQ ID NO: 69;
- a light chain variable region CDR3 comprising SEQ ID NO: 70; or conservative sequence modifications thereof.
- the heavy chain variable region CDR3 sequence comprises an amino acid sequence selected from the consensus sequence: R (G,E,D) (S,L,G,- ) (G,L,T,W, - ) ( ⁇ , ⁇ , ⁇ , ⁇ ,- ) (V,T,-) (M,P,-) (G,V,- ) (R, -) (G,M, -) (D,H,L,T,W) (A,G,N,W) (D,F,V,Y) (F,L) (D,E) (H,I,L,Y) (SEQ ID NO: 113), wherein "-" denotes the option of no amino acid residue being present at that consensus position.
- the antibodies may further include a light chain variable region CDR3 sequence comprising an amino acid sequence selected from the consensus sequence: Q (F,R,Y) (N,S) (N,T,S) (Y,W) P (F,L,P,R) T (SEQ ID NO: 114), wherein "-" denotes the option of no amino acid residue being present at that consensus position.
- the heavy chain variable region CDR2 sequence comprises an amino acid sequence selected from the consensus sequence: I (K,W) (Y,N,Q) D G S (E,N) (K,Q) (SEQ ID NO: 115), wherein "-" denotes the option of no amino acid residue being present at that consensus position, and the light chain variable region CDR2 sequence comprises an amino acid sequence selected from the consensus sequence: (A,D) A S (SEQ ID NO: 116).
- the heavy chain variable region CDR1 sequence comprises an amino acid sequence selected from the consensus sequence: G F (T,S) (F,L) (S,N) (I,S,H) (Y,H) (SEQ ID NO: 117); and the light chain variable region CDR1 sequence comprises an amino acid sequence selected from the consensus sequence: Q (D,G,S) (I,V) (D,S) (R,S) (A,W,Y) (SEQ ID NO: 118).
- isolated antibodies of the invention bind to human CD27 and include a heavy chain variable region including an amino acid sequence selected from the group consisting of SEQ ID NOs: 6, 7, 24, 25, 36, 37, 48, 49, 60, 61, 72, 73, 84, 85, 102, 103, and conservative sequence modifications thereof.
- the antibody may further include a light chain variable region including an amino acid sequence selected from the group consisting of SEQ ID NOs: 12, 13, 18, 19, 30, 31, 42, 43, 54, 55, 66, 67, 78, 79, 90, 91, 96, 97, 108, 109, and conservative sequence modifications thereof.
- isolated antibodies of the invention bind to human CD27 and include a heavy chain variable region and a light chain variable region including the amino acid sequences selected from the group consisting of:
- Isolated antibodies which include heavy and light chain variable regions having at least 80%, or at least 85%, or at least 90%, or at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or more sequence identity to any of the above sequences are also included in the present invention. Ranges intermediate to the above- recited values, e.g. , heavy and light chain variable regions having at least 80-85%, 85-90%, 90-95% or 95- 100% sequence identity to any of the above sequences are also intended to be encompassed by the present invention.
- Also encompassed by the present invention are isolated antibodies which compete for binding to CD27 with the antibodies of the invention.
- isolated antibodies which compete for binding to CD27 with the antibodies of the invention.
- the antibody competes for binding to CD27 with an antibody comprising heavy and/or light chain variable regions comprising the amino acid sequences set forth in SEQ ID NOs: 37 and 43, SEQ ID NOs: 49 and 55, SEQ ID NOs: 103 and 109, SEQ ID NOs: 85 and 91, SEQ ID NOs: 85 and 97, SEQ ID NOs: 25 and 31, SEQ ID NOs: 73 and 79, SEQ ID NOs: 7 and 13, SEQ ID NOs: 7 and 19, SEQ ID NOs: 61 an 67, respectively, or amino acid sequences at least 80% identical thereto.
- the antibody competes for binding to CD27 with an antibody comprising heavy and/or light chain variable regions comprising the amino acid sequences set forth in SEQ ID NOs: 37 and 43 (1F5), SEQ ID NOs: 49 and 55 (1H8) or SEQ ID NOs: 103 and 109 (3H12).
- the antibody competes for binding to CD27 with an antibody comprising heavy and/or light chain variable regions comprising the amino acid sequences set forth in SEQ ID NOs: 25 and 31 (2C2), SEQ ID NOs: 7 and 13 (3H8), SEQ ID NOs: 7 and 19 (3H8), SEQ ID NOs: 61 an 67 (1G5) or SEQ ID NOs: 73 and 79 (2G9).
- the antibody competes for binding to CD27 with an antibody comprising heavy and/or light chain variable regions comprising the amino acid sequences set forth in SEQ ID NOs: 85 and 91 (3A10) or SEQ ID NOs: 85 and 97 (3A10).
- antibodies of the invention bind to an epitope on CD27 recognized by the antibodies described herein.
- the antibody binds to an epitope on CD27 recognized by an antibody comprising heavy and/or light chain variable regions comprising the amino acid sequences set forth in SEQ ID NOs: 37 and 43, SEQ ID NOs: 49 and 55, SEQ ID NOs: 103 and 109, SEQ ID NOs: 85 and 91, SEQ ID NOs: 85 and 97, SEQ ID NOs: 25 and 31, SEQ ID NOs: 73 and 79, SEQ ID NOs: 7 and 13, SEQ ID NOs: 7 and 19, SEQ ID NOs: 61 an 67, respectively, or amino acid sequences at least 80% identical thereto.
- the antibody binds to an epitope on CD27 recognized by an antibody comprising heavy and/or light chain variable regions comprising the amino acid sequences set forth in SEQ ID NOs: 37 and 43 (1F5), SEQ ID NOs: 49 and 55 (1H8) or SEQ ID NOs: 103 and 109 (3H12).
- the antibody binds to an epitope on CD27 recognized by an antibody comprising heavy and/or light chain variable regions comprising the amino acid sequences set forth in SEQ ID NOs: 25 and 31 (2C2), SEQ ID NOs: 7 and 13 (3H8), SEQ ID NOs: 7 and 19 (3H8), SEQ ID NOs: 61 an 67 (1G5) or SEQ ID NOs: 73 and 79 (2G9).
- the antibody binds to an epitope on CD27 recognized by an antibody comprising heavy and/or light chain variable regions comprising the amino acid sequences set forth in SEQ ID NOs: 85 and 91 (3A10) or SEQ ID NOs: 85 and 97 (3A10).
- the antibodies of the invention can either be full-length, for example, any of the following isotypes: IgGl, IgG2, IgG3, IgG4, IgM, IgAl, IgA2, IgAsec, IgD, and IgE.
- the antibodies can be fragments such as an antigen-binding portion or a single chain antibody (e.g., a Fab, F(ab')2 > Fv, a single chain Fv fragment, an isolated
- the antibodies can be any kind of antibody, including, but not limited to, human, humanized, and chimeric antibodies.
- Tumor antigens employed by the present invention include any antigen or antigenic determinant which is present on (or associated with) a tumor cell and not typically on normal cells, or an antigen or antigenic determinant which is present on or associated with tumor cells in greater amounts than on normal (non-tumor) cells, or an antigen or antigenic determinant which is present on tumor cells in a different form than that found on normal (non-tumor) cells.
- Such antigens include tumor-specific antigens, including tumor-specific membrane antigens, tumor- associated antigens, including tumor-associated membrane antigens, embryonic antigens on tumors, growth factor receptors, growth factor ligands, and any other type of antigen that is associated with cancer.
- a tumor antigen may be, for example, an epithelial cancer antigen, (e.g., breast, gastrointestinal, lung), a prostate specific cancer antigen (PSA) or prostate specific membrane antigen (PSMA), a bladder cancer antigen, a lung (e.g., small cell lung) cancer antigen, a colon cancer antigen, an ovarian cancer antigen, a brain cancer antigen, a gastric cancer antigen, a renal cell carcinoma antigen, a pancreatic cancer antigen, a liver cancer antigen, an esophageal cancer antigen, a head and neck cancer antigen, or a colorectal cancer antigen.
- an epithelial cancer antigen e.g., breast, gastrointestinal, lung
- PSA prostate specific cancer antigen
- PSMA prostate specific membrane antigen
- the antigen may include a tumor antigen, such as hCG, gplOO or Pmell7, CEA, gplOO, TRP-2, NY-BR- 1, NY-CO-58, MN (gp250), idiotype, Tyrosinase, Telomerase, SSX2, MUC- 1, MAGE- A3, and high molecular weight- melanoma associated antigen (HMW-MAA) MARTI, melan-A, EGFRvIII, NY-ESO-1, MAGE-1, MAGE-3, WT1, Her2,or mesothelin.
- a tumor antigen such as hCG, gplOO or Pmell7, CEA, gplOO, TRP-2, NY-BR- 1, NY-CO-58, MN (gp250), idiotype, Tyrosinase, Telomerase, SSX2, MUC- 1, MAGE- A3, and high molecular weight- melanoma associated antigen (HMW-MA
- antigens employed by the present invention include antigens from infectious disease pathogens, such as viruses, bacteria, parasites and fungi, examples of which are disclosed herein.
- the invention also provides a bispecific molecule comprising an antibody of the invention linked to a second functional moiety having a different binding specificity than said antibody.
- the second molecule may bind a T cell receptor (e.g., CD3, CD40).
- compositions including an antibodyor a bispecific molecule described herein, formulated with a pharmaceutically acceptable carrier, are also provided.
- the compositions may further include an adjuvant, immunostimulatory agent (e.g., CD40 ligand, FLT 3 ligand, cytokines, colony- stimulating factors, an anti-CTLA-4 antibody, anti-PDl antibody, anti- 41BB antibody, anti OX-40 antibody, LPS (endotoxin), ssRNA, dsRNA, Bacille Calmette- Guerin (BCG), Levamisole hydrochloride, intravenous immune globulins and a Toll-like Receptor (TLR) agonist (e.g., TLR3 agonist such as Poly IC, a TLR4 agonist, a TLR5 agonist, a TLR7 agonist, a TLR8 agonist, and a TLR 9 agonist)), immunosuppressive agent, another antibody, or an antigen.
- immunostimulatory agent e.g
- antigens include, but are not limited to, a component of a pathogen, a tumor antigen (e.g. , hCG, gplOO or Pmell7, HER2/neu, WT1, mesothelin, CEA, gplOO, MARTI, TRP-2, melan-A, NY-ESO-1, NY-BR- 1, NY-CO-58, MN (gp250), idiotype, MAGE-1, MAGE-3, MAGE- A3, Tyrosinase, Telomerase, SSX2 antigens, MUC-1 antigens, and germ cell derived tumor antigens), an infectious disease antigen (e.g.
- a tumor antigen e.g. , hCG, gplOO or Pmell7, HER2/neu, WT1, mesothelin, CEA, gplOO, MARTI, TRP-2, melan-A, NY-ESO-1, NY-BR- 1, NY-CO-58,
- nucleic acid molecules encoding the antibodies of the invention are also encompassed by the invention, as well as expression vectors comprising such nucleic acids and host cells comprising such expression vectors.
- the invention provides an isolated monoclonal antibody that binds human CD27, wherein the antibody comprises a heavy chain variable region and a light chain variable region encoded by nucleic acid sequences selected from the group consisting of: (a) SEQ ID NOs: 5 and 11, respectively; (b) SEQ ID NOs: 5 and 17, respectively; (c) SEQ ID NOs: 23 and 29, respectively; (d) SEQ ID NOs: 35 and 41, respectively; (e) SEQ ID NOs: 47 and 53, respectively; (f) SEQ ID NOs: 59 and 65, respectively; (g) SEQ ID NOs: 71 and 77, respectively; (h) SEQ ID NOs: 83 and 89, (i) SEQ ID NOs: 83 and 95; (]) SEQ ID NOs: 101 and 107, respectively or nucleic acid sequences having at least 90% identity to the nucleic acid sequences of (a)-(h).
- the present invention provides methods for inducing or enhancing an immune response (e.g., a T cell-mediated immune response, and/or an NK- mediated response and/or a B cell-mediated immune response) against an antigen in a subject by administering to the subject an effective amount of an antibody (e.g., a full length antibody), composition or bispecific molecule described herein.
- an immune response e.g., a T cell-mediated immune response, and/or an NK- mediated response and/or a B cell-mediated immune response
- an antibody e.g., a full length antibody
- Such methods are particularly well-suited for use in vaccine therapies.
- the antibodies and other compositions of the present invention can also be used to inhibit growth of CD27 expressing cells by contacting the cells with an antibody or composition in an amount effective to inhibit growth of CD27 expressing cells (e.g., in the treatment of cancers).
- Antibodies useful in inhibiting the growth of CD27 expressing cells include full length antibodies and fragments thereof, as well as antibodies that contain a second binding specificity for an Fc receptor.
- the CD27 expressing cells are contacted with an antibody in the presence of effector cells under conditions sufficient to induce antibody-dependent cellular cytoxicity (ADCC) of target cells (e.g., the antibody induces at least about 40% specific lysis of CD27 expressing cells at a concentration of ⁇ ⁇ and comprises SEQ ID NOs:61, 67, 85, 91, 97, 37, and/or 43).
- ADCC antibody-dependent cellular cytoxicity
- the cells are contacted with an antibody under conditions sufficient to induce complement mediated cytotoxicity (CDC) of the cells (e.g., the antibody induces at least about 40% complement mediated cytotoxicity (CDC) of CD27 expressing cells at a concentration of 10 ⁇ g/ml and comprises SEQ ID NOs: 7, 13, 19, 49, 55, 103, and/or 109).
- CDC complement mediated cytotoxicity
- the antibody employed to inhibit growth of CD27 expressing cells may also possess (or lack) additional functional features.
- the antibody may also inhibit the binding of CD70 to CD27 on cells which express these proteins (e.g., a mAb comprising heavy and/or light chain variable regions sequences comprising SEQ ID NOs: 37 and/or 43 (mAb 1F5), SEQ ID NOs: 49 and/or 55 (mAb 1H8), or SEQ ID NOs: 103 and/or 109 (mAb 3H12).
- a mAb comprising heavy and/or light chain variable regions sequences comprising SEQ ID NOs: 37 and/or 43 mAb 1F5
- SEQ ID NOs: 49 and/or 55 mAb 1H8
- SEQ ID NOs: 103 and/or 109 mAb 3H12
- the antibody may not inhibit the binding ofCD70 to CD27 on such cells (e.g., a mAb comprising heavy and/or light chain variable regions sequences comprising SEQ ID NOs: 61 and/or 67 (mAb 1G5), SEQ ID NOs: 85 and/or 91, 85 and/or 97 (mAb 3A10), or SEQ ID NOs:7 and/or 13, 7 and/or 19 (mAb 3H8).
- mAb 1G5 mAb 1G5
- mAb 3A10 SEQ ID NOs: 85 and/or 91, 85 and/or 97
- SEQ ID NOs:7 and/or 13, 7 and/or 19 mAb 3H8
- CD27 expressing cells include any and all cells the express CD27, including, but not limited to NK cells, B cells and T cells.
- the CD27 expressing cells include cell lines such as Jurkat cells, Raji cells, Ramos cells and Daudi cells.
- the CD27 expressing cells are tumor cells or cancer cells.
- CD27 expressing cells include B cells, NK cells, T cells that are found infiltrating tumor or cancer cells, also called tumor infiltrating lymphocytes.
- the methods of inhibiting the growth of CD27 expressing cells that are described herein can be used to treat and prevent a wide variety of diseases and disorders.
- the methods can be used to treat or prevent a cancer (e.g., a cancer selected from the group consisting of leukemia, acute lymphocytic leukemia, acute myelocytic leukemia, myeloblasts promyelocyte myelomonocytic monocytic
- a cancer e.g., a cancer selected from the group consisting of leukemia, acute lymphocytic leukemia, acute myelocytic leukemia, myeloblasts promyelocyte myelomonocytic monocytic
- erythroleukemia chronic leukemia, chronic myelocytic (granulocytic) leukemia, chronic lymphocytic leukemia, mantle cell lymphoma, primary central nervous system lymphoma, Burkitt' s lymphoma, marginal zone B cell lymphoma, Polycythemia vera Lymphoma, Hodgkin's disease, non-Hodgkin' s disease, multiple myeloma, Waldenstrom's
- adenocarcinoma sweat gland carcinoma, sebaceous gland carcinoma, papillary carcinoma, papillary adenocarcinomas, cystadenocarcinoma, medullary carcinoma, bronchogenic carcinoma, renal cell carcinoma, hepatoma, bile duct carcinoma, choriocarcinoma, seminoma, embryonal carcinoma, Wilm's tumor, cervical cancer, uterine cancer, testicular tumor, lung carcinoma, small cell lung carcinoma, non small cell lung carcinoma, bladder carcinoma, epithelial carcinoma, glioma, astrocytoma, medulloblastoma, craniopharyngioma, ependymoma, pinealoma, hemangioblastoma, acoustic neuroma, oligodendroglioma, menangioma, melanoma, neuroblastoma, retinoblastoma, nasopharyngeal carcinoma, esophageal carcinoma, bas
- Preferred cancers include CD27- expressing tumors selected from the group consisting of chronic lymphocytic leukemia, mantle cell lymphoma, primary central nervous system lymphoma, Burkitt's lymphoma and marginal zone B cell lymphoma.
- the methods can be used to treat or prevent a bacterial, fungal, viral or parasitic infection.
- the present invention further provides methods for inhibiting the binding of CD70 to CD27 on cells in a subject having a disorder by administering to the subject antibodies or compositions as described herein, as well as methods for down-regulating a T cell response in an individual having a disorder by administering to a subject antibodies or compositions described herein.
- These methods are ideally suited for use in the treatment of immune disorders, such as graft rejection, autoimmune diseases, and allergy.
- Antibodies useful in these methods include Fab fragments, as well as a mutated Fc region so that the antibody does not bind, or has significantly reduced binding to, Fc receptors .
- the antibody comprises heavy and/or light chain variable regions sequences comprising SEQ ID NOs: 37 and/or 43 (mAb 1F5), SEQ ID NOs: 49 and/or 55 (mAb 1H8), or SEQ ID NOs: 103 and/or 109 (mAb 3H12).
- the diseases and disorders can be used to treat a wide variety of diseases and disorders, including, but not limited to graft rejection, allergy and autoimmune diseases.
- the disease is an autoimmune disease (e.g., multiple sclerosis, rheumatoid arthritis, type 1 diabetes, psoriasis, Crohn's disease and other inflammatory bowel diseases such as ulcerative colitis, systemic lupus eythematosus (SLE), autoimmune encephalomyelitis, myasthenia gravis (MG), Hashimoto's thyroiditis, Goodpasture's syndrome, pemphigus, Graves disease, autoimmune hemolytic anemia, autoimmune thrombocytopenic purpura, scleroderma with anti- collagen antibodies, mixed connective tissue disease, polypyositis, pernicious anemia, idiopathic Addison's disease, autoimmune associated
- autoimmune disease e.g., multiple sclerosis, rheumatoid arthritis, type
- the present invention further provides for particular uses for the antibodies, compositions and bispecific molecules described herein.
- the invention provides for the use of an antibody, composition or bispecific molecule in the manufacture of a medicament for inducing or enhancing an immune response against an antigen in a subject.
- the invention provides for the use of an antibody or composition in the manufacture of a medicament for inhibiting growth of CD27 expressing cells, the use of an antibody or composition in the manufacture of a medicament for inhibiting the binding of CD70 to CD27 on cells in a subject having a disorder, and the use of an antibody or composition in the manufacture of a medicament for down-regulating a T cell response in an individual having a disorder.
- the present invention further includes an antibody, composition or bispecific molecule for use in inducing or enhancing an immune response against an antigen in a subject, an antibody or composition for use in inhibiting growth of CD27 expressing cells, an antibody or composition for use in inhibiting the binding of CD70 to CD27 on cells in a subject having a disorder, and an antibody or composition for use in down-regulating a T cell response in an individual having a disorder.
- the present invention also provides methods for detecting the presence or absence of CD27 in a biological sample by (1) contacting a biological sample with an antibody described herein (wherein the antibody is labeled with a detectable substance) and (2) detecting the antibody bound to CD27.
- kits comprising the compositions (e.g., antibodies and/or bispecific molecules) of the invention and, optionally, instructions for use.
- the kit can further contain a least one additional reagent, such as a cytokine or complement, or one or more additional antibodies of the invention.
- Figure 1 depicts the affinity and kinetic parameters for mAbs 1G5, 1H8, 3H12, 3H8, 2G9, 1F5, 3A10, 2C2, ms 1A4, ms 9F4 and ms M-T271 as determined by BiacoreTM BiaEvaluation software (Biacore AB) with recombinant human CD27 immobilized on the chip.
- BiacoreTM BiaEvaluation software BiacoreTM BiaEvaluation software
- Figure 2 is a graph showing the binding of human anti-CD27 antibodies (2C2, 3H8, 1F5, 1G5, 1H8, 2G9, 3A10 and 3H12) to recombinant purified human CD27 using ELISA.
- Figure 3 is a graph showing binding by ELISA of 1F5 to purified recombinant human or monkey (macaque) CD27.
- Figure 4 is a graph depicting the effect of human anti-CD27 antibodies (2C2,
- Figure 5 is a flow cytometric analysis of 1F5 binding to human lymphoblastoid cell lines, and blocking of sCD70 binding.
- Figures 6A-D are graphs showing the binding of human anti-CD27 antibodies (2C2, 3H8, and 1F5) to CD27 on Jurkat cells (Figure 4A), Raji cells ( Figure 4B), Ramos cells (Figure 4C), and Daudi cells ( Figure 4D) as assessed by flow cytometry.
- Figure 7 is a graph showing the binding of human anti-CD27 antibodies (2C2, 3H8, 1F5, 1G5, 1H8, 2G9, 3A10 and 3H12) to CD27 on Daudi cells as assessed by flow cytometry.
- Figure 8 is a bar graph showing the results of an anti-CD27 cross-blocking ELISA experiment, demonstrating that antibodies 1F5, 1H8 and 3H12 are capable of cross- blocking each other and thus bind to the same epitope.
- Figure 9 is a bar graph showing the results of an anti-CD27 cross-blocking ELISA experiment, demonstrating that antibodies 2C2, 3H8, 1G5 and 2G9 are capable of cross-blocking each other and thus bind to the same epitope.
- Figure 10 is a bar graph showing the results of an anti-CD27 cross-blocking
- Figure 11 is a graph depicting the results of a complement dependent cellular cytotoxicity (CDCC) assay using mAbs 1F5, 2C2, 3H8, 1G5, 1H8, 2G9, 3A10 and 3H12.
- Figure 12 is a graph depicting the results of a further complement dependent cellular cytotoxicity (CDCC) assay using mAb 1F5
- Figure 13 is a graph depicting the results of an antibody dependent cell- mediated cytotoxicity (ADCC) assay using mAbs 2C2, 1F5, 3H8, 1G5, 1H8, 2G9, 3A10, 3H12, Rituxan and HulgG.
- ADCC antibody dependent cell- mediated cytotoxicity
- Figure 14 is a graph depicting the results of a further antibody dependent cell- mediated cytotoxicity (ADCC) using mAb 1F5
- Figure 15 is an alignment of the VH sequences of human anti- antibodies (1F5, 1G5, 1H8, 2C2, 2G9, 3A10, 3H12 and 3H8).
- Figure 16 is an alignment of the VL sequences of human anti-CD27 antibodies (1F5, 1G5, 1H8, 2C2, 2G9, 3A10, 3H12 and 3H8).
- Figures 17 and 18 show results from an in vivo non-human primate study using mAb 1F5.
- Figure 17 shows 1F5 on circulating lymphocytes after a single dose.
- Figure 18 shows 1F5 does not significantly deplete circulating lymphocytes.
- Figure 19 depicts the results of a pentamer staining assay on mouse peripheral blood cells and splenocytes.
- Figure 20 depicts the results of an ELISPOT assay and enhanced IFNy production using anti-CD 27 antibodies.
- Figures 21 shows enhancement by anti-CD27 mAbs of T cell responses to a vaccine antigen in a transgenic mouse model by pentamer staining and IFN ELISPOT.
- Figures 22A-C are the protocol for and results of an experiment showing that anti-CD27 enhances T cell responses to an APC-targeted vaccine (CC-DEC205-OVA).
- Figure 22A shows the protocol for the experiment.
- Figure 22B shows the results of a tetramer staining experiment to measure antigen- specific T cells.
- Figure 22C shows the results of an IFN-gamma ELISPOT assay to measure antigen- specific T cells.
- Figures 23A-D are the results of an experiment showing that anti-CD27 in combination with the TLR3 agonist PolylC (at 25 ⁇ g, 50 ⁇ g or 100 ⁇ g) enhances T cell responses to an APC-targeted vaccine (CC-DEC205-OVA).
- Figure 23A is a graph showing the % of IFN-gamma positive cells among CD8+ T cells for either wild-type mice treated with poly IC and the anti-CD27 mAb 1F5, huCD27-transgenic mice treated with poly IC and a control human IgGl antibody or huCD27 -transgenic mice treated with poly IC and the anti- CD27 mAb 1F5.
- Figures 24 and 25 show results from a study of administration af ant-CD27 mAb prior to vaccine in the presence or absence of T:LR agnost and show the significance of timing of the aministration of the antibody relative to the vaccine.
- Figures 26 and 27 show results from administration of anti-CD27 mAb in combination with TCR activation ion T-cells from human CD27 transgenic mice, as shown by both proliferation and cytokine production.
- Figures 28A-D are the protocol for and results of an experiment showing that anti- CD27 enhances the efficacy ofan CC-DEC205-OVA vaccine in a M04 (B16-OVA) melanoma challenge model.
- Figure 24A shows the protocol for the experiment.
- Figure 24B is a graph plotting the tumor size (in mm ) against number of days post tumor inoculation in untreated mice.
- Figure 24C is a graph plotting the tumor size (in mm ) against number of days post tumor inoculation in mice treated with the vaccine alone.
- Figure 24D is a graph plotting the tumor size (in mm ) against number of days post tumor inoculation in mice treated with the vaccine in combination with an anti-CD27 antibody.
- Figures 29A and B are graphs showing prolonged survival of human CD27- transgenic mice (tumor models) following challenge with a syngeneic lymphoma and administration of various doses ofanti-CD27 mAb 1F5.
- Figures 30 to 32 show the results of an experiment testing the effect of anti-CD27 treatment in a Raji xenograft model in SCID mice.
- Figure 30A plots the tumor size (in mm 3 ) against number of days post tumor inoculation in mice either untreated, treated with a control human IgGl antibody or treated with the anti-CD27 lF5and 3H8 antibodies. Arrows indicate days when antibody treatment was given by i.p. injection.
- Figure 30B shows survival in a Kaplan-Meier plot.
- Figure 31A plots the tumor size (in mm 3 ) against number of days post tumor inoculation in mice either untreated, treated with a control human IgGl antibody or treated with the anti-CD27 1F5 antibody. Arrows indicate days when antibody treatment was given by i.p. injection.
- Figure 31B shows survival in a Kaplan-Meier plot.
- Figure 32 shows the results of a further experiment testing the effect of anti-CD27 treatment in a Raji xenograft model in SCID mice in a Kaplan-Meier plot.
- Figure 33 shows the results of an experiment testing the effect of anti-CD27 treatment in a Daudi xenograft model in SCID mice.
- Figure 33A plots the tumor size (in mm ) against number of days post tumor inoculation in mice either treated with a control human IgGl antibody or treated with the anti-CD27 1F5 antibody (0.1 mg or 0.3 mg).
- Figure 33B shows survival in a Kaplan-Meier plot.
- Figure 34 shows the results of an ELISPOT assay and that enhanced antigen- specific IFNg production using anti-CD27 antibody is abrogated when the Fc portion of the IgG is unable to engage Fc receptors.
- the present invention provides anti-CD27 antibodies that exhibit particular functional properties correlating with significant therapeutic benefits, including upregulation of immune function (e.g. T cell mediated immune responses as in vaccine therapies, NK activation in cancer therapies), inhibition of cell growth (e.g., in cancer therapy) and down- regulation of T cell mediated immune responses (e.g., in autoimmune therapy).
- immune function e.g. T cell mediated immune responses as in vaccine therapies, NK activation in cancer therapies
- inhibition of cell growth e.g., in cancer therapy
- down-regulation of T cell mediated immune responses e.g., in autoimmune therapy.
- these functional features include, for example: (1) inhibition of (e.g., completely or partially blocks) binding of soluble CD70 to CD27 expressing cells by at least about 70%, further for example by at least 80% or at least 90% (2) binding to human CD27 with a K D of 1 x 10 "9 M or less, (3) induction of at least about 40% complement mediated cytotoxicity (CDC) of CD27 expressing cells at a concentration of 10 ⁇ g/ml, (4) induction of at least about 40% specific lysis of CD27 expressing cells by ADCC at a concentration of 10 ⁇ g/ml, (further for example at least about 50%, at least about 60% or at least about 70% specific lysis)(5) induction or enhancement of immune responses, especially TH1 responses and/or (6) induction or enhancement of T-cell activity, especially specific CD8+ T-cell numbers and/or activity.
- the antibodies include particular heavy and light chain variable regions and/or CDR sequences.
- CD27 refers to a receptor that is a member of the TNF-receptor superfamily, which binds to ligand CD70.
- CD27 is required for generation and long-term maintenance of T cell immunity and plays a key role in regulating B-cell activation and immunoglobulin synthesis.
- the term "CD27” includes any variants or isoforms of CD27 which are naturally expressed by cells (e.g., human CD27 deposited with GENBANK® having accession no.
- antibodies of the invention may cross-react with CD27 from species other than human.
- the antibodies may be specific for human CD27 and may not exhibit any cross -reactivity with other species.
- CD27 or any variants and isoforms thereof may either be isolated from cells or tissues which naturally express them or be recombinantly produced using well-known techniques in the art and/or those described herein.
- the antibodies are targeted to hCD27 which has a normal glycosylation pattern.
- Genbank® accesion No. AAH12160.1 reports the amino acid sequence of human CD27 as follows (SEQ ID NO: l):
- CD70 also referred to as “CD70 molecule”, “CD27L”,
- CD27LG refers to the ligand for CD27 (see, for example, Bowman MR et al, J. Immunol. 1994 Feb 15;152(4): 1756-61).
- CD70 is a type II
- transmembrane protein that belongs to the tumor necrosis factor (TNF) ligand family. It is a surface antigen on activated T and B lymphocytes that induces proliferation of co- stimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation. It has also been suggested that CD70 plays a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin synthesis (Hintzen RQ et ah, J. Immunol. 1994 Feb 15;152(4): 1762-73).
- Genbank® (Accession No. NP_001243 ) reports the amino acid sequence of human CD70 as follows (SEQ ID NO: 2):
- antibody as referred to herein includes whole antibodies and any antigen binding fragment ⁇ i.e., "antigen -binding portion") or single chain thereof.
- antibody refers, in one preferred embodiment, to a glycoprotein comprising at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds, or an antigen binding portion thereof.
- Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as V H ) and a heavy chain constant region.
- the heavy chain constant region is comprised of three domains, CHI, CH2 and CH3.
- Each light chain is comprised of a light chain variable region (abbreviated herein as V L ) and a light chain constant region.
- the light chain constant region is comprised of one domain, CL.
- V H and V L regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR).
- CDR complementarity determining regions
- FR framework regions
- Each V H and V L is composed of three CDRs and four FRs, arranged from amino- terminus to carboxy- terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
- the variable regions of the heavy and light chains contain a binding domain that interacts with an antigen.
- the constant regions of the antibodies may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system ⁇ e.g., effector cells) and the first component (Clq) of the classical complement system.
- antibody portion refers to one or more fragments of an antibody that retain the ability to specifically bind to an antigen ⁇ e.g., human CD27).
- fragments are, for example between about 8 and about 1500 amino acids in length, suitably between about 8 and about 745 amino acids in length, suitably about 8 to about 300, for example about 8 to about 200 amino acids, or about 10 to about 50 or 100 amino acids in length. It has been shown that the antigen-binding function of an antibody can be performed by fragments of a full-length antibody.
- binding fragments encompassed within the term "antigen-binding portion" of an antibody include (i) a Fab fragment, a monovalent fragment consisting of the V L , V H , CL and CHI domains; (ii) a F(ab')2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the V H and CHI domains; (iv) a Fv fragment consisting of the V L and V H domains of a single arm of an antibody, (v) a dAb fragment (Ward et al, (1989) Nature 341:544-546), which consists of a V H domain; and (vi) an isolated complementarity determining region (CDR) or (vii) a combination of two or more isolated CDRs which may optionally be joined by a synthetic linker.
- a Fab fragment a monovalent fragment consisting of the V L , V H , CL and
- the two domains of the Fv fragment, V L and V H are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the V L and V H regions pair to form monovalent molecules (known as single chain Fv (scFv); see e.g., Bird et al. (1988) Science 242:423-426; and Huston et al. (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883).
- single chain Fv single chain Fv
- Such single chain antibodies are also intended to be encompassed within the term "antigen-binding portion" of an antibody.
- Antigen-binding portions can be produced by recombinant DNA techniques, or by enzymatic or chemical cleavage of intact immunoglobulins .
- bispecific or “bifunctional antibody” is an artificial hybrid antibody having two different heavy/light chain pairs and two different binding sites.
- Bispecific antibodies can be produced by a variety of methods including fusion of hybridomas or linking of Fab' fragments. See, e.g., Songsivilai & Lachmann, Clin. Exp. Immunol. 79:315-321 (1990); Kostelny et al., J. Immunol. 148, 1547-1553 (1992).
- human monoclonal antibody refers to an antibody which displays a single binding specificity and affinity for a particular epitope. Accordingly, the term “human monoclonal antibody” refers to an antibody which displays a single binding specificity and which has variable and optional constant regions derived from human germline immunoglobulin sequences. In one embodiment, human monoclonal antibodies are produced by a hybridoma which includes a B cell obtained from a transgenic non-human animal, e.g., a transgenic mouse, having a genome comprising a human heavy chain transgene and a light chain transgene fused to an immortalized cell.
- recombinant human antibody includes all human antibodies that are prepared, expressed, created or isolated by recombinant means, such as (a) antibodies isolated from an animal (e.g., a mouse) that is transgenic or transchromosomal for human immunoglobulin genes or a hybridoma prepared therefrom, (b) antibodies isolated from a host cell transformed to express the antibody, e.g., from a transfectoma, (c) antibodies isolated from a recombinant, combinatorial human antibody library, and (d) antibodies prepared, expressed, created or isolated by any other means that involve splicing of human immunoglobulin gene sequences to other DNA sequences.
- variable and constant regions that utilize particular human germline immunoglobulin sequences are encoded by the germline genes, but include subsequent rearrangements and mutations which occur, for example, during antibody maturation.
- the variable region contains the antigen binding domain, which is encoded by various genes that rearrange to form an antibody specific for a foreign antigen.
- the variable region can be further modified by multiple single amino acid changes (referred to as somatic mutation or hypermutation) to increase the affinity of the antibody to the foreign antigen.
- the constant region will change in further response to an antigen (i.e., isotype switch).
- the rearranged and somatically mutated nucleic acid molecules that encode the light chain and heavy chain immunoglobulin polypeptides in response to an antigen may not have sequence identity with the original nucleic acid molecules, but instead will be substantially identical or similar (i.e., have at least 80% identity).
- human antibody includes antibodies having variable and constant regions (if present) of human germline immunoglobulin sequences.
- Human antibodies of the invention can include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo) (see, Lonberg, N. et al. (1994) Nature 368(6474): 856-859);
- human antibody does not include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences (i.e., humanized antibodies).
- a heterologous antibody is defined in relation to the transgenic non-human organism producing such an antibody. This term refers to an antibody having an amino acid sequence or an encoding nucleic acid sequence corresponding to that found in an organism not consisting of the transgenic non-human animal, and generally from a species other than that of the transgenic non-human animal.
- an "isolated antibody,” as used herein, is intended to refer to an antibody which is substantially free of other antibodies having different antigenic specificities (e.g., an isolated antibody that specifically binds to human CD27 is substantially free of antibodies that specifically bind antigens other than human CD27).
- An isolated antibody that specifically binds to an epitope of may, however, have cross -reactivity to other CD27 proteins from different species. However, the antibody preferably always binds to human CD27.
- an isolated antibody is typically substantially free of other cellular material and/or chemicals.
- a combination of "isolated" antibodies having different CD27 specificities is combined in a well defined composition.
- epitopes refers to a site on an antigen to which an immunoglobulin or antibody specifically binds.
- Epitopes can be formed both from contiguous amino acids or noncontiguous amino acids juxtaposed by tertiary folding of a protein. Epitopes formed from contiguous amino acids are typically retained on exposure to denaturing solvents, whereas epitopes formed by tertiary folding are typically lost on treatment with denaturing solvents.
- An epitope typically includes at least 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15 amino acids in a unique spatial conformation.
- epitope mapping Methods for determining what epitopes are bound by a given antibody (i.e., epitope mapping) are well known in the art and include, for example, immunoblotting and immunoprecipitation assays, wherein overlapping or contiguous peptides from CD27 are tested for reactivity with the given anti-CD27 antibody.
- Methods of determining spatial conformation of epitopes include techniques in the art and those described herein, for example, x-ray crystallography and 2- dimensional nuclear magnetic resonance (see, e.g. , Epitope Mapping Protocols in Methods in Molecular Biology, Vol. 66, G. E. Morris, Ed. (1996)).
- antibodies that bind to an epitope on CD27 which comprises all or a portion of an epitope recognized by the particular antibodies described herein (e.g., the same or an overlapping region or a region between or spanning the region).
- antibodies that bind the same epitope and/or antibodies that compete for binding to human CD27 with the antibodies described herein can be identified using routine techniques. Such techniques include, for example, an immunoassay, which shows the ability of one antibody to block the binding of another antibody to a target antigen, i.e., a competitive binding assay. Competitive binding is determined in an assay in which the immunoglobulin under test inhibits specific binding of a reference antibody to a common antigen, such as CD27.
- RIA solid phase direct or indirect radioimmunoassay
- EIA solid phase direct or indirect enzyme immunoassay
- sandwich competition assay see Stahli et al., Methods in Enzymology 9:242 (1983)
- solid phase direct biotin-avidin EIA see Kirkland et al., J. Immunol. 137:3614 (1986)
- solid phase direct labeled assay solid phase direct labeled sandwich assay
- solid phase direct labeled sandwich assay see Harlow and Lane, Antibodies: A Laboratory Manual, Cold Spring Harbor Press (1988)
- solid phase direct label RIA using 1-125 label see Morel et al., Mol. Immunol.
- epitope mapping methods such as, x- ray analyses of crystals of antigen:antibody complexes which provides atomic resolution of the epitope.
- Other methods monitor the binding of the antibody to antigen fragments or mutated variations of the antigen where loss of binding due to a modification of an amino acid residue within the antigen sequence is often considered an indication of an epitope component.
- computational combinatorial methods for epitope mapping can also be used. These methods rely on the ability of the antibody of interest to affinity isolate specific short peptides from combinatorial phage display peptide libraries. The peptides are then regarded as leads for the definition of the epitope corresponding to the antibody used to screen the peptide library.
- computational algorithms have also been developed which have been shown to map conformational discontinuous epitopes.
- the terms “specific binding,” “selective binding,” “selectively binds,” and “specifically binds,” refer to antibody binding to an epitope on a predetermined antigen.
- the antibody binds with an equilibrium dissociation constant (Kpj) of approximately less than 10 - " 7 M, such as approximately less than 10 - " 8 M, 10 - “ 9 M or 10 - “ 10 M or even lower when determined by surface plasmon resonance (SPR) technology in a BIACORE 2000 instrument using recombinant human CD27 as the analyte and the antibody as the ligand and binds to the predetermined antigen with an affinity that is at least two-fold greater than its affinity for binding to a non-specific antigen (e.g., BSA, casein) other than the predetermined antigen or a closely-related antigen.
- a non-specific antigen e.g., BSA, casein
- K D is intended to refer to the dissociation equilibrium constant of a particular antibody-antigen interaction.
- the human antibodies of the invention bind to CD27 with a dissociation equilibrium constant (K D ) of approximately 10 "8 M or less, such as less than 10 "9 M or 10 "10 M or even lower when determined by surface plasmon resonance (SPR) technology in a BIACORE 2000 instrument using recombinant human CD27 as the analyte and the antibody as the ligand.
- SPR surface plasmon resonance
- Kd is intended to refer to the off rate constant for the dissociation of an antibody from the antibody/antigen complex.
- ka as used herein, is intended to refer to the on rate constant for the association of an antibody with the antigen.
- EC50 refers to the concentration of an antibody or an antigen-binding portion thereof, which induces a response, either in an in vitro or an in vivo assay, which is 50% of the maximal response, i.e., halfway between the maximal response and the baseline.
- isotype refers to the antibody class (e.g., IgM or IgGl) that is encoded by heavy chain constant region genes.
- a human monoclonal antibody of the invention is of the IgGl isotype.
- a human monoclonal antibody of the invention is of the IgG2 isotype.
- the term "binds to immobilized CD27,” refers to the ability of a human antibody of the invention to bind to CD27, for example, expressed on the surface of a cell or which is attached to a solid support.
- cross-reacts refers to the ability of an antibody of the invention to bind to CD27 from a different species.
- an antibody of the present invention which binds human CD27 may also bind another species of CD27.
- cross-reactivity is measured by detecting a specific reactivity with purified antigen in binding assays (e.g., SPR, ELISA) or binding to, or otherwise functionally interacting with, cells physiologically expressing CD27.
- Methods for determining cross-reactivity include standard binding assays as described herein, for example, by BiacoreTM surface plasmon resonance (SPR) analysis using a BiacoreTM 2000 SPR instrument (Biacore AB, Uppsala, Sweden), or flow cytometric techniques.
- SPR surface plasmon resonance
- isotype switching refers to the phenomenon by which the class, or isotype, of an antibody changes from one Ig class to one of the other Ig classes.
- nonswitched isotype refers to the isotypic class of heavy chain that is produced when no isotype switching has taken place; the CH gene encoding the nonswitched isotype is typically the first CH gene immediately downstream from the functionally rearranged VDJ gene. Isotype switching has been classified as classical or non- classical isotype switching.
- Classical isotype switching occurs by recombination events which involve at least one switch sequence region in the transgene.
- Non-classical isotype switching may occur by, for example, homologous recombination between human ⁇ ⁇ and human ⁇ ⁇ ( ⁇ -associated deletion).
- Alternative non-classical switching mechanisms such as intertransgene and/or interchromosomal recombination, among others, may occur and effectuate isotype switching.
- switch sequence refers to those DNA sequences responsible for switch recombination.
- a "switch donor” sequence typically a ⁇ switch region, will be 5' (i.e. , upstream) of the construct region to be deleted during the switch recombination.
- the "switch acceptor” region will be between the construct region to be deleted and the replacement constant region (e.g., ⁇ , ⁇ , etc.). As there is no specific site where recombination always occurs, the final gene sequence will typically not be predictable from the construct.
- glycosylation pattern is defined as the pattern of
- a glycosylation pattern of a heterologous antibody can be characterized as being substantially similar to glycosylation patterns which occur naturally on antibodies produced by the species of the nonhuman transgenic animal, when one of ordinary skill in the art would recognize the glycosylation pattern of the heterologous antibody as being more similar to said pattern of glycosylation in the species of the nonhuman transgenic animal than to the species from which the CH genes of the transgene were derived.
- naturally-occurring refers to the fact that an object can be found in nature.
- a polypeptide or polynucleotide sequence that is present in an organism (including viruses) that can be isolated from a source in nature and which has not been intentionally modified by man in the laboratory is naturally- occurring.
- rearranged refers to a configuration of a heavy chain or light chain immunoglobulin locus wherein a V segment is positioned immediately adjacent to a D-J or J segment in a conformation encoding essentially a complete VH or VL domain, respectively.
- a rearranged immunoglobulin gene locus can be identified by comparison to germline DNA; a rearranged locus will have at least one recombined heptamer/nonamer homology element.
- V segment configuration refers to the configuration wherein the V segment is not recombined so as to be immediately adjacent to a D or J segment.
- nucleic acid molecule is intended to include DNA molecules and RNA molecules.
- a nucleic acid molecule may be single-stranded or double- stranded, but preferably is double- stranded DNA.
- isolated nucleic acid molecule as used herein in reference to nucleic acids encoding antibodies or antibody portions (e.g. , VH, VL, CDR3) that bind to CD27, is intended to refer to a nucleic acid molecule in which the nucleotide sequences encoding the antibody or antibody portion are free of other nucleotide sequences encoding antibodies or antibody portions that bind antigens other than CD27, which other sequences may naturally flank the nucleic acid in human genomic DNA.
- SEQ ID NOs: 35 and 41, 47 and 53, 101 and 107, 83 and 89, 83 and 95, 23 and 29, 71 and 77 correspond, respectively, to the nucleotide sequences comprising the heavy chain (VH) and light chain (VL) variable regions of anti-CD27 antibody monoclonal antibodies 1F5, 1H8, 3H12, 3A10, 2C2, 2G9, 3H8, and 1G5.
- the present invention also encompasses "conservative sequence modifications" of the sequences set forth in SEQ ID NOs: 5-112, i.e., nucleotide and amino acid sequence modifications which do not abrogate the binding of the antibody encoded by the nucleotide sequence or containing the amino acid sequence, to the antigen.
- conservative sequence modifications include conservative nucleotide and amino acid substitutions, as well as, nucleotide and amino acid additions and deletions.
- modifications can be introduced into SEQ ID NOs: 5-112 by standard techniques known in the art, such as site-directed mutagenesis and PCR-mediated mutagenesis.
- Conservative amino acid substitutions include ones in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art.
- amino acids with basic side chains ⁇ e.g., lysine, arginine, histidine
- acidic side chains ⁇ e.g., aspartic acid, glutamic acid
- uncharged polar side chains ⁇ e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine, tryptophan
- nonpolar side chains ⁇ e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine
- beta-branched side chains ⁇ e.g., threonine, valine, isoleucine
- aromatic side chains ⁇ e.g., tyrosine, phenylalanine, tryptophan, histidine).
- a predicted nonessential amino acid residue in a human anti-CD27 antibody is preferably replaced with another amino acid residue from the same side chain family.
- mutations can be introduced randomly along all or part of an anti-CD27 antibody coding sequence, such as by saturation
- the resulting modified anti-CD27 antibodies can be screened for binding activity.
- nucleic acids For nucleic acids, the term "substantial homology" indicates that two nucleic acids, or designated sequences thereof, when optimally aligned and compared, are identical, with appropriate nucleotide insertions or deletions, in at least about 80% of the nucleotides, usually at least about 90% to 95%, and more preferably at least about 98% to 99.5% of the nucleotides. Alternatively, substantial homology exists when the segments will hybridize under selective hybridization conditions, to the complement of the strand.
- the comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm, as described in the non-limiting examples below.
- the percent identity between two nucleotide sequences can be determined using the GAP program in the GCG software package (available at http://www.gcg.com), using a NWSgapdna.CMP matrix and a gap weight of 40, 50, 60, 70, or 80 and a length weight of 1, 2, 3, 4, 5, or 6.
- the percent identity between two nucleotide or amino acid sequences can also be determined using the algorithm of E. Meyers and W. Miller (CABIOS, 4: 11-17 (1989)) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.
- the percent identity between two amino acid sequences can be determined using the
- nucleic acid and protein sequences of the present invention can further be used as a "query sequence" to perform a search against public databases to, for example, identify related sequences. Such searches can be performed using the NBLAST and
- Gapped BLAST can be utilized as described in Altschul et al., (1997) Nucleic Acids Res. 25(17):3389-3402.
- the nucleic acids may be present in whole cells, in a cell lysate, or in a partially purified or substantially pure form.
- a nucleic acid is "isolated” or “rendered substantially pure” when purified away from other cellular components or other contaminants, e.g. , other cellular nucleic acids or proteins, by standard techniques, including alkaline/SDS treatment, CsCl banding, column chromatography, agarose gel electrophoresis and others well known in the art. See, F. Ausubel, et ah , ed. Current Protocols in Molecular Biology, Greene Publishing and Wiley Interscience, New York (1987).
- nucleic acid compositions of the present invention while often in a native sequence (except for modified restriction sites and the like), from either cDNA, genomic or mixtures thereof may be mutated, in accordance with standard techniques to provide gene sequences. For coding sequences, these mutations, may affect amino acid sequence as desired.
- DNA sequences substantially homologous to or derived from native V, D, J, constant, switches and other such sequences described herein are contemplated (where "derived" indicates that a sequence is identical or modified from another sequence).
- a nucleic acid is "operably linked" when it is placed into a functional relationship with another nucleic acid sequence.
- a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence.
- operably linked means that the DNA sequences being linked are contiguous and, where necessary to join two protein coding regions, contiguous and in reading frame.
- operably linked indicates that the sequences are capable of effecting switch recombination.
- vector is intended to refer to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked.
- plasmid refers to a circular double stranded DNA loop into which additional DNA segments may be ligated.
- viral vector Another type of vector is a viral vector, wherein additional DNA segments may be ligated into the viral genome.
- Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g. , bacterial vectors having a bacterial origin of replication and episomal mammalian vectors).
- Other vectors are capable of autonomous replication in a host cell into which they are introduced (e.g. , bacterial vectors having a bacterial origin of replication and episomal mammalian vectors). Other vectors
- non-episomal mammalian vectors can be integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome.
- vectors are capable of directing the expression of genes to which they are operatively linked. Such vectors are referred to herein as "recombinant expression vectors"(or simply, "expression vectors")
- expression vectors of utility in recombinant DNA techniques are often in the form of plasmids.
- plasmid and vector may be used interchangeably as the plasmid is the most commonly used form of vector.
- the invention is intended to include such other forms of expression vectors, such as viral vectors (e.g., replication defective retroviruses, adenoviruses and adeno-associated viruses), which serve equivalent functions.
- recombinant host cell (or simply “host cell”), as used herein, is intended to refer to a cell into which a recombinant expression vector has been introduced. It should be understood that such terms are intended to refer not only to the particular subject cell but to the progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term “host cell” as used herein.
- antigen refers to any natural or synthetic immunogenic substance, such as a protein, peptide, or hapten.
- Suitable antigens for use in the present invention include, for example, infectious disease antigens and tumor antigens, against which protective or therapeutic immune responses are desired, e.g., antigens expressed by a tumor cell or a pathogenic organism or infectious disease antigens.
- suitable antigens include tumor-associated antigens for the prevention or treatment of cancers.
- tumor- associated antigens include, but are not limited to, sequences comprising all or part of the sequences of hCG, gplOO or Pmell7, HER2/neu, WT1, mesothelin, CEA, gplOO, MARTI, TRP-2, melan-A, NY-ESO-1, NY-BR-1, NY-CO-58, MN (gp250), idiotype, MAGE-1, MAGE-3, MAGE- A3, Tyrosinase, Telomerase, SSX2 and MUC-1 antigens, and germ cell derived tumor antigens.
- Tumor associated antigens also include the blood group antigens, for example, Le a , Le b , LeX, LeY, H-2, B-l, B-2 antigens.
- a MAGE antigen can be combined with other antigens such as melanin A, tyrosinase, and gplOO along with adjuvants such as GM-CSF or IL-12, and linked to an anti-APC antibody.
- viral antigens include viral antigens for the prevention or treatment of viral diseases.
- viral antigens include, but are not limited to, HIV-1 gag, HIV- 1 env, HIV-1 nef, HBV (surface or core antigens), HPV, FAS, HSV-1, HSV-2, pl7, ORF2 and ORF3 antigens.
- bacterial antigens include, but are not limited to,
- the antibody-bacterial antigen conjugates of the invention can be in the treatment or prevention of various bacterial diseases such as Anthrax, Botulism, Tetanus, Chlamydia, Cholera, Diphtheria, Lyme Disease, Syphilis and Tuberculosis.
- Other suitable antigens from infectious disease pathogens, such as viruses, bacteria, parasites and fungi are disclosed below.
- HPV antigen that may be used in the compositions and the methods of the invention may include, for example an HPV-16 antigen, an HPV- 18 antigen, an HPV-31 antigen, an HPV-33 antigen and/or an HPV-35 antigen; and is suitably an HPV-16 antigen and/or HPV-18 antigen.
- a genome of HPV-16 is described in Virology, 145: 181- 185 (1985) and DNA sequences encoding HPV-18 are described in US Patent No. 5,840,306, the disclosures of which are incorporated by reference herein in their entirety.
- HPV-16 antigens e.g., seroreactive regions of the El and/or E2 proteins of HPV-16 are described in US Patent No.
- HPV-18 antigens e.g., seroreactive regions of the LI and/or L2 proteins of HPV-18
- US Patent No. 5,840,306 the disclosures of which are incorporated by reference herein.
- a complete genome for HBV is available at GENBANK® Accession No. NC_003977, the disclosure of which is incorporated herein.
- HCV The genome of HCV is described in European Patent Application No. 318 216, the disclosure of which is incorporated herein.
- Antigenic peptides of proteins can be identified in a variety of manners well known in the art.
- T cell epitopes can be predicted by analyzing the sequence of the protein using web-based predictive algorithms (BIMAS & SYFPEITHI) to generate potential MHC class I and II- binding peptides that match an internal database of 10,000 well characterized MHC binding peptides previously defined by CTLs.
- High scoring peptides can be ranked and selected as "interesting" on the basis of high affinity to a given MHC molecule.
- Another method for identifying antigenic peptides containing T cell epitopes is by dividing the protein into non-overlapping peptides of desired length or overlapping peptides of desired lengths which can be produced recombinantly, synthetically, or in certain limited situations, by chemical cleavage of the protein and tested for immunogenic properties, e.g. , eliciting a T cell response (i.e. , proliferation or lymphokine secretion).
- a peptide having T cell stimulating activity and thus comprising at least one T cell epitope can be modified by addition or deletion of amino acid residues at either the amino or carboxy terminus of the peptide and tested to determine a change in T cell reactivity to the modified peptide. If two or more peptides which share an area of overlap in the native protein sequence are found to have human T cell stimulating activity, as determined by T cell biology techniques, additional peptides can be produced comprising all or a portion of such peptides and these additional peptides can be tested by a similar procedure.
- peptides are selected and produced recombinantly or synthetically. Peptides are selected based on various factors, including the strength of the T cell response to the peptide (e.g., stimulation index). The physical and chemical properties of these selected peptides (e.g. , solubility, stability) can then be examined to determine whether the peptides are suitable for use in therapeutic compositions or whether the peptides require modification.
- APC antigen presenting cell
- T-cells recognize this complex using T-cell receptor (TCR).
- APCs include, but are not limited to, dendritic cells (DCs), peripheral blood mononuclear cells (PBMC), monocytes (such as THP-1), B lymphoblastoid cells (such as C1R.A2, 1518 B-LCL) and monocyte-derived dendritic cells (DCs).
- DCs dendritic cells
- PBMC peripheral blood mononuclear cells
- monocytes such as THP-1
- B lymphoblastoid cells such as C1R.A2, 1518 B-LCL
- DCs monocyte-derived dendritic cells
- APC receptors include, but are not limited to C-type lectins, such as, the human Dendritic and Epithelial Cell 205 receptor (CD27), and the human macrophage mannose receptor.
- the term "antigen presentation" refers to the process by which APCs capture antigens and enables their recognition by T-cells, e.g., as a component of an MHC-I and/or MHC-II conjugate.
- MHC molecules include two types of molecules, MHC class I and MHC class II.
- MHC class I molecules present antigen to specific CD8+ T cells and MHC class II molecules present antigen to specific CD4+ T cells.
- Antigens delivered exogenously to APCs are processed primarily for association with MHC class II.
- antigens delivered endogenously to APCs are processed primarily for association with MHC class I.
- immuno stimulatory agent includes but is not limited to compounds capable of stimulating APCs, such as DCs and macrophages.
- suitable immuno stimulatory agents for use in the present invention are capable of stimulating APCs, so that the maturation process of the APCs is accelerated, the proliferation of APCs is increased, and/or the recruitment or release of co-stimulatory molecules (e.g., CD80, CD86, ICAM-1, MHC molecules and CCR7) and pro-inflammatory cytokines (e.g., IL- ⁇ , IL-6, IL-12, IL- 15, and IFN- ⁇ ) is upregulated.
- co-stimulatory molecules e.g., CD80, CD86, ICAM-1, MHC molecules and CCR7
- pro-inflammatory cytokines e.g., IL- ⁇ , IL-6, IL-12, IL- 15, and IFN- ⁇
- Suitable immuno stimulatory agents are also capable of increasing T cell proliferation.
- Such immuno stimulatory agents include, but are not be limited to, CD40 ligand; FLT 3 ligand; cytokines, such as IFN-a, IFN- ⁇ , IFN- ⁇ and IL-2; colony-stimulating factors, such as G-CSF (granulocyte colony- stimulating factor) and GM-CSF (granulocyte-macrophage colony- stimulating factor); an anti-CTLA-4 antibody, anti-PDl antibody, anti-41BB antibody, or anti-OX-40 antibody; LPS (endotoxin); ssRNA; dsRNA; Bacille Calmette-Guerin (BCG); Levamisole hydrochloride; and intravenous immune globulins.
- CD40 ligand such as CD40 ligand
- FLT 3 ligand such as CD40 ligand
- cytokines such as IFN-a, IFN- ⁇ , IFN- ⁇ and IL-2
- colony-stimulating factors such as G-CSF (granulocyte colon
- an immunostimulatory agant may be a Toll-like Receptor (TLR) agonist.
- the immunostimulatory agent may be a TLR3 agonist such as double-stranded inosine:cytosine polynucleotide (Poly I:C, for example available as AmpligenTM from Hemispherx Bipharma, PA, US or Poly IC:LC from Oncovir) or Poly A:U; a TLR4 agonist such as monophosphoryl lipid A (MPL) or RC-529 (for example as available from GSK, UK); a TLR5 agonist such as flagellin; a TLR7 or TLR8 agonist such as an imidazoquinoline TLR7 or TLR 8 agonist, for example imiquimod (eg AldaraTM) or resiquimod and related imidazoquinoline agents (for example as available from 3M
- TLR3 agonist such as double-stranded inosine:cytosine polynucleotide (Pol
- TLR 9 agonist such as a deoxynucleotide with unmethylated CpG motifs (so-called "CpGs", for example as available from Coley Pharmaceutical).
- a preferred immunostimulatory agent is a TLR3 agonist, preferably Poly I:C.
- Such immunostimulatory agents may be administered simultaneously, separately or sequentially with the antibodies and constructs of the present invention and may also be physically linked to the antibodies and constructs.
- linkage refers to the association of two or more molecules.
- the linkage can be covalent or non-covalent.
- the linkage also can be genetic (i.e. , recombinantly fused). Such linkages can be achieved using a wide variety of art recognized techniques, such as chemical conjugation and recombinant protein production.
- antigen cross-presentation refers to presentation of exogenous protein antigens to T cells via MHC class I and class II molecules on APCs.
- T cell-mediated response refers to any response mediated by T cells, including effector T cells (e.g. , CD8 + cells) and helper T cells (e.g., CD4 + cells).
- T cell mediated responses include, for example, T cell cytotoxicity and proliferation.
- cytotoxic T lymphocyte (CTL) response refers to an immune response induced by cytotoxic T cells. CTL responses are mediated primarily by CD8 + T cells.
- inhibits or “blocks” (e.g., referring to inhibition/blocking of binding of CD70 to CD27 on cells) are used interchangeably and encompass both partial and complete inhibition/blocking.
- the inhibition/blocking of CD70 preferably reduces or alters the normal level or type of activity that occurs when CD70 binding occurs without inhibition or blocking.
- Inhibition and blocking are also intended to include any measurable decrease in the binding affinity of CD70 when in contact with an anti-CD27 antibody as compared to CD70 not in contact with an anti-CD27 antibody, e.g.
- the anti-CD27 antibody inhibits binding of CD70 by at least about 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75% , 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%.
- the anti-CD27 antibody inhibits binding of CD70 by at least about 70%.
- the anti-CD27 antibody inhibits binding of CD70 by at least 80%
- the term "inhibits growth" is intended to include any measurable decrease in the growth of a cell, e.g. , the inhibition of growth of a cell by at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 99%, or 100%.
- inducing an immune response and “enhancing an immune response” are used interchangeably and refer the stimulation of an immune response (i.e., either passive or adaptive) to a particular antigen.
- induce as used with respect to inducing CDC or ADCC refer to the stimulation of particular direct cell killing
- the antibody induces at least about 20, 25, 30, 35, 40, 45, 50, 55, or 60 % lysis via CDC of CD27 expressing cells at a concentration of 10 ⁇ g/ml. In a preferred embodiment, the antibody induces at least about 40 % lysis via CDC of CD27 expressing cells at a concentration of 10 ⁇ g/ml. In another embodiment, the antibody induces at least about 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, or 85% lysis via ADCC (i.e., specific lysis) of CD27 expressing cells at a concentration of 10 ⁇ g/ml. In a preferred embodiment, the antibody induces at least about 40 % lysis via ADCC of CD27 expressing cells at a concentration of 10 ⁇ g/ml.
- treat refers to therapeutic or preventative measures described herein.
- the methods of “treatment” employ administration to a subject, in need of such treatment, a human antibody of the present invention, for example, a subject in need of an enhanced immune response against a particular antigen or a subject who ultimately may acquire such a disorder, in order to prevent, cure, delay, reduce the severity of, or ameliorate one or more symptoms of the disorder or recurring disorder, or in order to prolong the survival of a subject beyond that expected in the absence of such treatment.
- an effective dose or "effective dosage” is defined as an amount sufficient to achieve or at least partially achieve the desired effect.
- terapéuticaally effective dose is defined as an amount sufficient to cure or at least partially arrest the disease and its complications in a patient already suffering from the disease. Amounts effective for this use will depend upon the severity of the disorder being treated and the general state of the patient' s own immune system.
- patient includes human and other mammalian subjects that receive either prophylactic or therapeutic treatment.
- the term "subject” includes any human or non-human animal.
- the methods and compositions of the present invention can be used to treat a subject with an immune disorder.
- non-human animal includes all vertebrates, e.g. , mammals and non-mammals, such as non-human primates, sheep, dog, cow, chickens, amphibians, reptiles, etc.
- the present invention encompasses antibodies, e.g., fully human antibodies, that bind CD27, e.g., human CD27.
- exemplary monoclonal antibodies that bind CD27 include 1F5, 1H8, 3H12, 3A10, 2C2, 2G9, 3H8, and 1G5.
- Monoclonal antibodies of the invention can be produced using a variety of known techniques, such as the standard somatic cell hybridization technique described by Kohler and Milstein, Nature 256: 495 (1975). Although somatic cell hybridization procedures are preferred, in principle, other techniques for producing monoclonal antibodies also can be employed, e.g., viral or oncogenic transformation of B lymphocytes, phage display technique using libraries of human antibody genes.
- a hybridoma method is used for producing an antibody that binds human CD27.
- a mouse or other appropriate host animal can be immunized with a suitable antigen in order to elicit lymphocytes that produce or are capable of producing antibodies that will specifically bind to the antigen used for immunization.
- lymphocytes may be immunized in vitro. Lymphocytes can then be fused with myeloma cells using a suitable fusing agent, such as polyethylene glycol, to form a hybridoma cell (Goding, Monoclonal Antibodies: Principles and Practice, pp.59- 103 (Academic Press, 1986)).
- Culture medium in which hybridoma cells are growing is assayed for production of monoclonal antibodies directed against the antigen. After hybridoma cells are identified that produce antibodies of the desired specificity, affinity, and/or activity, the clones may be subcloned by limiting dilution procedures and grown by standard methods (Goding, Monoclonal Antibodies Principles and Practice, pp. 59-103 (Academic Press, 1986)). Suitable culture media for this purpose include, for example, D- MEM or RPMI-1640 medium. In addition, the hybridoma cells may be grown in vivo as ascites tumors in an animal.
- the monoclonal antibodies secreted by the subclones can be separated from the culture medium, ascites fluid, or serum by conventional immunoglobulin purification procedures such as, for example, protein A-Sepharose, hydroxylapatite chromatography, gel electrophoresis, dialysis, or affinity chromatography.
- antibodies and antibody portions that bind human CD27 can be isolated from antibody phage libraries generated using the techniques described in, for example, McCafferty et al., Nature, 348:552-554 (1990). Clackson et al., Nature, 352:624-628 (1991), Marks et al, J. Mol. Biol, 222:581-597 (1991) and Hoet et al (2005) Nature Biotechnology 23, 344-348 ; U.S. Patent Nos. 5,223,409; 5,403,484; and 5,571,698 to Ladner et al ; U.S. Patent Nos. 5,427,908 and 5,580,717 to Dower et al ; U.S.
- the antibody that binds human CD27 is produced using the phage display technique described by Hoet et al., supra. This technique involves the generation of a human Fab library having a unique combination of immunoglobulin sequences isolated from human donors and having synthetic diversity in the heavy-chain CDRs is generated. The library is then screened for Fabs that bind to human CD27.
- the preferred animal system for generating hybridomas which produce antibodies of the invention is the murine system.
- Hybridoma production in the mouse is well known in the art, including immunization protocols and techniques for isolating and fusing immunized splenocytes.
- antibodies directed against CD27 are generated using transgenic or transchromosomal mice carrying parts of the human immune system rather than the mouse system.
- the invention employs transgenic mice, referred to herein as "HuMAb mice” which contain a human immunoglobulin gene miniloci that encodes unrearranged human heavy ( ⁇ and ⁇ ) and ⁇ light chain immunoglobulin sequences, together with targeted mutations that inactivate the endogenous ⁇ and ⁇ chain loci (Lonberg, N. et al. (1994) Nature 368(6474): 856-859).
- mice exhibit reduced expression of mouse IgM or K, and in response to immunization, the introduced human heavy and light chain transgenes undergo class switching and somatic mutation to generate high affinity human IgGK monoclonal antibodies
- HuMAb mice The preparation of HuMAb mice is described in detail in Section II below and in Taylor, L. et al.
- transgenic or transchromosomal mice containing human immunoglobulin genes can be immunized with a purified or enriched preparation of the CD27 antigen and/or cells expressing CD27, as described, for example, by Lonberg et al. (1994) Nature 368(6474): 856-859; Fishwild et al. (1996) Nature Biotechnology 14: 845-851 and WO 98/24884.
- HuMAb mice are immunized either with recombinant CD27 proteins or cell lines expressing CD27 as immunogens.
- mice can be immunized with DNA encoding human CD27.
- mice will be 6-16 weeks of age upon the first infusion.
- a purified or enriched preparation (5-50 ⁇ g) of the recombinant CD27 antigen can be used to immunize the HuMAb mice intraperitoneally.
- mice can also be immunized with cells expressing CD27, e.g., a cell line, to promote immune responses.
- Exemplary cell lines include CD27-overexpressing stable CHO and Raji cell lines.
- SC subcutaneously
- IP/SC immunizations up to a total of 10
- the immune response can be monitored over the course of the immunization protocol with plasma samples being obtained by retroorbital bleeds.
- the plasma can be screened by ELISA (as described below), and mice with sufficient titers of anti-CD27 human immunoglobulin can be used for fusions. Mice can be boosted intravenously with antigen 3 days before sacrifice and removal of the spleen.
- splenocytes and lymph node cells from immunized mice can be isolated and fused to an appropriate immortalized cell line, such as a mouse myeloma cell line.
- an appropriate immortalized cell line such as a mouse myeloma cell line.
- the resulting hybridomas can then be screened for the production of antigen- specific antibodies.
- single cell suspensions of splenic lymphocytes from immunized mice can be fused to SP2/0-Ag8.653 nonsecreting mouse myeloma cells (ATCC, CRL 1580) with 50% PEG (w/v).
- Cells can be plated at approximately 1 x 10 5 in flat bottom micro titer plate, followed by a two week incubation in selective medium containing besides usual reagents 10% fetal Clone Serum, 5-10% origen hybridoma cloning factor (IGEN) and IX HAT (Sigma). After approximately two weeks, cells can be cultured in medium in which the HAT is replaced with HT. Individual wells can then be screened by ELISA for human anti-CD27 monoclonal IgM and IgG antibodies, or for binding to the surface of cells expressing CD27, e.g., a CHO cell line expressing CD27, by FLISA (fluorescence-linked immunosorbent assay).
- the antibody secreting hybridomas can be replated, screened again, and if still positive for IgG, anti-CD27 monoclonal antibodies can be subcloned at least twice by limiting dilution. The stable subclones can then be cultured in vitro to generate antibody in tissue culture medium for characterization.
- Antibodies of the invention also can be produced in a host cell transfectoma using, for example, a combination of recombinant DNA techniques and gene transfection methods as is well known in the art (Morrison, S. (1985) Science 229: 1202).
- the gene(s) of interest e.g., human antibody genes
- an expression vector such as a eukaryotic expression plasmid such as used by GS gene expression system disclosed in WO 87/04462, WO 89/01036 and EP 338 841 or other expression systems well known in the art.
- the purified plasmid with the cloned antibody genes can be introduced in eukaryotic host cells such as CHO-cells or NSO-cells or alternatively other eukaryotic cells like a plant derived cells, fungi or yeast cells.
- the method used to introduce these genes could be methods described in the art such as electroporation, lipofectine, lipofectamine or other.
- cells expressing the antibody can be identified and selected. These cells represent the transfectomas which can then be amplified for their expression level and upscaled to produce antibodies. Recombinant antibodies can be isolated and purified from these culture supernatants and/or cells.
- these cloned antibody genes can be expressed in other expression systems such as E. coli or in complete organisms or can be synthetically expressed.
- Antibodies interact with target antigens predominantly through amino acid residues that are located in the six heavy and light chain complementarity determining regions (CDRs). For this reason, the amino acid sequences within CDRs are more diverse between individual antibodies than sequences outside of CDRs. Because CDR sequences are responsible for most antibody-antigen interactions, it is possible to express recombinant antibodies that mimic the properties of specific naturally occurring antibodies by constructing expression vectors that include CDR sequences from the specific naturally occurring antibody grafted onto framework sequences from a different antibody with different properties (see, e.g. , Riechmann, L. et al., 1998, Nature 332:323-327; Jones, P. et al., 1986, Nature 321 :522-525; and Queen, C.
- Such framework sequences can be obtained from public DNA databases that include germline antibody gene sequences. These germline sequences will differ from mature antibody gene sequences because they will not include completely assembled variable genes, which are formed by V(D)J joining during B cell maturation. Germline gene sequences will also differ from the sequences of a high affinity secondary repertoire antibody at individual evenly across the variable region. For example, somatic mutations are relatively infrequent in the amino-terminal portion of framework region. For example, somatic mutations are relatively infrequent in the amino terminal portion of framework region 1 and in the carboxy- terminal portion of framework region 4.
- variable region can be synthesized as a set of short, overlapping, oligonucleotides and combined by PCR amplification to create an entirely synthetic variable region clone. This process has certain advantages such as elimination or inclusion or particular restriction sites, or optimization of particular codons.
- the nucleotide sequences of heavy and light chain transcripts from a hybridoma are used to design an overlapping set of synthetic oligonucleotides to create synthetic V sequences with identical amino acid coding capacities as the natural sequences.
- the synthetic heavy and kappa chain sequences can differ from the natural sequences in three ways: strings of repeated nucleotide bases are interrupted to facilitate oligonucleotide synthesis and PCR amplification; optimal translation initiation sites are incorporated according to Kozak's rules (Kozak, 1991, J. Biol. Chem. 266: 19867-19870); and,
- Hindlll sites are engineered upstream of the translation initiation sites.
- the optimized coding, and corresponding non-coding, strand sequences are broken down into 30 - 50 nucleotide approximately the midpoint of the corresponding non-coding oligonucleotide.
- the oligonucleotides can be assembled into overlapping double stranded sets that span segments of 150 - 400 nucleotides. The pools are then used as templates to produce
- PCR amplification products of 150 - 400 nucleotides.
- a single variable region oligonucleotide set will be broken down into two pools which are separately amplified to generate two overlapping PCR products. These overlapping products are then combined by PCR amplification to form the complete variable region.
- the reconstructed heavy and light chain variable regions are then combined with cloned promoter, leader sequence, translation initiation, leader sequence, constant region, 3' untranslated, polyadenylation, and transcription termination, sequences to form expression vector constructs.
- the heavy and light chain expression constructs can be combined into a single vector, co-transfected, serially transfected, or separately transfected into host cells which are then fused to form a host cell expressing both chains.
- Plasmids for use in construction of expression vectors were constructed so that PCR amplified V heavy and V kappa light chain cDNA sequences could be used to reconstruct complete heavy and light chain minigenes. These plasmids can be used to express completely human IgGiK or IgG 4 K antibodies. Fully human and chimeric antibodies of the present invention also include IgG2, IgG3, IgE, IgA, IgM, and IgD antibodies. Similar plasmids can be constructed for expression of other heavy chain isotypes, or for expression of antibodies comprising lambda light chains.
- structural features of anti-CD27 antibodies of the invention are used to create structurally related anti-CD27 antibodies that retain at least one functional property of the antibodies of the invention, such as, for example, (1) inhibits (e.g., completely or partially blocks) binding of CD70 to CD27 expressing cells by at least about 70% (e.g., by at least about 70%, or by at least 70%, at an antibody concentration of 10 ⁇ g/ml);
- a xenograft model prevents or inhibits the growth of CD27-expressing tumor cells in a xenograft model (e.g., reduces tumor size in severe combined immunodeficiency (SCID) mice by at least about 50% 20-days post tumor cell inoculation in vivo at 0.5mg ip on at least 6 days);
- SCID severe combined immunodeficiency
- T-cell activity induces or enhances T-cell activity, in particular but not limited to specific CD8+ T-cell numbers or functional activity, or T cell proliferation or activation;
- one or more CDR regions of antibodies of the invention can be combined recombinantly with known framework regions and CDRs to create additional, recombinantly-engineered, anti-CD27 antibodies of the invention.
- the heavy and light chain variable framework regions can be derived from the same or different antibody sequences.
- the antibody sequences can be the sequences of naturally occurring antibodies or can be consensus sequences of several antibodies. See Kettleborough et al., Protein Engineering 4:773 (1991); Kolbinger et al., Protein Engineering 6:971 (1993) and Carter et al., WO 92/22653.
- the invention provides a method for preparing an anti-CD27 antibody including: preparing an antibody including (1) heavy chain framework regions and heavy chain CDRs, where at least one of the heavy chain CDRs includes an amino acid sequence selected from the amino acid sequences of CDRs shown in SEQ ID NOs: 8, 9, 10, 26, 27, 28, 38, 39, 40, 50, 51, 52, 62, 63, 64, 74, 75, 76, 86, 87, 88, 104, 105, 106; and (2) light chain framework regions and light chain CDRs, where at least one of the light chain CDRs includes an amino acid sequence selected from the amino acid sequences of CDRs shown in SEQ ID NOs: SEQ ID NOs: 14, 15, 16, 20, 21, 22, 32, 33, 34, 44, 45, 46, 56, 57, 58, 68, 69, 70, 80, 81, 82, 92, 93, 94, 98, 99, 100, 110, 111, 112; where the antibody retains the ability
- the recombinant antibodies of the invention prepared as set forth above preferably comprise the heavy and/or light chain CDR3s of antibodies 1F5, 1H8, 3H12, 3A10, 2C2, 2G9, 3H8, and 1G5.
- the antibodies further can comprise the CDR2s of antibodies 1F5, 1H8, 3H12, 3A10, 2C2, 2G9, 3H8, and 1G5.
- the antibodies further can comprise the CDRls of antibodies 1F5, 1H8, 3H12, 3A10, 2C2, 2G9, 3H8, and 1G5.
- the antibodies can further comprise any combinations of the CDRs.
- the invention further provides anti-
- CD27 antibodies comprising: (1) heavy chain framework regions, a heavy chain CDR1 region, a heavy chain CDR2 region, and a heavy chain CDR3 region, wherein the heavy chain CDR3 region is selected from the CDR3s of 1F5, 1H8, 3H12, 3A10, 2C2, 2G9, 3H8, and 1G5 and (2) light chain framework regions, a light chain CDR1 region, a light chain CDR2 region, and a light chain CDR3 region, wherein the light chain CDR3 region is selected from the CDR3s of 1F5, 1H8, 3H12, 3A10, 2C2, 2G9, 3H8, and 1G5, wherein the antibody binds CD27.
- the antibody may further include the heavy chain CDR2 and/or the light chain CDR2 of antibodies 1F5, 1H8, 3H12, 3A10, 2C2, 2G9, 3H8, and 1G5.
- the antibody may further comprise the heavy chain CDR1 and/or the light chain CDR1 of antibodies 1F5, 1H8, 3H12, 3A10, 2C2, 2G9, 3H8, and 1G5.
- variable region sequences, or portions thereof, of the anti- CD27 antibodies of the invention are modified to create structurally related anti-CD27 antibodies that retain binding (i.e., to the same epitope as the unmodified antibody) and, thus, are functionally equivalent.
- Methods for identifying residues that can be altered without removing antigen binding are well-known in the art (see, e.g., Marks et al.
- the CDR1, 2, and/or 3 regions of the engineered antibodies described above can comprise the exact amino acid sequence(s) as those of antibodies 1F5, 1H8, 3H12, 3A10, 2C2, 2G9, 3H8, and 1G5 disclosed herein.
- the antibodies comprise derivatives from the exact CDR sequences of 1F5, 1H8, 3H12, 3A10, 2C2, 2G9, 3H8, and 1G5 yet still retain the ability of to bind CD27 effectively.
- sequence modifications may include one or more amino acid additions, deletions, or substitutions, e.g., conservative sequence modifications as described above. Sequence modifications may also be based on the consensus sequences described above for the particular CDR1, CDR2, and CDR3 sequences of antibodies 1F5, 1H8, 3H12, 3A10, 2C2, 2G9, 3H8, and 1G5.
- the engineered antibody may be composed of one or more CDRs that are, for example, 90%, 95%, 98% or 99.5% identical to one or more CDRs of antibodies 1F5, 1H8, 3H12, 3A10, 2C2, 2G9, 3H8, and 1G5. Ranges intermediate to the above-recited values, e.g., CDRs that are 90-95%, 95-98%, or 98-100% identical identity to one or more of the above sequences are also intended to be encompassed by the present invention.
- one or more residues of a CDR may be altered to modify binding to achieve a more favored on-rate of binding, a more favored off -rate of binding, or both, such that an idealized binding constant is achieved.
- an antibody having ultra high binding affinity of, for example, 10 10 M "1 or more can be achieved.
- Affinity maturation techniques well known in the art and those described herein, can be used to alter the CDR region(s) followed by screening of the resultant binding molecules for the desired change in binding. Accordingly, as CDR(s) are altered, changes in binding affinity as well as immunogenicity can be monitored and scored such that an antibody optimized for the best combined binding and low immunogenicity are achieved.
- modifications can also be made within one or more of the framework regions, FR1, FR2, FR3 and FR4, of the heavy and/or the light chain variable regions of a antibody, so long as these modifications do not eliminate the binding affinity of the antibody.
- one or more non-germline amino acid residues in the framework regions of the heavy and/or the light chain variable region of a antibody of the invention is substituted with a germline amino acid residue, i.e., the corresponding amino acid residue in the human germline sequence for the heavy or the light chain variable region, which the antibody has significant sequence identity with.
- an antibody chain can be aligned to a germline antibody chain which it shares significant sequence identity with, and the amino acid residues which do not match between antibody framework sequence and the germline chain framework can be substituted with corresponding residues from the germline sequence.
- the antibody framework amino acid should usually be substituted by the equivalent human germline sequence amino acid if it is reasonably expected that the amino acid falls within one of the following categories:
- Residues which "noncovalently bind antigen directly" include amino acids in positions in framework regions which have a good probability of directly interacting with amino acids on the antigen according to established chemical forces, for example, by hydrogen bonding, Van der Waals forces, hydrophobic interactions, and the like.
- an amino acid residue in the framework region of a antibody of the invention is substituted with the corresponding germline amino acid residue which noncovalently binds antigen directly.
- Residues which are "adjacent to a CDR region" include amino acid residues in positions immediately adjacent to one or more of the CDRs in the primary sequence of the antibody, for example, in positions immediately adjacent to a CDR as defined by Kabat, or a
- an amino acid residue within the framework region of an antibody of the invention is substituted with a corresponding germline amino acid residue which is adjacent to a CDR region.
- Residues that "otherwise interact with a CDR region" include those that are determined by secondary structural analysis to be in a spatial orientation sufficient to affect a
- Such amino acids will generally have a side chain atom within about 3 angstrom units (A) of some atom in the CDRs and must contain an atom that could interact with the CDR atoms according to established chemical forces, such as those listed above. Accordingly, in one embodiment, an amino acid residue within the framework region of an antibody of the invention is substituted with the corresponding germline amino acid residue which otherwise interacts with a CDR region.
- the amino acids at several positions in the framework are known to be important for determining CDR confirmation (e.g., capable of interacting with the CDRs) in many antibodies (Chothia and Lesk, supra, Chothia et ah, supra and Tramontano et ah, J. Mol. Biol.
- the amino acids at positions 2, 48, 64 and 71 of the light chain and 26-30, 71 and 94 of the heavy chain are known to be capable of interacting with the CDRs in many antibodies.
- the amino acids at positions 35 in the light chain and 93 and 103 in the heavy chain are also likely to interact with the CDRs.
- Additional residues which may effect conformation of the CDRs can be identified according to the methodology of Foote and Winter (1992) /. Mol. Biol. 224:487. Such residues are termed "vernier" residues and are those residues in the framework region closely underlying (i.e., forming a "platform” under) the CDRs.
- Residues which "participate in the VL-VH interface" or "packing residues” include those residues at the interface between VL and VH as defined, for example, by Novotny and Haber, Proc. Natl. Acad. Sci. USA, 82:4592-66 (1985) or Chothia et al, supra.
- amino acids that are unusual or "rare" for an antibody at that position can be substituted with amino acids from the equivalent position of the human germline sequence or from the equivalent positions of more typical antibodies. For example, substitution may be desirable when the amino acid in a framework region of the antibody is rare for that position and the corresponding amino acid in the germline sequence is common for that position in immunoglobulin sequences; or when the amino acid in the antibody is rare for that position and the corresponding amino acid in the germline sequence is also rare, relative to other sequences. It is contemplated that by replacing an unusual amino acid with an amino acid from the germline sequence that happens to be typical for antibodies, the antibody may be made less immunogenic.
- IR indicates an amino acid occurring at that position in less than about 20%, preferably less than about 10%, more preferably less than about 5%, even more preferably less than about 3%, even more preferably less than about 2% and even more preferably less than about 1% of sequences in a representative sample of sequences
- common indicates an amino acid occurring in more than about 25% but usually more than about 50% of sequences in a representative sample.
- all light and heavy chain variable region sequences are respectively grouped into "subgroups" of sequences that are especially homologous to each other and have the same amino acids at certain critical positions (Kabat et ah, supra).
- framework regions of antibodies are usually substantially identical, and more usually, identical to the framework regions of the human germline sequences from which they were derived.
- many of the amino acids in the framework region make little or no direct contribution to the specificity or affinity of an antibody.
- many individual conservative substitutions of framework residues can be tolerated without appreciable change of the specificity or affinity of the resulting
- variable framework region of the antibody shares at least 85% sequence identity to a human germline variable framework region sequence or consensus of such sequences.
- variable framework region of the antibody shares at least 90%, 95%, 96%, 97%, 98% or 99% sequence identity to a human germline variable framework region sequence or consensus of such sequences.
- an antibody may be selected for its retention of other functional properties of antibodies of the invention, such as, for example: (1) inhibits ⁇ e.g., completely or partially blocks) binding of CD70 to CD27 expressing cells by at least about 70%; (2) binds to human CD27 with an equilibrium dissociation constant Kd of 10 ⁇ 9 M or less, or alternatively, an equilibrium association constant Ka of 10 +9 M "1 or greater ;
- Monoclonal antibodies of the invention can be characterized for binding to CD27 using a variety of known techniques. Generally, the antibodies are initially
- microtiter plates can be coated with purified CD27 in PBS, and then blocked with irrelevant proteins such as bovine serum albumin (BSA) diluted in PBS. Dilutions of plasma from CD27 -immunized mice are added to each well and incubated for 1-2 hours at 37°C. The plates are washed with PBS/Tween 20 and then incubated with a goat-anti-human IgG Fc-specific polyclonal reagent conjugated to alkaline phosphatase for 1 hour at 37°C. After washing, the plates are developed with ABTS substrate, and analyzed at OD of 405. Preferably, mice which develop the highest titers will be used for fusions.
- BSA bovine serum albumin
- An ELISA assay as described above can be used to screen for antibodies and, thus, hybridomas that produce antibodies that show positive reactivity with the CD27 immunogen.
- Hybridomas that bind, preferably with high affinity, to CD27 can then be subcloned and further characterized.
- One clone from each hybridoma, which retains the reactivity of the parent cells (by ELISA), can then be chosen for making a cell bank, and for antibody purification.
- selected hybridomas can be grown in roller bottles, two-liter spinner-flasks or other culture systems. Supernatants can be filtered and concentrated before affinity chromatography with protein A-Sepharose (Pharmacia,
- the concentration can be determined by OD 2 8o using 1.43 extinction coefficient or preferably by nephelometric analysis.
- IgG can be checked by gel electrophoresis and by antigen specific method.
- each antibody can be biotinylated using commercially available reagents (Pierce, Rockford, IL). Biotinylated MAb binding can be detected with a streptavidin labeled probe.
- isotype ELISAs can be performed using art recognized techniques. For example, wells of microtiter plates can be coated with 10 g/ml of anti- Ig overnight at 4°C. After blocking with 5% BSA, the plates are reacted with 10 ⁇ g/ml of monoclonal antibodies or purified isotype controls, at ambient temperature for two hours. The wells can then be reacted with either IgGl or other isotype specific conjugated probes. Plates are developed and analyzed as described above.
- flow cytometry can be used. Briefly, cell lines and/or human PBMCs expressing membrane- bound CD27 (grown under standard growth conditions) are mixed with various
- Anti-CD27 IgGs can be further tested for reactivity with the CD27 antigen by Western blotting. Briefly, cell extracts from cells expressing CD27 can be prepared and subjected to sodium dodecyl sulfate polyacrylamide gel electrophoresis. After
- the separated antigens will be transferred to nitrocellulose membranes, blocked with 20% mouse serum, and probed with the monoclonal antibodies to be tested.
- IgG binding can be detected using anti- IgG alkaline phosphatase and developed with
- BCIP/NBT substrate tablets (Sigma Chem. Co., St. Louis, MO).
- the antibodies of the present invention are linked to a therapeutic moiety, such as a cytotoxin, a drug or a radioisotope.
- a therapeutic moiety such as a cytotoxin, a drug or a radioisotope.
- these antibody conjugates are referred to as "immunotoxins.”
- a cytotoxin or cytotoxic agent includes any agent that is detrimental to (e.g. , kills) cells.
- Examples include taxol, cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicin, doxorubicin, daunorubicin, dihydroxy anthracin dione, mitoxantrone, mithramycin, actinomycin D, 1-dehydrotestosterone, glucocorticoids, procaine, tetracaine, lidocaine, propranolol, and puromycin and analogs or homologs thereof.
- Therapeutic agents include, but are not limited to, antimetabolites (e.g.
- alkylating agents e.g., mechlorethamine, thioepa chlorambucil, melphalan, carmustine (BSNU) and lomustine (CCNU)
- cyclothosphamide busulfan, dibromomannitol
- an antibody of the present invention can be conjugated to a radioisotope, e.g. , radioactive iodine, to generate cytotoxic radiopharmaceuticals for treating a dendritic-related disorder, such as an autoimmune or inflammatory disease, or graft versus host disease.
- a radioisotope e.g. , radioactive iodine
- the antibody conjugates of the invention can be used to modify a given biological response, and the drug moiety is not to be construed as limited to classical chemical therapeutic agents.
- the drug moiety may be a protein or polypeptide possessing a desired biological activity.
- proteins may include, for example, an enzymatically active toxin, or active fragment thereof, such as abrin, ricin A, pseudomonas exotoxin, or diphtheria toxin; a protein such as tumor necrosis factor or interferon- ⁇ ; or, biological response modifiers such as, for example, lymphokines, interleukin-1 ("IL-1 "), interleukin-2 ("IL-2”), interleukin-6 (“IL-6”), granulocyte macrophage colony stimulating factor (“GM-CSF”), granulocyte colony stimulating factor (“G-CSF”), or other growth factors.
- IL-1 interleukin-1
- IL-2 interleukin-2
- IL-6 interleukin-6
- the present invention provides a composition, e.g. , a composition, containing one or a combination of monoclonal antibodies of the present invention, formulated together with a carrier (e.g., a pharmaceutically acceptable carrier).
- a carrier e.g., a pharmaceutically acceptable carrier
- compositions containing bispecific molecules which comprise an antibody of the present invention are also provided.
- the compositions include a combination of multiple (e.g. , two or more) isolated antibodies of the invention.
- each of the antibodies of the composition binds to a distinct, pre-selected epitope of CD27.
- compositions of the invention also can be administered in combination therapy, i.e. , combined with other agents.
- the combination therapy can include a composition of the present invention with at least one or more additional therapeutic agents, such as anti-inflammatory agents, DMARDs (disease-modifying antirheumatic drugs), immunosuppressive agents, and chemo therapeutics.
- additional therapeutic agents such as anti-inflammatory agents, DMARDs (disease-modifying antirheumatic drugs), immunosuppressive agents, and chemo therapeutics.
- the pharmaceutical compositions of the invention can also be administered in conjunction with radiation therapy. Co-administration with other antibodies is also encompassed by the invention.
- the terms “carrier” and “pharmaceutically acceptable carrier” includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible.
- the carrier is suitable for intravenous, intramuscular, subcutaneous, parenteral, spinal or epidermal administration (e.g., by injection or infusion).
- the active compound i.e., antibody, bispecific and multispecific molecule, may be coated in a material to protect the compound from the action of acids and other natural conditions that may inactivate the compound.
- adjuvants which may be used with the antibodies and constructs of the present invention include: Freund's Incomplete Adjuvant and Complete Adjuvant (Difco Laboratories, Detroit, Mich.); Merck Adjuvant 65 (Merck and Company, Inc., Rahway, N.J.); AS-2 (SmithKline Beecham, Philadelphia, Pa.); aluminum salts such as aluminum hydroxide gel (alum) or aluminum phosphate; salts of calcium, iron or zinc; an insoluble suspension of acylated tyrosine; acylated sugars; cationically or anionically derivatised polysaccharides; polyphosphazenes; biodegradable microspheres; cytokines, such as GM-CSF, interleukin-2, -7, -12, and other like factors; 3D-MPL; CpG oligonucleotide; and monophosphoryl lipid A, for example 3-de-O-acylated monophosphoryl lipid A.
- MPL adjuvants are available from Corixa Corporation (Seattle, Wash; see, for example, U.S. Pat. Nos. 4,436,727; 4,877,611; 4,866,034 and 4,912,094).
- CpG-containing oligonucleotides in which the CpG dinucleotide is unmethylated
- Immunostimulatory DNA sequences are also described, for example, by Sato et al., Science 273:352, 1996.
- adjuvants include, for example, saponins, such as Quil A, or derivatives thereof, including QS21 and QS7 (Aquila Biopharmaceuticals Inc.,
- cytokine, chemokine and co- stimulatory molecules as either protein or peptide, including for example pro-inflammatory cytokines such as Interferon, GM-CSF, IL-1 alpha, IL-1 beta, TGF-alpha and TGF-beta, Thl inducers such as interferon gamma, IL-2, IL-12, IL-15, IL-18 and IL-21, Th2 inducers such as IL-4, IL-5, IL-6, IL-10 and IL-13 and other chemokine and co- stimulatory genes such as MCP-1, MIP-1 alpha, MIP-1 beta, RANTES, TCA-3, CD80, CD86 and CD40L; immunostimulatory agents targeting ligands such as CTLA-4 and L-selectin, apoptosis stimulating proteins and peptides such as Fas; synthetic lipid based adjuvants, such as vaxfectin, (Reyes), Interferon, GM-CSF, IL-1 alpha
- TLR Toll-like Receptor
- a “pharmaceutically acceptable salt” refers to a salt that retains the desired biological activity of the parent compound and does not impart any undesired toxicological effects (see e.g., Berge, S.M., et al. (1977) J. Pharm. Sci. 66: 1-19).
- Examples of such salts include acid addition salts and base addition salts.
- Acid addition salts include those derived from nontoxic inorganic acids, such as hydrochloric, nitric, phosphoric, sulfuric,
- Base addition salts include those derived from alkaline earth metals, such as sodium, potassium, magnesium, calcium and the like, as well as from nontoxic organic amines, such as ⁇ , ⁇ '- dibenzylethylenediamine, N-methylglucamine, chloroprocaine, choline, diethanolamine, ethylenediamine, procaine and the like.
- composition of the present invention can be administered by a variety of methods known in the art. As will be appreciated by the skilled artisan, the route and/or mode of administration will vary depending upon the desired results.
- the active compounds can be prepared with carriers that will protect the compound against rapid release, such as a controlled release formulation, including implants, transdermal patches, and
- Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Many methods for the preparation of such formulations are patented or generally known to those skilled in the art. See, e.g., Sustained and Controlled Release Drug Delivery Systems, J.R. Robinson, ed., Marcel Dekker, Inc., New York, 1978.
- the compound may be administered to a subject in an appropriate carrier, for example, liposomes, or a diluent.
- an appropriate carrier for example, liposomes, or a diluent.
- Acceptable diluents include saline and aqueous buffer solutions.
- Liposomes include water-in-oil-in-water CGF emulsions as well as conventional liposomes (Strejan et al. (1984) J. Neuroimmunol. 7:27).
- Carriers include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion.
- the use of such media and agents for pharmaceutically active substances is known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the pharmaceutical compositions of the invention is contemplated. Supplementary active compounds can also be incorporated into the compositions.
- compositions typically must be sterile and stable under the conditions of manufacture and storage.
- the composition can be formulated as a solution, microemulsion, liposome, or other ordered structure suitable to high drug concentration.
- the carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof.
- the proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
- isotonic agents for example, sugars, polyalcohols such as mannitol, sorbitol, or sodium chloride in the composition.
- Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent that delays absorption, for example, monostearate salts and gelatin.
- Sterile injectable solutions can be prepared by incorporating the active compound in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by sterilization microfiltration.
- dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above.
- a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above.
- the preferred methods of preparation are vacuum drying and freeze-drying
- Dosage regimens are adjusted to provide the optimum desired response ⁇ e.g., a therapeutic response). For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation.
- the antibodies of the invention may be administered once or twice weekly by subcutaneous or intramuscular injection or once or twice monthly by subcutaneous or intramuscular injection.
- Dosage unit form refers to physically discrete units suited as unitary dosages for the subjects to be treated; each unit contains a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier.
- the specification for the dosage unit forms of the invention are dictated by and directly dependent on (a) the unique characteristics of the active compound and the particular therapeutic effect to be achieved, and (b) the limitations inherent in the art of compounding such an active compound for the treatment of sensitivity in individuals.
- antioxidants examples include: (1) water soluble antioxidants, such as ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite and the like; (2) oil-soluble antioxidants, such as ascorbyl palmitate, butylated hydroxyanisole (BHA), butylated hydroxytoluene (BHT), lecithin, propyl gallate, alpha-tocopherol, and the like; and (3) metal chelating agents, such as citric acid, ethylenediamine tetraacetic acid (EDTA), sorbitol, tartaric acid, phosphoric acid, and the like.
- water soluble antioxidants such as ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite and the like
- oil-soluble antioxidants such as ascorbyl palmitate, butylated hydroxyanisole (BHA), butylated hydroxytoluene (BHT), le
- formulations of the present invention include those suitable for oral, nasal, topical (including buccal and sublingual), rectal, vaginal and/or parenteral administration.
- the formulations may conveniently be presented in unit dosage form and may be prepared by any methods known in the art of pharmacy.
- the amount of active ingredient which can be combined with a carrier material to produce a single dosage form will vary depending upon the subject being treated, and the particular mode of administration.
- the amount of active ingredient which can be combined with a carrier material to produce a single dosage form will generally be that amount of the composition which produces a therapeutic effect. Generally, out of one hundred per cent, this amount will range from about 0.001 per cent to about ninety percent of active ingredient, preferably from about 0.005 per cent to about 70 per cent, most preferably from about 0.01 per cent to about 30 per cent.
- Formulations of the present invention which are suitable for vaginal administration also include pessaries, tampons, creams, gels, pastes, foams or spray formulations containing such carriers as are known in the art to be appropriate.
- Dosage forms for the topical or transdermal administration of compositions of this invention include powders, sprays, ointments, pastes, creams, lotions, gels, solutions, patches and inhalants.
- the active compound may be mixed under sterile conditions with a pharmaceutically acceptable carrier, and with any preservatives, buffers, or propellants which may be required.
- parenteral administration and “administered parenterally” as used herein means modes of administration other than enteral and topical administration, usually by injection, and includes, without limitation, intravenous, intramuscular,
- aqueous and nonaqueous carriers examples include water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as ethyl oleate.
- polyols such as glycerol, propylene glycol, polyethylene glycol, and the like
- vegetable oils such as olive oil
- injectable organic esters such as ethyl oleate.
- Proper fluidity can be maintained, for example, by the use of coating materials, such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants.
- compositions may also contain adjuvants such as preservatives, wetting agents, emulsifying agents and dispersing agents. Prevention of presence of microorganisms may be ensured both by sterilization procedures, supra, and by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutanol, phenol sorbic acid, and the like. It may also be desirable to include isotonic agents, such as sugars, sodium chloride, and the like into the compositions. In addition, prolonged absorption of the injectable pharmaceutical form may be brought about by the inclusion of agents which delay absorption such as aluminum monostearate and gelatin.
- the compounds of the present invention are administered as pharmaceuticals, to humans and animals, they can be given alone or as a pharmaceutical composition containing, for example, 0.001 to 90% (more preferably, 0.005 to 70%, such as 0.01 to 30%) of active ingredient in combination with a pharmaceutically acceptable carrier.
- the compounds of the present invention which may be used in a suitable hydrated form, and/or the pharmaceutical compositions of the present invention, are formulated into pharmaceutically acceptable dosage forms by conventional methods known to those of skill in the art.
- Actual dosage levels of the active ingredients in the pharmaceutical compositions of the present invention may be varied so as to obtain an amount of the active ingredient which is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, without being toxic to the patient.
- the selected dosage level will depend upon a variety of pharmacokinetic factors including the activity of the particular compositions of the present invention employed, or the ester, salt or amide thereof, the route of administration, the time of administration, the rate of excretion of the particular compound being employed, the duration of the treatment, other drugs, compounds and/or materials used in combination with the particular compositions employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors well known in the medical arts.
- a physician or veterinarian having ordinary skill in the art can readily determine and prescribe the effective amount of the pharmaceutical composition required.
- a suitable daily dose of a composition of the invention will be that amount of the compound which is the lowest dose effective to produce a therapeutic effect.
- Such an effective dose will generally depend upon the factors described above. It is preferred that administration be intravenous, intramuscular, intraperitoneal, or subcutaneous, preferably administered proximal to the site of the target.
- the effective daily dose of a therapeutic composition may be administered as two, three, four, five, six or more sub-doses administered separately at appropriate intervals throughout the day, optionally, in unit dosage forms. While it is possible for a compound of the present invention to be administered alone, it is preferable to administer the compound as a pharmaceutical formulation (composition).
- compositions can be administered with medical devices known in the art.
- a therapeutic composition of the invention can be administered with a needleless hypodermic injection device, such as the devices disclosed in U.S. Patent Nos. 5,399,163, 5,383,851, 5,312,335, 5,064,413, 4,941,880, 4,790,824, or 4,596,556.
- a needleless hypodermic injection device such as the devices disclosed in U.S. Patent Nos. 5,399,163, 5,383,851, 5,312,335, 5,064,413, 4,941,880, 4,790,824, or 4,596,556.
- Examples of well-known implants and modules useful in the present invention include: U.S. Patent No. 4,487,603, which discloses an implantable micro- infusion pump for dispensing medication at a controlled rate; U.S. Patent No. 4. ,486, 194, which discloses a therapeutic device for administering medicants through the skin; U.S. Patent No.
- the antibodies of the invention can be formulated to ensure proper distribution in vivo.
- the blood-brain barrier excludes many highly hydrophilic compounds.
- the therapeutic compounds of the invention cross the BBB (if desired)
- they can be formulated, for example, in liposomes.
- liposomes For methods of manufacturing liposomes, see, e.g., U.S. Patents 4,522,811; 5,374,548; and 5,399,331.
- the liposomes may comprise one or more moieties which are selectively transported into specific cells or organs, thus enhance targeted drug delivery (see, e.g., V.V. Ranade (1989) J. Clin. Pharmacol. 29:685).
- Exemplary targeting moieties include folate or biotin (see, e.g., U.S. Patent 5,416,016 to Low et ah); mannosides (Umezawa et ah, (1988) Biochem. Biophys. Res. Commun. 153: 1038); antibodies (P.G. Bloeman et al. (1995) FEBS Lett. 357: 140; M. Owais et al. (1995) Antimicrob. Agents Chemother. 39: 180); surfactant protein A receptor (Briscoe et al. (1995) Am. J. Physiol. 1233: 134), different species of which may comprise the formulations of the inventions, as well as components of the invented molecules; pl20 (Schreier et al. (1994) J. Biol. Chem. 269:9090); see also K.
- the therapeutic compounds of the invention are formulated in liposomes; in a more preferred embodiment, the liposomes include a targeting moiety.
- the therapeutic compounds in the liposomes are delivered by bolus injection to a site proximal to the tumor or infection.
- the composition must be fluid to the extent that easy syringability exists. It must be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms such as bacteria and fungi.
- the ability of a compound to inhibit cancer can be evaluated in an animal model system predictive of efficacy in human tumors.
- this property of a composition can be evaluated by examining the ability of the compound to inhibit, such inhibition in vitro by assays known to the skilled practitioner.
- a therapeutically effective amount of a therapeutic compound can decrease tumor size, or otherwise ameliorate symptoms in a subject.
- One of ordinary skill in the art would be able to determine such amounts based on such factors as the subject's size, the severity of the subject's symptoms, and the particular composition or route of administration selected.
- the composition must be sterile and fluid to the extent that the composition is deliverable by syringe.
- the carrier can be an isotonic buffered saline solution, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyetheylene glycol, and the like), and suitable mixtures thereof. Proper fluidity can be maintained, for example, by use of coating such as lecithin, by maintenance of required particle size in the case of dispersion and by use of surfactants.
- isotonic agents for example, sugars, polyalcohols such as mannitol or sorbitol, and sodium chloride in the composition. Long-term absorption of the injectable compositions can be brought about by including in the composition an agent which delays absorption, for example, aluminum monostearate or gelatin.
- the compound When the active compound is suitably protected, as described above, the compound may be orally administered, for example, with an inert diluent or an assimilable edible carrier.
- the antibodies, bispecific molecules, and compositions of the present invention can be used to treat and/or prevent (e.g. , immunize against) a variety of diseases and conditions.
- cancer One of the primary disease indications that can be treated is cancer.
- an anti-CD27 antibody that induces or enhances an immune response can be used in the treatment of cancer.
- Types of cancers include, but are not limited to, leukemia, acute lymphocytic leukemia, acute myelocytic leukemia, myeloblasts promyelocyte
- (granulocytic) leukemia chronic lymphocytic leukemia, mantle cell lymphoma, primary central nervous system lymphoma, Burkitt's lymphoma and marginal zone B cell lymphoma, Polycythemia vera Lymphoma, Hodgkin's disease, non-Hodgkin' s disease, multiple myeloma, Waldenstrom's macroglobulinemia, heavy chain disease, solid tumors, sarcomas, and carcinomas, fibrosarcoma, myxosarcoma, liposarcoma, chrondrosarcoma, osteogenic sarcoma, osteosarcoma, chordoma, angiosarcoma, endotheliosarcoma, lymphangiosarcoma, lymphangioendotheliosarcoma, synovioma, mesothelioma, Ewing's tumor, leiomyosarcoma, rhabdomyosarcoma,
- adenocarcinoma sweat gland carcinoma, sebaceous gland carcinoma, papillary carcinoma, papillary adenocarcinomas, cystadenocarcinoma, medullary carcinoma, bronchogenic carcinoma, renal cell carcinoma, hepatoma, bile duct carcinoma, choriocarcinoma, seminoma, embryonal carcinoma, Wilm's tumor, cervical cancer, uterine cancer, testicular tumor, lung carcinoma, small cell lung carcinoma, non small cell lung carcinoma, bladder carcinoma, epithelial carcinoma, glioma, astrocytoma, medulloblastoma, craniopharyngioma, ependymoma, pinealoma, hemangioblastoma, acoustic neuroma, oligodendroglioma, menangioma, melanoma, neuroblastoma, retinoblastoma, nasopharyngeal carcinoma, esophageal carcinoma, bas
- Preferred cancers include CD27-expressing tumors selected from the group consisting of chronic lymphocytic leukemia, mantle cell lymphoma, primary central nervous system lymphoma, Burkitt's lymphoma and marginal zone B cell lymphoma.
- disease indications for use of an anti-CD27 antibody that induces or enhances an immune response include bacterial, fungal, viral and parasitic infectious diseases.
- Other disease indications for use of an anti-CD27 antibody that inhibits or reduces an immune response include graft rejection, allergy and autoimmune diseases.
- Exemplary autoimmune diseases include, but are not limited to, multiple sclerosis, rheumatoid arthritis, type 1 diabetes, psoriasis, Crohn's disease and other inflammatory bowel diseases such as ulcerative colitis, systemic lupus eythematosus (SLE), autoimmune encephalomyelitis, myasthenia gravis (MG), Hashimoto's thyroiditis,
- Goodpasture's syndrome pemphigus, Graves disease, autoimmune hemolytic anemia, autoimmune thrombocytopenic purpura, scleroderma with anti- collagen antibodies, mixed connective tissue disease, polypyositis, pernicious anemia, idiopathic Addison's disease, autoimmune associated infertility, glomerulonephritis, crescentic glomerulonephritis, proliferative glomerulonephritis, bullous pemphigoid, Sjogren's syndrome, psoriatic arthritis, insulin resistance, autoimmune diabetes mellitus, autoimmune hepatitis, autoimmune hemophilia, autoimmune lymphoproliferative syndrome (ALPS), autoimmune hepatitis, autoimmune hemophilia, autoimmune lymphoproliferative syndrome, autoimmune uveoretinitis, Guillain-Bare syndrome, arteriosclerosis and Alzheimer's disease.
- APS autoimmune lymphoproliferative syndrome
- Exemplary allergic disorders include, but are not limited to allergic conjunctivitis, vernal conjunctivitis, vernal keratoconjunctivitis, and giant papillary conjunctivitis; nasal allergic disorders, including allergic rhinitis and sinusitis; otic allergic disorders, including eustachian tube itching; allergic disorders of the upper and lower airways, including intrinsic and extrinsic asthma; allergic disorders of the skin, including dermatitis, eczema and urticaria; and allergic disorders of the gastrointestinal tract.
- an antibody of the invention is administered in combination with a vaccine, to enhance the immune response against the vaccine antigen, for example a tumor antigen (to thereby enhance the immune response against the tumor) or an antigen from an infectious disease pathogen (to thereby enhance the immune response against the infectious disease pathogen).
- a vaccine antigen can comprise, for example, an antigen or antigenic composition capable of eliciting an immune response against a tumor or against an infectious disease pathogen such as a virus, a bacteria, a parasite or a fungus.
- the antigen or antigens can be, for example, peptides/proteins, polysaccharides and/or lipids.
- the antigen or antigens be derived from tumors, such as the various tumor antigens previously disclosed herein.
- the antigen or antigens can be derived from pathogens such as viruses, bacteria, parasites and/or fungi, such as the various pathogen antigens previously disclosed herein. Additional examples of suitable pathogen antigens include, but are not limited to, the following:
- Viral antigens or antigenic determinants can be derived from, for example,: Cytomegalovirus (especially Human, such as gB or derivatives thereof); Epstein Barr virus (such as gp350); flaviviruses (e.g. Yellow Fever Virus, Dengue Virus, Tick-borne
- hepatitis virus such as hepatitis B virus (for example Hepatitis B Surface antigen such as the PreSl, PreS2 and S antigens described in EP- A-414 374; EP-A-0304 578, and EP- A- 198474), hepatitis A virus, hepatitis C virus and hepatitis E virus; HrV-l, (such as tat, nef, gpl20 or gpl60); human herpes viruses, such as gD or derivatives thereof or Immediate Early protein such as ICP27 from HSV1 or HSV2; human papilloma viruses (for example HPV6, 11, 16, 18); Influenza virus (whole live or inactivated virus, split influenza virus, grown in eggs or MDCK cells, or Vero cells or whole flu virosomes (as described by Gluck, Vaccine, 1992,10, 915-920) or purified or recombin
- parainfluenza virus parainfluenza virus; rabies virus; Respiratory Syncytial virus (such as F and G proteins); rotavirus (including live attenuated viruses); smallpox virus; Varicella Zoster Virus (such as gpl, II and IE63); and the HPV viruses responsible for cervical cancer (for example the early proteins E6 or E7 in fusion with a protein D carrier to form Protein D-E6 or E7 fusions from HPV 16, or combinations thereof; or combinations of E6 or E7 with L2 (see for example WO 96/26277).
- Respiratory Syncytial virus such as F and G proteins
- rotavirus including live attenuated viruses
- smallpox virus smallpox virus
- Varicella Zoster Virus such as gpl, II and IE63
- HPV viruses responsible for cervical cancer for example the early proteins E6 or E7 in fusion with a protein D carrier to form Protein D-E6 or E7 fusions from HPV 16,
- Bacterial antigens or antigenic determinants can be derived from, for example,: Bacillus spp., including B. anthracis (eg botulinum toxin); Bordetella spp, including B.
- pertussis for example pertactin, pertussis toxin, filamenteous hemagglutinin, adenylate cyclase, fimbriae
- Borrelia spp. including B. burgdorferi (eg OspA, OspC, DbpA, DbpB), B. garinii (eg OspA, OspC, DbpA, DbpB), B. afzelii (eg OspA, OspC, DbpA, DbpB), B.
- Corynebacterium spp. including C. diphtheriae (eg diphtheria toxin); Ehrlichia spp., including E. equi and the agent of the Human Granulocytic Ehrlichiosis; Rickettsia spp, including R.rickettsii; Enterococcus spp., including E. faecalis, E. faecium; Escherichia spp, including enterotoxic E. coli (for example colonization factors, heat-labile toxin or derivatives thereof, or heat-stable toxin), enterohemorragic E. coli, enteropathogenic E.
- C. diphtheriae eg diphtheria toxin
- Ehrlichia spp. including E. equi and the agent of the Human Granulocytic Ehrlichiosis
- Rickettsia spp including R.rickettsii
- Haemophilus spp. including H. influenzae type B (eg PRP), non-typable H. influenzae, for example OMP26, high molecular weight adhesins, P5, P6, protein D and lipoprotein D, and fimbrin and fimbrin derived peptides (see for example US 5,843,464); Helicobacter spp, including H. pylori (for example urease, catalase, vacuolating toxin); Pseudomonas spp, including P. aeruginosa; Legionella spp, including L. pneumophila ; Leptospira spp., including L. interrogans; Listeria spp., including L.
- Moraxella spp including M catarrhalis, also known as Branhamella catarrhalis (for example high and low molecular weight adhesins and invasins); Morexella Catarrhalis (including outer membrane vesicles thereof, and OMP106 (see for example W097/41731)); Mycobacterium spp., including M. tuberculosis (for example ESAT6, Antigen 85A, -B or -C), M. bovis, M. leprae, M. avium, M. paratuberculosis, M. smegmatis; Neisseria spp, including N. gonorrhea and N. meningitidis (for example capsular
- Neisseria mengitidis B including outer membrane vesicles thereof, and NspA (see for example WO 96/29412); Salmonella spp, including S. typhi, S. paratyphi, S. choleraesuis, S. enteritidis; Shigella spp, including S. sonnei, S. dysenteriae, S. flexnerii; Staphylococcus spp., including S. aureus, S. epidermidis; Streptococcus spp, including S.
- pneumonie eg capsular polysaccharides and conjugates thereof, PsaA, PspA, streptolysin, choline-binding proteins
- PsaA capsular polysaccharides and conjugates thereof, PsaA, PspA, streptolysin, choline-binding proteins
- Pneumolysin Biochem Biophys Acta, 1989,67,1007; Rubins et al, Microbial Pathogenesis, 25,337-342
- mutant detoxified derivatives thereof see for example WO 90/06951; WO 99/03884
- Treponema spp. including T. pallidum (eg the outer membrane proteins), T. denticola, T. hyodysenteriae
- Vibrio spp including V. cholera (for example cholera toxin)
- Yersinia spp including Y. enterocolitica (for example a Yop protein), Y. pestis, Y.
- Parasitic/fungal antigens or antigenic determinants can be derived from, for example,: Babesia spp., including B. microti; Candida spp., including C. albicans;
- Cryptococcus spp. including C. neoformans; Entamoeba spp., including E. histolytica;
- Giardia spp. including ;G. lamblia; Leshmania spp., including L. major; Plasmodium.
- Schisostoma spp. including S. mansoni; Trichomonas spp., including T. vaginalis;
- Toxoplasma spp. including T. gondii (for example SAG2, SAG3, Tg34); Trypanosoma spp., including T. cruzi.
- T. gondii for example SAG2, SAG3, Tg34
- Trypanosoma spp. including T. cruzi.
- antigens and antigenic determinants can be used in many different forms.
- antigens or antigenic determinants can be present as isolated proteins or peptides (for example in so-called "subunit vaccines") or, for example, as cell-associated or virus- associated antigens or antigenic determinants (for example in either live or killed pathogen strains). Live pathogens will preferably be attenuated in known manner.
- antigens or antigenic determinants may be generated in situ in the subject by use of a polynucleotide coding for an antigen or antigenic determinant (as in so-called "DNA vaccination"), although it will be appreciated that the polynucleotides which can be used with this approach are not limited to DNA, and may also include RNA and modified
- a vaccine antigen can also be targeted, for example to particular cell types or to particular tissues.
- the vaccine antigen can be targeted to Antigen Presenting Cells (APCs), for example by use of agents such as antibodies targeted to APC-surface receptors such as DEC-205, for example as discussed in WO 2009/061996 (Celldex Therapeutics, Inc), or the Mannose Receptor (CD206) for example as discussed in WO 03040169 (Medarex, Inc.).
- APCs Antigen Presenting Cells
- agents such as antibodies targeted to APC-surface receptors such as DEC-205, for example as discussed in WO 2009/061996 (Celldex Therapeutics, Inc), or the Mannose Receptor (CD206) for example as discussed in WO 03040169 (Medarex, Inc.).
- the antibodies of the invention can be administered to a subject directly (i.e. , in vivo), either alone or with other therapies such as an
- immuno stimulatory agent a vaccine, chemotherapy or radiation therapy.
- the antibodies, bispecifics, compositions, and immunostimulatory agents and other therapies are administered in an effective amount to exert their desired therapeutic effect.
- an effective amount refers to that amount necessary or sufficient to realize a desired biologic effect.
- an effective amount could be that amount necessary to eliminate a tumor, cancer, or bacterial, viral or fungal infection.
- the effective amount for any particular application can vary depending on such factors as the disease or condition being treated, the particular antibody being administered, the size of the subject, or the severity of the disease or condition.
- One of ordinary skill in the art can empirically determine the effective amount of a particular molecule without necessitating undue experimentation.
- Preferred routes of administration for vaccines include, for example, injection (e.g. , subcutaneous, intravenous, parenteral, intraperitoneal, intrathecal).
- the injection can be in a bolus or a continuous infusion.
- Other routes of administration include oral
- Antibodies and bispecific molecules of the invention also can be coadministered with adjuvants and other therapeutic agents.
- coadministered includes any or all of simultaneous, separate, or sequential administration of the antibodies and conjugates of the present invention with adjuvants and other agents, including administration as part of a dosing regimen.
- the antibodies are typically formulated in a carrier alone or in combination with such agents. Examples of such carriers include solutions, solvents, dispersion media, delay agents, emulsions and the like. The use of such media for pharmaceutically active substances is well known in the art. Any other conventional carrier suitable for use with the molecules falls within the scope of the instant invention.
- Suitable agents for co-administration with the antibodies, conjugates, bispecifics, and compositions include other antibodies, cytotoxins and/or drugs, as well as adjuvants, immunostimulatory agents and/or immunosuppressive agents.
- the agent is a chemotherapeutic agent.
- the antibodies, bispecifics, and compositions can be administered in combination with radiation.
- Chemotherapeutic agents suitable for coadministration with the antibodies and conjugates of the present invention in the treatment of tumors include, for example: taxol, cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicin, doxorubicin, daunorubicin, dihydroxy anthracin dione, mitoxantrone, mithramycin, actinomycin D, 1-dehydrotestosterone, glucocorticoids, procaine, tetracaine, lidocaine, propranolol, and puromycin and analogs or homologs thereof.
- agents include, for example, antimetabolites (e.g. , methotrexate, 6-mercaptopurine, 6- thioguanine, cytarabine, 5-fluorouracil decarbazine), alkylating agents (e.g. ,
- anthracyclines e.g. , daunorubicin (formerly daunomycin) and doxorubicin
- antibiotics e.g. , dactin
- agents that delete or inhibit immunosuppressive activities for example, by immune cells (for example regulatory T-cells, NKT cells, macrophages, myeloid-derived suppressor cells, immature or suppressive dendritic cells) or suppressive factors produced by the tumor or host cells in the local microenvironment of the tumor (for example, TGFbeta, indoleamine 2,3 dioxygenase - IDO), may also be administered with the antibodies and conjugates of the present invention.
- immune cells for example regulatory T-cells, NKT cells, macrophages, myeloid-derived suppressor cells, immature or suppressive dendritic cells
- suppressive factors produced by the tumor or host cells in the local microenvironment of the tumor for example, TGFbeta, indoleamine 2,3 dioxygenase - IDO
- Such agents include antibodies and small molecule drugs such as IDO inhibitors such as 1 methyl tryptophan or derivatives.
- Suitable agents for coadministration with the antibodies and bispecifics of the present invention for treatment of such immune disorders include for example,
- immunosuppressive agents such as rapamycin, cyclosporin and FK506; anti-TNFa agents such as etanercept, adalimumab and infliximab; and steroids.
- specific natural and synthetic steroids include, for example: aldosterone, beclomethasone, betamethasone, budesonide, cloprednol, cortisone, cortivazol, deoxycortone, desonide, desoximetasone, dexamethasone, difluorocortolone, fluclorolone, flumethasone, flunisolide, fluocinolone, fluocinonide, fluocortin butyl, fluorocortisone, fluorocortolone, fluorometholone, flurandrenolone, fluticasone, halcinonide, hydrocortisone, icomethasone, meprednisone, methylprednisolone, paramethasone,
- Suitable agents for coadministration with the antibodies and bispecifics of the present invention for inducement or enhancement of an immune response include, for example, adjuvants and/or immuno stimulatory agents, non-limiting examples of which have been disclosed hereinbefore.
- a preferred immunostimulatory agent is a TLR3 agonist, such as Poly IC.
- Human anti-CD27 monoclonal antibodies were generated by immunizing the
- HC2/KCo7 strain of HuMAb® transgenic mice (“HuMAb” is a Trade Mark of Medarex, Inc., Princeton, New Jersey) with a soluble human CD27 antigen.
- HuMAb is a Trade Mark of Medarex, Inc., Princeton, New Jersey
- HC2/KCo7 HuMAb mice were generated as described in U.S. Pat. Nos. 5,770,429 and 5,545,806, the entire disclosures of which are hereby incorporated by reference.
- the antigen was a soluble fusion protein comprising a CD27 extracellular domain fused with an antibody Fc domain (recombinant human CD27-Fc chimeric protein (R&D Systems).
- the antigen was mixed with Complete Freund' s (Sigma) adjuvant for the first immunization. Thereafter, the antigen was mixed with Incomplete Freund' s (Sigma). Additional mice were immunized with the soluble CD27 protein in RIBI MPL plus TDM adjuvant system (Sigma). 5-25 micrograms soluble recombinant CD27 antigen in PBS or 5 x 10 6 CHO cells transfected for surface expression of human CD27 in PBS were mixed 1: 1 with the adjuvant.
- mice were injected with 100 microliters of the prepared antigen into the peritoneal cavity every 14 days. Animals that developed anti-CD27 titers were given an iv injection of 10 micrograms soluble recombinant CD27 antigen three to four days prior to fusion. Mouse spleens were harvested, and the isolated splenocytes used for hybridoma preparation.
- Hybridoma Preparation The P3x63Ag8.653 murine myeloma cell line (ATCC CRL 1580) was used for the fusions. RPMI 1640 (Invitrogen) containing 10% FBS, and was used to culture the myeloma cells. Additional media supplements were added to the P3x63Ag8.653 murine myeloma cell line (ATCC CRL 1580) was used for the fusions. RPMI 1640 (Invitrogen) containing 10% FBS, and was used to culture the myeloma cells. Additional media supplements were added to the P3x63Ag8.653 murine myeloma cell line (ATCC CRL 1580) was used for the fusions. RPMI 1640 (Invitrogen) containing 10% FBS, and was used to culture the myeloma cells. Additional media supplements were added to the P3x63Ag8.653 murine myeloma cell line (ATCC C
- Hybridoma growth media which included: 3% Origen-Hybridoma Cloning Factor (Igen), 10% FBS (Sigma), L-glutamine (Gibco) 0.1% gentamycin (Gibco), 2-mercaptoethanol (Gibco), HAT (Sigma; 1.0 x 10 4 M hypoxanthine, 4.0 x 10 "7 M aminopterin, 1.6 x 10 "5 M thymidine), or HT (Sigma; 1.0 x 10 "4 M hypoxanthine, 1.6 x 10 "5 M thymidine) media.
- Spleen cells were mixed with the P3x63Ag8.653myeloma cells in a 6: 1 ratio and pelleted by centrifugation. Polyethylene glycol was added dropwise with careful mixing to facilitate fusion. Hybridomas were allowed to grow out for one to two weeks until visible colonies become established. Supernatant was harvested and used for initial screening for human IgG via ELISA using a human kappa chain specific capture and a human Fc specific detection. IgG positive supernatants were then assayed for CD27 specificity via flow cytometry or using a ELISA to detect anti-CD27.
- Hybridomas producing specific human monoclonal antibodies were subcloned and expanded.
- the human mAbs produced were then purified by protein A column chromatography according to standard conditions which led to the isolation of a number of antibodies of particular interest, which were designated as 4B7-1B3 (also referred to herein as 4B7), 3H12-1C8 (also referred to herein as 3H12), 1F5-1H5 (also referred to herein as 1F5), 2C2-1A10 (also referred to herein as 2C2) , 2G9-1D11 (also referred to herein as 2G9) , 1H8-B4 (also referred to herein as 1H8) , 3H12-1E12 (also referred to herein as 3H12), 3G1-1A11 (also referred to herein as 3G1) (1B10), 4A2-B11
- 3A10-G10 also referred to herein as 3A10
- 2G11-B5 also referred to herein as 2G11
- 4H11-Gl 1 also referred to herein as 4H11
- 2H3-E8 also referred to herein as 2H3
- 4A7-B3 also referred to herein as 4A7
- 3H8-1B11 also referred to herein as 3H8
- 1G5-1B9 also referred to herein as 1G5 .
- the hybridomas were also screened for cross -reactivity with rhesus macaque
- Binding affinity and binding kinetics of various human anti-CD27 antibodies from Example 1 were examined by BiacoreTM surface plasmon resonance (SPR) analysis using a BiacoreTM 2000 SPR instrument (Biacore AB, Uppsala, Sweden) according to the manufacturer's guidelines.
- SPR surface plasmon resonance
- Biacore Product No. BR- 1000-14 Carboxymethylated dextran covalently attached to a gold surface
- Biacore Product No. BR- 1000-14 using standard amine coupling chemistry with an Amine Coupling Kit provided by Biacore according to the manufacturer's guidelines
- BiAcore Product No. BR- 1000-50 comprising coupling reagents N-hydroxysuccinimide (NHS) and l-Ethyl-3-(3- dimethylaminopropyl) carbodiimide hydrochloride (EDC)).
- NHS N-hydroxysuccinimide
- EDC l-Ethyl-3-(3- dimethylaminopropyl) carbodiimide hydrochloride
- Low levels of ligand were immobilised to limit any effects of mass transport of analyte on kinetic parameters, such that the R MAX observed was in the order of 100-400 RU.
- HBS-EP buffer HBS-EP buffer, Biacore Product No. BR-1001-88: 4-(2-hydroxyethyl)-l- piperazineethanesulfonic acid (HEPES) 0.01M, sodium chloride 0.15M
- EDTA ethylenediaminetetraacetic acid
- Surfactant P20 0.005%
- concentrations ranging from 1.56 to 50 nM and at a flow rate of 30 ⁇ /minute for 180 seconds.
- the antigen- antibody association and dissociation kinetics were followed for either 480 seconds or 1200 seconds for antibodies with slower dissociation rates.
- Biacore's BIAevaluation software version 3.2 (Biacore AB, Uppsala, Sweden) was used in each case to derive kinetic parameters from the concentration series of analyte diluted in HBS-EP running buffer.
- the association and dissociation curves were fitted to a 1: 1 Langmuir binding model using BiacoreTM BIAevaluation software (Biacore AB) according to the manufacturer's guidelines.
- Microtiter plates were coated with soluble or recombinant human or macaque CD27in PBS, and then blocked with 5% bovine serum albumin in PBS. Protein A purified human mAbs and an isotype control were added at saturating concentrations and incubated at 37°C. The plates were washed with PBS/Tween and then incubated with a goat-anti-human IgG Fc-specific polyclonal reagent conjugated to alkaline phosphatase at 37°C. After washing, the plates were developed with pNPP substrate (1 mg/ml), and analyzed at OD 405- 650 using a microtiter plate reader. Representatives binding curves are shown in Figure 2. The results were also used to estimate the 50% saturating concentration (C value in 4- parameter fit curve) as shown in Table 1 below.
- PBMCs peripheral blood cells were isolated from whole blood of 3 humans and 3 cynomolgus macaques. The cells were stained with 1F5 mAb together with markers to delineate the major T cell and B cell populations that express CD27.
- Table 2 summarizes the mean + standard error of results for human and macaque cells with respect to the percent of cells expressing CD27 and the intensity of expression (MFI). These data establish a similar distribution of 1F5 binding to peripheral blood cells from human and monkey.
- Antibodies were tested for binding to human cell lines expressing human D27 on their surface. Protein A purified human mAbs 2C2, 3H8 and 1F5 were incubated with Jurkat, Raji, Ramos and Daudi cells expressing human CD27, as well as control cells at 4°C. All antibodies were used at saturating concentrations. After 1 hour, the cells were washed with PBS containing 0.1% BSA and 0.05% NaN 3 (PBA) and the bound antibodies were detected by incubating the cells with a PE labeled goat anti-human IgG Fc- specific probe, at 4°C.
- PBA PBS containing 0.1% BSA and 0.05% NaN 3
- a microtiter plate was coated with a recombinant human CD27-Fc chimeric fusion protein, then blocked with 5% BSA in PBS. Unconjugated human mAbs (20 ⁇ g/mL) were mixed with horseradish peroxidase labeled secondary antibodies (0.5 ⁇ g/mL), then added to the plate and incubated at 37°C. The plates were washed with PBS/Tween and developed with TMB substrate and analyzed at OD 450 using a microtiter plate reader.
- Target cells (Lymphoma Raji cells) were cultured (in AIM-V medium) for 1-2 hours at 37°C, 5%C0 2 in the presence of anti-CD27 antibodies and rabbit complement (final dilution of 1: 15) in a final volume of 150ul. Appropriate controls with a leak signal (targets only) and MAX signal (targets with LysolTM detergent at 12% for a final concentration of 4%) were included as well. Cells were adjusted to 1 x 10 6 /ml and 50ul were added to each well (to give 50,000 cells/well). Wells were then resuspended and lOOul of the cell suspension was transferred to an opaque, white plate.
- target cells were washed and loaded with Calcein AM (Molecular Probes). Loaded cells were then washed again and resuspended to lxl0 6 /ml in culture media (RPMI + 10% FBS). Target cells were cultured for 2 hours at 37°C, 5%C0 2 in the presence of anti-CD27 antibodies and rabbit complement (final dilution of 1: 15) in a final volume of 150ul. Appropriate controls with a leak signal (targets only) and MAX signal (targets with Triton X-100 at 20% for a final concentration of 2%) were included as well. Following the incubation, 75ul of supernatant from the wells were transferred into an opaque, black plate.
- Calcein AM Molecular Probes
- ADCC Antibody Dependent Cell-mediated Cytotoxicity
- Targets cells (Lymphoma Raji cells) were washed and loaded with BATDA reagent (Perkin Elmer). Loaded cells were then washed again and resuspended to 2xl0 5 /ml in culture media (RPMI + 10% FBS). Effector cells were prepared and adjusted to appropriate concentrations in culture media to yield desired effector: target ratios (100: 1 - 50: 1). In a round bottom plate, target cells, effector cells and antibody were added in a final volume of 150ul. Appropriate controls were used, including a leak signal (targets only), a spontaneous lysis signal (targets + effectors), and a maximum lysis signal (targets + LysolTM detergent at 12% for a final concentration of 4%).
- target cells Loaded cells were then washed again and resuspended to lxl0 5 /ml in culture media (RPMI + 10% FBS). Effector cells were prepared and adjusted to appropriate concentrations in culture media to yield desired effectontarget ratios (75: 1). In a round bottom plate, target cells, effector cells and antibody were added in a final volume of 150ul. Appropriate controls were used, including a leak signal (targets only), a spontaneous lysis signal (targets + effectors), and a maximum lysis signal (targets + Triton X-100 at 20% for a final concentration of 2%).
- Calcein AM Molecular Probes
- human mAbs from hybridomas producing specific human mAbs IgG were purified by protein A column chromatography which led to the isolation of a panel of antibodies (human mAbs) of particular interest.
- the V H and V L coding regions of human mAbs 4B7, 3H12, 1F5, 2C2, 2G9, 1H8, 3H12, 3G1 (IB 10) 4A2, 3A10, 2G11, 4H11, 2H3, 4A7, 3H8 and 1G5 were identified using RNA from the corresponding hybridomas. RNA was reverse transcribed to cDNA, the V coding regions were amplified by PCR and the PCR product was sequenced.
- V H nucleic acid sequence (SEQ ID NO: 5) atggagttggggctgagctgggttttccttgttgctattttagaaggtgtccagtgtgaggtgcagctggtggagtctgggggaggcttg gtccagcctggggggtcctgagactctcctgtgtgcagcctctggattcacctttagtagttattggatggcctgggtccgccaggctcca gggaaagggctggagtggctgggcaatataaagcaagatggaagtgagaaatactatgtggactctgtgaagggccgattcaccatc tccagagacaacgccaagaactcactgtatctacaaatgaacagcctgagaggaatggaagt
- V H amino acid sequence (SEQ ID NO: 6) (including signal peptide in underlined italics):
- V H CDRl (SEQ ID NO: 8): GFTFSSYW
- V H CDR2 (SEQ ID NO: 9): IKQDGSEK V H CDR3 (SEQ ID NO: 10): VRELGMDWYFDL
- V L nucleic acid sequence (SEQ ID NO: 11)
- V L amino acid sequence (SEQ ID NO: 12) (including signal peptide in underlined italics): EAPAOLL LLLLTOJ rGErVLTOSPATLSLSPGERATLSCRASOSVDSYLAWYOO KPGOAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISNLEPEDFAVYYCOORSNWPP TFGQGTKVEIK
- V L CDRl (SEQ ID NO: 14): OSVDSY
- V L CDR2 (SEQ ID NO: 15): DAS V L CDR3 (SEQ ID NO: 16): OORSNWPPT
- V L amino acid sequence (SEQ ID NO: 18) (including signal peptide in underlined italics):
- V L CDR2 (SEQ ID NO: 21): DAS
- V L CDR3 (SEQ ID NO: 22): OORSNWPPT
- V H amino acid sequence (SEQ ID NO: 24) (including signal peptide in underlined italics):
- V H amino acid sequence (SEQ ID NO: 25) excluding signal peptide: OVOLVESGGGVVOPGRSLRLSCAASGFTFSSYDIHWVROAPGKGLEWVAVIWNDGS
- VTVSS V H CDRl (SEQ ID NO: 26): GFTFSSYD
- V H CDR2 (SEQ ID NO: 27): IWNDGSNK
- V H CDR3 (SEQ ID NO: 28): VGGTADLEHWDO
- V L amino acid sequence (SEQ ID NO: 30) (including signal peptide in underlined italics):
- RVLAOLLGLLLLC PGARCDIOMTOSPSSLSASVGDRVTITCRASOGISSWLAWYOO KPEKAPKSLIYAASSLOSGVPSRFSGSGSGTDFTLTISSLOPEDFATYYCOOYNSYPLT FGGGTKVEIK
- V L CDR2 (SEQ ID NO: 33): AAS
- V L CDR3 (SEQ ID NO: 34): QQYNSYPLT
- V H amino acid sequence (SEQ ID NO: 36) (including signal peptide in underlined italics): E GM LVALLRGyOCOVOLVESGGGVVOPGRSLRLSCAASGFTFSSYDMHWV ROAPGKGLEWVAVIWYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTA VYYCARGSGNWGFFDYWGOGTLVTVSS V H amino acid sequence (SEQ ID NO: 37) excluding signal peptide:
- V H CDR2 (SEQ ID NO: 39): IWYDGSNK
- V H CDR3 (SEQ ID NO: 40): ARGSGNWGFFDY
- V L amino acid sequence (SEQ ID NO: 42) (including signal peptide in underlined italics):
- RVLAOLLGLLLLC PGARCDIOMTOSPSSLSASVGDRVTITCRASOGISRWLAWYOO KPEKAPKSLIYAASSLOSGVPSRFSGSGSGTDFTLTISSLOPEDFATYYCOOYNTYPRT FGQGTKVEIK
- V L CDR2 (SEQ ID NO: 45): AAS
- V L CDR3 (SEQ ID NO: 46): OOYNTYPRT
- V H amino acid sequence (SEQ ID NO: 48) (including signal peptide in underlined italics):
- V H CDRl (SEQ ID NO: 50): GFTFNIYD
- V H CDR2 (SEQ ID NO: 51): IWYDGSNO V H CDR3 (SEQ ID NO: 52): ARGTHWGYFDY 1H8 VK (VK 1D-16; JK1)
- V L nucleic acid sequence (SEQ ID NO: 53)
- V L CDRl (SEQ ID NO: 56): OGISSW
- V L CDR2 (SEQ ID NO: 57): AAS V L CDR3 (SEQ ID NO: 58): OOYNSYPRT 1G5 VH (VH 3-33; D6-19; JH2)
- V H amino acid sequence (SEQ ID NO: 60) (including signal peptide in underlined italics):
- V H CDRl (SEQ ID NO: 62): GFSFSSYG
- V H CDR2 (SEQ ID NO: 63): LWYDGSHK
- V H CDR3 (SEQ ID NO: 64): AREGLA VPGHWYFDL 1G5 VK (VK 1-13; JK1) V L nucleic acid sequence (SEQ ID NO: 65)
- V L amino acid sequence (SEQ ID NO: 66) (including signal peptide in underlined italics):
- V L CDRl (SEQ ID NO: 68): OGISSA
- V L CDR2 (SEQ ID NO: 69): DAS
- V L CDR3 (SEQ ID NO: 70): QQFNTYPRT
- VH 3-33; Dl-7; JH4 V H nucleic acid sequence
- VTVSS V H CDRl (SEQ ID NO: 74): GFTLSSHD V H CDR2 (SEQ ID NO: 75): IWNDGSNK V H CDR3 (SEQ ID NO: 76): VRGTADLEHWDO
- V L amino acid sequence (SEQ ID NO: 78) (including signal peptide in underlined italics):
- RVLAOLLGLLLLC PGARCDIOMTOSPSSLSASVGDRVTITCRASOGISSWLAWYOO KPEKAPKSLIYAASSLOSGVPSRFSGSGSGTDFTLTISSLOPEDFATYYCOOYNSYPLT FGGGTKVEIK
- V L CDR2 (SEQ ID NO: 81): AAS V L CDR3 (SEQ ID NO: 82): QQYNSYPLT
- V H nucleic acid sequence (SEQ ID NO: 83)
- V H amino acid sequence (SEQ ID NO: 84) (including signal peptide in underlined italics):
- V H CDRl (SEQ ID NO: 86): GFTFSHYG
- V H CDR2 (SEQ ID NO: 87): IWYDGSNK V H CDR3 (SEQ ID NO: 88): ARDGWTTMVRGLNVFDI 3A10 VK #1 (VK 1D-16; JK5)
- V L nucleic acid sequence (SEQ ID NO: 89)
- RVLAOLLGLLLLC PGARCDIOMTOSPSSLSASVGDRVTITCRASODISSWLAWYOO KPEKAPKSLIYAASSLOSGVPSRFSGSGSGTDFTLTISSLOPEDFATYYCOOYNSYPPT FGQGTRLEIK V L amino acid sequence (SEQ ID NO: 91) excluding signal peptide:
- V L CDR2 (SEQ ID NO: 93): AAS V L CDR3 (SEQ ID NO: 94): QQYNSYPPT 3A10 VK #4 (VK 1-13; JK5)
- a futher light chain was also found to be active as follows (though only the above light chain (3H8-1B11 VK #1) was used in the above Examples):
- V L nucleic acid sequence (SEQ ID NO: 95)
- V L CDRl (SEQ ID NO: 98): OGISSA
- V L CDR2 (SEQ ID NO: 99): AAS V L CDR3 (SEQ ID NO: 100): QQYNSYPPT 3H12 VH (VH 3-33; D7-27; JH4)
- V H nucleic acid sequence (SEQ ID NO: 101) atggagtttgggctgagctgggttttcctcgttgctcttttaagaggtgtccagtgtcaggtgcagctggtggagtctgggggaggcgtg gtccagcctggtggagtctgggggaggcgtg gtccagcctgggaggtccctgagactctcctgtgcaacgtctggattcaccttcagtagctatgacatgcactgggtccgccaggctcc aggcaaggggctggagtgggtggcagttatttggtatgatggaagtaataatactatgcagactccgtgaagggccgattcaccatct ccagagacaattccaagaacacg
- V H CDRl (SEQ ID NO: 104): GFTFSSYD
- V H CDR2 (SEQ ID NO: 105): IWYDGSNK
- V H CDR3 (SEQ ID NO: 106): ARGSGNWGFFDY 3H12 VK #2 (VK 1D-16; JK1) V L nucleic acid sequence (SEQ ID NO: 107)
- V L amino acid sequence (SEQ ID NO: 108) (including signal peptide in underlined italics):
- RVLAOLLGLLLLC PGARCDIOMTOSPSSLSASVGDRVTITCRASOGISRWLAWYOO KPEKAPKSLIYAASSLOSGVPSRFSGSGSGTDFTLTISSLOPEDFATYYCOOYNTYPRT FGQGTKVEIK
- V L amino acid sequence (SEQ ID NO: 109) excluding signal peptide:
- V L CDRl (SEQ ID NO: 110): OGISRW
- V L CDR2 (SEQ ID NO: 111): AAS
- V L CDR3 (SEQ ID NO: 112): QQYNTYPRT ALIGNMENTS ARE SHOWN IN FIGS 15 AND 16 Example 10
- Anti-CD27 mAbs Enhanced Antigen-specific CD8+ T-cell Proliferation and Activation Pentamer Staining on Mouse Peripheral Blood Cells and Splenocytes
- Human CD27 transgenic mice (huCD27-Tg) were intravenously injected with 5 mg of chicken ovalbumin and the panel of fully human antibodies recognizing human
- CD27 generated as in Example 1 (CD27 human mAbs). Rat anti-mouse CD27 clone AT124 and irrelevant human IgGl were included as positive and negative controls, respectively. Each antibody (250 ⁇ g) was co-injected with ovalbumin on day 0 and an additional 250 ⁇ g of antibody alone on day 1. Peripheral blood and spleen cells were harvested on day 7.
- Splenocytes 1 x 10 6 or whole blood ( 100 ⁇ ) were used for staining.
- cells were stained with 10 ⁇ of H-2Kb/SIINFEKL, a tetrameric complex of mouse MHC complexed with the peptide T cell epitope from ovalbumin (Beckman Coulter), or a similar pentameric complex (Prolmmune), anti-CD8 (eBioscience) and anti-huCD27 mAb or anti-msCD27 mAb (BD Biosciences) at room temperature for 30 minutes. Cells were then RBC-lysed, washed and fixed, and at least 100,000 events were acquired in Flow Cytometer LSR (BD Biosciences). The fraction of tetramer- or pentamer-positive cells in the CD8 + or CD27 + gated population was determined. Results are shown in Figures 19 and 21 from which it can be seen that the anti-CD27 antibodies significantly enhanced immune responses.
- Example 12 shows that the fraction of tetramer- or pen
- Splenocytes (2.5 x 10 5 and 0.5 x 10 5 ) from the pentamer staining preparation of Example 8 above were placed on an anti-IFNy monoclonal antibody (mAb) coated plate in triplicate wells after RBC lysis.
- SIINFEKL peptide was added at a final concentration of 2 ⁇ g/ml.
- a background control was set up for each sample in triplicate in the absence of peptide.
- the stimulation was maintained at 37° C in a tissue culture incubator overnight.
- ELISPOT detection was performed using an ELISPOT kit (BD Biosciences) following the manufacturer's protocol. IFNy-spot number was counted. Results are shown in Figures 20 and 21, from which it can be seen that anti-CD27 mAbs significantly enhanced T-cell activity.
- Anti-CD27 mAb Enhances T cell Responses to a Vaccine Antigen
- HuCD27 transgenic mice were immunized with 5 ⁇ g (s.c.) of the APC-targeted vaccine comprising an anti-mouse DEC-205 IgG antibody fused to ovalbumin (OVA) (referred to as cc-mDEC-205-OVA), in combination with the anti-CD27 human mAb 1F5 (i.p.) at various doses (25, 50, 100, 200 or 400 ⁇ g).
- OVA ovalbumin
- huCD27-Tg (transgenic) and wild-type (WT) mouse littermates were intraperitoneally injected with anti-CD27 mAb 1F5 (50 ⁇ g) on day -3, and then
- huCD27-Tg mice and wild type (WT) littermates were intraperitoneally injected with anti-CD27 mAb (5C ⁇ g) on various days related to vaccine as indicated in Figure 28, and subcutaneously via 4 paws injected with anti-mDec205-OVA (5 ⁇ g) plus or minus TLR agonist Poly IC-LC (20 ⁇ g) on day 0. Spleens were collected on day 7 and assessed by tetramer staining and IFNy-ELISPOT. A representative panel of tetramer staining among gated CD8 T cells is shown in Figures 24 and 25. IFNy- ELISPOT showed a similar pattern.
- T-cell activation is greater when the antibody is administered before the vaccine, for example a day or more before the vaccine (antigen) is administered.
- T cells were purified from spleen of hCD27-Tg mice by negative selection with beads. Cells were labeled with CFSE and incubated with 0 ⁇ g/ml of anti-CD27 human mAb 1F5 or isotype control for 3 days. The cross-linking anti-human IgG was passed through an endotoxin removal column before use. IFNy-ICS and CSFE dilution among CD8 and CD4 T cells are shown in Figures 26 and 27. TNFa-ICS showed the same pattern as IFNg. As shown in Figure 26 and 27, when combined with TCR activation, 1F5 mAb effectively induces proliferation and cytokine production from T cells in vitro. The data show that both cross-linking with anti-human IgG and T cell receptor activation with anti-CD3 mAb were required for 1F5 induced
- Anti-CD27 mAb Enhances the Efficacy of Vaccine in a M04 Melanoma Challenge Model
- mice per group were subcutaneously inoculated with 0.3 x 10 5 M04 cells on day 0. On day 5 and 12, these mice were intraperitoneally injected with anti-CD27 mAb 1F5 (50 ⁇ g); on day 8 and 15, additional doses of CD27 HuMab (50 ⁇ g) and vaccinated with anti-niDec205-OVA (5 ⁇ g). Tumor growth was measured with calipers 2 times a week. Results are shown in Figure 24.
- mice were subcutaneously inoculated with 1 x 10 5 M04 cells on day 0. On day 5 and 12, these mice were vaccinated with anti-niDec205-OVA (5 ⁇ g) plus the TLR agonist Poly IC-LC (10 ⁇ ) intraperitoneally. On days 6 and 13, mice were injected with anti-CD27 mAb 1F5 (50 ⁇ g). Tumor growth was measured with calipers 2 times a week as indicated in the protocol illustrated in Figure 285A.
- CB.17 SCID mice (purchased from Taconic) were maintained in a pathogen- free mouse facility. Lymphoma Raji cells (1 x 10 5 ) were subcutaneously injected into SCID mice, 4 mice per group. On day 6, these mice were treated with CD27 human mAbs via intraperitoneal administration, 0.5 mg per dose and dosed twice a week for 3 weeks. Tumor growth was measured with calipers 3 times a week. Results of tumor growth and Kaplan- Meier analysis are shown in Figure 30A and 30B, from which is can be seen that the anti- CD27 mAbs significantly prolonged survival of the tumor challenged mice.
- CB.17 SCID mice purchased from Taconic
- Human lymphoma Raji cells (5 x 10 5 ) were subcutaneously injected into SCID mice on day 0, 6 mice per group.
- these mice were treated with anti-CD27 mAb 1F5 via intraperitoneal administration, 0.033, 0.1 or 0.3 mg per dose and dosed twice a week for 3 weeks. Tumor growth was measured with calipers 2 times a week.
- CB.17 SCID mice (purchased from Taconic) were maintained in a pathogen- free mouse facility.
- Human lymphoma Daudi cells (1 x 10 6 ) were subcutaneously injected into SCID mice on day 0, 6 mice per group.
- On day 5, these mice were treated with anti- CD27 human mAb 1F5 via intraperitoneal administration, 0.033, 0.1 or 0.3 mg per dose and dosed twice a week for 3 weeks. Tumor growth was measured with calipers 2 times a week.
- HuCD27 transgenic mice were immunized with 5 ⁇ g (s.c.) of APC-targeted vaccine comprising an anti-mouse DEC-205 IgG antibody fused to ovalbumin (OVA) (referred to as cc-mDEC-205-OVA), in combination with the anti-CD27 human mAb 1F5 (i.p.) or mAb 1F5 mutant ( Fc portion mutated to prevent Fc receptor binding) or contol IgG mAb.
- OVA ovalbumin
- splenocytes were analyzed for CD8+ T cell reactivity to the OVA SIINFEKL peptide (OVA peptide 257- 264) by IFN-yELISPOT by the procedure as generally described.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Engineering & Computer Science (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Immunology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Diabetes (AREA)
- Epidemiology (AREA)
- Neurology (AREA)
- Gastroenterology & Hepatology (AREA)
- Biomedical Technology (AREA)
- Zoology (AREA)
- Hematology (AREA)
- Physical Education & Sports Medicine (AREA)
- Oncology (AREA)
- Endocrinology (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Neurosurgery (AREA)
- Communicable Diseases (AREA)
- Toxicology (AREA)
- Urology & Nephrology (AREA)
- Reproductive Health (AREA)
- Dermatology (AREA)
- Rheumatology (AREA)
- Gynecology & Obstetrics (AREA)
Priority Applications (14)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| AU2011239706A AU2011239706B2 (en) | 2010-04-13 | 2011-04-13 | Antibodies that bind human CD27 and uses thereof |
| KR1020127029230A KR101958753B1 (ko) | 2010-04-13 | 2011-04-13 | 인간 cd27에 결합하는 항체 및 이의 용도 |
| CA2796571A CA2796571C (en) | 2010-04-13 | 2011-04-13 | Antibodies that bind human cd27 and uses thereof |
| ES11730118.4T ES2608475T3 (es) | 2010-04-13 | 2011-04-13 | Anticuerpos que se unen a cd27 humana y usos de los mismos |
| SG2012071908A SG184310A1 (en) | 2010-04-13 | 2011-04-13 | Antibodies that bind human cd27 and uses thereof |
| JP2013505106A JP6002659B2 (ja) | 2010-04-13 | 2011-04-13 | ヒトcd27に結合する抗体およびその使用 |
| NZ602892A NZ602892A (en) | 2010-04-13 | 2011-04-13 | Antibodies that bind human cd27 and uses thereof |
| EP11730118.4A EP2558498B1 (en) | 2010-04-13 | 2011-04-13 | Antibodies that bind human cd27 and uses thereof |
| MX2012011768A MX339621B (es) | 2010-04-13 | 2011-04-13 | Anticuerpos que se unen a cd27 humano y uso de los mismos. |
| BR112012026227-0A BR112012026227A2 (pt) | 2010-04-13 | 2011-04-13 | anticorpo monoclonal humano ou humanizado, molécula biespecífica, vetor de expressão, célula transformada, composição, e, usos de um anticorpo |
| DK11730118.4T DK2558498T3 (en) | 2010-04-13 | 2011-04-13 | ANTIBODIES BINDING HUMANT CD27 AND APPLICATIONS THEREOF |
| CN201180029048.XA CN103154034B (zh) | 2010-04-13 | 2011-04-13 | 结合人cd27的抗体及其用途 |
| EA201291039A EA024701B1 (ru) | 2010-04-13 | 2011-04-13 | Антитела, связывающие cd27 человека, и их применение |
| IL222329A IL222329B (en) | 2010-04-13 | 2012-10-09 | Antibodies that bind human 27cd and their uses |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US32372010P | 2010-04-13 | 2010-04-13 | |
| US61/323,720 | 2010-04-13 | ||
| US201161471459P | 2011-04-04 | 2011-04-04 | |
| US61/471,459 | 2011-04-04 |
Publications (3)
| Publication Number | Publication Date |
|---|---|
| WO2011130434A2 true WO2011130434A2 (en) | 2011-10-20 |
| WO2011130434A3 WO2011130434A3 (en) | 2012-03-08 |
| WO2011130434A9 WO2011130434A9 (en) | 2012-07-19 |
Family
ID=44534592
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2011/032355 Ceased WO2011130434A2 (en) | 2010-04-13 | 2011-04-13 | Antibodies that bind human cd27 and uses thereof |
Country Status (15)
| Country | Link |
|---|---|
| US (3) | US9169325B2 (OSRAM) |
| EP (2) | EP3165540A1 (OSRAM) |
| JP (2) | JP6002659B2 (OSRAM) |
| KR (1) | KR101958753B1 (OSRAM) |
| CN (2) | CN105669865A (OSRAM) |
| AU (1) | AU2011239706B2 (OSRAM) |
| BR (1) | BR112012026227A2 (OSRAM) |
| CA (1) | CA2796571C (OSRAM) |
| EA (2) | EA201690310A1 (OSRAM) |
| ES (1) | ES2608475T3 (OSRAM) |
| IL (1) | IL222329B (OSRAM) |
| MX (1) | MX339621B (OSRAM) |
| NZ (2) | NZ602892A (OSRAM) |
| SG (1) | SG184310A1 (OSRAM) |
| WO (1) | WO2011130434A2 (OSRAM) |
Cited By (35)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2014140374A3 (en) * | 2013-03-15 | 2014-12-04 | Novo Nordisk A/S | Monovalent cd27 antibodies |
| WO2015016718A1 (en) | 2013-08-02 | 2015-02-05 | Bionovion Holding B.V. | Combining cd27 agonists and immune checkpoint inhibition for immune stimulation |
| JP2015511965A (ja) * | 2012-03-15 | 2015-04-23 | ヤンセン バイオテツク,インコーポレーテツド | ヒト抗cd27抗体、方法、及び使用 |
| US9725494B2 (en) | 2013-05-17 | 2017-08-08 | United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Soluble CD27 (sCD27) and the use thereof |
| WO2017220990A1 (en) | 2016-06-20 | 2017-12-28 | Kymab Limited | Anti-pd-l1 antibodies |
| WO2018020273A1 (en) | 2016-07-29 | 2018-02-01 | University Of Southampton | Cancer and b-cell related disease therapy |
| WO2018058022A1 (en) | 2016-09-26 | 2018-03-29 | Merck Sharp & Dohme Corp. | Anti-cd27 antibodies |
| WO2018113774A1 (en) * | 2016-12-23 | 2018-06-28 | Beijing Biocytogen Co., Ltd | Genetically modified non-human animal with human or chimeric cd27 |
| US10208113B2 (en) | 2014-06-23 | 2019-02-19 | Janssen Biotech, Inc. | Interferon α and ω antibody antagonists |
| US10280200B2 (en) | 2012-05-25 | 2019-05-07 | Janssen Biotech, Inc. | Non-natural consensus albumin binding domains |
| WO2019184935A1 (zh) | 2018-03-28 | 2019-10-03 | 江苏恒瑞医药股份有限公司 | 抗cd27抗体、其抗原结合片段及其医药用途 |
| WO2019195452A1 (en) * | 2018-04-04 | 2019-10-10 | Bristol-Myers Squibb Company | Anti-cd27 antibodies and uses thereof |
| WO2019196117A1 (en) * | 2018-04-13 | 2019-10-17 | Dingfu Biotarget Co., Ltd. | Anti-cd27 antibodies and use thereof |
| WO2019241730A2 (en) | 2018-06-15 | 2019-12-19 | Flagship Pioneering Innovations V, Inc. | Increasing immune activity through modulation of postcellular signaling factors |
| WO2020123444A1 (en) | 2018-12-11 | 2020-06-18 | Celldex Therapeutics, Inc. | Methods of using cd27 antibodies as conditioning treatment for adoptive cell therapy |
| US10729725B2 (en) | 2017-05-12 | 2020-08-04 | Crispr Therapeutics Ag | Materials and methods for engineering cells and uses thereof in immuno-oncology |
| WO2020227159A2 (en) | 2019-05-03 | 2020-11-12 | Flagship Pioneering Innovations V, Inc. | Methods of modulating immune activity |
| US10980222B2 (en) | 2016-12-23 | 2021-04-20 | Biocytogen Pharmaceuticals (Beijing) Co., Ltd. | Genetically modified non-human animal with human or chimeric CD27 |
| WO2021127217A1 (en) | 2019-12-17 | 2021-06-24 | Flagship Pioneering Innovations V, Inc. | Combination anti-cancer therapies with inducers of iron-dependent cellular disassembly |
| US11166985B2 (en) | 2017-05-12 | 2021-11-09 | Crispr Therapeutics Ag | Materials and methods for engineering cells and uses thereof in immuno-oncology |
| US11180566B2 (en) | 2010-04-13 | 2021-11-23 | Celldex Therapeutics, Inc. | Antibodies that bind human CD27 and uses thereof |
| WO2022006179A1 (en) | 2020-06-29 | 2022-01-06 | Flagship Pioneering Innovations V, Inc. | Viruses engineered to promote thanotransmission and their use in treating cancer |
| US11254912B2 (en) | 2018-05-11 | 2022-02-22 | Crispr Therapeutics Ag | Methods and compositions for treating cancer |
| US11332537B2 (en) | 2018-04-17 | 2022-05-17 | Celldex Therapeutics, Inc. | Anti-CD27 and anti-PD-L1 antibodies and bispecific constructs |
| US11389481B2 (en) | 2019-04-30 | 2022-07-19 | Crispr Therapeutics Ag | Allogeneic cell therapy of B cell malignancies using genetically engineered T cells targeting CD19 |
| WO2022212784A1 (en) | 2021-03-31 | 2022-10-06 | Flagship Pioneering Innovations V, Inc. | Thanotransmission polypeptides and their use in treating cancer |
| WO2023278641A1 (en) | 2021-06-29 | 2023-01-05 | Flagship Pioneering Innovations V, Inc. | Immune cells engineered to promote thanotransmission and uses thereof |
| WO2023031473A1 (en) | 2021-09-06 | 2023-03-09 | Genmab B.V. | Antibodies capable of binding to cd27, variants thereof and uses thereof |
| US11759509B2 (en) | 2013-03-29 | 2023-09-19 | Sumitomo Pharma Co., Ltd. | WT1 antigen peptide conjugate vaccine |
| WO2023218051A1 (en) | 2022-05-12 | 2023-11-16 | Genmab A/S | Binding agents capable of binding to cd27 in combination therapy |
| WO2023218046A1 (en) | 2022-05-12 | 2023-11-16 | Genmab A/S | Binding agents capable of binding to cd27 in combination therapy |
| WO2024077191A1 (en) | 2022-10-05 | 2024-04-11 | Flagship Pioneering Innovations V, Inc. | Nucleic acid molecules encoding trif and additionalpolypeptides and their use in treating cancer |
| WO2024151687A1 (en) | 2023-01-09 | 2024-07-18 | Flagship Pioneering Innovations V, Inc. | Genetic switches and their use in treating cancer |
| US12102680B2 (en) | 2014-08-19 | 2024-10-01 | Merck Sharp & Dohme Llc | Anti-TIGIT antibodies |
| US12383608B2 (en) | 2016-11-30 | 2025-08-12 | Sumitomo Pharma Co., Ltd. | WT1 helper peptides and combinations of WT1 helper peptide and conjugate of cancer antigen peptides |
Families Citing this family (69)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP6023706B2 (ja) * | 2010-07-09 | 2016-11-09 | アデュロ・バイオテック・ホールディングス・ヨーロッパ・ベスローテン・フエンノートシャップAduro Biotech Holdings, Europe B.V. | Cd27に対するアゴニスト抗体 |
| WO2012088446A1 (en) | 2010-12-22 | 2012-06-28 | Board Of Trustees Of The Leland Stanford Junior University | Superagonists and antagonists of interleukin-2 |
| TWI679212B (zh) | 2011-11-15 | 2019-12-11 | 美商安進股份有限公司 | 針對bcma之e3以及cd3的結合分子 |
| KR20160042917A (ko) | 2013-07-25 | 2016-04-20 | 엑시큐어, 인크. | 예방 및 치료 용도를 위한 면역자극제로서의 구형 핵산-기재 구축물 |
| US10781242B2 (en) | 2013-09-24 | 2020-09-22 | Medicenna Therapeutics Inc. | Interleukin-2 fusion proteins and uses thereof |
| EP3092255A4 (en) | 2014-01-10 | 2017-09-20 | Birdie Biopharmaceuticals Inc. | Compounds and compositions for treating egfr expressing tumors |
| US10150802B2 (en) | 2014-04-24 | 2018-12-11 | The Board Of Trustees Of The Leland Stanford Junior University | Superagonists, partial agonists and antagonists of interleukin-2 |
| WO2016002827A1 (ja) * | 2014-07-01 | 2016-01-07 | 国立研究開発法人国立精神・神経医療研究センター | 進行型免疫性脱髄疾患治療剤 |
| CA2954446A1 (en) | 2014-07-09 | 2016-01-14 | Shanghai Birdie Biotech, Inc. | Anti-pd-l1 combinations for treating tumors |
| WO2016061142A1 (en) * | 2014-10-14 | 2016-04-21 | Novartis Ag | Antibody molecules to pd-l1 and uses thereof |
| KR102781223B1 (ko) * | 2014-11-10 | 2025-03-12 | 메디뮨 리미티드 | Cd73에 특이적인 결합 분자 및 이의 용도 |
| MA40737A (fr) * | 2014-11-21 | 2017-07-04 | Memorial Sloan Kettering Cancer Center | Déterminants de la réponse d'un cancer à une immunothérapie par blocage de pd-1 |
| CA2973720A1 (en) * | 2015-01-14 | 2016-07-21 | Compass Therapeutics Llc | Multispecific immunomodulatory antigen-binding constructs |
| EP3268037B1 (en) | 2015-03-09 | 2022-08-31 | Celldex Therapeutics, Inc. | Cd27 agonists |
| MY188749A (en) | 2015-04-17 | 2021-12-28 | Bristol Myers Squibb Co | Compositions comprising a combination of nivolumab and ipilimumab |
| US20180140691A1 (en) * | 2015-05-20 | 2018-05-24 | Sumitomo Dainippon Pharma Co., Ltd. | Combination use of wt1 antigen peptide and immunomodulator |
| US11466253B2 (en) | 2015-10-22 | 2022-10-11 | Juno Therapeutics Gmbh | Methods for culturing cells and kits and apparatus for same |
| EP3364995B1 (en) * | 2015-10-23 | 2021-08-04 | Apogenix AG | Single-chain cd27-receptor agonist proteins |
| US10392442B2 (en) | 2015-12-17 | 2019-08-27 | Bristol-Myers Squibb Company | Use of anti-PD-1 antibody in combination with anti-CD27 antibody in cancer treatment |
| CN115554406A (zh) | 2016-01-07 | 2023-01-03 | 博笛生物科技有限公司 | 用于治疗肿瘤的抗-cd20组合 |
| CN115252792A (zh) | 2016-01-07 | 2022-11-01 | 博笛生物科技有限公司 | 用于治疗肿瘤的抗-egfr组合 |
| KR20180114223A (ko) * | 2016-03-04 | 2018-10-17 | 더 락커펠러 유니버시티 | 증진된 효능제 활성을 갖는 cd40에 대한 항체 |
| EP3433275A1 (en) | 2016-03-24 | 2019-01-30 | Millennium Pharmaceuticals, Inc. | Methods of treating gastrointestinal immune-related adverse events in immune oncology treatments |
| IL292302B2 (en) | 2016-05-20 | 2023-10-01 | Biohaven Pharm Holding Co Ltd | Use of glutamate modulating factors in cancer immunotherapy |
| KR102590454B1 (ko) | 2016-07-07 | 2023-10-17 | 더 보드 어브 트러스티스 어브 더 리랜드 스탠포드 주니어 유니버시티 | 항체-애쥬번트 접합체 |
| JP7009448B2 (ja) | 2016-08-12 | 2022-02-10 | ヤンセン バイオテツク,インコーポレーテツド | 強化されたアゴニスト活性を有する、Fcが遺伝子操作を受けた抗TNFRスーパーファミリーメンバー抗体及びその使用方法 |
| MA45919A (fr) | 2016-08-12 | 2019-06-19 | Janssen Biotech Inc | Conception d'anticorps modifiés et d'autres molécules contenant un domaine fc présentant des fonctions d'agonisme et d'effecteur améliorées |
| SG11201901077RA (en) | 2016-08-17 | 2019-03-28 | Compugen Ltd | Anti-tigit antibodies, anti-pvrig antibodies and combinations thereof |
| EP3524624A4 (en) * | 2016-09-29 | 2020-06-17 | Jiangsu Hengrui Medicine Co., Ltd. | ANTI-CD27 ANTIBODIES, ANTI-BINDING FRAGMENT THEREOF AND MEDICAL USES THEREOF |
| TWI788307B (zh) | 2016-10-31 | 2023-01-01 | 美商艾歐凡斯生物治療公司 | 用於擴增腫瘤浸潤性淋巴細胞之工程化人造抗原呈現細胞 |
| KR102903340B1 (ko) | 2017-01-06 | 2025-12-26 | 이오반스 바이오테라퓨틱스, 인크. | 종양 괴사 인자 수용체 슈퍼패밀리 (tnfrsf) 효능제를 사용한 종양 침윤 림프구 (til)의 확장 및 til과 tnfrsf 효능제의 치료 조합물 |
| WO2018183928A1 (en) | 2017-03-31 | 2018-10-04 | Bristol-Myers Squibb Company | Methods of treating tumor |
| CN118515666A (zh) | 2017-04-27 | 2024-08-20 | 博笛生物科技有限公司 | 2-氨基-喹啉衍生物 |
| WO2018209270A1 (en) | 2017-05-11 | 2018-11-15 | Northwestern University | Adoptive cell therapy using spherical nucleic acids (snas) |
| MX2019014265A (es) | 2017-06-01 | 2020-08-03 | Compugen Ltd | Tratamientos conjuntos triples con anticuerpos. |
| JP7433051B2 (ja) | 2017-06-19 | 2024-02-19 | メディシナ セラピューティクス インコーポレイテッド | Il-2スーパーアゴニスト、アゴニスト、およびそれらの融合体の使用および方法 |
| KR20200019226A (ko) | 2017-06-23 | 2020-02-21 | 버디 바이오파마슈티칼즈, 인크. | 약학 조성물 |
| WO2019070991A1 (en) * | 2017-10-05 | 2019-04-11 | Duke University | IMPROVING THE EFFECTIVENESS OF VACCINES AGAINST CANCER |
| WO2019075468A1 (en) | 2017-10-15 | 2019-04-18 | Bristol-Myers Squibb Company | TUMOR TREATMENT METHODS |
| MA51875A (fr) | 2018-02-13 | 2020-12-23 | Iovance Biotherapeutics Inc | Expansion de lymphocytes infiltrant les tumeurs (til) avec des antagonistes du récepteur a2a de l'adénosine et combinaisons thérapeutiques de til et d'antagonistes du récepteur a2a de l'adénosine |
| CA3093407A1 (en) | 2018-03-23 | 2019-09-26 | Bristol-Myers Squibb Company | Antibodies against mica and/or micb and uses thereof |
| KR20200139724A (ko) | 2018-03-30 | 2020-12-14 | 브리스톨-마이어스 스큅 컴퍼니 | 종양을 치료하는 방법 |
| CA3105891A1 (en) | 2018-07-24 | 2020-01-30 | Inhibrx, Inc. | Multispecific polypeptide constructs containing a constrained cd3 binding domain and a receptor binding region and methods of using the same |
| CN113518647A (zh) | 2018-10-11 | 2021-10-19 | 印希比股份有限公司 | 5t4单域抗体及其治疗性组合物 |
| EP3864045A2 (en) | 2018-10-11 | 2021-08-18 | Inhibrx, Inc. | Dll3 single domain antibodies and therapeutic compositions thereof |
| WO2020077257A1 (en) | 2018-10-11 | 2020-04-16 | Inhibrx, Inc. | Pd-1 single domain antibodies and therapeutic compositions thereof |
| CN115227824A (zh) * | 2018-11-12 | 2022-10-25 | 中南大学湘雅二医院 | 免疫检查点的抑制剂在制备治疗青光眼和其他眼部免疫损伤机制相关疾病药物中的应用 |
| JP2022525594A (ja) | 2019-03-15 | 2022-05-18 | ボルト バイオセラピューティクス、インコーポレーテッド | Her2を標的とする免疫結合体 |
| CA3134144A1 (en) | 2019-03-29 | 2020-10-08 | Myst Therapeutics, Llc | Ex vivo methods for producing a t cell therapeutic and related compositions and methods |
| JP2022531461A (ja) * | 2019-05-07 | 2022-07-06 | モデルナティエックス インコーポレイテッド | 免疫細胞活性を破壊するポリヌクレオチド及びその使用方法 |
| KR20220122639A (ko) | 2019-11-27 | 2022-09-02 | 미스트 쎄라퓨틱스, 엘엘씨 | 조절제를 이용한 종양 반응성 t 세포 조성물의 제조 방법 |
| KR20210095781A (ko) | 2020-01-24 | 2021-08-03 | 주식회사 에이프릴바이오 | 항원결합 단편 및 생리활성 이펙터 모이어티로 구성된 융합 컨스트럭트를 포함하는 다중결합항체 및 이를 포함하는 약학조성물 |
| WO2021174208A1 (en) | 2020-02-27 | 2021-09-02 | Myst Therapeutics, Llc | Methods for ex vivo enrichment and expansion of tumor reactive t cells and related compositions thereof |
| CN111690070A (zh) * | 2020-05-13 | 2020-09-22 | 深圳市众循精准医学研究院 | 一种sPD-1-Fc-sTGFβRII融合蛋白及其应用 |
| JP6796737B1 (ja) * | 2020-06-02 | 2020-12-09 | 振武 曽 | 多項目自動血球計数装置 |
| WO2022036495A1 (en) | 2020-08-17 | 2022-02-24 | Utc Therapeutics Inc. | Lymphocytes-antigen presenting cells co-stimulators and uses thereof |
| JP2024501029A (ja) | 2020-12-28 | 2024-01-10 | ブリストル-マイヤーズ スクイブ カンパニー | Pd1/pd-l1抗体の皮下投与 |
| SMT202500208T1 (it) | 2020-12-28 | 2025-07-22 | Bristol Myers Squibb Co | Composizioni anticorpali e metodi per il loro uso |
| US20240117047A1 (en) * | 2021-02-11 | 2024-04-11 | The Regents Of The University Of California | Monoclonal antibodies specific for human ror1 |
| EP4314068A1 (en) | 2021-04-02 | 2024-02-07 | The Regents Of The University Of California | Antibodies against cleaved cdcp1 and uses thereof |
| WO2023064958A1 (en) | 2021-10-15 | 2023-04-20 | Compugen Ltd. | Combination therapy with anti-pvrig antibodies formulations, anti-tigit antibodies, and anti-pd-1 antibodies |
| MX2024007528A (es) | 2021-12-23 | 2024-08-30 | Sana Biotechnology Inc | Linfocitos t del receptor de antígeno quimérico (car) para el tratamiento de enfermedades autoinmunitarias y métodos asociados. |
| CN119562830A (zh) | 2022-06-02 | 2025-03-04 | 百时美施贵宝公司 | 抗体组合物及其使用方法 |
| CN115368463B (zh) * | 2022-07-19 | 2025-12-19 | 合肥天港免疫药物有限公司 | 双特异性抗体及其应用 |
| WO2024163708A1 (en) | 2023-02-01 | 2024-08-08 | Regeneron Pharmaceuticals, Inc. | Asymmetrical flow field-flow fractionation with mass spectrometry for biomacromolecule analysis |
| WO2024220597A2 (en) | 2023-04-18 | 2024-10-24 | Sana Biotechnology, Inc. | Digital droplet based assay for detecting replication competent lentiviral vector |
| WO2024220598A2 (en) | 2023-04-18 | 2024-10-24 | Sana Biotechnology, Inc. | Lentiviral vectors with two or more genomes |
| WO2025145207A1 (en) | 2023-12-29 | 2025-07-03 | Bristol-Myers Squibb Company | Combination therapy of kras inhibitor and treg-depleting agent |
| CN121299112B (zh) * | 2024-09-12 | 2026-04-17 | 中国食品药品检定研究院 | 一种检测九型hpv疫苗或抗原原液体外相对效力的方法 |
Citations (72)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4436727A (en) | 1982-05-26 | 1984-03-13 | Ribi Immunochem Research, Inc. | Refined detoxified endotoxin product |
| US4439196A (en) | 1982-03-18 | 1984-03-27 | Merck & Co., Inc. | Osmotic drug delivery system |
| US4447224A (en) | 1982-09-20 | 1984-05-08 | Infusaid Corporation | Variable flow implantable infusion apparatus |
| US4447233A (en) | 1981-04-10 | 1984-05-08 | Parker-Hannifin Corporation | Medication infusion pump |
| US4475196A (en) | 1981-03-06 | 1984-10-02 | Zor Clair G | Instrument for locating faults in aircraft passenger reading light and attendant call control system |
| US4486194A (en) | 1983-06-08 | 1984-12-04 | James Ferrara | Therapeutic device for administering medicaments through the skin |
| US4487603A (en) | 1982-11-26 | 1984-12-11 | Cordis Corporation | Implantable microinfusion pump system |
| US4522811A (en) | 1982-07-08 | 1985-06-11 | Syntex (U.S.A.) Inc. | Serial injection of muramyldipeptides and liposomes enhances the anti-infective activity of muramyldipeptides |
| US4596556A (en) | 1985-03-25 | 1986-06-24 | Bioject, Inc. | Hypodermic injection apparatus |
| EP0198474A1 (en) | 1985-04-15 | 1986-10-22 | SMITHKLINE BEECHAM BIOLOGICALS s.a. | Hepatitis B surface antigen formed by recombinant DNA techniques, vaccines, diagnostics, cell lines and methods of forming same |
| WO1987004462A1 (en) | 1986-01-23 | 1987-07-30 | Celltech Limited | Recombinant dna sequences, vectors containing them and method for the use thereof |
| US4790824A (en) | 1987-06-19 | 1988-12-13 | Bioject, Inc. | Non-invasive hypodermic injection device |
| WO1989001036A1 (en) | 1987-07-23 | 1989-02-09 | Celltech Limited | Recombinant dna expression vectors |
| EP0304578A1 (en) | 1987-06-22 | 1989-03-01 | Medeva Holdings B.V. | Peptide comprising hepatitis B surface antigen |
| EP0318216A1 (en) | 1987-11-18 | 1989-05-31 | Chiron Corporation | NANBV diagnostics and vaccines |
| US4866034A (en) | 1982-05-26 | 1989-09-12 | Ribi Immunochem Research Inc. | Refined detoxified endotoxin |
| EP0338841A1 (en) | 1988-04-18 | 1989-10-25 | Celltech Limited | Recombinant DNA methods, vectors and host cells |
| US4877611A (en) | 1986-04-15 | 1989-10-31 | Ribi Immunochem Research Inc. | Vaccine containing tumor antigens and adjuvants |
| US4912094A (en) | 1988-06-29 | 1990-03-27 | Ribi Immunochem Research, Inc. | Modified lipopolysaccharides and process of preparation |
| WO1990006951A1 (en) | 1988-12-16 | 1990-06-28 | De Staat Der Nederlanden Vertegenwoordigd Door De Minister Van Welzijn, Volksgezondheid En Cultuur | Pneumolysin mutants and pneumococcal vaccines made therefrom |
| US4941880A (en) | 1987-06-19 | 1990-07-17 | Bioject, Inc. | Pre-filled ampule and non-invasive hypodermic injection device assembly |
| EP0414374A2 (en) | 1989-07-25 | 1991-02-27 | Smithkline Biologicals S.A. | Novel antigens and methods for their preparation |
| US5064413A (en) | 1989-11-09 | 1991-11-12 | Bioject, Inc. | Needleless hypodermic injection device |
| WO1992003918A1 (en) | 1990-08-29 | 1992-03-19 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| WO1992022645A1 (en) | 1991-06-14 | 1992-12-23 | Genpharm International, Inc. | Transgenic immunodeficient non-human animals |
| WO1992022653A1 (en) | 1991-06-14 | 1992-12-23 | Genentech, Inc. | Method for making humanized antibodies |
| WO1993001227A1 (en) | 1991-07-08 | 1993-01-21 | University Of Massachusetts At Amherst | Thermotropic liquid crystal segmented block copolymer |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| US5312335A (en) | 1989-11-09 | 1994-05-17 | Bioject Inc. | Needleless hypodermic injection device |
| WO1994025585A1 (en) | 1993-04-26 | 1994-11-10 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5374548A (en) | 1986-05-02 | 1994-12-20 | Genentech, Inc. | Methods and compositions for the attachment of proteins to liposomes using a glycophospholipid anchor |
| US5383851A (en) | 1992-07-24 | 1995-01-24 | Bioject Inc. | Needleless hypodermic injection device |
| US5399331A (en) | 1985-06-26 | 1995-03-21 | The Liposome Company, Inc. | Method for protein-liposome coupling |
| US5416016A (en) | 1989-04-03 | 1995-05-16 | Purdue Research Foundation | Method for enhancing transmembrane transport of exogenous molecules |
| US5427908A (en) | 1990-05-01 | 1995-06-27 | Affymax Technologies N.V. | Recombinant library screening methods |
| WO1996002555A1 (en) | 1994-07-15 | 1996-02-01 | The University Of Iowa Research Foundation | Immunomodulatory oligonucleotides |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| US5545807A (en) | 1988-10-12 | 1996-08-13 | The Babraham Institute | Production of antibodies from transgenic animals |
| WO1996026277A1 (en) | 1995-02-24 | 1996-08-29 | Cantab Pharmaceuticals Research Limited | Polypeptides useful as immunotherapeutic agents and methods of polypeptide preparation |
| WO1996029412A1 (en) | 1995-03-17 | 1996-09-26 | Biochem Vaccines Inc. | Proteinase k resistant surface protein of neisseria meningitidis |
| US5620886A (en) | 1993-03-18 | 1997-04-15 | Ludwig Institute For Cancer Research | Isolated nucleic acid sequence coding for a tumor rejection antigen precursor processed to at least one tumor rejection antigen presented by HLA-A2 |
| US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| WO1997041731A1 (en) | 1996-05-03 | 1997-11-13 | Antex Biologics, Inc. | Moraxella catarrhalis outer membrane protein-106 polypeptide, gene sequence and uses thereof |
| WO1998024884A1 (en) | 1996-12-02 | 1998-06-11 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies |
| US5770429A (en) | 1990-08-29 | 1998-06-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5789650A (en) | 1990-08-29 | 1998-08-04 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5804381A (en) | 1996-10-03 | 1998-09-08 | Cornell Research Foundation | Isolated nucleic acid molecule encoding an esophageal cancer associated antigen, the antigen itself, and uses thereof |
| US5814318A (en) | 1990-08-29 | 1998-09-29 | Genpharm International Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5840306A (en) | 1995-03-22 | 1998-11-24 | Merck & Co., Inc. | DNA encoding human papillomavirus type 18 |
| US5843464A (en) | 1995-06-02 | 1998-12-01 | The Ohio State University | Synthetic chimeric fimbrin peptides |
| US5856462A (en) | 1996-09-10 | 1999-01-05 | Hybridon Incorporated | Oligonucleotides having modified CpG dinucleosides |
| WO1999003884A2 (en) | 1997-07-21 | 1999-01-28 | North American Vaccine, Inc. | Modified immunogenic pneumolysin, compositions and their use as vaccines |
| US5874299A (en) | 1990-08-29 | 1999-02-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5877397A (en) | 1990-08-29 | 1999-03-02 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5885793A (en) | 1991-12-02 | 1999-03-23 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| WO1999033488A2 (en) | 1997-12-24 | 1999-07-08 | Smithkline Beecham Biologicals S.A. | Adjuvanted vaccine formulation |
| US5969108A (en) | 1990-07-10 | 1999-10-19 | Medical Research Council | Methods for producing members of specific binding pairs |
| WO1999052549A1 (en) | 1998-04-09 | 1999-10-21 | Smithkline Beecham Biologicals S.A. | Adjuvant compositions |
| US6069233A (en) | 1996-10-03 | 2000-05-30 | Memorial Sloan-Kettering Cancer Center | Isolated nucleic acid molecule encoding an esophageal cancer associated antigen, the antigen itself, and uses thereof |
| US6172197B1 (en) | 1991-07-10 | 2001-01-09 | Medical Research Council | Methods for producing members of specific binding pairs |
| US6235525B1 (en) | 1991-05-23 | 2001-05-22 | Ludwig Institute For Cancer Research | Isolated nucleic acid molecules coding for tumor rejection antigen precursor MAGE-3 and uses thereof |
| WO2001072329A1 (en) | 2000-03-29 | 2001-10-04 | The Trustees Of The University Of Pennsylvania | Compositions and methods for enhancing immunogenicity of antigens |
| WO2002090986A1 (en) | 2001-05-04 | 2002-11-14 | Ludwig Institute For Cancer Research | Colon cancer antigen panel |
| US6531127B2 (en) | 1991-07-18 | 2003-03-11 | Dade Behring Marburg Gmbh | Antibodies that specifically react with seroreactive regions on HPV 16 proteins E1 and E2 |
| WO2003040169A2 (en) | 2001-11-07 | 2003-05-15 | Celldex Therapeutics , Inc. | Human monoclonal antibodies to dendritic cells |
| US6774226B1 (en) | 1999-11-30 | 2004-08-10 | Ludwig Institute For Cancer Research | Isolated nucleic acid molecules encoding cancer associated antigens, the antigens per se, and uses thereof |
| WO2008051424A2 (en) | 2006-10-20 | 2008-05-02 | University Of Southampton | Human immune therapies using a cd27 agonist alone or in combination with other immune modulators |
| WO2009061996A2 (en) | 2007-11-07 | 2009-05-14 | Celldex Therapeutics Inc. | Antibodies that bind human dendritic and epithelial cell 205 (dec-205) |
| US9001348B2 (en) | 2012-06-12 | 2015-04-07 | Ricoh Company, Ltd. | Information processing system, information processing method, and a recording medium that allow a user to select print data and print selected print data |
| US9905535B2 (en) | 2014-11-21 | 2018-02-27 | Samsung Electronics Co., Ltd. | Semiconductor packages and fabrication method thereof |
Family Cites Families (35)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5182368A (en) | 1986-06-13 | 1993-01-26 | Ledbetter Jeffrey A | Ligands and methods for augmenting B-cell proliferation |
| US5506126A (en) | 1988-02-25 | 1996-04-09 | The General Hospital Corporation | Rapid immunoselection cloning method |
| WO1989008114A1 (en) | 1988-02-25 | 1989-09-08 | The General Hospital Corporation | Rapid immunoselection cloning method |
| US6218525B1 (en) | 1988-02-25 | 2001-04-17 | The General Hospital Corporation | Nucleic acid encoding CD28 |
| WO1992001049A2 (en) | 1990-07-13 | 1992-01-23 | The General Hospital Corporation | Cd53 cell surface antigen and use thereof |
| AU3328493A (en) | 1991-12-17 | 1993-07-19 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| WO1996034096A1 (en) | 1995-04-28 | 1996-10-31 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US6010853A (en) | 1997-05-29 | 2000-01-04 | Dana-Farber Cancer Institute | Siva genes, novel genes involved in CD27-mediated apoptosis |
| US20030035790A1 (en) | 1999-01-15 | 2003-02-20 | Shu-Hsia Chen | Combination therapy for the prevention or treatment of cancer, inflammatory disorders or infectious diseases in a subject |
| WO2000041508A2 (en) | 1999-01-15 | 2000-07-20 | Mount Sinai School Of Medicine Of The City University Of New York | Combination therapy of cancer by the activation of co-stimulatory molecules expressed by immune cells and cytokines |
| NZ527977A (en) * | 2001-02-12 | 2005-10-28 | Medarex Inc | Human monoclonal antibodies to FC alpha receptor (CD89) |
| WO2003068268A2 (en) | 2002-02-14 | 2003-08-21 | Bioinvent International Ab | Treatment, diagnosis and imaging of disease |
| AU2003217912A1 (en) | 2002-03-01 | 2003-09-16 | Xencor | Antibody optimization |
| AU2003289716A1 (en) | 2002-09-12 | 2004-04-30 | Incyte Corporation | Molecules for diagnostics and therapeutics |
| CA2516128A1 (en) | 2003-02-14 | 2004-09-02 | Sagres Discovery, Inc. | Therapeutic targets in cancer |
| US20040170982A1 (en) | 2003-02-14 | 2004-09-02 | Morris David W. | Novel therapeutic targets in cancer |
| JP2007524362A (ja) | 2003-02-14 | 2007-08-30 | サイグレス ディスカバリー, インコーポレイテッド | 癌における治療gpcr標的 |
| US20080213267A1 (en) | 2006-02-24 | 2008-09-04 | Arius Research, Inc. | Cytotoxicity mediation of cells evidencing surface expression of TROP-2 |
| WO2007102200A1 (ja) * | 2006-03-07 | 2007-09-13 | Osaka University | 抗cd20モノクローナル抗体 |
| PT2222697E (pt) * | 2007-11-01 | 2013-02-15 | Perseid Therapeutics Llc | Polipeptídeos imunossupressores e ácidos nucleicos |
| EP2090320A1 (en) * | 2008-02-15 | 2009-08-19 | Helmholtz-Zentrum für Infektionsforschung GmbH | Ligands of the Natural Killer (NK) cell surface marker CD27 and therapeutic uses thereof |
| CA2729567C (en) * | 2008-06-30 | 2018-04-24 | Kyowa Hakko Kirin Co., Ltd. | Anti-cd27 antibody |
| NZ602892A (en) | 2010-04-13 | 2014-08-29 | Celldex Therapeutics Inc | Antibodies that bind human cd27 and uses thereof |
| US20120213771A1 (en) | 2010-04-13 | 2012-08-23 | Celldex Therapeutics Inc. | Antibodies that bind human cd27 and uses thereof |
| JP6023706B2 (ja) | 2010-07-09 | 2016-11-09 | アデュロ・バイオテック・ホールディングス・ヨーロッパ・ベスローテン・フエンノートシャップAduro Biotech Holdings, Europe B.V. | Cd27に対するアゴニスト抗体 |
| AU2012273182A1 (en) | 2011-06-21 | 2014-01-16 | The Johns Hopkins University | Focused radiation for augmenting immune-based therapies against neoplasms |
| BR122020002414B1 (pt) | 2012-03-15 | 2022-03-03 | Janssen Biotech, Inc | Uso de anticorpos anti-cd27 humanos |
| RU2016107426A (ru) | 2013-08-02 | 2017-09-07 | Адуро Байотек Холдингс, Юроуп Б.В. | Комбинирование агонистов cd27 и ингибирование иммунных контрольных точек для стимуляции иммунитета |
| JP2016531920A (ja) | 2013-09-05 | 2016-10-13 | アデュロ・バイオテック・ホールディングス・ヨーロッパ・ベスローテン・フエンノートシャップAduro Biotech Holdings, Europe B.V. | Cd70結合ペプチドおよびそれに関連する方法、プロセスおよび用途 |
| GB201500319D0 (en) | 2015-01-09 | 2015-02-25 | Agency Science Tech & Res | Anti-PD-L1 antibodies |
| EP3268037B1 (en) | 2015-03-09 | 2022-08-31 | Celldex Therapeutics, Inc. | Cd27 agonists |
| KR20250099459A (ko) | 2015-11-03 | 2025-07-01 | 얀센 바이오테크 인코포레이티드 | Pd-1과 특이적으로 결합하는 항체 및 그의 용도 |
| JP7038064B2 (ja) | 2016-04-18 | 2022-03-17 | セルデックス セラピューティクス インコーポレイテッド | ヒトcd40に結合するアゴニスト抗体およびその使用 |
| GB201613167D0 (en) | 2016-07-29 | 2016-09-14 | Univ Southampton | Cancer and b-cell related disease therapy |
| WO2019204462A2 (en) | 2018-04-17 | 2019-10-24 | Celldex Therapeutics, Inc. | Anti-cd27 and anti-pd-l1 antibodies and bispecific constructs |
-
2011
- 2011-04-13 NZ NZ602892A patent/NZ602892A/en not_active IP Right Cessation
- 2011-04-13 US US13/086,286 patent/US9169325B2/en active Active
- 2011-04-13 CN CN201610122341.5A patent/CN105669865A/zh active Pending
- 2011-04-13 SG SG2012071908A patent/SG184310A1/en unknown
- 2011-04-13 AU AU2011239706A patent/AU2011239706B2/en not_active Ceased
- 2011-04-13 BR BR112012026227-0A patent/BR112012026227A2/pt not_active Application Discontinuation
- 2011-04-13 KR KR1020127029230A patent/KR101958753B1/ko active Active
- 2011-04-13 EP EP16193133.2A patent/EP3165540A1/en not_active Ceased
- 2011-04-13 EP EP11730118.4A patent/EP2558498B1/en active Active
- 2011-04-13 ES ES11730118.4T patent/ES2608475T3/es active Active
- 2011-04-13 CN CN201180029048.XA patent/CN103154034B/zh active Active
- 2011-04-13 EA EA201690310A patent/EA201690310A1/ru unknown
- 2011-04-13 WO PCT/US2011/032355 patent/WO2011130434A2/en not_active Ceased
- 2011-04-13 JP JP2013505106A patent/JP6002659B2/ja active Active
- 2011-04-13 CA CA2796571A patent/CA2796571C/en not_active Expired - Fee Related
- 2011-04-13 NZ NZ623807A patent/NZ623807A/en not_active IP Right Cessation
- 2011-04-13 MX MX2012011768A patent/MX339621B/es active IP Right Grant
- 2011-04-13 EA EA201291039A patent/EA024701B1/ru not_active IP Right Cessation
-
2012
- 2012-10-09 IL IL222329A patent/IL222329B/en active IP Right Grant
-
2015
- 2015-07-02 US US14/790,247 patent/US11180566B2/en not_active Expired - Fee Related
-
2016
- 2016-09-05 JP JP2016172375A patent/JP6486300B2/ja active Active
-
2021
- 2021-10-22 US US17/507,895 patent/US20220227877A1/en active Pending
Patent Citations (85)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4475196A (en) | 1981-03-06 | 1984-10-02 | Zor Clair G | Instrument for locating faults in aircraft passenger reading light and attendant call control system |
| US4447233A (en) | 1981-04-10 | 1984-05-08 | Parker-Hannifin Corporation | Medication infusion pump |
| US4439196A (en) | 1982-03-18 | 1984-03-27 | Merck & Co., Inc. | Osmotic drug delivery system |
| US4866034A (en) | 1982-05-26 | 1989-09-12 | Ribi Immunochem Research Inc. | Refined detoxified endotoxin |
| US4436727A (en) | 1982-05-26 | 1984-03-13 | Ribi Immunochem Research, Inc. | Refined detoxified endotoxin product |
| US4522811A (en) | 1982-07-08 | 1985-06-11 | Syntex (U.S.A.) Inc. | Serial injection of muramyldipeptides and liposomes enhances the anti-infective activity of muramyldipeptides |
| US4447224A (en) | 1982-09-20 | 1984-05-08 | Infusaid Corporation | Variable flow implantable infusion apparatus |
| US4487603A (en) | 1982-11-26 | 1984-12-11 | Cordis Corporation | Implantable microinfusion pump system |
| US4486194A (en) | 1983-06-08 | 1984-12-04 | James Ferrara | Therapeutic device for administering medicaments through the skin |
| US4596556A (en) | 1985-03-25 | 1986-06-24 | Bioject, Inc. | Hypodermic injection apparatus |
| EP0198474A1 (en) | 1985-04-15 | 1986-10-22 | SMITHKLINE BEECHAM BIOLOGICALS s.a. | Hepatitis B surface antigen formed by recombinant DNA techniques, vaccines, diagnostics, cell lines and methods of forming same |
| US5399331A (en) | 1985-06-26 | 1995-03-21 | The Liposome Company, Inc. | Method for protein-liposome coupling |
| WO1987004462A1 (en) | 1986-01-23 | 1987-07-30 | Celltech Limited | Recombinant dna sequences, vectors containing them and method for the use thereof |
| US4877611A (en) | 1986-04-15 | 1989-10-31 | Ribi Immunochem Research Inc. | Vaccine containing tumor antigens and adjuvants |
| US5374548A (en) | 1986-05-02 | 1994-12-20 | Genentech, Inc. | Methods and compositions for the attachment of proteins to liposomes using a glycophospholipid anchor |
| US4790824A (en) | 1987-06-19 | 1988-12-13 | Bioject, Inc. | Non-invasive hypodermic injection device |
| US4941880A (en) | 1987-06-19 | 1990-07-17 | Bioject, Inc. | Pre-filled ampule and non-invasive hypodermic injection device assembly |
| EP0304578A1 (en) | 1987-06-22 | 1989-03-01 | Medeva Holdings B.V. | Peptide comprising hepatitis B surface antigen |
| WO1989001036A1 (en) | 1987-07-23 | 1989-02-09 | Celltech Limited | Recombinant dna expression vectors |
| EP0318216A1 (en) | 1987-11-18 | 1989-05-31 | Chiron Corporation | NANBV diagnostics and vaccines |
| EP0338841A1 (en) | 1988-04-18 | 1989-10-25 | Celltech Limited | Recombinant DNA methods, vectors and host cells |
| US4912094B1 (en) | 1988-06-29 | 1994-02-15 | Ribi Immunochem Research Inc. | Modified lipopolysaccharides and process of preparation |
| US4912094A (en) | 1988-06-29 | 1990-03-27 | Ribi Immunochem Research, Inc. | Modified lipopolysaccharides and process of preparation |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| US5571698A (en) | 1988-09-02 | 1996-11-05 | Protein Engineering Corporation | Directed evolution of novel binding proteins |
| US5403484A (en) | 1988-09-02 | 1995-04-04 | Protein Engineering Corporation | Viruses expressing chimeric binding proteins |
| US5545807A (en) | 1988-10-12 | 1996-08-13 | The Babraham Institute | Production of antibodies from transgenic animals |
| WO1990006951A1 (en) | 1988-12-16 | 1990-06-28 | De Staat Der Nederlanden Vertegenwoordigd Door De Minister Van Welzijn, Volksgezondheid En Cultuur | Pneumolysin mutants and pneumococcal vaccines made therefrom |
| US5416016A (en) | 1989-04-03 | 1995-05-16 | Purdue Research Foundation | Method for enhancing transmembrane transport of exogenous molecules |
| EP0414374A2 (en) | 1989-07-25 | 1991-02-27 | Smithkline Biologicals S.A. | Novel antigens and methods for their preparation |
| US5312335A (en) | 1989-11-09 | 1994-05-17 | Bioject Inc. | Needleless hypodermic injection device |
| US5064413A (en) | 1989-11-09 | 1991-11-12 | Bioject, Inc. | Needleless hypodermic injection device |
| US5580717A (en) | 1990-05-01 | 1996-12-03 | Affymax Technologies N.V. | Recombinant library screening methods |
| US5427908A (en) | 1990-05-01 | 1995-06-27 | Affymax Technologies N.V. | Recombinant library screening methods |
| US5969108A (en) | 1990-07-10 | 1999-10-19 | Medical Research Council | Methods for producing members of specific binding pairs |
| US5569825A (en) | 1990-08-29 | 1996-10-29 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5789650A (en) | 1990-08-29 | 1998-08-04 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5770429A (en) | 1990-08-29 | 1998-06-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| US5814318A (en) | 1990-08-29 | 1998-09-29 | Genpharm International Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5877397A (en) | 1990-08-29 | 1999-03-02 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| WO1992003918A1 (en) | 1990-08-29 | 1992-03-19 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5874299A (en) | 1990-08-29 | 1999-02-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US6235525B1 (en) | 1991-05-23 | 2001-05-22 | Ludwig Institute For Cancer Research | Isolated nucleic acid molecules coding for tumor rejection antigen precursor MAGE-3 and uses thereof |
| WO1992022645A1 (en) | 1991-06-14 | 1992-12-23 | Genpharm International, Inc. | Transgenic immunodeficient non-human animals |
| WO1992022653A1 (en) | 1991-06-14 | 1992-12-23 | Genentech, Inc. | Method for making humanized antibodies |
| WO1993001227A1 (en) | 1991-07-08 | 1993-01-21 | University Of Massachusetts At Amherst | Thermotropic liquid crystal segmented block copolymer |
| US6172197B1 (en) | 1991-07-10 | 2001-01-09 | Medical Research Council | Methods for producing members of specific binding pairs |
| US6531127B2 (en) | 1991-07-18 | 2003-03-11 | Dade Behring Marburg Gmbh | Antibodies that specifically react with seroreactive regions on HPV 16 proteins E1 and E2 |
| US5885793A (en) | 1991-12-02 | 1999-03-23 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US6521404B1 (en) | 1991-12-02 | 2003-02-18 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US6593081B1 (en) | 1991-12-02 | 2003-07-15 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US6582915B1 (en) | 1991-12-02 | 2003-06-24 | Medical Research Council | Production of anti-self bodies from antibody segment repertories and displayed on phage |
| US6555313B1 (en) | 1991-12-02 | 2003-04-29 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US6544731B1 (en) | 1991-12-02 | 2003-04-08 | Medical Research Council | Production of anti-self antibodies from antibody segment repertories and displayed on phage |
| US5383851A (en) | 1992-07-24 | 1995-01-24 | Bioject Inc. | Needleless hypodermic injection device |
| US5399163A (en) | 1992-07-24 | 1995-03-21 | Bioject Inc. | Needleless hypodermic injection methods and device |
| US5620886A (en) | 1993-03-18 | 1997-04-15 | Ludwig Institute For Cancer Research | Isolated nucleic acid sequence coding for a tumor rejection antigen precursor processed to at least one tumor rejection antigen presented by HLA-A2 |
| US5854203A (en) | 1993-03-18 | 1998-12-29 | Ludwig Institute For Cancer Research | Tumor rejection antigen precursor processed to at least one tumor rejection antigen presented by HLA-A2 |
| WO1994025585A1 (en) | 1993-04-26 | 1994-11-10 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| WO1996002555A1 (en) | 1994-07-15 | 1996-02-01 | The University Of Iowa Research Foundation | Immunomodulatory oligonucleotides |
| WO1996026277A1 (en) | 1995-02-24 | 1996-08-29 | Cantab Pharmaceuticals Research Limited | Polypeptides useful as immunotherapeutic agents and methods of polypeptide preparation |
| WO1996029412A1 (en) | 1995-03-17 | 1996-09-26 | Biochem Vaccines Inc. | Proteinase k resistant surface protein of neisseria meningitidis |
| US5840306A (en) | 1995-03-22 | 1998-11-24 | Merck & Co., Inc. | DNA encoding human papillomavirus type 18 |
| US5843464A (en) | 1995-06-02 | 1998-12-01 | The Ohio State University | Synthetic chimeric fimbrin peptides |
| WO1997041731A1 (en) | 1996-05-03 | 1997-11-13 | Antex Biologics, Inc. | Moraxella catarrhalis outer membrane protein-106 polypeptide, gene sequence and uses thereof |
| US5856462A (en) | 1996-09-10 | 1999-01-05 | Hybridon Incorporated | Oligonucleotides having modified CpG dinucleosides |
| US5804381A (en) | 1996-10-03 | 1998-09-08 | Cornell Research Foundation | Isolated nucleic acid molecule encoding an esophageal cancer associated antigen, the antigen itself, and uses thereof |
| US6069233A (en) | 1996-10-03 | 2000-05-30 | Memorial Sloan-Kettering Cancer Center | Isolated nucleic acid molecule encoding an esophageal cancer associated antigen, the antigen itself, and uses thereof |
| WO1998024884A1 (en) | 1996-12-02 | 1998-06-11 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies |
| WO1999003884A2 (en) | 1997-07-21 | 1999-01-28 | North American Vaccine, Inc. | Modified immunogenic pneumolysin, compositions and their use as vaccines |
| WO1999033488A2 (en) | 1997-12-24 | 1999-07-08 | Smithkline Beecham Biologicals S.A. | Adjuvanted vaccine formulation |
| WO1999052549A1 (en) | 1998-04-09 | 1999-10-21 | Smithkline Beecham Biologicals S.A. | Adjuvant compositions |
| US6774226B1 (en) | 1999-11-30 | 2004-08-10 | Ludwig Institute For Cancer Research | Isolated nucleic acid molecules encoding cancer associated antigens, the antigens per se, and uses thereof |
| US6911529B1 (en) | 1999-11-30 | 2005-06-28 | Ludwig Institute For Cancer Research | Isolated nucleic acid molecules encoding cancer associated antigens, the antigens per se, and uses thereof |
| WO2001072329A1 (en) | 2000-03-29 | 2001-10-04 | The Trustees Of The University Of Pennsylvania | Compositions and methods for enhancing immunogenicity of antigens |
| WO2002090986A1 (en) | 2001-05-04 | 2002-11-14 | Ludwig Institute For Cancer Research | Colon cancer antigen panel |
| WO2003040169A2 (en) | 2001-11-07 | 2003-05-15 | Celldex Therapeutics , Inc. | Human monoclonal antibodies to dendritic cells |
| WO2008051424A2 (en) | 2006-10-20 | 2008-05-02 | University Of Southampton | Human immune therapies using a cd27 agonist alone or in combination with other immune modulators |
| WO2009061996A2 (en) | 2007-11-07 | 2009-05-14 | Celldex Therapeutics Inc. | Antibodies that bind human dendritic and epithelial cell 205 (dec-205) |
| US9001348B2 (en) | 2012-06-12 | 2015-04-07 | Ricoh Company, Ltd. | Information processing system, information processing method, and a recording medium that allow a user to select print data and print selected print data |
| US9905535B2 (en) | 2014-11-21 | 2018-02-27 | Samsung Electronics Co., Ltd. | Semiconductor packages and fabrication method thereof |
Non-Patent Citations (108)
| Title |
|---|
| "AS-2", SMITHKLINE BEECHAM |
| "Current Protocols in Molecular Biology", 1987, GREENE PUBLISHING AND WILEY INTERSCIENCE |
| "Freund's Incomplete Adjuvant and Complete Adjuvant", DIFCO LABORATORIES |
| "Merck Adjuvant", vol. 65, MERCK AND COMPANY, INC. |
| "Monoclonal Antibodies For Cancer Detection And Therapy", 1985, ACADEMIC PRESS, article "Analysis, Results, And Future Prospective Of The Therapeutic Use Of Radiolabeled Antibody In Cancer Therapy", pages: 303 - 16 |
| "Rpitope Mapping Protocols in Methods in Molecular Biology", vol. 66, 1996 |
| "Sustained and Controlled Release Drug Delivery Systems", 1978, MARCEL DEKKER, INC. |
| ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 10 |
| ALTSCHUL ET AL., NUCLEIC ACIDS RES., vol. 25, no. 17, 1997, pages 3389 - 3402 |
| ARNON ET AL.: "Monoclonal Antibodies And Cancer Therapy", 1985, ALAN R. LISS, INC., article "Monoclonal Antibodies For Immunotargeting Of Drugs In Cancer Therapy", pages: 243 - 56 |
| BARBAS, J. AM. CHEM. SOC., vol. 116, 1994, pages 2161 - 2162 |
| BEIBOER ET AL., J. MOL. BIOL, vol. 296, 2000, pages 833 - 849 |
| BERGE, S.M. ET AL., J. PHARM. SCI., vol. 66, 1977, pages 1 - 19 |
| BEUTLER, B., CURRENT OPINION IN MICROBIOLOGY, vol. 3, 2000, pages 23 - 30 |
| BIOCHEM BIOPHYS ACTA, vol. 67, 1989, pages 1007 |
| BIRD, SCIENCE, vol. 242, 1988, pages 423 - 426 |
| BOWMAN MR ET AL., J. IMMUNOL., vol. 152, no. 4, 15 February 1994 (1994-02-15), pages 1756 - 61 |
| BRISCOE ET AL., AM. J. PHYSIOL., vol. 1233, 1995, pages 134 |
| BRUMMELL ET AL., BIOCHEM., vol. 32, 1993, pages 1180 - 1187 |
| BURKS ET AL., PROC. NATL. ACAD. SCI. USA, vol. 94, 1997, pages 412 - 417 |
| CAMERINI ET AL., J IMMUNOL., vol. 147, 1991, pages 3165 - 69 |
| CASSON ET AL., J. IMMUNOL., vol. 155, no. 12, 1995, pages 5647 - 54 |
| CHEN, J. ET AL., EMBO J., vol. 12, 1993, pages 821 - 830 |
| CHEN, J. ET AL., INTERNATIONAL IMMUNOLOGY, vol. 5, 1993, pages 647 - 656 |
| CHEUNG ET AL., VIROLOGY, vol. 176, 1990, pages 546 |
| CHOI ET AL., NATURE GENETICS, vol. 4, 1993, pages 117 - 123 |
| CHOTHIA, LESK, J. MOL. BIOL., vol. 196, 1987, pages 901 |
| CLACKSON ET AL., NATURE, vol. 352, 1991, pages 624 - 628 |
| DITZEL ET AL., J. IMMUNOL., vol. 157, 1996, pages 739 - 749 |
| E. MEYERS, W. MILLER, CABIOS, vol. 4, 1989, pages 11 - 17 |
| FISHWILD, D. ET AL., NATURE BIOTECHNOLOGY, vol. 14, 1996, pages 845 - 851 |
| FISHWILD, NATURE BIOTECHNOLOGY, vol. 14, 1996, pages 845 - 851 |
| FOOTE, WINTER, J. MOL. BIOL., vol. 224, 1992, pages 487 |
| GODING: "Monoclonal Antibodies: Principles and Practice", 1986, ACADEMIC PRESS, pages: 59 - 103 |
| GODING: "Monoclonal Antibodies:Principles and Practice", 1986, ACADEMIC PRESS, pages: 59 - 103 |
| HALL ET AL., J. IMUNOL., vol. 149, 1992, pages 1605 - 1612 |
| HARDING, F., LONBERG, N., ANN. N. Y ACAD. SCI, vol. 764, 1995, pages 536 - 546 |
| HARDING, F., LONBERG, N., ANN. N.Y. ACAD. SCI, vol. 764, 1995, pages 536 - 546 |
| HARLOW, LANE: "Antibodies: A Laboratory Manual", 1988, COLD SPRING HARBOR PRESS |
| HARRISON ET AL., VACCINE, vol. 19, 2001, pages 1820 - 1826 |
| HELLSTROM ET AL.: "Controlled Drug Delivery", 1987, MARCEL DEKKER, INC., article "Antibodies For Drug Delivery", pages: 623 - 53 |
| HINTZEN RQ, J. IMMUNOL., vol. 152, no. 4, 15 February 1994 (1994-02-15), pages 1762 - 73 |
| HOET ET AL., NATURE BIOTECHNOLOGY, vol. 23, 2005, pages 344 - 348 |
| HUSTON ET AL., PROC. NATL. ACAD. SCI. UFA, vol. 85, 1988, pages 5879 - 5883 |
| J.J. KILLION, I.J. FIDLER, IMMUNOMETHODS, vol. 4, 1994, pages 273 |
| JAHN ET AL., IMMUNOBIOL., vol. 193, 1995, pages 400 - 419 |
| JESPERS ET AL., BIOTECHNOLOGY, vol. 12, no. 9, 1994, pages 899 - 903 |
| JONES, P. ET AL., NATURE, vol. 321, 1986, pages 522 - 525 |
| K. KEINANEN, M.L. LAUKKANEN, FEBS LETT., vol. 346, 1994, pages 123 |
| KANZLER ET AL., NATURE MEDICINE, vol. 13, no. 5, May 2007 (2007-05-01) |
| KETTLEBOROUGH ET AL., PROTEIN ENGINEERING, vol. 4, 1991, pages 773 |
| KIRKLAND ET AL., J. IMMUNOL., vol. 137, 1986, pages 3614 |
| KLIMKA ET AL., BRIT. J. CANCER, vol. 83, 2000, pages 252 - 260 |
| KOBATA T, PROC. NAIL. ACAD. SCI. U S A., vol. 92, no. 24, 21 November 1995 (1995-11-21), pages 11249 - 53 |
| KOBAYASHI ET AL., PROTEIN ENG., vol. 12, no. 10, 1999, pages 879 - 884 |
| KOHLER, MILSTEIN, NATURE, vol. 256, 1975, pages 495 |
| KOLBINGER ET AL., PROTEIN ENGINEERING, vol. 6, 1993, pages 971 |
| KOSTELNY ET AL., J. IMMUNOL., vol. 148, 1992, pages 1547 - 1553 |
| KOZAK, J. BIOL. CHEM., vol. 266, 1991, pages 19867 - 19870 |
| LOENEN WA ET AL., EUR. J. IMMUNOL., vol. 22, 1992, pages 447 |
| LONBERG ET AL., NATURE, vol. 368, no. 6474, 1994, pages 856 - 859 |
| LONBERG, N. ET AL., NATURE, vol. 368, no. 6474, 1994, pages 856 - 859 |
| LONBERG, N., HANDBOOK OF EXPERIMENTAL PHARMACOLOGY, vol. 113, 1994, pages 49 - 10 1 |
| LONBERG, N., HANDBOOK OF EXPERIMENTAL PHARMACOLOGY, vol. 113, 1994, pages 49 - 101 |
| LONBERG, N., HUSZAR, D., INTERN. REV. IMMUNOL., vol. 13, 1995, pages 65 - 93 |
| LONBERG, N.: "Handbook oj ExperimenlaZ Pharmacology", vol. 113, 1994, pages: 49 - 101 |
| LONBERG, NATURE BIOTECH., vol. 23, no. 9, 2005, pages 1117 - 1125 |
| LONBERG, NATURE, vol. 368, no. 6474, 1994, pages 856 - 859 |
| M. OWAIS ET AL., ANTIMICROB. AGENTS CHEMOTHER., vol. 39, 1995, pages 180 |
| MARKS ET AL., BIO/TECHNOLOGY, vol. 10, 1992, pages 779 - 783 |
| MARKS ET AL., BIOTECHNOLOGY, vol. 10, no. 7, 1992, pages 779 - 83 |
| MARKS ET AL., J. MOL. BIOL., vol. 222, 1991, pages 581 - 597 |
| MARTIN, THORTON, MOL. BIOL., vol. 263, 1996, pages 800 |
| MCCAFFERTY ET AL., NATURE, vol. 348, 1990, pages 552 - 554 |
| MOLDENHAUER ET AL., SCAND. J. IMMUNOL., vol. 32, 1990, pages 77 |
| MOREL ET AL., MOL. IMMUNOL., vol. 25, no. 1, 1988, pages 7 |
| MORRISON, S., SCIENCE, vol. 229, 1985, pages 1202 |
| NEEDLEMAN, WUNSCH, J. MOL. BIOL., 1970, pages 444 - 453 |
| NOVOTNY, HABER, PROC. NATL. ACAD. SCI. USA, vol. 82, 1985, pages 4592 - 66 |
| P.G. BLOEMAN ET AL., FEBS LETT., vol. 357, 1995, pages 140 |
| POLYMENIS ET AL., J. IMMUNOL., vol. 152, 1994, pages 5318 - 5329 |
| QUEEN, C. ET AL., PROC. NATL. ACAD. SEE. U.S.A., vol. 86, 1989, pages 10029 - 10033 |
| RADER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 95, 1998, pages 8910 - 8915 |
| RANHEIM EA ET AL., BLOOD, vol. 85, no. 12, 15 June 1995 (1995-06-15), pages 3556 - 65 |
| REYES ET AL., VACCINE, vol. 19, 2001, pages 3778 - 3786 |
| RHODES, J. ET AL., NATURE, vol. 377, 1995, pages 71 - 75 |
| RIECHMANN, L. ET AL., NATURE, vol. 332, 1998, pages 323 - 327 |
| RUBINS ET AL., MICROBIAL PATHOGENESIS, vol. 25, pages 337 - 342 |
| SAKANISHI T ET AL., BIOCHEM BIOPHYS. RES. COMMUN., 18 February 2010 (2010-02-18) |
| SCHREIER ET AL., J. BIOL. CHEM., vol. 269, 1994, pages 9090 |
| SHARON ET AL., PNAS USA, vol. 83, no. 8, 1986, pages 2628 - 31 |
| SONGSIVILAI, LACHMANN, CLIN. EXP. IMMUNOL., vol. 79, 1990, pages 315 - 321 |
| STAHLI ET AL., METHNDS IN ENZYMOLOGY, vol. 9, 1983, pages 242 |
| STREJAN ET AL., J. NEUROIMMUNOL., vol. 7, 1984, pages 27 |
| TAYLOR, L. ET AL., INTERNATIONAL IMMUNOLOGY, vol. 6, 1994, pages 579 - 591 |
| TAYLOR, L. ET AL., NUCLEIC ACIDS RESEARCH, vol. 20, 1992, pages 6287 - 6295 |
| THORPE ET AL.: "Monoclonal Antibodies '84: Biological And Clinical Applications", 1985, article "Antibody Carriers Of Cytotoxic Agents In Cancer Therapy: A Review", pages: 475 - 506 |
| THORPE ET AL.: "The Preparation And Cytotoxic Properties Of Antibody-Toxin Conjugates", IMMUNOL. REV., vol. 62, 1982, pages 119 - 58, XP001179872, DOI: doi:10.1111/j.1600-065X.1982.tb00392.x |
| TRAMONTANO, J. MOL. BIOL., vol. 215, 1990, pages 175 |
| TUAILLON ET AL., J. IMMUNOL., vol. 152, 1994, pages 2912 - 2920 |
| TUAILLON ET AL., PROC. NATL. ACAD. SCI USA, vol. 90, 1993, pages 3720 - 3724 |
| UMEZAWA ET AL., BIOCHEM. BIOPHYS. RES. COMMUN., vol. 153, 1988, pages 1038 |
| V.V. RANADE, J. CLIN. PHARTNACOL., vol. 29, 1989, pages 685 |
| VAN OERS MH ET AL., BLOOD, vol. 82, no. 11, 1 December 1993 (1993-12-01), pages 3430 - 6 |
| VASILAKOS ET AL., CELLULAR IMMUNOLOGY, vol. 204, 2000, pages 64 - 74 |
| VIROLOGY, vol. 145, 1985, pages 181 - 185 |
| WARD, NALURE, vol. 341, 1989, pages 544 - 546 |
| WATERHOUSE ET AL., NUC. ACIDS. RES., vol. 21, 1993, pages 2265 - 2266 |
Cited By (67)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11180566B2 (en) | 2010-04-13 | 2021-11-23 | Celldex Therapeutics, Inc. | Antibodies that bind human CD27 and uses thereof |
| US10301392B2 (en) | 2012-03-15 | 2019-05-28 | Janssen Biotech, Inc. | Methods of inhibiting T-cell mediated B-cell antibody production using anti-CD27 antibodies |
| JP2015511965A (ja) * | 2012-03-15 | 2015-04-23 | ヤンセン バイオテツク,インコーポレーテツド | ヒト抗cd27抗体、方法、及び使用 |
| US11732050B2 (en) | 2012-03-15 | 2023-08-22 | Janssen Biotech, Inc. | Neutralizing human anti-CD27 antibodies |
| US10689453B2 (en) | 2012-03-15 | 2020-06-23 | Janssen Biotech, Inc. | Methods of inhibiting naive T-cell proliferation using anti-CD27 antibodies |
| US10280200B2 (en) | 2012-05-25 | 2019-05-07 | Janssen Biotech, Inc. | Non-natural consensus albumin binding domains |
| WO2014140374A3 (en) * | 2013-03-15 | 2014-12-04 | Novo Nordisk A/S | Monovalent cd27 antibodies |
| US11759509B2 (en) | 2013-03-29 | 2023-09-19 | Sumitomo Pharma Co., Ltd. | WT1 antigen peptide conjugate vaccine |
| US9725494B2 (en) | 2013-05-17 | 2017-08-08 | United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Soluble CD27 (sCD27) and the use thereof |
| JP2016531907A (ja) * | 2013-08-02 | 2016-10-13 | アデュロ・バイオテック・ホールディングス・ヨーロッパ・ベスローテン・フエンノートシャップAduro Biotech Holdings, Europe B.V. | 免疫刺激のためのcd27アゴニストと免疫チェックポイント阻害との組み合わせ |
| WO2015016718A1 (en) | 2013-08-02 | 2015-02-05 | Bionovion Holding B.V. | Combining cd27 agonists and immune checkpoint inhibition for immune stimulation |
| US10358491B2 (en) | 2014-06-23 | 2019-07-23 | Janssen Biotech, Inc. | Interferon alpha and omega antibody antagonists |
| US10759854B2 (en) | 2014-06-23 | 2020-09-01 | Janssen Biotech, Inc. | Interferon alpha and omega antibody antagonists |
| US10208113B2 (en) | 2014-06-23 | 2019-02-19 | Janssen Biotech, Inc. | Interferon α and ω antibody antagonists |
| US12102680B2 (en) | 2014-08-19 | 2024-10-01 | Merck Sharp & Dohme Llc | Anti-TIGIT antibodies |
| WO2017220989A1 (en) | 2016-06-20 | 2017-12-28 | Kymab Limited | Anti-pd-l1 and il-2 cytokines |
| WO2017220988A1 (en) | 2016-06-20 | 2017-12-28 | Kymab Limited | Multispecific antibodies for immuno-oncology |
| WO2017220990A1 (en) | 2016-06-20 | 2017-12-28 | Kymab Limited | Anti-pd-l1 antibodies |
| WO2018020273A1 (en) | 2016-07-29 | 2018-02-01 | University Of Southampton | Cancer and b-cell related disease therapy |
| CN109890846A (zh) * | 2016-09-26 | 2019-06-14 | 默沙东公司 | 抗-cd27抗体 |
| KR20190053949A (ko) * | 2016-09-26 | 2019-05-20 | 머크 샤프 앤드 돔 코포레이션 | 항-cd27 항체 |
| TWI854952B (zh) * | 2016-09-26 | 2024-09-11 | 美商默沙東有限責任公司 | 抗cd27抗體 |
| CN109890846B (zh) * | 2016-09-26 | 2023-10-24 | 默沙东有限责任公司 | 抗-cd27抗体 |
| US10556957B2 (en) | 2016-09-26 | 2020-02-11 | Merck Sharp & Dohme Corp. | Anti-CD27 antibodies |
| WO2018058022A1 (en) | 2016-09-26 | 2018-03-29 | Merck Sharp & Dohme Corp. | Anti-cd27 antibodies |
| KR20210040465A (ko) * | 2016-09-26 | 2021-04-13 | 머크 샤프 앤드 돔 코포레이션 | 항-cd27 항체 |
| US12383608B2 (en) | 2016-11-30 | 2025-08-12 | Sumitomo Pharma Co., Ltd. | WT1 helper peptides and combinations of WT1 helper peptide and conjugate of cancer antigen peptides |
| US10980222B2 (en) | 2016-12-23 | 2021-04-20 | Biocytogen Pharmaceuticals (Beijing) Co., Ltd. | Genetically modified non-human animal with human or chimeric CD27 |
| WO2018113774A1 (en) * | 2016-12-23 | 2018-06-28 | Beijing Biocytogen Co., Ltd | Genetically modified non-human animal with human or chimeric cd27 |
| US11471491B1 (en) | 2017-05-12 | 2022-10-18 | Crispr Therapeutics Ag | Materials and methods for engineering cells and uses thereof in immuno-oncology |
| US11135247B2 (en) | 2017-05-12 | 2021-10-05 | Crispr Therapeutics Ag | Materials and methods for engineering cells and uses thereof in immuno-oncology |
| US10881689B2 (en) | 2017-05-12 | 2021-01-05 | Crispr Therapeutics Ag | Materials and methods for engineering cells and uses thereof in immuno-oncology |
| US10736919B2 (en) | 2017-05-12 | 2020-08-11 | Crispr Therapeutics Ag | Materials and methods for engineering cells and uses thereof in immuno-oncology |
| US11013767B2 (en) | 2017-05-12 | 2021-05-25 | Crispr Therapeutics Ag | Materials and methods for engineering cells and uses thereof in immuno-oncology |
| US11298378B2 (en) | 2017-05-12 | 2022-04-12 | Crispr Therapeutics Ag | Materials and methods for engineering cells and uses thereof in immuno-oncology |
| US11071755B1 (en) | 2017-05-12 | 2021-07-27 | Crispr Therapeutics Ag | Materials and methods for engineering cells and uses thereof in immuno-oncology |
| US11622977B2 (en) | 2017-05-12 | 2023-04-11 | Crispr Therapeutics Ag | Materials and methods for engineering cells and uses thereof in immuno-oncology |
| US11166985B2 (en) | 2017-05-12 | 2021-11-09 | Crispr Therapeutics Ag | Materials and methods for engineering cells and uses thereof in immuno-oncology |
| US10729725B2 (en) | 2017-05-12 | 2020-08-04 | Crispr Therapeutics Ag | Materials and methods for engineering cells and uses thereof in immuno-oncology |
| US11191783B2 (en) | 2017-05-12 | 2021-12-07 | Crispr Therapeutics Ag | Materials and methods for engineering cells and uses thereof in immuno-oncology |
| US11202802B2 (en) | 2017-05-12 | 2021-12-21 | Crispr Therapeutics Ag | Materials and methods for engineering cells and uses thereof in immuno-oncology |
| US11207351B2 (en) | 2017-05-12 | 2021-12-28 | Crispr Therapeutics Ag | Materials and methods for engineering cells and uses thereof in immuno-oncology |
| US10857184B2 (en) | 2017-05-12 | 2020-12-08 | Crispr Therapeutics Ag | Materials and methods for engineering cells and uses thereof in immuno-oncology |
| WO2019184935A1 (zh) | 2018-03-28 | 2019-10-03 | 江苏恒瑞医药股份有限公司 | 抗cd27抗体、其抗原结合片段及其医药用途 |
| US12110337B2 (en) | 2018-04-04 | 2024-10-08 | Bristol-Myers Squibb Company | Anti-CD27 antibodies and uses thereof |
| WO2019195452A1 (en) * | 2018-04-04 | 2019-10-10 | Bristol-Myers Squibb Company | Anti-cd27 antibodies and uses thereof |
| CN112292399A (zh) * | 2018-04-04 | 2021-01-29 | 百时美施贵宝公司 | 抗cd27抗体及其用途 |
| US11795230B2 (en) | 2018-04-13 | 2023-10-24 | Dingfu Biotarget Co., Ltd. | Anti-CD27 antibodies and use thereof |
| WO2019196117A1 (en) * | 2018-04-13 | 2019-10-17 | Dingfu Biotarget Co., Ltd. | Anti-cd27 antibodies and use thereof |
| US11332537B2 (en) | 2018-04-17 | 2022-05-17 | Celldex Therapeutics, Inc. | Anti-CD27 and anti-PD-L1 antibodies and bispecific constructs |
| US11459393B2 (en) | 2018-04-17 | 2022-10-04 | Celldex Therapeutics, Inc. | Anti-CD27 and anti-PD-L1 antibodies and bispecific constructs |
| US11254912B2 (en) | 2018-05-11 | 2022-02-22 | Crispr Therapeutics Ag | Methods and compositions for treating cancer |
| US12227763B2 (en) | 2018-05-11 | 2025-02-18 | Crispr Therapeutics Ag | Methods and compositions for treating cancer |
| US11649438B2 (en) | 2018-05-11 | 2023-05-16 | Crispr Therapeutics Ag | Methods and compositions for treating cancer |
| WO2019241730A2 (en) | 2018-06-15 | 2019-12-19 | Flagship Pioneering Innovations V, Inc. | Increasing immune activity through modulation of postcellular signaling factors |
| WO2020123444A1 (en) | 2018-12-11 | 2020-06-18 | Celldex Therapeutics, Inc. | Methods of using cd27 antibodies as conditioning treatment for adoptive cell therapy |
| US11389481B2 (en) | 2019-04-30 | 2022-07-19 | Crispr Therapeutics Ag | Allogeneic cell therapy of B cell malignancies using genetically engineered T cells targeting CD19 |
| WO2020227159A2 (en) | 2019-05-03 | 2020-11-12 | Flagship Pioneering Innovations V, Inc. | Methods of modulating immune activity |
| WO2021127217A1 (en) | 2019-12-17 | 2021-06-24 | Flagship Pioneering Innovations V, Inc. | Combination anti-cancer therapies with inducers of iron-dependent cellular disassembly |
| WO2022006179A1 (en) | 2020-06-29 | 2022-01-06 | Flagship Pioneering Innovations V, Inc. | Viruses engineered to promote thanotransmission and their use in treating cancer |
| WO2022212784A1 (en) | 2021-03-31 | 2022-10-06 | Flagship Pioneering Innovations V, Inc. | Thanotransmission polypeptides and their use in treating cancer |
| WO2023278641A1 (en) | 2021-06-29 | 2023-01-05 | Flagship Pioneering Innovations V, Inc. | Immune cells engineered to promote thanotransmission and uses thereof |
| WO2023031473A1 (en) | 2021-09-06 | 2023-03-09 | Genmab B.V. | Antibodies capable of binding to cd27, variants thereof and uses thereof |
| WO2023218051A1 (en) | 2022-05-12 | 2023-11-16 | Genmab A/S | Binding agents capable of binding to cd27 in combination therapy |
| WO2023218046A1 (en) | 2022-05-12 | 2023-11-16 | Genmab A/S | Binding agents capable of binding to cd27 in combination therapy |
| WO2024077191A1 (en) | 2022-10-05 | 2024-04-11 | Flagship Pioneering Innovations V, Inc. | Nucleic acid molecules encoding trif and additionalpolypeptides and their use in treating cancer |
| WO2024151687A1 (en) | 2023-01-09 | 2024-07-18 | Flagship Pioneering Innovations V, Inc. | Genetic switches and their use in treating cancer |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20220227877A1 (en) | Antibodies that bind human cd27 and uses thereof | |
| US20260116968A1 (en) | Agonistic antibodies that bind human cd40 and uses thereof | |
| US20120213771A1 (en) | Antibodies that bind human cd27 and uses thereof | |
| US20250346671A1 (en) | Anti-pd-l1 antibodies and methods of use thereof | |
| AU2018201621A1 (en) | Antibodies that bind human CD27 and uses thereof | |
| AU2013203270B2 (en) | Antibodies that bind human CD27 and uses thereof | |
| US20240409639A1 (en) | Anti-ilt4 and anti-pd-1 bispecific constructs | |
| DK2558498T3 (en) | ANTIBODIES BINDING HUMANT CD27 AND APPLICATIONS THEREOF | |
| HK1181782B (en) | Antibodies that bind human cd27 and uses thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 201180029048.X Country of ref document: CN |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 11730118 Country of ref document: EP Kind code of ref document: A2 |
|
| DPE1 | Request for preliminary examination filed after expiration of 19th month from priority date (pct application filed from 20040101) | ||
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2012/011768 Country of ref document: MX |
|
| ENP | Entry into the national phase |
Ref document number: 2013505106 Country of ref document: JP Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2796571 Country of ref document: CA |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 8988/DELNP/2012 Country of ref document: IN |
|
| ENP | Entry into the national phase |
Ref document number: 2011239706 Country of ref document: AU Date of ref document: 20110413 Kind code of ref document: A |
|
| REEP | Request for entry into the european phase |
Ref document number: 2011730118 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2011730118 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 20127029230 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 201291039 Country of ref document: EA |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112012026227 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 112012026227 Country of ref document: BR Kind code of ref document: A2 Effective date: 20121011 |