WO2008145142A1 - Stable igg4 antibodies - Google Patents

Stable igg4 antibodies Download PDF

Info

Publication number
WO2008145142A1
WO2008145142A1 PCT/DK2008/050129 DK2008050129W WO2008145142A1 WO 2008145142 A1 WO2008145142 A1 WO 2008145142A1 DK 2008050129 W DK2008050129 W DK 2008050129W WO 2008145142 A1 WO2008145142 A1 WO 2008145142A1
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
disorders
stabilized igg4
igg4
treatment
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/DK2008/050129
Other languages
English (en)
French (fr)
Inventor
Jan Van De Winkel
Tom Vink
Janine Schuurman
Paul Parren
Rob Aalberse
Marijn Van Der Neut Kolfschoten
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Genmab AS
Original Assignee
Genmab AS
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=39831865&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=WO2008145142(A1) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Priority to AU2008255352A priority Critical patent/AU2008255352B2/en
Priority to EP08748828.4A priority patent/EP2164873B2/en
Priority to JP2010509682A priority patent/JP6071165B2/ja
Priority to EP13181032.7A priority patent/EP2666787B1/en
Priority to EP22155736.6A priority patent/EP4119579A1/en
Application filed by Genmab AS filed Critical Genmab AS
Priority to US12/602,439 priority patent/US20100267934A1/en
Priority to CA002688275A priority patent/CA2688275A1/en
Publication of WO2008145142A1 publication Critical patent/WO2008145142A1/en
Anticipated expiration legal-status Critical
Priority to US13/912,581 priority patent/US20130345406A1/en
Priority to US15/197,496 priority patent/US10752695B2/en
Priority to US16/947,021 priority patent/US20210061919A1/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K51/00Preparations containing radioactive substances for use in therapy or testing in vivo
    • A61K51/02Preparations containing radioactive substances for use in therapy or testing in vivo characterised by the carrier, i.e. characterised by the agent or material covalently linked or complexing the radioactive nucleus
    • A61K51/04Organic compounds
    • A61K51/08Peptides, e.g. proteins, carriers being peptides, polyamino acids, proteins
    • A61K51/10Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/6811Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
    • A61K47/6813Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin the drug being a peptidic cytokine, e.g. an interleukin or interferon
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6839Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting material from viruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6845Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a cytokine, e.g. growth factors, VEGF, TNF, a lymphokine or an interferon
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6849Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K51/00Preparations containing radioactive substances for use in therapy or testing in vivo
    • A61K51/02Preparations containing radioactive substances for use in therapy or testing in vivo characterised by the carrier, i.e. characterised by the agent or material covalently linked or complexing the radioactive nucleus
    • A61K51/04Organic compounds
    • A61K51/08Peptides, e.g. proteins, carriers being peptides, polyamino acids, proteins
    • A61K51/10Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody
    • A61K51/1006Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody the antibody being against or targeting material from viruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K51/00Preparations containing radioactive substances for use in therapy or testing in vivo
    • A61K51/02Preparations containing radioactive substances for use in therapy or testing in vivo characterised by the carrier, i.e. characterised by the agent or material covalently linked or complexing the radioactive nucleus
    • A61K51/04Organic compounds
    • A61K51/08Peptides, e.g. proteins, carriers being peptides, polyamino acids, proteins
    • A61K51/10Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody
    • A61K51/1021Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody against cytokines, e.g. growth factors, VEGF, TNF, lymphokines or interferons
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K51/00Preparations containing radioactive substances for use in therapy or testing in vivo
    • A61K51/02Preparations containing radioactive substances for use in therapy or testing in vivo characterised by the carrier, i.e. characterised by the agent or material covalently linked or complexing the radioactive nucleus
    • A61K51/04Organic compounds
    • A61K51/08Peptides, e.g. proteins, carriers being peptides, polyamino acids, proteins
    • A61K51/10Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody
    • A61K51/1027Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody against receptors, cell-surface antigens or cell-surface determinants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K51/00Preparations containing radioactive substances for use in therapy or testing in vivo
    • A61K51/02Preparations containing radioactive substances for use in therapy or testing in vivo characterised by the carrier, i.e. characterised by the agent or material covalently linked or complexing the radioactive nucleus
    • A61K51/04Organic compounds
    • A61K51/08Peptides, e.g. proteins, carriers being peptides, polyamino acids, proteins
    • A61K51/10Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody
    • A61K51/1027Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody against receptors, cell-surface antigens or cell-surface determinants
    • A61K51/103Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody against receptors, cell-surface antigens or cell-surface determinants against receptors for growth factors or receptors for growth regulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K51/00Preparations containing radioactive substances for use in therapy or testing in vivo
    • A61K51/02Preparations containing radioactive substances for use in therapy or testing in vivo characterised by the carrier, i.e. characterised by the agent or material covalently linked or complexing the radioactive nucleus
    • A61K51/04Organic compounds
    • A61K51/08Peptides, e.g. proteins, carriers being peptides, polyamino acids, proteins
    • A61K51/10Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody
    • A61K51/1027Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody against receptors, cell-surface antigens or cell-surface determinants
    • A61K51/1039Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody against receptors, cell-surface antigens or cell-surface determinants against T-cell receptors
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/02Stomatological preparations, e.g. drugs for caries, aphtae, periodontitis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/04Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/16Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/18Drugs for disorders of the alimentary tract or the digestive system for pancreatic disorders, e.g. pancreatic enzymes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • A61P11/02Nasal agents, e.g. decongestants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • A61P11/06Antiasthmatics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00Drugs for disorders of the urinary system
    • A61P13/02Drugs for disorders of the urinary system of urine or of the urinary tract, e.g. urine acidifiers
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00Drugs for disorders of the urinary system
    • A61P13/08Drugs for disorders of the urinary system of the prostate
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00Drugs for disorders of the urinary system
    • A61P13/10Drugs for disorders of the urinary system of the bladder
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00Drugs for disorders of the urinary system
    • A61P13/12Drugs for disorders of the urinary system of the kidneys
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P15/00Drugs for genital or sexual disorders; Contraceptives
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P15/00Drugs for genital or sexual disorders; Contraceptives
    • A61P15/10Drugs for genital or sexual disorders; Contraceptives for impotence
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • A61P17/02Drugs for dermatological disorders for treating wounds, ulcers, burns, scars, keloids, or the like
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • A61P17/06Antipsoriatics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • A61P17/08Antiseborrheics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/02Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/06Antigout agents, e.g. antihyperuricemic or uricosuric agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/08Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00Drugs for disorders of the muscular or neuromuscular system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/14Drugs for disorders of the nervous system for treating abnormal movements, e.g. chorea, dyskinesia
    • A61P25/16Anti-Parkinson drugs
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/28Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P27/00Drugs for disorders of the senses
    • A61P27/02Ophthalmic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P27/00Drugs for disorders of the senses
    • A61P27/16Otologicals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04Antibacterial agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/14Antivirals for RNA viruses
    • A61P31/18Antivirals for RNA viruses for HIV
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/04Antineoplastic agents specific for metastasis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/06Immunosuppressants, e.g. drugs for graft rejection
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/08Antiallergic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P5/00Drugs for disorders of the endocrine system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00Drugs for disorders of the blood or the extracellular fluid
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00Drugs for disorders of the blood or the extracellular fluid
    • A61P7/06Antianaemics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/10Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/16Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from plants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2863Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2887Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against CD20
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/526CH3 domain
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/53Hinge
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/55Fab or Fab'
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/94Stability, e.g. half-life, pH, temperature or enzyme-resistance

Definitions

  • the heterogeneity of IgG4s is believed to be related to the core sequence of the IgG4 hinge region which, instead of Cys-Pro-Pro-Cys, as in IgGl and IgG2, consists of Cys-Pro-Ser-Cys, which is believed to be a more flexible structure.
  • Data that support the role of the core hinge sequence in this heterogeneity of IgG4 have been reported by Angal et al. (1993) MoI Immunol 30: 105.
  • IgG4 antibodies unlike other IgG subclasses, behave as monovalent molecules in interactions with antigen. It was found that serum-derived human IgG4 cannot precipitate purified antigen, because it cannot crosslink. While such serum-derived IgG4 is functionally monovalent (Aalberse et al. (1983) J Immunol 130:722; van der Zee et al.
  • IgG4 antibodies with bispecific reactivity were shown to exist in sera from allergic patients expressing large amounts of IgG4 antibodies against two different antigens (Schuurman et al (1999) Immunology 97:693; Aalberse and Schuurman (2002) Immunology 105:9; Aalberse et al (1999) Int Arch Allergy Immunol 118: 187).
  • IgG4 antibodies can exchange 'half-molecules', an activity termed Fab arm exchange herein.
  • IgG4 antibodies therefore have unusual properties which are undesirable in vivo: IgG4 antibodies are unstable, dynamic, molecules which engage in Fab arm exchange. An administered therapeutic IgG4 antibody may exchange with endogenous IgG4 antibodies with undesired specificities. The random nature of this process introduces unpredictability which is highly undesirable for human immunotherapy.
  • the present invention relates to stabilized forms of IgG4 antibodies that have a reduced ability to undergo Fab-arm exchange. It has surprisingly been found that substitution of the Arg residue at position 409 or the Phe residue at position 405 in human IgG4 can prevent Fab arm exchange, and thus stabilize IgG4, even in the absence of a mutation of the core hinge region sequence to Cys-Pro-Pro-Cys. This was unexpected, because it was believed that elimination of the flexibility of the hinge region via a change of the core hinge sequence to Cys-Pro-Pro-Cys was a requirement for prevention of half-molecule exchange.
  • the invention relates to a stabilized IgG4 antibody for use as a medicament, comprising a heavy chain and a light chain, wherein said heavy chain comprises a human IgG4 constant region having a substitution of the Arg residue at position 409, the Phe residue at position 405 or the Lys residue at position 370, wherein said antibody optionally comprises one or more further substitutions, deletions and/or insertions, with the proviso that if the antibody has a residue selected from the group consisting of: Lys, Ala, Thr, Met and Leu at the position corresponding to 409, then the antibody does not comprise a Cys-Pro-Pro-Cys sequence in the hinge region.
  • the invention relates to an isolated stabilized IgG4 antibody for use as a medicament, comprising a heavy chain and a light chain, wherein said heavy chain comprises a human IgG4 constant region having a residue selected from the group consisting of: Lys, Ala, Thr, Met and Leu at the position corresponding to 409 and/or a residue selected from the group consisting of: Ala, VaI, GIy, He and Leu at the position corresponding to 405, and wherein said antibody optionally comprises one or more further substitutions, deletions and/or insertions, but does not comprise a Cys-Pro- Pro-Cys sequence in the hinge region.
  • the constant region of the stabilized IgG4 antibody of the invention is even identical to that of the above mentioned Lys409 allotype described by Brusco et al. (1998) Eur J Immunogen 25:349.
  • the constant region of the antibody is identical to antibodies found naturally in humans.
  • FIG. 1 SDS- Pag e an alysis of pu r if ied reco m bi n ant I g GI an d l g G4 . After purification, the Betvl and FeIdI, IgGl and IgG4 antibodies were analyzed on non- reducing SDS-PAGE.
  • Figure 2. Bispecif i c I g G levels i n n u/ n u BaIb/ c m ice at d iff eren t t i m e poi nts.
  • the amount of bispecific IgG as determined in the heterologous cross-linking assay was plotted versus the amount of Bet v 1 specific IgG as determined in the Bet v 1 binding test.
  • Data from IgGl and IgG4 containing plasma samples are represented by open symbols and closed symbols, respectively.
  • the dashed line represents the calculated amount of bispecific IgG, if the exchange of IgG half molecules is random and complete.
  • the mouse was dosed with a mix containing 300 ⁇ g of Bet v 1 binding IgG4 and 300 ⁇ g of FeI d 1 binding IgG4.
  • FIG. 6 Fab arm ex ch an g e of I g G by h u m an blood cel ls Fab arm exchange of IgG4 (black bars) and IgGl (grey bars) was evaluated by incubating chimeric IgG mixtures with mononuclear cells (MNC), thrombocytes (Thr) and erythrocytes (Ery) for 48h at 37°C, after which bispecific activity in the heterologous cross-linking assay (FeI d 1-Bet v 1) was measured. As a control the antibody mixtures were also incubated in serum free culture medium (SFC). Bispecificity is expressed as percentage 125 I-Bet v 1 bound relative to amount added.
  • MNC mononuclear cells
  • Thr thrombocytes
  • Ery erythrocytes
  • FIG. 10 Fab ar m exch an g e of l g G4 by eryt h rocyte lysate Fab arm exchange of IgG4 was evaluated by incubating a chimeric IgG4 mixture in lysate from erythrocytes at 37°C. IgG4 was incubated with increasing dilutions of lysate. Bispecific activity in the heterologous cross-linking assay (Bet v 1-FeI d 1) was measured in samples drawn at indicated time points. Bispecificity is expressed as percentage 125 I-Bet v 1 bound relative to amount added.
  • GSH mediated exchange of IgG4 Fab arms was evaluated by incubating IgG4 in the presence of increasing concentrations of GSH in PBS/Azide. At indicated time points samples were drawn in which antigen binding and bispecific activity was measured. The exchange of IgG4 Fab arms was calculated from the measured concentration of bispecific IgG (as determined in the heterologous cross-linking assay) and the maximal expected concentration of bispecific IgG4 if the exchange of IgG4 Fab arms is random and complete. The exchange was expressed as percentage of the maximal exchange, set at 100%.
  • FIG. 15 l g G4 Fab ar m ex ch an g e m ed iated by a pan el of red u ci n g ag en ts.
  • IgG4-Betvl and IgG4-Feldl in PBS were incubated in the presence of different agents (all reducing, except GSSG) for 24h at 37°C.
  • the concentration of Bet v 1 specific IgG was measured in the Bet v 1 binding assay and the concentration of bispecific IgG was measured in the heterologous cross-linking assay (FeI d 1-Bet v 1).
  • the percentage of bispecific IgG relative to the IgG-Betvl concentration was calculated. Standard error bars represent SEM calculated from three measurements.
  • IgG4-CD20/IgG4-EGFr or IgGl-CD20/IgGl-EGFr mixtures were incubated at 37°C with or without 0.5 mM GSH. Samples were taken at indicated time points. The formation of bispecific antibodies was measured in a sandwich ELISA. Y-axis indicates the optical density at 405 nm as a measurement of the formation of bispecific CD20/EGFR antibodies.
  • Rhesus monkey IVIg participates in Fab arm exchange of recombinant human lgG4 antibodies.
  • Mixtures of two recombinant human IgG4 antibodies (IgG4-CD20 and IgG4-EGFr) were incubated with GSH for 24h at 37°C, in the presence or absence of rhesus monkey or human IVIg.
  • the formation of bispecific antibodies through Fab arm exchange was measured in a sandwich ELISA.
  • IgG4 anti-feldl wt with IgG4 anti-betvl wt (indicated as IgG4 wt in the figure)
  • IgGl anti-feldl wt with IgG4 anti-betvl wt (indicated as IgGl wt)
  • IgGl-CPSC IgGl anti-feldl CPSC with IgGl anti-betvl CPSC (indicates as IgGl-CPSC)
  • IgGl anti-feldl CH3(IgG4) with IgGl atni-betvl CH3(IgG4) (indicated as IgGl- CH3 (IgG4))
  • Figure 19 Schematic representation of constructs for IgGI and lgG4 containing mutations in the core hinge and/ or CH3 domain.
  • Figure 20 Fab arm exchange of IgGI and lgG4 hinge region or CH3 domain m utants.
  • Figure 21 Binding of hingeless lgG4 antibody 2F8-HG and CH3 mutants 2F8-HG-F405L, 2 F8-HG-F405A, 2F8-HG-R409A and 2F8-HG-R409K to EGFr. Binding was tested in an EGFR ELISA in the presence and absence of polyclonal human IgG (IVIG).
  • Figure 22 Sequence alignment of anti-EGFr antibody 2F8 in a IgGI , lgG4 and ( partial) I gG3 backbone. Amino acid numbering according to Kabat and according to the EU-index are depicted (both described in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD. (1991)).
  • Figure 23 Fab arm exchange of CH3 domain mutants of human lgG4 antibodies.
  • Mixtures of two recombinant human IgG4 antibodies (IgG4-CD20 and IgG4- EGFr) and CH3 domain mutants thereof were incubated with 0.5 mM GSH for 24h at 37°C.
  • the formation of bispecific antibodies through Fab arm exchange was measured in a sandwich ELISA.
  • FIG. 24 Shows the location of primers used for the preparation of DNA constructs.
  • immunoglobulin refers to a class of structurally related glycoproteins consisting of two pairs of polypeptide chains, one pair of light (L) low molecular weight chains and one pair of heavy (H) chains, all four inter-connected by disulfide bonds.
  • L light
  • H heavy
  • each heavy chain typically is comprised of a heavy chain variable region (abbreviated herein as V H or VH) and a heavy chain constant region.
  • the heavy chain constant region typically is comprised of three domains, C H 1, C H 2, and C H 3.
  • Each light chain typically is comprised of a light chain variable region (abbreviated herein as V L or VL) and a light chain constant region.
  • the light chain constant region typically is comprised of one domain, C L .
  • the V H and V L regions may be further subdivided into regions of hypervariability (or hypervariable regions which may be hypervariable in sequence and/or form of structurally defined loops), also termed complementarity determining regions (CDRs), interspersed with regions that are more conserved, termed framework regions (FRs).
  • CDRs complementarity determining regions
  • Each V H and V L is typically composed of three CDRs and four FRs, arranged from amino- terminus to carboxy-terminus in the following order: FRl, CDRl, FR2, CDR2, FR3, CDR3, FR4 (see also Chothia and Lesk J. MoI. Biol. 196, 901-917 (1987)).
  • a heavy chain variable domain may include a single amino acid insert (residue 52a according to Kabat) after residue 52 of V H CDR2 and inserted residues (for instance residues 82a, 82b, and 82c, etc. according to Kabat) after heavy chain FR residue 82.
  • the Kabat numbering of residues may be determined for a given antibody by alignment at regions of homology of the sequence of the antibody with a "standard" Kabat numbered sequence.
  • the numbering of amino acid residues is performed by the EU-index also described in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD. (1991). This numbering is often used in literature dealing with the Fc part of human immunoglobulin G molecules and is also used throughout this application.
  • Figure 22 gives an overview of both numbering methods and shows an alignment of different antibody isotypes based on anti-EGFR antibody 2F8.
  • antibody in the context of the present invention refers to an immunoglobulin molecule, a fragment of an immunoglobulin molecule, or a derivative of either thereof, which has the ability to specifically bind to an antigen under typical physiological conditions with a half life of significant periods of time, such as at least about 30 minutes, at least about 45 minutes, at least about one hour, at least about two hours, at least about four hours, at least about 8 hours, at least about 12 hours, about 24 hours or more, about 48 hours or more, about 3, 4, 5, 6, 7 or more days, etc., or any other relevant functionally-defined period (such as a time sufficient to induce, promote, enhance, and/or modulate a physiological response associated with antibody binding to the antigen and/or time sufficient for the antibody to recruit an Fc-mediated effector activity).
  • variable regions of the heavy and light chains of the immunoglobulin molecule contain a binding domain that interacts with an antigen.
  • the constant regions of the antibodies may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (such as effector cells) and components of the complement system such as CIq, the first component in the classical pathway of complement activation.
  • the term antibody herein unless otherwise stated or clearly contradicted by context, includes fragments of an antibody that comprise a mutated or wildtype core hinge region and retain the ability to specifically bind to the antigen.
  • antibody may be performed by fragments of a full-length antibody. Although such fragments are generally included within the meaning of antibody, they collectively and each independently are unique features of the present invention, exhibiting different biological properties and utility.
  • antibody also includes polyclonal antibodies, monoclonal antibodies (mAbs), antibody-like polypeptides, such as chimeric antibodies and humanized antibodies, and antibody fragments retaining the ability to specifically bind to the antigen (antigen-binding fragments) provided by any known technique, such as enzymatic cleavage, peptide synthesis, and recombinant techniques.
  • human antibody is intended to include antibodies having variable and constant regions derived from human germline immunoglobulin sequences.
  • the human antibodies of the invention may include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo).
  • human antibody is not intended to include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences.
  • chimeric antibody refers to an antibody that contains one or more regions from one antibody and one or more regions from one or more other antibodies.
  • the term “chimeric antibody” includes divalent and polyvalent antibodies. Chimeric antibodies are produced by recombinant processes well known in the art (see for instance Cabilly et al., PNAS USA 81, 3273-3277 (1984), Morrison et al., PNAS USA 81, 6851-6855 (1984), Boulianne et al., Nature 312, 643-646 (1984), EP125023, Neuberger et al., Nature 314, 268-270 (1985), EP171496, EP173494, WO86/01533, EP184187, Sahagan et al., J. Immunol.
  • a “humanized antibody” is an antibody that is derived from a non-human species, in which certain amino acids in the framework and constant domains of the heavy and light chains have been mutated so as to avoid or abrogate an immune response in humans.
  • Humanized forms of non-human (for instance murine) antibodies are chimeric antibodies which contain minimal sequence derived from non-human immunoglobulin.
  • humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a hypervariable region of the recipient are replaced by residues from a hypervariable region of a non-human species (donor antibody) such as mouse, rat, rabbit or nonhuman primate having the desired specificity, affinity, and capacity.
  • Fv framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues.
  • humanized antibodies may comprise residues which are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance.
  • a humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin and all or substantially all of the FR regions are those of a human immunoglobulin sequence.
  • a humanized antibody typically also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
  • an "isolated antibody” as used herein is intended to refer to an antibody which is substantially free of other antibodies having different antigenic specificities.
  • An isolated antibody that specifically binds to an epitope, isoform or variant of a particular human target antigen may, however, have cross-reactivity to other related antigens, for instance from other species (such as species homologs).
  • an isolated antibody may be substantially free of other cellular material and/or chemicals.
  • monoclonal antibody or “monoclonal antibody composition” as used herein refer to a preparation of antibody molecules of single molecular composition.
  • a monoclonal antibody composition displays a single binding specificity and affinity for a particular epitope.
  • human monoclonal antibody refers to antibodies displaying a single binding specificity which have variable and constant regions derived from human germline immunoglobulin sequences.
  • the human monoclonal antibodies may be generated by a hybridoma which includes a B cell obtained from a transgenic or transchromosomal nonhuman animal, such as a transgenic mouse, having a genome comprising a human heavy chain transgene and a light chain transgene, fused to an immortalized cell.
  • k d (sec "1 ), as used herein, refers to the dissociation rate constant of a particular antibody-antigen interaction. Said value is also referred to as the k off value.
  • k a (M "1 x sec “1 ), as used herein, refers to the association rate constant of a particular antibody-antigen interaction.
  • K D (M), as used herein, refers to the dissociation equilibrium constant of a particular antibody-antigen interaction.
  • isotype refers to the immunoglobulin (sub)class, for instance IgGl, IgG2, IgG3, IgG4, IgD, IgA, IgE, or IgM, that is encoded by heavy chain constant region genes.
  • a human antibody is "derived from" a particular germline sequence if the antibody is obtained from a system using human immunoglobulin sequences, for instance by immunizing a transgenic mouse carrying human immunoglobulin genes or by screening a human immunoglobulin gene library, and wherein the selected human antibody is at least 90%, such as at least 95%, for instance at least 96%, such as at least 97%, for instance at least 98%, or such as at least 99% identical in amino acid sequence to the amino acid sequence encoded by the germline immunoglobulin gene.
  • a human antibody derived from a particular human germline sequence will display no more than 20 amino acid differences, e.g. no more than 10 amino acid differences, such as no more than 5, for instance no more than 4, 3, 2, or 1 amino acid difference from the amino acid sequence encoded by the germline immunoglobulin gene.
  • effector cell refers to an immune cell which is involved in the effector phase of an immune response, as opposed to the cognitive and activation phases of an immune response.
  • exemplary immune cells include a cell of a myeloid or lymphoid origin, for instance lymphocytes (such as B cells and T cells including cytolytic T cells (CTLs)), killer cells, natural killer cells, macrophages, monocytes, eosinophils, polymorphonuclear cells, such as neutrophils, granulocytes, mast cells, and basophils.
  • lymphocytes such as B cells and T cells including cytolytic T cells (CTLs)
  • killer cells such as B cells and T cells including cytolytic T cells (CTLs)
  • killer cells such as B cells and T cells including cytolytic T cells (CTLs)
  • killer cells such as B cells and T cells including cytolytic T cells (CTLs)
  • killer cells such as B cells and T cells including cytolytic T cells (CTLs)
  • killer cells such as B
  • an effector cell is capable of inducing antibody-dependent cellular cytotoxicity (ADCC), such as a natural killer cell, capable of inducing ADCC.
  • ADCC antibody-dependent cellular cytotoxicity
  • monocytes, macrophages, which express FcR are involved in specific killing of target cells and presenting antigens to other components of the immune system, or binding to cells that present antigens.
  • an effector cell may phagocytose a target antigen or target cell.
  • the expression of a particular FcR on an effector cell may be regulated by humoral factors such as cytokines.
  • Fc ⁇ RI has been found to be up-regulated by interferon Y (IFN- ⁇ ) and/or G-CSF. This enhanced expression increases the cytotoxic activity of FcyRI-bearing cells against targets.
  • An effector cell can phagocytose or lyse a target antigen or a target cell.
  • Treatment refers to the administration of an effective amount of a therapeutically active compound of the present invention with the purpose of easing, ameliorating, arresting or eradicating (curing) symptoms or disease states.
  • half-molecule exchange and "Fab arm exchange” are used interchangeably herein and refer to a type of protein modification for human IgG4, in which an IgG4 heavy chain and attached light chain (half-molecule) is swapped for a heavy-light chain pair from another IgG4 molecule.
  • IgG4 molecules may acquire two distinct Fab arms recognizing two distinct antigens (resulting in bispecific molecules) while their Fc domain structure remains unchanged.
  • Fab arm exchange occurs naturally in vivo and can be induced in vitro by purified blood cells or reducing agents such as reduced glutathione.
  • the invention relates to a stabilized IgG4 antibody for use as a medicament, comprising a heavy chain and a light chain, wherein said heavy chain comprises a human IgG4 constant region having a substitution of the Arg residue at position 409, the Phe residue at position 405 or the Lys residue at position 370, wherein said antibody optionally comprises one or more further substitutions, deletions and/or insertions, with the proviso that if the antibody has a residue selected from the group consisting of: Lys, Ala, Thr, Met and Leu at the position corresponding to 409, then the antibody does not comprise a Cys-Pro-Pro-Cys sequence in the hinge region.
  • the antibody comprises a heavy chain and a light chain, wherein said heavy chain comprises a human IgG4 constant region having a residue selected from the group consisting of: Lys, Ala, Thr, Met and Leu at the position corresponding to 409 and/or a residue selected from the group consisting of: Ala, VaI, GIy, He and Leu at the position corresponding to 405, and wherein said antibody optionally comprises one or more further substitutions, deletions and/or insertions, but does not comprise a Cys-Pro-Pro-Cys sequence in the hinge region.
  • said heavy chain comprises a human IgG4 constant region having a residue selected from the group consisting of: Lys, Ala, Thr, Met and Leu at the position corresponding to 409 and/or a residue selected from the group consisting of: Ala, VaI, GIy, He and Leu at the position corresponding to 405, and wherein said antibody optionally comprises one or more further substitutions, deletions and/or insertions, but does not
  • the numbers 405 and 409 refer to the Phe and Lys residues at positions 405 and 409, respectively, using the numbering according to the EU index, see also Example 38 and figure 22.
  • the invention relates to an isolated stabilized IgG4 antibody, comprising a heavy chain and a light chain, wherein said heavy chain comprises a human IgG4 constant region having a residue selected from the group consisting of: Lys, Ala, Thr, Met and Leu at the position corresponding to 409 and/or a residue selected from the group consisting of: Ala, VaI, GIy, He and Leu at the position corresponding to 405, and wherein said antibody optionally comprises further substitutions, deletions and/or insertions, but does not comprise a Cys-Pro-Pro-Cys sequence in the hinge region and does not comprise both a Lys at position 409 and a Leu at position 309.
  • said antibody comprises a Lys, Thr, Met or Leu residue at the position corresponding to 409.
  • said antibody comprises a Lys, Met or Leu residue at the position corresponding to 409.
  • the CH3 region of the antibody has been replaced by the CH3 region of human IgGl, of human IgG2 or of human IgG3.
  • the antibody has a residue which is has a lower mass (in Da) than Phe at the position corresponding to 405.
  • said antibody comprises an Ala, VaI, GIy, He or Leu residue at the position corresponding to 405.
  • the stabilized IgG4 antibody of the invention does not comprise a substitution of the Leu residue at the position corresponding to 235 by a GIu.
  • said antibody does comprise a substitution of the Leu residue at the position corresponding to 235 by a GIu.
  • the antibody of the invention comprises one or more of the following substitutions: an Ala at position 234, an Ala at position 236, an Ala at position 237, an Ala at position 297, an Ala or VaI at position 318, an Ala at position 320, an Ala or GIn at position 322.
  • the stabilized IgG4 antibody of the invention does not comprise a Cys-Pro-Pro-Cys sequence in the hinge region.
  • the stabilized IgG4 antibody of the invention comprises a CXPC or CPXC sequence in the hinge region, wherein X can be any amino acid except for proline.
  • the antibody of the invention does not comprise a CPRC sequence in the core hinge region and/or does not comprise an extended IgG3-like hinge region, such as the extended hinge region as set forth in figure 22 (between positions 228 and 229 in IgG3).
  • the stabilized IgG4 antibody of the invention comprises a CPSC sequence in the hinge region.
  • the stabilized IgG4 antibody of the invention comprises a constant heavy chain region comprising an amino acid sequence selected from the group consisting of: SEQ ID NO:39, 40 and 41 or a variant of said amino acid sequence having less than 25, such as less than 10, e.g. less than 9, 8, 7, 6, 5, 4, 3, or 2 substitutions, deletions and/or insertions compared to said amino acid sequence.
  • the stabilized IgG4 antibody of the invention has a lower ability to activate effector functions as compared to IgGl and IgG3,
  • said antibody is less efficient in mediating CDC and/or ADCC than a corresponding IgGl or IgG3 antibody having the same variable regions.
  • Assays for measuring CDC or ADCC activity are well known in the art.
  • the antibody of the invention comprises a human kappa light chain. In another embodiment, said antibody comprises a human lambda light chain.
  • the stabilized IgG4 antibody of the invention is a bivalent antibody, for example an antibody which is bivalent even in the presence of excess of irrelevant antibodies, as explained in Example 38.
  • the stabilized IgG4 antibody of the invention is preferably a full-length antibody, i.e. not a fragment.
  • antibodies of the invention are monoclonal antibodies.
  • Monoclonal antibodies may e.g. be produced by the hybridoma method first described by Kohler et al., Nature 256, 495 (1975), or may be produced by recombinant DNA methods.
  • Monoclonal antibodies may also be isolated from phage antibody libraries using the techniques described in, for example, Clackson et al., Nature 352, 624-628 (1991) and Marks et al., J. MoI. Biol. 222, 581-597 (1991).
  • Monoclonal antibodies may be obtained from any suitable source.
  • monoclonal antibodies may be obtained from hybridomas prepared from murine splenic B cells obtained from mice immunized with an antigen of interest, for instance in form of cells expressing the antigen on the surface, or a nucleic acid encoding an antigen of interest.
  • Monoclonal antibodies may also be obtained from hybridomas derived from antibody-expressing cells of immunized humans or non-human mammals such as rats, dogs, primates, etc.
  • the antibody of the invention is a human antibody.
  • Human monoclonal antibodies directed may be generated using transgenic or transchromosomal mice carrying parts of the human immune system rather than the mouse system.
  • transgenic and transchromosomic mice include mice referred to herein as HuMAb mice and KM mice, respectively, and are collectively referred to herein as "transgenic mice”.
  • the HuMAb mouse contains a human immunoglobulin gene miniloci that encodes unrearranged human heavy ( ⁇ and Y) and K light chain immunoglobulin sequences, together with targeted mutations that inactivate the endogenous ⁇ and K chain loci (Lonberg, N. et al., Nature 368, 856-859 (1994)). Accordingly, the mice exhibit reduced expression of mouse IgM or K and in response to immunization, the introduced human heavy and light chain transgenes, undergo class switching and somatic mutation to generate high affinity human IgG, K monoclonal antibodies (Lonberg, N. et al. (1994), supra; reviewed in Lonberg, N. Handbook of Experimental Pharmacology 113, 49-101 (1994), Lonberg, N.
  • HuMAb mice The preparation of HuMAb mice is described in detail in Taylor, L. et al., Nucleic Acids Research 20, 6287-6295 (1992), Chen, J. et al., International Immunology 5, 647-656 (1993), Tuaillon et al., J. Immunol. 152, 2912-2920 (1994), Taylor, L. et al., International Immunology 6, 579-591 (1994), Fishwild, D. et al., Nature Biotechnology 14, 845-851 (1996).
  • the HCo7 mice have a JKD disruption in their endogenous light chain (kappa) genes (as described in Chen et al., EMBO J. 12, 821-830 (1993)), a CMD disruption in their endogenous heavy chain genes (as described in Example 1 of WO 01/14424), a KCo5 human kappa light chain transgene (as described in Fishwild et al., Nature Biotechnology 14, 845-851 (1996)), and a HCo7 human heavy chain transgene (as described in US 5,770,429).
  • Human monoclonal or polyclonal antibodies to be used in the present invention, or antibodies used in the present invention originating from other species may also be generated transgenically through the generation of another non-human mammal or plant that is transgenic for the immunoglobulin heavy and light chain sequences of interest and production of the antibody in a recoverable form therefrom.
  • antibodies may be produced in, and recovered from, the milk of goats, cows, or other mammals. See for instance US 5,827,690, US 5,756,687, US 5,750,172 and US 5,741,957.
  • human or other antibodies to be used in the present invention may be generated through display-type technologies, including, without limitation, phage display, retroviral display, ribosomal display, and other techniques, using techniques well known in the art and the resulting molecules may be subjected to additional maturation, such as affinity maturation, as such techniques are well known in the art (see for instance Hoogenboom et al., J. MoI. Biol.
  • the antibody of the invention is linked to a compound selected from the group consisting of: a cytotoxic agent; a radioisotope; a prodrug or drug, such as a taxane; a cytokine; and a chemokine.
  • a compound selected from the group consisting of: a cytotoxic agent; a radioisotope; a prodrug or drug, such as a taxane; a cytokine; and a chemokine are well-known in the art. References to suitable methods have been given in WO 2004/056847 (Genmab).
  • the invention relates to a pharmaceutical composition
  • a pharmaceutical composition comprising a stabilized IgG4 antibody as defined herein above.
  • the pharmaceutical compositions may be formulated with pharmaceutically acceptable carriers or diluents as well as any other known adjuvants and excipients in accordance with conventional techniques, such as those disclosed in Remington : The Science and Practice of Pharmacy, 19th Edition, Gennaro, Ed., Mack Publishing Co., Easton, PA, 1995.
  • the pharmaceutically acceptable carriers or diluents as well as any other known adjuvants and excipients should be suitable for the chosen compound of the present invention and the chosen mode of administration. Suitability for carriers and other components of pharmaceutical compositions is determined based on the lack of significant negative impact on the desired biological properties of the chosen compound or pharmaceutical composition of the present invention (e.g., less than a substantial impact (10% or less relative inhibition, 5% or less relative inhibition, etc.) on antigen binding.
  • a pharmaceutical composition of the present invention may also include diluents, fillers, salts, buffers, detergents (e. g., a nonionic detergent, such as Tween-80), stabilizers, stabilizers (e. g., sugars or protein-free amino acids), preservatives, tissue fixatives, solubilizers, and/or other materials suitable for inclusion in a pharmaceutical composition.
  • detergents e. g., a nonionic detergent, such as Tween-80
  • stabilizers e. g., sugars or protein-free amino acids
  • preservatives e. g., tissue fixatives, solubilizers, and/or other materials suitable for inclusion in a pharmaceutical composition.
  • Actual dosage levels of the active ingredients in the pharmaceutical compositions of the present invention may be varied so as to obtain an amount of the active ingredient which is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, without being toxic to the patient.
  • the selected dosage level will depend upon a variety of pharmacokinetic factors including the activity of the particular compositions of the present invention employed, or the ester, salt or amide thereof, the route of administration, the time of administration, the rate of excretion of the particular compound being employed, the duration of the treatment, other drugs, compounds and/or materials used in combination with the particular compositions employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors well known in the medical arts.
  • a physician or veterinarian having ordinary skill in the art can readily determine and prescribe the effective amount of the pharmaceutical composition required.
  • the physician or veterinarian could start doses of the compounds of the invention employed in the pharmaceutical composition at levels lower than that required in order to achieve the desired therapeutic effect and gradually increase the dosage until the desired effect is achieved.
  • a suitable daily dose of a composition of the invention will be that amount of the compound which is the lowest dose effective to produce a therapeutic effect.
  • Such an effective dose will generally depend upon the factors described above. It is preferred that administration be intravenous, intramuscular, intraperitoneal, by inhalation or subcutaneous.
  • the effective daily dose of a therapeutic composition may be administered as two, three, four, five, six or more sub-doses administered separately at appropriate intervals throughout the day, optionally, in unit dosage forms.
  • Stabilized IgG4 antibodies of the invention can be used in the treatment and/or prevention of a number of diseases, and be directed to an antigen selected from a broad variety of suitable target molecules.
  • the antibody binds an antigen selected from the group consisting of: erythropoietin, beta-amyloid, thrombopoietin, interferon-alpha (2a and 2b), interferon-beta (Ib), interferon-gamma, TNFR I (CD120a), TNFR II (CD120b), IL-IR type 1 (CD121a), IL-IR type 2 (CD121b), IL- 2, IL2R (CD25), IL-2R-beta (CD123), IL-3, IL-4, IL-3R (CD123), IL-4R (CD124), IL-5R (CD125), IL-6R-alpha (CD126), -beta (CD130), IL-8, IL-IO, IL-I
  • the antibody binds an alpha-4 integrin and is for use in the treatment of inflammatory and autoimmune diseases, such as rheumatoid arthritis, multiple sclerosis, inflammatory bowel disease, asthma and sepsis.
  • inflammatory and autoimmune diseases such as rheumatoid arthritis, multiple sclerosis, inflammatory bowel disease, asthma and sepsis.
  • the antibody binds a molecule selected from the group consisting of: LFA-I, MAC-I, l-selectin and PSGL-I and is for use in the treatment of inflammatory and autoimmune diseases, such as rheumatoid arthritis, multiple sclerosis, inflammatory bowel disease, asthma, type-1 diabetes, SLE, psoriasis, atopic dermatitis, and COPD.
  • inflammatory and autoimmune diseases such as rheumatoid arthritis, multiple sclerosis, inflammatory bowel disease, asthma, type-1 diabetes, SLE, psoriasis, atopic dermatitis, and COPD.
  • the antibody binds a molecule selected from the group consisting of: LFA-I, MAC-I, l-selectin and PSGL-I and is for use in the treatment of a disease selected from the group consisting of ischemia-reperfusion injury, cytic fibrosis, osteomyelitis, glomerulonepritis, gout and sepsis.
  • the antibody binds Cdl la and is for use in the treatment of inflammatory and autoimmune diseases, such as rheumatoid arthritis, multiple sclerosis, inflammatory bowel disease, asthma, type-1 diabetes, SLE, psoriasis, atopic dermatitis and COPD.
  • inflammatory and autoimmune diseases such as rheumatoid arthritis, multiple sclerosis, inflammatory bowel disease, asthma, type-1 diabetes, SLE, psoriasis, atopic dermatitis and COPD.
  • the antibody binds ICAM-I and is for use in the treatment of inflammatory and autoimmune diseases, such as rheumatoid arthritis, multiple sclerosis, inflammatory bowel disease, asthma, type-1 diabetes, SLE, psoriasis, atopic dermatitis and COPD.
  • inflammatory and autoimmune diseases such as rheumatoid arthritis, multiple sclerosis, inflammatory bowel disease, asthma, type-1 diabetes, SLE, psoriasis, atopic dermatitis and COPD.
  • the antibody binds P-selectin and is for use in the treatment of cardiovascular diseases, post-thrombotic vein wall fibrosis, ischemia reperfusion injury, inflammatory diseases or sepsis.
  • the antibody binds periostin and is for use in the treatment of malignant diseases and/or metastising diseases, such as ovary cancer, endometrial cancer, NSCLC, glioblastoma, brain-related tumors, breast cancer, OSCC, colon cancer, pancreatic cancer, HNSCC, kidney cancer, thymoma, lung cancer, skin cancer, larynx cancer, liver cancer, parotid tumors, gastric cancer, esophagus cancer, prostate cancer, bladder cancer and cancer of the testis.
  • malignant diseases and/or metastising diseases such as ovary cancer, endometrial cancer, NSCLC, glioblastoma, brain-related tumors, breast cancer, OSCC, colon cancer, pancreatic cancer, HNSCC, kidney cancer, thymoma, lung cancer, skin cancer, larynx cancer, liver cancer, parotid tumors, gastric cancer, esophagus cancer, prostate cancer, bladder cancer and cancer of the test
  • the antibody binds CD33 (Siglec 3), is optionally coupled to a toxin, cytotoxic or cytostatic drug, and is for use in the treatment of tumors expressing CD33 or acute myeloid leukemia.
  • the antibody binds Siglec 8 and is for use in the treatment of: asthma, inflammatory or autoimmune diseases, such as rheumatoid arthritis, multiple sclerosis, inflammatory bowel disease, asthma, type-1 diabetes, SLE, psoriasis, atopic dermatitis and COPD.
  • inflammatory or autoimmune diseases such as rheumatoid arthritis, multiple sclerosis, inflammatory bowel disease, asthma, type-1 diabetes, SLE, psoriasis, atopic dermatitis and COPD.
  • the antibody binds nucleolin and is for use in the treatment of malignant diseases and/or metastising diseases, such as ovary cancer, cervical cancer, endometrial cancer, NSCLC, glioblastoma, brain-related tumors, breast cancer, OSCC, colon cancer, pancreatic cancer, HNSCC, kidney cancer, thymoma, lung cancer, skin cancer, larynx cancer, liver cancer, parotid tumors, gastric cancer, oesophagus cancer, prostate cancer, bladder cancer, cancer of the testis and lymphomas.
  • malignant diseases and/or metastising diseases such as ovary cancer, cervical cancer, endometrial cancer, NSCLC, glioblastoma, brain-related tumors, breast cancer, OSCC, colon cancer, pancreatic cancer, HNSCC, kidney cancer, thymoma, lung cancer, skin cancer, larynx cancer, liver cancer, parotid tumors, gastric cancer, oesophagus cancer
  • the antibody binds CCLl, CCL2, CCL3, CCL4, CCL5, CCLI l, CCL13, CCL17, CCL18, CCL20, CCL22, CCL26, CCL27 or CX3CL1 and is for use in the treatment of: : atopic dermatitis, inflammatory and autoimmune diseases, such as rheumatoid arthritis, multiple sclerosis, inflammatory bowel disease, asthma, type-1 diabetes, SLE, psoriasis, COPD and sepsis.
  • atopic dermatitis such as rheumatoid arthritis, multiple sclerosis, inflammatory bowel disease, asthma, type-1 diabetes, SLE, psoriasis, COPD and sepsis.
  • the antibody binds PD-I and is for use in restoring T cell function in HIV-I infection and therapy of AIDS.
  • the antibody binds LIGHT and is for use in the treatment of a disease selected from the group consisting of: hepatitis, inflammatory bowel disease, graft-versus-host disease (GVHD) and inflammation.
  • a disease selected from the group consisting of: hepatitis, inflammatory bowel disease, graft-versus-host disease (GVHD) and inflammation.
  • the antibody binds EGF, VEGF, TGFalpha or HGF and is for use in the treatment of: malignant diseases, such as solid cancers.
  • the antibody binds PDGF and is for use in the treatment of: diseases in which abnormal cell proliferation cell migration and/or angiogenesis occurs, such as atherosclerosis, fibrosis, and malignant diseases.
  • the antibody binds complement or a related components such as: CIq, C4, C2, C3, C5, C6, C7, C8, C9, MBL, or factor B and is for use in : diseases in which complement and related components play a detrimental role, such as organ transplant rejection, multiple sclerosis, Guillain-Barre syndrome, hemolytic anemia, Paroxysmal Nocturnal Hemoglobinuria, stroke, heart attacks, burn injuries, age-related macular degeneration, asthma, lupus, arthritis, myasthenia gravis, anti-phospholipid syndrome, sepsis and ischemia reperfusion injury.
  • diseases in which complement and related components play a detrimental role such as organ transplant rejection, multiple sclerosis, Guillain-Barre syndrome, hemolytic anemia, Paroxysmal Nocturnal Hemoglobinuria, stroke, heart attacks, burn injuries, age-related macular degeneration, asthma, lupus, arthritis, myasthenia gravis, anti-phospholipid syndrome, sepsis and
  • the antibody binds a Matrix Metallo Protease such as any of MMPl to MMP28 and is for use in the treatment of: inflammatory and autoimmune diseases, cancer, including metastatic cancer; arthritis, inflammation, cardiovascular diseases, cerebrovascular diseases such as stroke or cerebral aneurysms, pulmonary diseases such as asthma, ocular diseases such as corneal wound healing or degenerative genetic eye diseases, gastrointestinal diseases such as inflammatory bowel disease or ulcers, oral diseases such as dental caries, oral cancer or periodontitis, ischemia reperfusion injury or sepsis.
  • inflammatory and autoimmune diseases cancer, including metastatic cancer
  • arthritis inflammation
  • cardiovascular diseases cerebrovascular diseases such as stroke or cerebral aneurysms
  • pulmonary diseases such as asthma
  • ocular diseases such as corneal wound healing or degenerative genetic eye diseases
  • gastrointestinal diseases such as inflammatory bowel disease or ulcers
  • oral diseases such as dental caries, oral cancer or periodontitis, ischemia reperfusion injury or sepsis.
  • the antibody binds CD32b and is for use in enhancement of T-cell responses to tumor antigens and ADCC/ phagocytosis by macrophages, in combination with another therapeutic antibody; vaccination, immunotherapy of B-cell lymphoma's, asthma or allergy.
  • the antibody binds CD200 or CD200R and is for use in the treatment of: asthma, rheumatoid arthritis, GVHD, other autoimmune diseases, or cancer, such as solid tumors or lymphomas.
  • the antibody binds Killer Immunoglobulin-Like Receptors (KIRs), NKG2D or related molecules, leukocyte- associated immunoglobulin-like receptors (LAIRs), or Iy49 and is for use in the treatment of: cancer, such as solid tumors or lymphomas; asthma, rheumatoid arthritis, GVHD or other autoimmune diseases.
  • KIRs Killer Immunoglobulin-Like Receptors
  • NKG2D or related molecules binds Killer Immunoglobulin-Like Receptors
  • LAIRs leukocyte- associated immunoglobulin-like receptors
  • Iy49 is for use in the treatment of: cancer, such as solid tumors or lymphomas; asthma, rheumatoid arthritis, GVHD or other autoimmune diseases.
  • the antibody binds BST-2 and is for use in the treatment of: asthma, atherosclerosis, rheumatoid arthritis, psoriasis, Crohn's disease, ulcerative cholitis, atopic dermatitis, sepsis or inflammation.
  • the antibody binds ML-IAP (melanoma inhibitor of apoptosis protein) and is for use in the treatment of melanoma.
  • ML-IAP melanoma inhibitor of apoptosis protein
  • the antibody binds CD40 or CD40R and is for use in the treatment of: cancer, in particular B-cell lymphomas, B-cell-related or - mediated diseases, autoimmune diseases such as psoriatic arthritis, rheumatoid arthritis, multiple sclerosis, psoriasis, Crohn's disease or ulcerative cholitis.
  • the antibody binds CD79 and is for use in the treatment of B-cell-related or -mediated diseases, such as B-cell lymphomas, leukemia, autoimmune diseases, inflammation or allergy.
  • B-cell-related or -mediated diseases such as B-cell lymphomas, leukemia, autoimmune diseases, inflammation or allergy.
  • the antibody binds a T cell receptor and is for use in the treatment of T-cell-related or -mediated diseases, such as T-cell lymphomas, leukemia, autoimmune diseases, inflammation or allergy.
  • T-cell-related or -mediated diseases such as T-cell lymphomas, leukemia, autoimmune diseases, inflammation or allergy.
  • the antibody binds FcalphaRI and is for use in the treatment of a disease or disorder selected from: allergic asthma or other allergic diseases such as allergic rhinitis, seasonal/perennial allergies, hay fever, nasal allergies, atopic dermatitis, eczema, hives, urticaria, contact allergies, allergic conjunctivitis, ocular allergies, food and drug allergies, latex allergies, or insect allergies, or IgA nephropathy, such as IgA pemphigus.
  • allergic asthma or other allergic diseases such as allergic rhinitis, seasonal/perennial allergies, hay fever, nasal allergies, atopic dermatitis, eczema, hives, urticaria, contact allergies, allergic conjunctivitis, ocular allergies, food and drug allergies, latex allergies, or insect allergies, or IgA nephropathy, such as IgA pemphigus.
  • the antibody binds IL-8 and is for use in the treatment of a disease or disorder selected from the group consisting of: palmoplantar pustulosis (PPP), psoriasis, or other skin diseases, inflammatory, autoimmune and immune disorders, alcoholic hepatitis and acute pancreatitis, diseases involving IL-8 mediated angiogenesis.
  • a disease or disorder selected from the group consisting of: palmoplantar pustulosis (PPP), psoriasis, or other skin diseases, inflammatory, autoimmune and immune disorders, alcoholic hepatitis and acute pancreatitis, diseases involving IL-8 mediated angiogenesis.
  • the antibody binds CD20 and is for use in the treatment of a disease or disorder selected from the group consisting of: rheumatoid arthritis, (auto)immune and inflammatory disorders, non-Hodgkin's lymphoma, B-CLL, lymphoid neoplasms, malignancies and hematological disorders, infectious diseases and connective disorders, neurological disorders, gastrointestinal disorders, hepatic disorders, allergic disorders, hematological disorders, skin disorders, pulmonary disorders, malignant disorders, endocrinological disorders, vascular disorders, infectious disorders, kidney disorders, cardiac disorders, circulatory disorders, metabolic disorders, bone and muscle disorders, and immune mediated cytopenia.
  • a disease or disorder selected from the group consisting of: rheumatoid arthritis, (auto)immune and inflammatory disorders, non-Hodgkin's lymphoma, B-CLL, lymphoid neoplasms, malignancies and hematological disorders, infectious diseases and connective disorders, neurological disorders,
  • the antibody binds CD38 and is for use in the treatment of a disease or disorder selected from the group consisting of: tumorigenic disorders, immune disorders in which CD38 expressing B cells, plasma cells, monocytes and T cells are involved, acute respiratory distress syndrome and choreoretinitis, rheumatoid arthritis, inflammatory, immune and/or autoimmune disorders in which autoantibodies and/or excessive B and T lymphocyte activity are prominent, skin disorders, immune-mediated cytopenias, connective tissue disorders, arthritides, hematological disorders, endocrinopathies, hepato-gastrointestinal disorders, nephropathies, neurological disorders, cardiac and pulmonary disorders, allergic disorders, ophthalmologic disorders, infectious diseases, gynecological-obstetrical disorders, male reproductive disorders, transplantation-derived disorders,
  • a disease or disorder selected from the group consisting of: tumorigenic disorders, immune disorders in which CD38 expressing B cells, plasma cells, monocytes and T cells are involved, acute respiratory distress syndrome and choreoreti
  • the antibody binds EGFr and is for use in the treatment of a disease or disorder selected from the group consisting of: cancers (over)expressing EGFr and other EGFr related diseases, such as autoimmune diseases, psoriasis, inflammatory arthritis.
  • the antibody binds CD4 and is for use in the treatment of a disease or disorder selected from the group consisting of: rheumatoid arthritis, (auto)immune and inflammatory disorders, cutaneous T cell lymphomas, non- cutaneous T cell lymphomas, lymphoid neoplasms, malignancies and hematological disorders, infectious diseases, and connective disorders, neurological disorders, gastrointestinal disorders, hepatic disorders, allergic disorders, hematologic disorders, skin disorders, pulmonary disorders, malignant disorders, endocrinological disorders, vascular disorders, infectious disorders, kidney disorders, cardiac disorders, circulatory disorders, metabolic disorders, bone disorders, muscle disorders, immune mediated cytopenia, and HIV infection/AIDS.
  • a disease or disorder selected from the group consisting of: rheumatoid arthritis, (auto)immune and inflammatory disorders, cutaneous T cell lymphomas, non- cutaneous T cell lymphomas, lymphoid neoplasms, malignancies and hematological disorders, infectious diseases,
  • the antibody binds CD28 and is for use in the treatment of a disease or disorder selected from the group consisting of: an inflammatory disease, autoimmune disease and immune disorder.
  • the antibody binds tissue factor, or a complex of Factor VII and tissue factor and is for use in the treatment of a disease or disorder selected from the group consisting of: vascular diseases, such as myocardial vascular disease, cerebral vascular disease, retinopathy and macular degeneration, and inflammatory disorders.
  • vascular diseases such as myocardial vascular disease, cerebral vascular disease, retinopathy and macular degeneration
  • inflammatory disorders such as myocardial vascular disease, cerebral vascular disease, retinopathy and macular degeneration
  • the invention relates to the use of a stabilized IgG4 antibody that binds any of the antigen mentioned herein above for the preparation of a medicament for the treatment of a disease or disorder as mentioned herein above in connection with said target antigen.
  • Oligonucleotide primers were synthesized and quantified by Isogen Bioscience (Maarssen, The Netherlands). Primers were dissolved in H 2 O to 100 pmol/ ⁇ l and stored at -20°C. A summary of all PCR and sequencing primers is given below. For PCR, PfuTurbo® Hotstart DNA polymerase (Stratagene, Amsterdam, The Netherlands) was used according to the manufacturer's instructions.
  • Each reaction mix contained 200 ⁇ M mixed dNTPs (Roche Diagnostics, Almere, The Netherlands), 6.7 pmol of both the forward and reverse primer, 100 ng of genomic DNA or 1 ng of plasmid DNA and 1 unit of PfuTurbo® Hotstart DNA polymerase in PCR reaction buffer (supplied with polymerase) in a total volume of 20 ⁇ l.
  • PCR reactions were carried out with a TGradient Thermocycler 96 (Whatman Biometra, Goettingen, Germany) using a 32-cycle program: denaturing at 95°C for 2 min; 30 cycles of 95°C for 30 sec, a 60-70°C gradient (or another specific annealing temperature) for 30 sec, and 72°C for 3 min; final extension at 72°C for 10 min. If appropriate, the PCR mixtures were stored at 4°C until further analysis or processing.
  • PCR or digestion products were separated by agarose gel electrophoresis (e.g. when multiple fragments were present) using a 1% Tris Acetate EDTA agarose gel.
  • the desired fragment was excised from the gel and recovered using the QIAEX II Gel Extraction Kit (Qiagen; product* 20051), according to the manufacturer's instructions.
  • DNA 100 ng was digested with 5 units of enzyme(s) in the appropriate buffer in a final volume of 10 ⁇ l (reaction volumes were scaled up as appropriate). Digestions were incubated at the recommended temperature for a minimum of 60 min. For fragments requiring double digestions with restriction enzymes which involve incompatible buffers or temperature requirements, digestions were performed sequentially. If necessary digestion products were purified by agarose gel electrophoresis and gel extraction.
  • Ligations of DNA fragments were performed with the Quick Ligation Kit (New England Biolabs) according to the manufacturer's instructions. For each ligation, vector DNA was mixed with approximately three-fold molar excess of insert DNA.
  • Plasmid DNA (1-5 ⁇ l of DNA solution, typically 2 ⁇ l of DNA ligation mix) was transformed into One Shot DH5 ⁇ -Tl R or MACH-I T1 R competent E. coli cells (Invitrogen, Breda, The Netherlands; product* 12297-016) using the heat-shock method, according to the manufacturer's instructions. Next, cells were plated on Luria-Bertani (LB) agar plates containing 50 ⁇ g/ml ampicillin. Plates were incubated for 16-18 h at 37°C until bacterial colonies became evident.
  • LB Luria-Bertani
  • Example 8 Screening of bacterial colonies by PCR
  • Bacterial colonies were screened for the presence of vectors containing the desired sequences via colony PCR using the HotStarTaq Master Mix Kit (Qiagen; product* 203445) and the appropriate forward and reverse primers. Selected colonies were lightly touched with a 20 ⁇ l pipette tip and touched briefly in 2 ml LB for small scale culture, and then resuspended in the PCR mix. PCR was performed with a TGradient Thermocycler 96 using a 35-cycle program: denaturation at 95°C for 15 min; 35 cycles of 94°C for 30 sec, 55°C for 30 sec and 72°C for 2 min; followed by a final extension step of 10 min at 72°C. If appropriate, the PCR mixtures were stored at 4°C until analysis by agarose gel electrophoresis.
  • Example 9 Plasmid DNA isolation from E. coli culture
  • Plasmid DNA was isolated from E. coli cultures using the following kits from Qiagen (via Westburg, Leusden, The Netherlands), according to the manufacturer's instructions.
  • Qiagen via Westburg, Leusden, The Netherlands
  • For bulk plasmid preparation 50-150 ml culture, either a HiSpeed Plasmid Maxi Kit (product* 12663) or a HiSpeed Plasmid Midi Kit (product* 12643) was used.
  • For small scale plasmid preparation ( ⁇ 2 ml culture) a Qiaprep Spin Miniprep Kit (product* 27106) was used and DNA was eluted in 50 ⁇ l elution buffer (supplied with kit).
  • Plasmid DNA was sequenced using standard procedures known in the art. Sequences were analyzed using Vector NTI software (Informax, Oxford, UK).
  • FreestyleTM 293-F (a HEK-293 subclone adapted to suspension growth and chemically defined Freestyle medium, e. g. HEK-293F) cells were obtained from Invitrogen and transfected according to the manufacturer's protocol using 293fectin (Invitrogen).
  • Example 12 Construction of pTomG4; A vector for the expression of variable heavy chain regionswith the constant region of human lgG4
  • Genomic DNA was isolated from a blood sample of a volunteer and used as a template in a PCR with primers IGG4gene2f and IGG4gene2r (see table below), amplifying the complete genomic constant region of the heavy chain of IgG4 and introducing suitable restriction sites for cloning into the mammalian expression vector pEE6.4 (Lonza Biologies)
  • the PCR fragment was purified and cloned into pEE6.4.
  • the PCR product was digested with HindIII and EcoRI, followed by heat inactivation of the restriction enzymes.
  • the pEE6.4 vector was digested HindIII and EcoRI, followed by heat inactivation of the restriction enzymes and dephosphorylation of the vector fragment with shrimp alkaline phosphatase, followed by heat inactivation of the phosphatase.
  • the IgG4 fragment and the pEE6.4HindIII/EcoRI dephosphorylated vector were ligated and transformed into competent MACH1-T1 R cells (Invitrogen). Three clones were grown in LB and plasmid DNA was isolated from a small culture (1.5 ml_). Restriction digestion revealed a pattern consistent with the cloning of the IgG4 fragment in the pEE6.4 vector. Plasmid DNA from two clones was transformed in DH5 ⁇ -Tl R E.
  • coli and plasmid DNA was isolated and the constructs were checked by sequence analysis of the insert and one clone was found to be identical to a genomic IgG4 clone from the Genbank database, apart from some minor differences in introns. These differences are presumably either polymorphisms or sequence faults in the Genbank sequence.
  • the plasmid was named pTomG4.
  • RNA was prepared from 0.3xl0 5 (Betvl) or 0.9xl0 5 (FeIdI) mouse hybridoma cells
  • RNeasy kit (Qiagen, Westburg, Leusden, Netherlands) according to the manufacturer's protocol.
  • RNA 5'-RACE-Complementary DNA (cDNA) of RNA was prepared from approximately 100 ng total RNA, using the SMART RACE cDNA Amplification kit (BD Biosciences Clontech, Mountain View, CA, USA), following the manufacturer's protocol. The VL and VH regions of the Betvl and FeIdI antibody were amplified by PCR. For this PfuTurbo® Hotstart DNA polymerase (Stratagene) was used according to the manufacturer's instructions.
  • SMART RACE cDNA Amplification kit BD Biosciences Clontech, Mountain View, CA, USA
  • Each reaction mix contained 200 ⁇ M mixed dNTPs (Roche Diagnostics), 12 pmol of the reverse primer (RACEGlmml for the VH region and RACEKmml for the VL region), 7.2 pmol UPM-Mix (UPM-Mix: 2 ⁇ M ShortUPMH3 and 0.4 ⁇ M LongUPMH3 oligonucleotide), 0.6 ⁇ l of the 5'RACE cDNA template as described above, and 1.5 unit of PfuTurbo® Hotstart DNA polymerase in PCR reaction buffer (supplied with polymerase) in a total volume of 30 ⁇ l.
  • PCR reactions were carried out with a TGradient Thermocycler 96 (Whatman Biometra) using a 35-cycle program : denaturing at 95°C for 2 min; 35 cycles of 95°C for 30 sec, a 55°C for 30 sec, and 72°C for 1.5 min; final extension at 72°C for 10 min.
  • the reaction products were separated by agarose gel electrophoresis on a 1 % TAE agarose gel and stained with ethidium bromide. Bands of the correct size were cut from the gels and the DNA was isolated from the agarose using the QiaexII gel extraction kit (Qiagen).
  • VH sequence Betvi (SEQ ID NO: 15): mkcswvifflmavvtgvnsevqlqqsgaelvkpgasvklsctasgfnikdtyihwvkqrpeqglewvgridpatgntrydpk fqgkatitadtssntaylqlssltsedtavyycasfrpgyaldywgqgtsvtvsss
  • VL sequence Betvi (SEQ I D N0:16) : mesqiqafvfvflwlsgvdgdivmtqshkfmstsvgdrvsftckasqdvftavawyqqkpgqspklliywastrrtgvpdrft gsgsgtdytltissvqaedlalyycqqhfstpptfgggtkleik
  • VH sequence FeIdI (SEQ ID N0:17): mgwsyiilflvatatdvhsqvqlqqpgaelvkpgasvklsckasgysftsywmhwlkqrpgqglewigeinpnngrtyyne kfktkatltvdkssstaymqlnsltsedsavyycarrltmvesfaywgqgtlvtfsa
  • VL sequence FeIdI (SEQ I D N0:18) : mesqtqvlmsllfwvsgtcgdivmtqspssltvtagekvtmsckssqsllnsgnqknyltwyqqkpgqppklliywastres gvpdrftgsgsgtdfsltissvqaedlaiyycqndysypftfgsgtkleik
  • Example 14 Construction of pConGI f BetV1 : A vector for the production of the heavy chain of Betv1-lgG1
  • the V H coding region of mouse anti-BetVl antibody was amplified by PCR from a plasmid containing this region (example 13) using the primers VHexbetvlfor and VHexbetvlrev, introducing suitable restriction sites for cloning into pConGlfO.4 and an ideal Kozak sequence.
  • the VH fragment was gel purified and cloned into pConGlfO.4.
  • the PCR product and the pConKappa0.4 vector were digested with HindIII and Apal and purified.
  • the V H fragment and the pConGlf0.4HindIII-ApaI digested vector were ligated and transformed into competent DH5 ⁇ -Tl R cells. A clone was selected containing the correct insert size and the correct sequence was confirmed.
  • This plasmid was named pConGlfBetvl.
  • Example 15 Construction of pConKBetvi: A vector for the production of the light chain of Betvi
  • the V L coding region mouse anti-BetVl antibody was amplified from a plasmid containing this region (example 13) using the primers VLexbetvlfor and VLexbetvlrev, introducing suitable restriction sites for cloning into pConK0.4 and an ideal Kozak sequence.
  • the PCR product and the pConKappa0.4 vector were digested with HindIII and BsiWI and purified.
  • the V L fragment and the pConKappa0.4HindIII-BsiWI digested vector were ligated and transformed into competent DH5 ⁇ T1 R E. coli. A clone was selected containing the correct insert size and the sequence was confirmed. This plasmid was named pConKBetvl.
  • Example 16 Construction of pTom G4Betv1 : A vector for the production of the heavy chain of Betv1-lgG4
  • pTomG4 and pConGlfBetvl were digested with HindIII and Apal and the relevant fragments were isolated.
  • the Betvl V H fragment and the pTomG4HindIII-ApaI digested vector were ligated and transformed into competent DH5 ⁇ -Tl R cells. A clone was selected containing the correct insert size and the sequence was confirmed. This plasmid was named pTomG4Betvl.
  • Example 17 Construction of pConGI f FeIdI : A vector for the production of the heavy chain of FeId 1 -IgGI
  • the V H coding region of mouse anti-Feldl antibody was amplified by PCR from a plasmid containing this region (example 13) using the primers VHexfeldlfor and VHexfeldlrev, introducing suitable restriction sites for cloning into pConGlfO.4 and an ideal Kozak sequence.
  • the VH fragment was gel purified and cloned into pConGlfO.4.
  • the PCR product and the pConKappa0.4 vector were digested with HindIII and Apal and purified.
  • the V H fragment and the pConGlf0.4HindIII-ApaI digested vector were ligated and transformed into competent DH5 ⁇ -Tl R cells. A clone was selected containing the correct insert size and the correct sequence was confirmed.
  • This plasmid was named pConG IfFeIdI.
  • Example 18 Construction of pConKFeldi : A vector for the production of the light chain of FeIdI
  • V L coding region mouse anti- " FeIdI antibody was amplified from a plasmid containing this region (example 13) using the primers VLexfeldlfor and VLexfeldlrev, introducing suitable restriction sites for cloning into pConK0.4 and an ideal Kozak sequence.
  • the PCR product and the pConKappa0.4 vector were digested with HindIII and BsiWI and purified.
  • the V L fragment and the pConKappa0.4HindIII-BsiWI digested vector were ligated and transformed into competent DH5 ⁇ T1 R E. coli. A clone was selected containing the correct insert size and the sequence was confirmed. This plasmid was named pConKFeldl.
  • Example 19 Construction of pTomG4Feld1 : A vector for the production of the heavy chain of FeId 1 -Ig G4
  • pTomG4 and pConGlf FeIdI were digested with HindIII and Apal and the relevant fragments were isolated.
  • the FeIdI V H fragment and the pTomG4HindIII-ApaI digested vector were ligated and transformed into competent DH5 ⁇ -Tl R cells. A clone was selected containing the correct insert size and the sequence was confirmed. This plasmid was named pTomG4Feldl.
  • Example 20 Construction of antibody expression vectors for the expression of 2F8-lgG4 and 7D8-lgG4
  • HuMab 2F8 IgGl-EGFR
  • HuMab 7D8 IgGl-CD20
  • the VH and VL coding regions of HuMab 2F8 (WO 02/100348) and HuMab 7D8 (WO 04/035607) were cloned in the expression vector pConGlf (Lonza Biologies) for the production of the IgGl heavy chain and pConKappa for the production of the kappa light chain, yielding the vectors pConGlf2F8, pConGlf7D8, pConKappa2F8 and pConKappa7D8.
  • VH regions of pConGlf2F8 and pConGlf7D8 were removed from these vectors by a Hindlll/Apal digestion and inserted into a Hindlll/Apal digested pTomG4 vector, resulting in pTomG42F8 and pTomG47D8 respectively.
  • Example 21 Production of Betv1-lgG1, Betv1-lgG4, FeIdI -IgGI and FeId 1 - 1 gG4 by transient expression in H EK -293 F cells
  • Antibodies were produced from all constructs by cotransfecting the relevant heavy and light chain vectors in HEK-293F cells using 293fectin according to the manufacturer's instructions.
  • Betvl-IgGl pConGIBetvl and pConKBetvl were coexpressed.
  • Betvl-IgG4 pTomG4Betvl and pConKBetvl were coexpressed.
  • FeIdI-IgGl pConGlFeldl and pConKFeldl were coexpressed.
  • Feldl-IgG4 pTomG4Feldl and pConKFeldl were coexpressed.
  • IgGl-EGFr For IgGl-EGFr, pConGlf2F8 and pConKappa2F8 were coexpressed. For IgG4-EGFr, pTomG42F8 and pConKappa2F8 were coexpressed. For IgGl-CD20, pConGlf7D8 and pConKappa7D8 were coexpressed. For IgG4-CD20, pTomG47D8 and pConkappa7D8 were coexpressed.
  • IgGl and IgG4 antibodies were purified by protein A affinity chromatography.
  • the cell culture supernatants were filtered over a 0.20 ⁇ M dead-end filter, followed by loading on a 5 ml Protein A column (rProtein A FF, GE Healthvcare) and elution of the IgG with 0.1 M citric acid-NaOH, pH 3.
  • the eluate was immediately neutralized with 2 M Tris-HCI, pH 9 and dialyzed overnight to 12.6 mM sodium phosphate, 140 mM NaCI, pH 7.4 (B. Braun, Oss, The Netherlands). After dialysis, samples were sterile filtered over a 0.20 ⁇ M dead-end filter.
  • the Betvl and FeIdI, IgGl and IgG4 antibodies were analyzed on non-reducing SDS-PAGE.
  • the Bis-Tris electrophoresis method used is a modification of the Laemmli method (Laemmli 1970 Nature 227 (5259 " ) : 680-5), where the samples were run at neutral pH.
  • the SDS-PAGE gels were stained with Coomassie and digitally imaged using the GeneGenius (Synoptics, Cambridge, UK).
  • Betvl and FeIdI IgGl showed 1 major band representing the full length tetrameric (2 heavy and two light chains) FeIdI and Betvl IgGl molecules.
  • Betvl and FeIdI IgG4 showed to have, besides the major band representing the tetrameric IgG4 molecule, substantial amounts of half-molecules (i.e. one heavy band one light chain).
  • mice Five nu/nu Balb/c mice 6-8 weeks of age were used to follow the exchange of IgG4 half molecules.
  • the mice were housed in a barrier unit of the Central Laboratory Animal Facility (Utrecht, The Netherlands) and kept in filter-top cages with water and food provided ad libitum. All experiments were approved by the Utrecht University animal ethics committee.
  • Chimeric antibodies were administered intraperitoneal ⁇ . Blood samples (75-100 ⁇ l) were drawn at 4.25 hours, 24 hours, 48 hours and 72 hours after administration. Blood was collected in heparin-containing vials and centrifuged for 5 minutes at 10.000g to separate plasma from cells. Plasma was stored at -20°C for determination of antigen specific antibody and bispecific antibody levels.
  • the Sepharose was washed with PBS-T (PBS supplemented with 0.1% Tween-20 and 0.05% (w/v) NaN 3 ) and the amount of radioactivity bound relative to the amount of radioactivity added was measured.
  • the concentration of Bet v 1 or FeI d 1 specific IgG was calculated using purified Bet v 1 specific antibodies or FeI d 1 specific antibodies as a standard (range 0-200 ng per test as determined by nephelometer).
  • the concentration of bispecific IgG was measured in two variants of the heterologous cross-linking assay. In the first assay, plasma was incubated for 24h with Sepharose-coupled Bet v 1 (0.5 mg) in a total volume of 300 ⁇ l in PBS-IAT.
  • Chimeric antibodies were mixed and subsequently incubated with whole blood, blood cells, plasma or serum to investigate the exchange activity of whole blood (components).
  • Serum was obtained by incubating whole blood in a glass vacutainer with clot activator for 30 min at 37°C, after which the clotted blood was spinned down.
  • the exchange of IgG4 half molecules was evaluated and compared to the exchange of IgGl half molecules.
  • As a control the blood samples were also incubated in the absence of chimeric antibodies.
  • the following antibodies mixtures were prepared in PBS:
  • Bispecific activity i.e. FeI d 1-Bet v 1 cross-linking activity
  • a sample was incubated for 24h with 0.5 mg Sepharose-coupled recombinant FeI d 1 in a total volume of 300 ⁇ l in PBS-IAT (PBS- AT supplemented with 1 ⁇ g/ml IVIg).
  • PBS-IAT PBS- AT supplemented with 1 ⁇ g/ml IVIg
  • the Sepharose was washed with PBS-T and incubated for 24h with 125 I-labeled Bet v 1, after which the Sepharose was washed with PBS-T and the amount of radioactivity bound relative to the amount of radioactivity added was measured.
  • bispecific activity is represented as percentage bound 125 I-labeled Bet v 1, which was determined in the heterologous cross-linking assay.
  • Bispecific activity is a measure for the exchange of IgG4 half molecules, which was primarily observed in whole blood and the cellular fraction of whole blood (Fig 5a). Bispecific levels in the cellular fraction were even higher than in whole blood. This is most likely explained by the fact that in the cellular fraction endogenous IgG4, which can also be exchanged with the added chimeric IgG4 antibodies, is no longer present.
  • Some bispecific activity was also observed in plasma and serum, but this activity was much lower than observed in whole blood and only slightly higher than background level, being 1.7%, which was obtained by incubating the IgG4 mixture in Optimem.
  • FeI d 1 binding antibodies eluted in one peak with a retention volume of ⁇ 12.9 ml, which corresponds to the retention volume of monomeric IgG.
  • the heterologous Bet v 1-FeI d 1 cross-linking activity was detected in the same fractions indicating that bispecific activity was associated with monomeric IgG (data not shown).
  • Chimeric antibodies were mixed and subsequently incubated with three different types of human blood cells (i.e. mononuclear cells (MNC), erythrocytes and platelets) to investigate IgG4 exchange activity.
  • MNC mononuclear cells
  • erythrocytes erythrocytes and platelets
  • the exchange of IgG4 half molecules was evaluated and compared to the exchange of IgGl half molecules.
  • the following antibodies mixtures were prepared in PBS:
  • bispecific activity is shown as percentage bound 125 I-labeled Bet v 1, which was determined in the heterologous cross-linking assay. All three cell types were able to induce bispecific activity. Some bispecific activity was also observed in Optimem serum free medium, but this activity was much lower than observed in the presence of blood cells. None of the tested cells was able to exchange IgGl half molecules.
  • Chimeric IgG4 antibodies were mixed and subsequently incubated with three different cell lines (i.e. Human Embryo Kidney (HEK) cells, murine B cells or hybridomas) to investigate IgG4 exchange activity.
  • HEK Human Embryo Kidney
  • Cell line J558 (provided by the Antigen Presentation Research Group of Sanquin) was chosen as a source of murine B cells.
  • Hybridomas which produce an anti-Cl esterase inhibitor, were obtained from the Autoimmune Research Group of Sanquin.
  • Suspension HEK (293F) cells were from Invitrogen, Breda, The Netherlands. All cells were washed three times with PBS, after which the cells were resuspended in PBS.
  • IgG4 half molecules The exchange of IgG4 half molecules was evaluated by incubating an IgG4 antibody mixture consisting of Bet v 1 specific IgG4 (2 ⁇ g) and FeI d 1 specific IgG4 (2 ⁇ g) with the aforementioned cells.
  • the antibody mixture was incubated with 24xlO 5 HEK cells, 25xlO 5 murine B cells or 2IxIO 5 hybridomas in a total volume of 50 ⁇ l (final concentration for each antibody was 80 ⁇ g/ml) on a horizontal orbital shaker (125 rpm) at 37°C.
  • bispecific activity is shown as percentage bound 125 I-labeled Bet v 1, which was determined in the heterologous cross-linking assay. All three cell types were able to exchange IgG4 half molecules.
  • Chimeric antibodies were mixed and subsequently incubated with human erythrocytes to investigate the exchange of IgG4 half molecules.
  • Erythrocytes were purified from a single donor and stored at 4°C in SAGM (Saline Adenine Glucose Mannitol) buffer. Before use the cells were washed three times with PBS.
  • SAGM Seline Adenine Glucose Mannitol
  • the concentration of Bet v 1 specific IgG was calculated using purified Bet v 1 specific antibodies as a standard (range 0-200 ng per test as determined by nephelometer). Bispecific activity in experiments using FeI d 1 and Bet v 1 specific antibodies was measured in the Feldl-Betvl cross-linking assay. In this assay, IgG containing sample was incubated for 24h with Sepharose-coupled cat extract (0.5 mg) in a total volume of 300 ⁇ l in PBS-AT.
  • the Sepharose was washed with PBS-T and incubated for 24h with 125 I-labeled Bet v 1, after which the Sepharose was washed with PBS-T and the amount of radioactivity bound relative to the amount of radioactivity added was measured.
  • the concentration of bispecific IgG (Feldl-Betvl) was calculated using purified IgGl-Betvl as a standard (obtained in Bet v 1 binding test using Prot G sepharose).
  • Size- exclusion chromatography was performed to exclude the possibility that bispecific activity observed in the IgG4 mix was the result of IgG aggregation.
  • FeI d 1 binding antibodies eluted in one peak with a retention volume of ⁇ 12.9 ml, which corresponds to the retention volume of monomeric IgG.
  • the heterologous Bet v 1-FeI d 1 cross-linking activity was detected in the same fractions indicating that bispecific activity was associated with monomeric IgG (data not shown).
  • Chimeric IgG4 antibodies were mixed and subsequently incubated with increasing dilutions of erythrocyte lysate.
  • Erythrocytes were isolated from a healthy donor and stored at 4°C in SAGM (Saline Adenine Glucose Mannitol) buffer with a hematocrit of 60.7%.
  • SAGM Seline Adenine Glucose Mannitol
  • hematocrit 60.7%.
  • PBS-Azide PBS supplemented with 0.05% (w/v) NaN 3
  • undiluted erythrocyte lysate was equivalent to a hematocrit of 30%.
  • IgG4 half molecules The exchange of IgG4 half molecules was evaluated by incubating an IgG4 antibody mixture consisting of Bet v 1 specific IgG4 (1 ⁇ g) and FeI d 1 specific IgG4 (1 ⁇ g) with 50 ⁇ l of freshly prepared lysate (supplemented with PBS/Azide to a total volume of 100 ⁇ l) at 37°C. Final concentration of each antibody was 10 ⁇ g/ml. At indicated time points a sample was drawn from the incubation mix in PBS-AT (PBS supplemented with 0.3% bovine serum albumin, 0.1% Tween-20 and 0.05% (w/v) NaN 3 ) to measure bispecific activity. Samples were stored, if necessary, at 4°C.
  • PBS-AT PBS supplemented with 0.3% bovine serum albumin, 0.1% Tween-20 and 0.05% (w/v) NaN 3
  • Bispecific activity i.e. Bet v 1-FeI d 1 cross-linking activity
  • sample dilutions were incubated for 24h with 0.5 mg Sepharose-coupled birch extract in a total volume of 300 ⁇ l in PBS-IAT (PBS-AT supplemented with 1 ⁇ g/ml IVIg).
  • PBS-IAT PBS-AT supplemented with 1 ⁇ g/ml IVIg
  • the Sepharose was washed with PBS-T and incubated for 24h with 125 I-labeled FeI d 1, after which the Sepharose was washed with PBS-T and the amount of radioactivity bound relative to the amount of radioactivity added was measured.
  • the concentration of bispecific IgG (Bet v 1-FeI d 1) was calculated using the calibration curve of the FeI d 1 binding test, which was obtained from purified FeI d 1 binding rlgG.
  • Size-exclusion chromatography was performed to exclude the possibility that bispecific activity induced by erythrocyte lysate was the result of IgG aggregation ( Figure 11).
  • an incubation mixture was prepared consisting of 10 ⁇ g Bet v 1 binding IgG4, 10 ⁇ g FeI d 1 binding IgG4 and 50 ⁇ l erythrocyte lysate, which was supplemented with PBS/Azide to final volume of 100 ⁇ l. This mixture was incubated at 37°C for 24h, after which 70 ⁇ l was fractionated on a Superdex200 column. In the fractions Bet v 1 binding IgG and FeI d 1-Bet v 1 cross-linking IgG were measured.
  • the concentration of Bet v 1 specific IgG was calculated using purified Bet v 1 specific antibodies as a standard (range 0-200 ng per test as determined by nephelometer).
  • the concentration of bispecific IgG i.e. FeI d 1-Bet v 1 cross-linking activity
  • a sample was incubated for 24h with 0.5 mg Sepharose-coupled cat extract, in which FeI d 1 antigen is present, in a total volume of 300 ⁇ l in PBS-IAT.
  • Erythrocytes were isolated from a healthy donor and stored at 4°C in SAGM (Saline Adenine Glucose Mannitol) buffer with a hematocrit of 60.7%. To obtain lysate the cells were washed three times with PBS-Azide (PBS supplemented with 0.05% (w/v) NaN 3 ) and resuspended in water with a volume that was two-fold higher than the volume of the storage buffer. Therefore, undiluted erythrocyte lysate was equivalent to a hematocrit of 30%. Part of the lysate was dialyzed against PBS-Azide using a dialysis membrane cassette from Pierce (3.5 kD cut-off). Ultrafiltrate was obtained by centrifugation of non-dialyzed lysate in an Amicon filter (3.5 kD cut-off).
  • IgG4 half molecules The exchange of IgG4 half molecules was evaluated by incubating an IgG4 antibody mixture (Bet v 1 specific IgG4 (0.5 ⁇ g) and FeI d 1 specific IgG4 (0.5 ⁇ g) with freshly prepared erythrocyte lysate (25 ⁇ l) or dialyzed lysate (25 ⁇ l) at 37°C. Total volume of each incubation was 50 ⁇ l resulting in a final concentration of 10 ⁇ g/ml for each antibody.
  • the following supplements were used : reduced glutathione (GSH) from Sigma, Glucose-6-phospate (G-6-P) and NADPH (both from Roche). These compounds were dissolved in water before use.
  • Bispecific activity i.e. FeI d 1-Bet v 1 cross-linking activity
  • sample dilutions were incubated for 24h with 0.5 mg Sepharose-coupled cat extract in a total volume of 300 ⁇ l in PBS-IAT (PBS- AT supplemented with 1 ⁇ g/ml IVIg).
  • PBS-IAT PBS- AT supplemented with 1 ⁇ g/ml IVIg.
  • the Sepharose was washed with PBS-T and incubated for 24h with 125 I-labeled Bet v 1, after which the Sepharose was washed with PBS-T and the amount of radioactivity bound relative to the amount of radioactivity added was measured.
  • IgG4 half molecules was evaluated by incubating an IgG4 antibody mixture consisting of Bet v 1 specific IgG4 (1 ⁇ g) and FeI d 1 specific IgG4 (1 ⁇ g) in PBS/Azide containing GSH at 37°C. Total incubation volume was 100 ⁇ l resulting in a final concentration of 10 ⁇ g/ml for each antibody. At indicated time points a sample was drawn from the incubation mixture in PBS-AT (PBS supplemented with 0.3% bovine serum albumin, 0.1% Tween-20 and 0.05% (w/v) NaN 3 ). Samples were stored at 4°C for measuring of antigen binding and bispecific activity
  • the concentration of Bet v 1 specific IgG was calculated using purified Bet v 1 specific antibodies as a standard (range 0-200 ng per test as determined by nephelometer).
  • the concentration of bispecific IgG i.e. FeI d 1-Bet v 1 cross-linking activity
  • a sample was incubated for 24h with 0.5 mg Sepharose-coupled cat extract, in which FeI d 1 antigen is present, in a total volume of 300 ⁇ l in PBS-IAT.
  • the Sepharose was washed with PBS-T and incubated for 24h with 125 I-labeled Bet v 1, after which the Sepharose was washed with PBS-T and the amount of radioactivity bound relative to the amount of radioactivity added was measured.
  • the concentration of bispecific IgG (FeI d 1-Bet v 1) was calculated using the same calibration curve as used in the Bet v 1 binding test, which was obtained from purified Bet v 1 binding IgG.
  • Bet v 1 binding antibodies eluted in one peak with a retention volume of ⁇ 12.6 ml, which corresponds to the retention volume of monomeric IgG.
  • the heterologous FeI d 1-Bet v 1 cross-linking activity was detected in the same fractions indicating that bispecific activity was associated with monomeric IgG.
  • the generation of bispecific IgG4 molecules in the presence of GSH was found to be temperature dependent, as exchange occurred more efficiently at 37°C than at 4°C (Fig 14).
  • IgGl-Betvl and IgGl-FeIdI or IgG4-Betvl and IgG4-Feldl were mixed at a final concentration of 10 ⁇ g/ml for antibody and incubated with reducing agents in a total volume of 50 ⁇ l.
  • L-cysteine was from Sigma (100 ⁇ M)
  • DTT dithiothreitol
  • BME ⁇ -mercapto-ethanol
  • GSSG oxidized glutathione
  • Figure 15 shows that the addition of GSH or other reducing agents (but not of GSSG) to a mixture of purified IgG4-Betvl and IgG4-Feldl was sufficient to induce Fab arm exchange and the generation of bispecific IgG4. In contrast, no bispecific reactivity was induced in the control IgGl mixture.
  • Bispecific activity was determined using a sandwich ELISA.
  • an ELISA plate (Greiner bio-one, Frickenhausen, Germany) was coated overnight with 1 ⁇ g/ml (lOO ⁇ l/well) of recombinant extracellular domain of EGFR in PBS at 4 0 C. The plate was washed 3 times with PBS/0.05 % Tween 20 (PBT). Samples were diluted in PBT/0.2 % BSA (PBTB) and transferred to the ELISA plate (100 ⁇ l/well). After incubation on a plate shaker (300 rpm) for 90 minutes at room temperature (RT), samples were discarded and the plate was washed 3 times with PBT.
  • PBT PBS/0.05 % Tween 20
  • mice anti- idiotypic monoclonal antibody 2F2 SABl.1 (directed against the anti-CD20 antibody 7D8; Genmab) at 2 ⁇ g/ml in PBTB was added and incubated at RT for 90 minutes at a plate shaker (300 rpm).
  • the anti-idiotypic antibody was discarded and the plate was washed 3 times with PBT, followed by the addition of 100 ⁇ l/well of a HRP conjugated goat anti- mouse IgG (Jackson ImmunoResearch Laboratories, Westgrove, PA, USA) at a 100Ox dilution in PBTB and incubation at RT for 90 minutes at a plate shaker (300 rpm).
  • the detection antibody was discarded and the plate was washed 3 times with PBT.
  • a 50 mg ABTS tablet (Roche Diagnostics GmbH, Mannheim, Germany) was dissolved in ABTS buffer (Roche) and added to the ELISA plate (100 ⁇ l/well).
  • the ELISA plate was incubated for 30 min (or longer if desired) at RT on a plate shaker (300 rpm) covered with aluminum foil and the reaction was stopped with 100 ⁇ l oxalic acid (Riedel de Haen Seelze, Germany) per well.
  • the ELISA plate was left at RT for 10 minutes before reading absorbance at 405 nm in an ELISA plate reader.
  • FIG 16A shows that bispecific anti-EGFR/CD20 antibodies formed in time upon incubation of the mixture of IgG4-EGFr and IgG4-CD20 in the presence, but not in the absence, of GSH.
  • Fab arm exchange did not occur in a mixture of IgGl antibodies, neither in the presence or absence of GSH.
  • a full concentration curve of GSH 0.5-1,000 ⁇ M was used to analyze exchange.
  • IgG4- CD20 and IgG4-EGFr were mixed and incubated with GSH in a total volume of 1 ml. Final concentration of each antibody was 50 ⁇ g/ml; the final concentration of GSH were as indicated in Figure 16B.
  • the mixtures were incubated at 37°C for 24h and samples were drawn in PBS-AT, in which the (bi)specific IgG concentrations were measured.
  • Figure 16B shows a clear GSH-dose dependence of IgG4 half molecule exchange.
  • exchange was tested in PBS and serum- and protein free, chemically defined medium (Freestyle 293 expression medium, GIBCO/Invitrogen Corporation). It was found that in this tissue culture medium, GSH-mediated exchange occurs at lower GSH- concentrations ( Figure 16C). It was also found that there is an optimum in GSH-mediated IgG4 half molecule exchange, as incubation with 5 mM GSH clearly resulted in lower exchange that with 0.5 mM ( Figure 16D).
  • Eluent A was MiIIiQ water (Millipore Synthesis AlO apparatus) and eluent B was LC-MS grade acetonitrile (Biosolve, Valkenswaard, The Netherlands). Both eluents contained 0.05% formic acid as organic modifier (Fluka Riedel-de Haen, Buchs, Germany). Time-of-flight electrospray ionization mass spectra were recorded on-line on a micrOTOFTM mass spectrometer (Bruker, Bremen, Germany) operating in the positive ion mode. In each analysis, a 500-5000 m/z scale was internally calibrated with ES tuning mix (Agilent Technologies, Santa Clara, USA). Mass spectra were deconvoluted by using the Maximum Entropy algorithm, which is provided with Data Ana lysisTM software v. 3.3 (Bruker).
  • Figure 17 shows that monkey polyclonal IVIg compares to human polyclonal IVIg in its ability to inhibit the exchange of Fab arms of the recombinant antibodies in vitro in the presence of reduced glutathione.
  • a component of rhesus IVIg, rhesus immunoglobulin participates in Fab arm exchange.
  • Rhesus immunoglobulin presumably rhesus IgG4, can exchange Fab arm with recombinant human IgG4.
  • IgGl-CPSC IgGl with an IgG4 core-hinge
  • IgGl-CPSC two CH3 domain swap mutants
  • P228S Mut primer-F SEQ ID NO: 19: cttgtgacaa aactcacacc tgcccatcgt gcccaggtaa gccag
  • P228S Mut primer-R SEQ ID NO:20: ctggcttacc tgggcacgat gggcaggtgt gagttttgtc acaag
  • PCR polymerase chain reaction
  • DNA digesting and ligation was used to create CH3 domain swap mutant constructs IgGl-CH3(IgG4) and IgGl-CPSC-CH3(IgG4).
  • Digestion reactions to obtain CH3 domains and vectors without CH3 domains were as follows: ⁇ 1500 ng DNA (pEE- Gl-betvl, pEE-Gl-CPSC and pEE-G4-betvl), 2 ⁇ l BSA, 2 ⁇ l Neb3 buffer, 1 ⁇ l Sail and H 2 O added to a volume of 20 ⁇ l. Incubation at 37°C for 30'.
  • DNA was purified and eluted with 30 ⁇ l H 2 O before 1 ⁇ l SanDI and 3 ⁇ l universal buffer was added and incubated at 37°C for 30'. Fragments were subjected to gel electrophoresis on 1% agarose gels with ethidium bromide. Fragments were cut from the gel under ultraviolet light and dissolved using a DNA purification kit (Amersham).
  • the pEE-G4-wt Sall/SanDI (which contained IgG4 CH3 domain) fragment was ligated into pEE-Gl-wt and pEE-Gl-CPSC using following procedure: 1 ⁇ l template DNA (Sall/SanDI digested pEE-Gl-wt and pEE-Gl- CPSC), 5 ⁇ l Sall/SanDI insert, 4 ⁇ l Ligate-it buffer, 9 ⁇ l H2O and 1 ⁇ l ligase in a total volume of 20 ⁇ l. Ligation was stopped after 5'.
  • IgG4-S228Pnew was made: IgG4-S228Pnew.
  • the hinge is stabilized by replacing serine at position 228 for a proline (IgGl core hinge).
  • Site- directed mutagenesis was performed using the QuickChange II XL Site-Directed Mutagenesis Kit (Stratagene, Amsterdam, The Netherlands) according to the manufacturer's instructions. This method included the introduction of a silent extra Xmal site to screen for successful mutagenesis.
  • PCR mixtures were stored at 4°C until further processing.
  • PCR mixtures were incubated with 1 ⁇ l Dpnl for 60 min at 37°C to digest the pTomG42F8HG vector and stored at 4°C until further processing.
  • the reaction mixture was precipitated with 5 ⁇ l 3 M NaAc and 125 ⁇ l Ethanol, incubated for 20 minutes at -20°C and spun down for 20 minutes at 4°C at 14000xg.
  • the DNA pellet was washed with 70% ethanol, dried and dissolved in 4 ⁇ l water.
  • the total 4 ⁇ l reaction volume was transformed in One Shot DNH5 ⁇ T1 R competent E. coli cells (Invitrogen, Breda, The Netherlands) according to the manufacturer's instructions (Invitrogen).
  • cells were plated on Luria-Bertani (LB) agar plates containing 50 ⁇ g/ml ampicillin. Plates were incubated for 16-18 hours at 37°C until bacterial colonies became evident.
  • plasmid was isolated from the bacteria and the mutation was confirmed by DNA sequencing. To check if no unwanted extra mutations were introduced the whole HC coding region was sequenced and did not contain any additional mutations. The final construct was named pTomG42F8S228PNew.
  • Recombinant antibodies from these constructs were transiently expressed in HEK 293 cells in 3 ml, 6-wells plates (NUNC) or in 125 ml erlenmeyers (Corning) with 293 Fectin (Invitrogen) as transfection reagent.
  • IgGl anti-feldl CPSC with IgGl atni-betvl CPSC indicated as IgGl CPSC - IgGl CPSC below
  • IgGl anti-feldl CPSC with IgGl anti-betvl CH3(IgG4) IgGl CPSC - IgGl CH3(IgG4)
  • IgGl anti-feldl CPSC with IgGl anti-betvl CPSC/CH3(IgG4) IgGl CPSC - IgGl CPSC/CH3(IgG4)
  • IgGl anti-feldl CH3(IgG4) with IgGl anti-betvl CH3(IgG4) IgGl CH3(IgG4) - IgGl CH3(IgG4)
  • IgGl anti-feldl CPSC/CH3(IgG4) with anti-betvl IgGl CPSC/CH3(IgG4) IgGl CPSC/CH3(IgG4) - IgGl CPSC/CH3(IgG4)
  • IgGl anti-feldl CPSC/CH3(IgG4) with IgG4 a-ntibetvl wt IgGl CPSC/CH3(IgG4) - IgG4 wt
  • IgG4 mutants Two IgG4 mutants were made: one CH3 point mutant in which arginine present at position 409 of IgG4 (within the CH3 domain) is replaced for lysine (IgG4-R409K), and one CH3 swap mutant (IgG4-CH3( ⁇ l)) (Figure 19). These mutants were also made with either Bet v 1 or FeI d 1 specificity. Site directed mutagenesis was used to introduce a P228S mutation in the hinge of IgGl using pEE-Gl-wt a Bet v 1 as a template. Mutagenic primers, forward and reverse, were designed with Vector NTI Advance 10:
  • P228S Mut primer-F SEQ ID NO: 23: cttgtgacaa aactcacacc tgcccatcgt gcccaggtaa gccag
  • P228S Mut primer-R SEQ ID NO:24: ctggcttacc tgggcacgat gggcaggtgt gagttttgtc acaag
  • DNA digesting and ligation was used to create CH3 domain swap mutant constructs IgGl-CH3( ⁇ 4) and IgGl-P228S-CH3( ⁇ 4).
  • Digestion reactions to obtain CH3 domains and vectors without CH3 domains were as follows: ⁇ 1500 ng DNA (pEE-Gl- betvl, pEE-Gl-CPSC and pEE-G4-betvl), 2 ⁇ l BSA, 2 ⁇ l Neb3 buffer, 1 ⁇ l Sail and H 2 O added to a volume of 20 ⁇ l. Incubation at 37°C for 30'.
  • Site-directed mutagenesis was used to introduce point mutations (K409R or R409K) into the pEE- ⁇ 4 wt, pEE- ⁇ l and PEE- ⁇ l-P228S constructs. Mutagenic primers, forward and reverse, were designed with Vector NTI Advance 10:
  • Site-directed mutagenesis was performed using the QuickChange II XL Site- Directed Mutagenesis Kit (Stratagene, Amsterdam, The Netherlands) according to the manufacturer's instructions, with changes as indicated below to increase mutagenic efficiency. This method included the introduction of a silent extra Accl site to screen for successful mutagenesis.
  • a prePCR mix was used containing 3 ⁇ l 1Ox pfu reaction buffer, 1 ⁇ l dNTP mix (10 mM), 275 ng forward or reverse primer, 50 ng template DNA and 0.75 ⁇ l Pfu turbo hotstart polymerase.
  • a prePCR was run using a GeneAmp PCR system 9700 (Applied Biosystems) : initial denaturation at 94°C for 5 min; 4 cycles of 94°C for 30 sec, 50 0 C for 1 min and 68 0 C for 14 min. 25 ⁇ l of forward primer containing prePCR mix was added to 25 ⁇ l of reverse primer containing prePCR mix. 0.5 ⁇ l Pfu turbo hotstart was added and amplification was performed : denaturing at 94 0 C for 1 min; 14 cycles of 94 0 C for 1 min, 50 0 C for 1 min and 68 0 C for 8 min; 12 cycles of 94 0 C for 30 sec, 55 0 C for 1 min and 68 0 C for 8 min.
  • plasmid was isolated from the bacteria and the mutation was confirmed by DNA sequencing. To check if no unwanted extra mutations were introduced the whole HC coding region was sequenced and did not contain any additional mutations.
  • Recombinant antibodies from these constructs were transiently expressed in HEK 293 cells in 3 ml, 6-wells plates (NUNC) or in 125 or 250 erlenmeyers (Corning) with 293 Fectin (Invitrogen) as transfection reagent.
  • GSH reduced glutathione
  • the exchange of half molecules was evaluated by incubating an antibody mixture consisting of Bet v 1 specific antibody (200 ng) and FeI d 1 specific antibody (200 ng) in PBS/Azide containing GSH (1 or 10 mM) at 37°C. Total incubation volume was 50 ⁇ l. After 24 hours samples were drawn from the incubation mixture in PBS-AT (PBS supplemented with 0.3% bovine serum albumin, 0.1% Tween-20 and 0.05% (w/v) NaN 3 ). For samples containing 10 mM GSH an equimolar amount of iodine-acetamide, a strongly alkylating agent that inhibits the GSH activity, was added. Samples were stored at 4°C for measuring of antigen binding and bispecific activity
  • the concentration of bispecific IgG was measured in the heterologous cross-linking assay.
  • a sample was incubated for 24h with 0.5 mg Sepharose-coupled cat extract, in which FeI d 1 antigen is present, in a total volume of 300 ⁇ l in PBS-IAT.
  • the Sepharose was washed with PBS-T and incubated for 24h with 125 I-labeled Bet v 1, after which the Sepharose was washed with PBS-T and the amount of radioactivity bound relative to the amount of radioactivity added was measured.
  • the concentration of bispecific IgG was calculated using the same calibration curve as used in the Bet v 1 binding test, which was obtained from purified Bet v 1 binding IgG. Tests were performed using antibody-containing supernatants in Freestyle 293 expression medium, GIBCO/Invitrogen Corporation.
  • Betvl-IgGl wt with FeIdI-IgGl wt (indicated as IgGl wt in Figure 20)
  • Betvl-IgGl-K409R with Feldl-IgGl-K409R Betvl-IgG4 wt with Feldl-IgG4 wt (IgG4 wt in Figure 20)
  • Hingeless IgG4 antibody (HG) molecules form dimers by low affinity non-covalent interactions.
  • WO/2007/059782 describes that this dimerization process can be inhibited by using HG IgG4 molecules in the presence of an excess of irrelevant antibodies.
  • WO/2007/059782 describes a hingeless IgG4 anti-EGFR antibody 2F8-HG.
  • pHG-2F8 A vector for the expression of the heavy chain of 2F8- HG: The heavy chain cDNA encoding region of 2F8-HG was codon optimized and cloned in the pEE6.4 vector (Lonza Biologies, Slough, UK). The resulting vector was named pHG- 2F8.
  • pKappa2F8 A vector for the production of the light chain of 2F8 antibodies: The VL region encoding antibody 2F8 was codon optimized and cloned in the pKappa2F2 vector (a vector encoding the codon optimized cDNA region of antibody 2F2 (described in WO2004035607) in vector pEE12.4 (Lonza)), replacing the 2F2 VL region with the 2F8 VL region. The resulting vector was named pKappa-2F8. Hingeless IgG4 anti-EGFR antibody 2F8-HG has been described in WO/2007/059782. The additional mutations given in the Table below were introduced into the CH3 region of hingeless IgG4 antibody 2F8-HG by site-directed mutagenesis.
  • KABAT indicates amino acid numbering according to Kabat (Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD. (1991)
  • EU index indicates amino acid numbering according to EU index as outlined in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD. (1991))
  • SEQ ID NO:39, 40, 41 indicates amino acid numbering as indicated in SEQ ID NO:39, 40 and 41 of this document.
  • constructs were expressed transiently in HEK-293F cells by cotransfecting the heavy-chain- and light-chain-encoding plasmids and binding to purified EGFr was determined in the absence and presence of 200 ⁇ g/ml polyclonal human IgG (Intravenous Immunoglobulin, IVIG, Sanquin Netherlands).
  • Binding affinities were determined using an ELISA in which purified EGFr (Sigma, St Louis, MO) was coated to 96-well Microlon ELISA plates (Greiner, Germany), 50 ng/well. Plates were blocked with PBS supplemented with 0.05% Tween 20 and 2% chicken serum. Subsequently, samples, serially diluted in a buffer containing 100 ⁇ g/ml polyclonal human IgG (Intravenous Immunoglobulin, IVIG, Sanquin Netherlands) were added and incubated for 1 h at room temperature (RT).
  • Plates were subsequently incubated with peroxidase-conjugated rabbit-anti-human kappa light chain (DAKO, Glostrup, Denmark) as detecting antibody and developed with 2,2'-azino-bis (3- ethylbenzthiazoline-6-sulfonic acid) (ABTS; Roche, Mannheim, Germany). Absorbance was measured in a microplate reader (Biotek, Winooski, VT) at 405 nm.
  • DAKO peroxidase-conjugated rabbit-anti-human kappa light chain
  • ABTS 2,2'-azino-bis (3- ethylbenzthiazoline-6-sulfonic acid)
  • Figure 21 shows that the binding curve of 2F8-HG in the presence of IVIG (thick dotted line with closed boxes) clearly right-shifts with respect to the binding curve of 2F8-HG without IVIG (thick closed line with open boxes).
  • This difference in avidity for the EGFr coat is consistent with the idea that, in the presence of IVIG, 2F8-HG binds monovalently.
  • the binding curves of the tested mutations, 2F8-HG-F405L, 2F8-HG- F405A, 2F8-HG-R409A and 2F8-HG-R409KA become insensitive to the addition of IVIG and were super-imposable on the bivalent binding curve of 2F8-HG in the absence of IVIG.
  • KABAT indicates amino acid numbering according to Kabat (Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD. (1991)
  • EU index indicates amino acid numbering according to EU index as outlined in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD. (1991))
  • SEQ ID NO:39, 40, 41 indicates amino acid numbering as indicated in SEQ ID NO:39, 40 and 41 of this document. See also figure 22 for comparison of numbering methods. N u m b e r i n g of CH 3 m u t at i o n s
  • IgGl-CD20 and IgGl-EGFr, IgG4-CD20 and IgG4-EGFr, or IgG4-CH3mutant-CD20 and IgG4-CH3mutant-EGFr were mixed and incubated with 0.5 mM GSH as described above.
  • Bispecific activity was determined as described in Example 33.
  • FIG. 23 shows that bispecific anti-EGFr/CD20 antibodies were formed in mixtures of IgG4 antibodies as well as in mixtures of CH3 domain mutants Q355R, E419Q, L445P and R409A. No bispecific activity was measured in mixtures of CH3 domain mutants R409K, R409M, R409L and K370T, indicating that these mutations stabilized dimerization of human IgG4 antibodies. CH3 domain mutant R409T, F405A and F405L partially stabilized dimerization of human IgG4 antibodies.
  • SEQ ID NO:39 Amino acid sequence of the wildtype C H region of human IgG4
  • SEQ ID NO:40 Amino acid sequence of the wildtype C H region of human IgG4
  • SEQ ID NO:41 Amino acid sequence of the wildtype C H region of human IgG4

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Organic Chemistry (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Immunology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Epidemiology (AREA)
  • Molecular Biology (AREA)
  • Optics & Photonics (AREA)
  • Physics & Mathematics (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Virology (AREA)
  • Diabetes (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Oncology (AREA)
  • Neurology (AREA)
  • Biomedical Technology (AREA)
  • Urology & Nephrology (AREA)
  • Neurosurgery (AREA)
  • Pulmonology (AREA)
  • Hematology (AREA)
  • Rheumatology (AREA)
  • Communicable Diseases (AREA)
  • Endocrinology (AREA)
  • Dermatology (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Cell Biology (AREA)
PCT/DK2008/050129 2007-05-31 2008-05-30 Stable igg4 antibodies Ceased WO2008145142A1 (en)

Priority Applications (10)

Application Number Priority Date Filing Date Title
CA002688275A CA2688275A1 (en) 2007-05-31 2008-05-30 Stable igg4 antibodies
EP08748828.4A EP2164873B2 (en) 2007-05-31 2008-05-30 Stable igg4 antibodies
JP2010509682A JP6071165B2 (ja) 2007-05-31 2008-05-30 安定なIgG4抗体
EP13181032.7A EP2666787B1 (en) 2007-05-31 2008-05-30 STABLE IgG4 ANTIBODIES
EP22155736.6A EP4119579A1 (en) 2007-05-31 2008-05-30 Stable igg4 antibodies
AU2008255352A AU2008255352B2 (en) 2007-05-31 2008-05-30 Stable IgG4 antibodies
US12/602,439 US20100267934A1 (en) 2007-05-31 2008-05-30 Stable igg4 antibodies
US13/912,581 US20130345406A1 (en) 2007-05-31 2013-06-07 Stable igg4 antibodies
US15/197,496 US10752695B2 (en) 2007-05-31 2016-06-29 Stable IgG4 antibodies
US16/947,021 US20210061919A1 (en) 2007-05-31 2020-07-15 STABLE IgG4 ANTIBODIES

Applications Claiming Priority (6)

Application Number Priority Date Filing Date Title
DKPA200700793 2007-05-31
DKPA200700792 2007-05-31
DKPA200700792 2007-05-31
DKPA200700793 2007-05-31
DKPA200701002 2007-07-06
DKPA200701002 2007-07-06

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US12/602,439 A-371-Of-International US20100267934A1 (en) 2007-05-31 2008-05-30 Stable igg4 antibodies
US13/912,581 Division US20130345406A1 (en) 2007-05-31 2013-06-07 Stable igg4 antibodies

Publications (1)

Publication Number Publication Date
WO2008145142A1 true WO2008145142A1 (en) 2008-12-04

Family

ID=39831865

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/DK2008/050129 Ceased WO2008145142A1 (en) 2007-05-31 2008-05-30 Stable igg4 antibodies

Country Status (6)

Country Link
US (4) US20100267934A1 (enExample)
EP (3) EP2666787B1 (enExample)
JP (3) JP6071165B2 (enExample)
AU (1) AU2008255352B2 (enExample)
CA (1) CA2688275A1 (enExample)
WO (1) WO2008145142A1 (enExample)

Cited By (143)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2009103791A1 (en) * 2008-02-22 2009-08-27 Genmab A/S Methods for assissing the risk of adverse events upon treatment with igg4 antibodies
WO2010063785A3 (en) * 2008-12-03 2010-07-29 Genmab A/S Antibody variants having modifications in the constant region
WO2010128398A1 (en) 2009-05-04 2010-11-11 Pangenetics 110 B.V. Antibodies against nerve growth factor (ngf) with enhanced in vivo stability
WO2011108502A1 (ja) 2010-03-02 2011-09-09 協和発酵キリン株式会社 改変抗体組成物
WO2011110642A2 (en) 2010-03-10 2011-09-15 Genmab A/S Monoclonal antibodies against c-met
WO2011116090A1 (en) 2010-03-17 2011-09-22 Abbott Research B.V. Anti-nerve growth factor (ngf) antibody compositions
US8043617B2 (en) 2006-06-02 2011-10-25 Regeneron Pharmaceuticals, Inc. Human antibodies to human IL-6 receptor
WO2011131746A2 (en) 2010-04-20 2011-10-27 Genmab A/S Heterodimeric antibody fc-containing proteins and methods for production thereof
WO2011147982A2 (en) 2010-05-27 2011-12-01 Genmab A/S Monoclonal antibodies against her2 epitope
WO2011147986A1 (en) 2010-05-27 2011-12-01 Genmab A/S Monoclonal antibodies against her2
US8080248B2 (en) 2006-06-02 2011-12-20 Regeneron Pharmaceuticals, Inc. Method of treating rheumatoid arthritis with an IL-6R antibody
WO2011157741A2 (en) 2010-06-15 2011-12-22 Genmab A/S Human antibody drug conjugates against tissue factor
WO2011138785A3 (en) * 2010-05-05 2011-12-29 Rappaport Family Institute For Research In The Medical Sciences Use of ccl1 in therapy
WO2012022982A2 (en) 2010-08-20 2012-02-23 Ucb Pharma S.A. Improved antibodies of the class igg4
US8246956B2 (en) 2003-12-24 2012-08-21 Abbott Research B.V. Humanized anti-nerve growth factor antibodies
WO2012143524A2 (en) 2011-04-20 2012-10-26 Genmab A/S Bispecific antibodies against her2 and cd3
WO2012143523A1 (en) 2011-04-20 2012-10-26 Genmab A/S Bispecifc antibodies against her2
EP2389192A4 (en) * 2009-01-23 2013-01-16 Biogen Idec Inc STABILIZED FC POLYPEPTIDES WITH REDUCED EFFECTOR FUNCTION AND METHOD OF USE
CN103193882A (zh) * 2013-03-29 2013-07-10 浙江大学 胚胎干细胞特异性标志物GM-CSFRα及其应用
WO2013124451A1 (en) 2012-02-22 2013-08-29 Ucb Pharma S.A. Sequence symmetric modified igg4 bispecific antibodies
WO2013124450A1 (en) 2012-02-22 2013-08-29 Ucb Pharma S.A. Sequence symmetric modified igg4 bispecific antibodies
WO2013166236A1 (en) * 2012-05-03 2013-11-07 Regeneron Pharmaceuticals, Inc. Human antibodies to fel d1 and methods of use thereof
WO2015184203A1 (en) 2014-05-29 2015-12-03 Macrogenics, Inc. Tri-specific binding molecules and methods of use thereof
US9212230B2 (en) 2007-03-29 2015-12-15 Genmab A/S Bispecific antibodies and methods for production thereof
KR20160044063A (ko) * 2013-09-13 2016-04-22 베이진 엘티디 항-pd1 항체 및 이의 치료 및 진단 용도
WO2016091891A1 (en) 2014-12-09 2016-06-16 INSERM (Institut National de la Santé et de la Recherche Médicale) Human monoclonal antibodies against axl
WO2016135066A1 (en) 2015-02-26 2016-09-01 INSERM (Institut National de la Santé et de la Recherche Médicale) Fusion proteins and antibodies comprising thereof for promoting apoptosis
US9493578B2 (en) 2009-09-02 2016-11-15 Xencor, Inc. Compositions and methods for simultaneous bivalent and monovalent co-engagement of antigens
WO2017019846A1 (en) 2015-07-30 2017-02-02 Macrogenics, Inc. Pd-1-binding molecules and methods use thereof
US9605084B2 (en) 2013-03-15 2017-03-28 Xencor, Inc. Heterodimeric proteins
US9605061B2 (en) 2010-07-29 2017-03-28 Xencor, Inc. Antibodies with modified isoelectric points
US9650446B2 (en) 2013-01-14 2017-05-16 Xencor, Inc. Heterodimeric proteins
CN106687125A (zh) * 2014-03-12 2017-05-17 耶达研究与开发有限公司 降低系统性调节性t细胞水平或活性来治疗cns疾病和损伤
US9688749B2 (en) 2005-06-07 2017-06-27 Abbvie Inc. Molecules that are able to inhibit the binding between NGF and the TrkA receptor as analgesics with prolonged effect
US9701759B2 (en) 2013-01-14 2017-07-11 Xencor, Inc. Heterodimeric proteins
US9717777B2 (en) 2010-05-05 2017-08-01 Rappaport Family Institute For Research In The Medical Sciences Use of CCL1 in therapy
US9738722B2 (en) 2013-01-15 2017-08-22 Xencor, Inc. Rapid clearance of antigen complexes using novel antibodies
WO2017144668A1 (en) 2016-02-26 2017-08-31 INSERM (Institut National de la Santé et de la Recherche Médicale) Antibodies having specificity for btla and uses thereof
JP2017525335A (ja) * 2014-06-12 2017-09-07 エフ.ホフマン−ラ ロシュ アーゲーF. Hoffmann−La Roche Aktiengesellschaft FcRn相互作用が変更された抗体を選択するための方法
WO2017162678A1 (en) 2016-03-22 2017-09-28 INSERM (Institut National de la Santé et de la Recherche Médicale) Humanized anti-claudin-1 antibodies and uses thereof
WO2017191300A1 (en) 2016-05-06 2017-11-09 INSERM (Institut National de la Santé et de la Recherche Médicale) Pharmaceutical compositions for the treatment of chemoresistant acute myeloid leukemia (aml)
US9822186B2 (en) 2014-03-28 2017-11-21 Xencor, Inc. Bispecific antibodies that bind to CD38 and CD3
US9850320B2 (en) 2014-11-26 2017-12-26 Xencor, Inc. Heterodimeric antibodies to CD3 X CD20
US9856327B2 (en) 2014-11-26 2018-01-02 Xencor, Inc. Heterodimeric antibodies to CD3 X CD123
US9862778B2 (en) 2011-10-11 2018-01-09 Genentech, Inc. Assembly of bispecific antibodies
US10106624B2 (en) 2013-03-15 2018-10-23 Xencor, Inc. Heterodimeric proteins
WO2018204871A1 (en) * 2017-05-05 2018-11-08 Allakos Inc. Methods and compositions for treating inflammatory gastrointestinal disorders
US10131710B2 (en) 2013-01-14 2018-11-20 Xencor, Inc. Optimized antibody variable regions
EP3310385A4 (en) * 2015-06-17 2018-12-19 Allakos Inc. Methods and compositions for treating fibrotic diseases
CN109069537A (zh) * 2016-04-04 2018-12-21 亘喜生物科技(上海)有限公司 共刺激结构域中具有重复结合基序的car
US10183996B2 (en) 2014-02-28 2019-01-22 Allakos Inc. Methods and compositions for treating Siglec-8 associated diseases
US10227411B2 (en) 2015-03-05 2019-03-12 Xencor, Inc. Modulation of T cells with bispecific antibodies and FC fusions
US10227410B2 (en) 2015-12-07 2019-03-12 Xencor, Inc. Heterodimeric antibodies that bind CD3 and PSMA
WO2019057933A1 (en) 2017-09-21 2019-03-28 Imcheck Therapeutics Sas ANTIBODIES HAVING SPECIFICITY FOR BTN2 AND USES THEREOF
US10316088B2 (en) 2016-06-28 2019-06-11 Xencor, Inc. Heterodimeric antibodies that bind somatostatin receptor 2
EP3279216A4 (en) * 2015-04-01 2019-06-19 Chugai Seiyaku Kabushiki Kaisha PROCESS FOR PREPARING POLYPEPTIDE HETERO OLIGOMER
US10344050B2 (en) 2011-10-27 2019-07-09 Genmab A/S Production of heterodimeric proteins
US10428155B2 (en) 2014-12-22 2019-10-01 Xencor, Inc. Trispecific antibodies
US10428146B2 (en) 2014-07-22 2019-10-01 Cb Therapeutics, Inc. Anti PD-1 antibodies
US10435458B2 (en) 2010-03-04 2019-10-08 Chugai Seiyaku Kabushiki Kaisha Antibody constant region variants with reduced Fcgammar binding
US10435470B2 (en) 2014-08-05 2019-10-08 Cb Therapeutics, Inc. Anti-PD-L1 antibodies
US10450381B2 (en) 2010-11-17 2019-10-22 Chugai Seiyaku Kabushiki Kaisha Methods of treatment that include the administration of bispecific antibodies
US10487155B2 (en) 2013-01-14 2019-11-26 Xencor, Inc. Heterodimeric proteins
US10501552B2 (en) 2015-01-26 2019-12-10 Macrogenics, Inc. Multivalent molecules comprising DR5-binding domains
US10501543B2 (en) 2016-10-14 2019-12-10 Xencor, Inc. IL15/IL15Rα heterodimeric Fc-fusion proteins
US10519242B2 (en) 2013-03-15 2019-12-31 Xencor, Inc. Targeting regulatory T cells with heterodimeric proteins
US10526417B2 (en) 2014-11-26 2020-01-07 Xencor, Inc. Heterodimeric antibodies that bind CD3 and CD38
US10544187B2 (en) 2013-03-15 2020-01-28 Xencor, Inc. Targeting regulatory T cells with heterodimeric proteins
US10544225B2 (en) 2014-07-03 2020-01-28 Beigene, Ltd. Anti-PD-L1 antibodies and their use as therapeutics and diagnostics
US10604577B2 (en) 2015-10-22 2020-03-31 Allakos Inc. Methods and compositions for treating systemic mastocytosis
WO2020148207A1 (en) 2019-01-14 2020-07-23 INSERM (Institut National de la Santé et de la Recherche Médicale) Human monoclonal antibodies binding to hla-a2
WO2020188086A1 (en) 2019-03-20 2020-09-24 Imcheck Therapeutics Sas Antibodies having specificity for btn2 and uses thereof
US10787518B2 (en) 2016-06-14 2020-09-29 Xencor, Inc. Bispecific checkpoint inhibitor antibodies
US10793632B2 (en) 2016-08-30 2020-10-06 Xencor, Inc. Bispecific immunomodulatory antibodies that bind costimulatory and checkpoint receptors
US10851178B2 (en) 2011-10-10 2020-12-01 Xencor, Inc. Heterodimeric human IgG1 polypeptides with isoelectric point modifications
US10858417B2 (en) 2013-03-15 2020-12-08 Xencor, Inc. Heterodimeric proteins
US10864203B2 (en) 2016-07-05 2020-12-15 Beigene, Ltd. Combination of a PD-1 antagonist and a RAF inhibitor for treating cancer
US10865253B2 (en) 2014-12-19 2020-12-15 Genmab A/S Rodent bispecific heterodimeric proteins
WO2021009263A1 (en) 2019-07-16 2021-01-21 INSERM (Institut National de la Santé et de la Recherche Médicale) Antibodies having specificity for cd38 and uses thereof
US10927435B2 (en) 2011-10-11 2021-02-23 Sanofi Biotechnology Compositions for the treatment of rheumatoid arthritis and methods of using same
US10935554B2 (en) 2013-08-23 2021-03-02 Regeneron Pharmaceuticals, Inc. Diagnostic tests and methods for assessing safety, efficacy or outcome of allergen-specific immunotherapy (SIT)
US10934344B2 (en) 2006-03-31 2021-03-02 Chugai Seiyaku Kabushiki Kaisha Methods of modifying antibodies for purification of bispecific antibodies
US10954301B2 (en) 2015-12-14 2021-03-23 Macrogenics, Inc. Bispecific molecules having immunoreactivity with PD-1 and CTLA-4, and methods of use thereof
WO2021058763A1 (en) 2019-09-27 2021-04-01 INSERM (Institut National de la Santé et de la Recherche Médicale) Anti-müllerian inhibiting substance antibodies and uses thereof
US10968276B2 (en) 2013-03-12 2021-04-06 Xencor, Inc. Optimized anti-CD3 variable regions
US10982006B2 (en) 2018-04-04 2021-04-20 Xencor, Inc. Heterodimeric antibodies that bind fibroblast activation protein
US10981992B2 (en) 2017-11-08 2021-04-20 Xencor, Inc. Bispecific immunomodulatory antibodies that bind costimulatory and checkpoint receptors
US11001643B2 (en) 2014-09-26 2021-05-11 Chugai Seiyaku Kabushiki Kaisha Cytotoxicity-inducing therapeutic agent
US11046784B2 (en) 2006-03-31 2021-06-29 Chugai Seiyaku Kabushiki Kaisha Methods for controlling blood pharmacokinetics of antibodies
US11053316B2 (en) 2013-01-14 2021-07-06 Xencor, Inc. Optimized antibody variable regions
US11072666B2 (en) 2016-03-14 2021-07-27 Chugai Seiyaku Kabushiki Kaisha Cell injury inducing therapeutic drug for use in cancer therapy
US11072653B2 (en) 2015-06-08 2021-07-27 Macrogenics, Inc. LAG-3-binding molecules and methods of use thereof
US11078279B2 (en) 2015-06-12 2021-08-03 Macrogenics, Inc. Combination therapy for the treatment of cancer
US11084863B2 (en) 2017-06-30 2021-08-10 Xencor, Inc. Targeted heterodimeric Fc fusion proteins containing IL-15 IL-15alpha and antigen binding domains
US11098127B2 (en) 2010-01-08 2021-08-24 Regeneron Pharmaceuticals, Inc. Stabilized formulations containing anti-interleukin-6 receptor (IL-6R) antibodies
WO2021175954A1 (en) 2020-03-04 2021-09-10 Imcheck Therapeutics Sas Antibodies having specificity for btnl8 and uses thereof
US11124576B2 (en) 2013-09-27 2021-09-21 Chungai Seiyaku Kabushiki Kaisha Method for producing polypeptide heteromultimer
US11168344B2 (en) 2005-03-31 2021-11-09 Chugai Seiyaku Kabushiki Kaisha Methods for producing polypeptides by regulating polypeptide association
US11174315B2 (en) 2015-10-08 2021-11-16 Macrogenics, Inc. Combination therapy for the treatment of cancer
WO2021234402A2 (en) 2020-05-21 2021-11-25 Mabsolve Limited Modified immunoglobulin fc regions
US11198732B2 (en) 2011-03-16 2021-12-14 Amgen Inc. Fc variants
US11203638B2 (en) 2017-05-05 2021-12-21 Allakos Inc. Methods and compositions for treating perennial allergic conjunctivitis and keratoconjunctivitis
US11242384B2 (en) 2017-01-20 2022-02-08 Sanofi Anti-TGF-beta antibodies and their use
US11248053B2 (en) 2007-09-26 2022-02-15 Chugai Seiyaku Kabushiki Kaisha Method of modifying isoelectric point of antibody via amino acid substitution in CDR
WO2022079199A1 (en) 2020-10-15 2022-04-21 UCB Biopharma SRL Binding molecules that multimerise cd45
US11312770B2 (en) 2017-11-08 2022-04-26 Xencor, Inc. Bispecific and monospecific antibodies using novel anti-PD-1 sequences
US11319355B2 (en) 2017-12-19 2022-05-03 Xencor, Inc. Engineered IL-2 Fc fusion proteins
US11332533B2 (en) 2007-09-26 2022-05-17 Chugai Seiyaku Kabushiki Kaisha Modified antibody constant region
US11352417B2 (en) 2016-12-22 2022-06-07 Regeneron Pharmaceuticals, Inc. Method of treating an allergy with allergen-specific monoclonal antibodies
US11358999B2 (en) 2018-10-03 2022-06-14 Xencor, Inc. IL-12 heterodimeric Fc-fusion proteins
US11472890B2 (en) 2019-03-01 2022-10-18 Xencor, Inc. Heterodimeric antibodies that bind ENPP3 and CD3
US11498969B2 (en) 2019-01-31 2022-11-15 Sanofi Biotechnology Compositions and methods for treating juvenile idiopathic arthritis
US11505595B2 (en) 2018-04-18 2022-11-22 Xencor, Inc. TIM-3 targeted heterodimeric fusion proteins containing IL-15/IL-15RA Fc-fusion proteins and TIM-3 antigen binding domains
US11524991B2 (en) 2018-04-18 2022-12-13 Xencor, Inc. PD-1 targeted heterodimeric fusion proteins containing IL-15/IL-15Ra Fc-fusion proteins and PD-1 antigen binding domains and uses thereof
US11555038B2 (en) 2017-01-25 2023-01-17 Beigene, Ltd. Crystalline forms of (S)-7-(1-(but-2-ynoyl)piperidin-4-yl)-2-(4-phenoxyphenyl)-4,5,6,7-tetrahydropyrazolo[1,5-a]pyrimidine-3-carboxamide, preparation, and uses thereof
US11591401B2 (en) 2020-08-19 2023-02-28 Xencor, Inc. Anti-CD28 compositions
US11597768B2 (en) 2017-06-26 2023-03-07 Beigene, Ltd. Immunotherapy for hepatocellular carcinoma
US11634495B2 (en) 2017-04-07 2023-04-25 Miltenyi Biotec B.V. & Co. KG Methods of activating CD32b/c comprising administering an antibody that binds BDCA-2 (CD303)
US11649262B2 (en) 2015-12-28 2023-05-16 Chugai Seiyaku Kabushiki Kaisha Method for promoting efficiency of purification of Fc region-containing polypeptide
US11701357B2 (en) 2016-08-19 2023-07-18 Beigene Switzerland Gmbh Treatment of B cell cancers using a combination comprising Btk inhibitors
US11739144B2 (en) 2021-03-09 2023-08-29 Xencor, Inc. Heterodimeric antibodies that bind CD3 and CLDN6
US11786529B2 (en) 2017-11-29 2023-10-17 Beigene Switzerland Gmbh Treatment of indolent or aggressive B-cell lymphomas using a combination comprising BTK inhibitors
US20230399390A1 (en) * 2019-10-24 2023-12-14 Novago Therapeutics Ag Novel anti-nogo-a antibodies
US11851476B2 (en) 2011-10-31 2023-12-26 Chugai Seiyaku Kabushiki Kaisha Antigen-binding molecule having regulated conjugation between heavy-chain and light-chain
US11859012B2 (en) 2021-03-10 2024-01-02 Xencor, Inc. Heterodimeric antibodies that bind CD3 and GPC3
US11919956B2 (en) 2020-05-14 2024-03-05 Xencor, Inc. Heterodimeric antibodies that bind prostate specific membrane antigen (PSMA) and CD3
WO2024115935A1 (en) 2022-11-29 2024-06-06 Inserm Methods for the treatment of b-cell lymphoma using cd39 inhibitors
WO2024170543A1 (en) 2023-02-14 2024-08-22 Institut National de la Santé et de la Recherche Médicale Anti-cd44 antibodies and uses thereof
WO2024175760A1 (en) 2023-02-24 2024-08-29 Institut National de la Santé et de la Recherche Médicale Methods for the treatment of endometriosis
US12098194B2 (en) 2017-01-20 2024-09-24 Genzyme Corporation Bone-targeting antibodies
US12145974B2 (en) * 2017-03-14 2024-11-19 Sunshine Lake Pharma Co., Ltd. Dual-target fusion proteins comprising FGF21 and GLP-1, connected through a Fc portion of an immunoglobulin
WO2024261239A1 (en) 2023-06-23 2024-12-26 Imcheck Therapeutics Bispecific antibodies targeting btn3a and the pd-1/pd-l1 inhibitory axis
EP4520771A2 (en) 2011-04-20 2025-03-12 Genmab A/S Bispecifc antibodies against her2
US12297279B2 (en) 2019-06-04 2025-05-13 Sanofi Biotechnology Compositions and methods for treating pain in subjects with rheumatoid arthritis
WO2025120171A1 (en) 2023-12-08 2025-06-12 UCB Biopharma SRL Antibodies
WO2025120015A1 (en) 2023-12-06 2025-06-12 Institut National de la Santé et de la Recherche Médicale Cd5 targeting antibodies with depleting and t or b-cell activation effects
WO2025162964A1 (en) 2024-01-30 2025-08-07 Institut National de la Santé et de la Recherche Médicale Methods for the treatment of endometriosis
US12415859B2 (en) 2018-12-18 2025-09-16 Genmab A/S Methods of producing heterodimeric antibodies
US12421322B2 (en) 2017-11-01 2025-09-23 Chugai Seiyaku Kabushiki Kaisha Antibody variant and isoform with lowered biological activity
US12440561B2 (en) 2019-04-24 2025-10-14 Sanofi Biotechnology Method of diagnosis and treatment of rheumatoid arthritis
US12460014B2 (en) 2016-04-28 2025-11-04 Chugai Seiyaku Kabushiki Kaisha Antibody-containing preparation
US12466897B2 (en) 2011-10-10 2025-11-11 Xencor, Inc. Heterodimeric human IgG1 polypeptides with isoelectric point modifications
US12497442B2 (en) 2020-05-21 2025-12-16 Mabsolve Limited Nucleic acids encoding modified immunoglobulin Fc regions

Families Citing this family (39)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2167669A2 (en) 2007-05-31 2010-03-31 Genmab A/S Transgenic animals producing monovalent human antibodies and antibodies obtainable from these animals
MX2012009321A (es) 2010-02-11 2012-11-21 Alexion Pharma Inc Metodos terapeuticos que utilizan anticuerpos anti-cd200.
US9884909B2 (en) 2010-12-01 2018-02-06 Alderbio Holdings Llc Anti-NGF compositions and use thereof
WO2012075340A2 (en) 2010-12-01 2012-06-07 Alderbio Holdings Llc Anti-ngf compositions and use thereof
US9539324B2 (en) 2010-12-01 2017-01-10 Alderbio Holdings, Llc Methods of preventing inflammation and treating pain using anti-NGF compositions
US9067988B2 (en) 2010-12-01 2015-06-30 Alderbio Holdings Llc Methods of preventing or treating pain using anti-NGF antibodies
US9078878B2 (en) 2010-12-01 2015-07-14 Alderbio Holdings Llc Anti-NGF antibodies that selectively inhibit the association of NGF with TrkA, without affecting the association of NGF with p75
US11214610B2 (en) 2010-12-01 2022-01-04 H. Lundbeck A/S High-purity production of multi-subunit proteins such as antibodies in transformed microbes such as Pichia pastoris
CN116063522A (zh) * 2011-06-13 2023-05-05 美国全心医药生技股份有限公司 抗psgl-1抗体及其用途
AU2014213147B2 (en) 2013-01-31 2019-01-17 lmmunAbs Inc. C5 antibody and method for preventing and treating complement-related diseases
TWI635098B (zh) 2013-02-01 2018-09-11 再生元醫藥公司 含嵌合恆定區之抗體
PE20160953A1 (es) 2013-12-12 2016-09-26 Shanghai hengrui pharmaceutical co ltd Anticuerpo pd-1, fragmento de union al antigeno de este y uso medico de este
TWI701042B (zh) 2014-03-19 2020-08-11 美商再生元醫藥公司 用於腫瘤治療之方法及抗體組成物
BR112016027845A2 (pt) 2014-05-29 2017-10-31 Medimmune Llc proteínas de fusão de ox40l e usos das mesmas
TWI566780B (zh) * 2014-10-24 2017-01-21 國立陽明大學 巨噬細胞發炎蛋白-1β(MIP-1β)抑制劑用於促進血管新生以改善組織缺血及糖尿病血管病變的用途
SI3221359T1 (sl) 2014-11-17 2020-08-31 Regeneron Pharmaceuticals, Inc. Metode zravljenja tumorja z uporabo bispecifičnega protitelesa CD3XCD20
EP3277725B1 (en) 2015-03-30 2020-11-25 Regeneron Pharmaceuticals, Inc. Heavy chain constant regions with reduced binding to fc gamma receptors
WO2016193380A1 (en) 2015-06-02 2016-12-08 Novo Nordisk A/S Insulins with polar recombinant extensions
AU2016332725A1 (en) 2015-09-29 2018-03-22 Celgene Corporation PD-1 binding proteins and methods of use thereof
MA43348A (fr) 2015-10-01 2018-08-08 Novo Nordisk As Conjugués de protéines
CA3025162A1 (en) 2016-05-26 2017-11-30 Qilu Puget Sound Biotherapeutics Corporation Mixtures of antibodies
JP2019534859A (ja) 2016-09-19 2019-12-05 セルジーン コーポレイション Pd−1結合タンパク質を使用して白斑を治療する方法
US10751414B2 (en) 2016-09-19 2020-08-25 Celgene Corporation Methods of treating psoriasis using PD-1 binding antibodies
GB201701194D0 (en) 2017-01-24 2017-03-08 Capella Bioscience Ltd Antigen binding molecules that bind light
WO2018185131A2 (en) 2017-04-05 2018-10-11 Novo Nordisk A/S Oligomer extended insulin-fc conjugates
RU2646807C1 (ru) * 2017-08-08 2018-03-07 Федеральное государственное бюджетное научное учреждение "Научно-исследовательский институт фундаментальной и клинической иммунологии" Способ выделения аутоантител подклассов иммуноглобулина G к иммунорегуляторному цитокину фактору некроза опухоли
US11312781B2 (en) 2018-01-24 2022-04-26 Capella Bioscience Ltd. Antigen binding molecules that bind LIGHT
CA3097625A1 (en) 2018-04-18 2019-10-24 Xencor, Inc. Il-15/il-15ra heterodimeric fc fusion proteins and uses thereof
RS66543B1 (sr) 2018-08-31 2025-03-31 Regeneron Pharma Strategija doziranja koja ublažava sindrom oslobađanja citokina za cd3/cd20 bispecifična antitela
JP6800191B2 (ja) * 2018-09-21 2020-12-16 ベイジーン スウィッツァーランド ゲーエムベーハー 抗pd−1抗体並びにその治療及び診断のための使用
CR20210239A (es) 2018-10-12 2021-12-15 Xencor Inc Proteínas de fusión de il-15/il-15ralfa-fc dirigidas a pd-1 y usos de las mismas en terapias combinadas
US11618776B2 (en) 2018-12-20 2023-04-04 Xencor, Inc. Targeted heterodimeric Fc fusion proteins containing IL-15/IL-15RA and NKG2D antigen binding domains
FI4001303T3 (fi) * 2019-07-18 2025-07-16 Hanmi Pharmaceutical Co Ltd Menetelmä pitkävaikutteisen lääkekonjugaatin valmistamiseksi valmistamalla uudenlainen välituote
TW202128757A (zh) 2019-10-11 2021-08-01 美商建南德克公司 具有改善之特性的 PD-1 標靶 IL-15/IL-15Rα FC 融合蛋白
KR20230148956A (ko) * 2022-04-19 2023-10-26 전남대학교산학협력단 플라젤린 및 면역글로불린 Fc 융합 단백질을 포함하는 간 질환 또는 대사증후군 치료용 조성물
KR20230148959A (ko) * 2022-04-19 2023-10-26 전남대학교산학협력단 플라젤린 및 면역글로불린 Fc 융합 단백질을 포함하는 대장염 치료용 조성물
KR20250018382A (ko) 2022-05-30 2025-02-05 한올바이오파마주식회사 안정성이 향상된 항-FcRn 항체 또는 이의 항원 결합 단편
WO2024146458A1 (zh) * 2023-01-06 2024-07-11 广东东阳光药业股份有限公司 抗il-11细胞因子人源化抗体
AU2024282654A1 (en) 2023-05-30 2025-12-04 Paragon Therapeutics, Inc. Alpha4beta7 integrin antibody compositions and methods of use

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2005063816A2 (en) * 2003-12-19 2005-07-14 Genentech, Inc. Monovalent antibody fragments useful as therapeutics
WO2006033386A1 (ja) * 2004-09-22 2006-03-30 Kirin Beer Kabushiki Kaisha 安定化されたヒトIgG4抗体
US20070105199A1 (en) * 2005-10-21 2007-05-10 Wei Yan Methods for generating monovalent IgG

Family Cites Families (43)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
JPS6147500A (ja) 1984-08-15 1986-03-07 Res Dev Corp Of Japan キメラモノクロ−ナル抗体及びその製造法
EP0173494A3 (en) 1984-08-27 1987-11-25 The Board Of Trustees Of The Leland Stanford Junior University Chimeric receptors by dna splicing and expression
GB8422238D0 (en) 1984-09-03 1984-10-10 Neuberger M S Chimeric proteins
JPS61134325A (ja) 1984-12-04 1986-06-21 Teijin Ltd ハイブリツド抗体遺伝子の発現方法
WO1987002671A1 (en) 1985-11-01 1987-05-07 International Genetic Engineering, Inc. Modular assembly of antibody genes, antibodies prepared thereby and use
AU600575B2 (en) * 1987-03-18 1990-08-16 Sb2, Inc. Altered antibodies
US5750172A (en) 1987-06-23 1998-05-12 Pharming B.V. Transgenic non human mammal milk
GB8823869D0 (en) 1988-10-12 1988-11-16 Medical Res Council Production of antibodies
US5633076A (en) 1989-12-01 1997-05-27 Pharming Bv Method of producing a transgenic bovine or transgenic bovine embryo
US6300129B1 (en) 1990-08-29 2001-10-09 Genpharm International Transgenic non-human animals for producing heterologous antibodies
US5633425A (en) 1990-08-29 1997-05-27 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5874299A (en) 1990-08-29 1999-02-23 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
KR100272077B1 (ko) 1990-08-29 2000-11-15 젠팜인터내셔날,인코포레이티드 이종 항체를 생산할 수 있는 전이유전자를 가진 인간이외의 동물
US5814318A (en) 1990-08-29 1998-09-29 Genpharm International Inc. Transgenic non-human animals for producing heterologous antibodies
US5789650A (en) 1990-08-29 1998-08-04 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5661016A (en) 1990-08-29 1997-08-26 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5877397A (en) 1990-08-29 1999-03-02 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5625126A (en) 1990-08-29 1997-04-29 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5770429A (en) 1990-08-29 1998-06-23 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5545806A (en) 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
WO1992022645A1 (en) 1991-06-14 1992-12-23 Genpharm International, Inc. Transgenic immunodeficient non-human animals
JPH06508880A (ja) 1991-07-08 1994-10-06 ユニバーシティ オブ マサチューセッツ アット アムハースト サーモトロピック液晶セグメント化ブロックコポリマー
US5733743A (en) 1992-03-24 1998-03-31 Cambridge Antibody Technology Limited Methods for producing members of specific binding pairs
ATE193301T1 (de) 1993-03-09 2000-06-15 Genzyme Corp Verfahren zur isolierung von proteinen aus milch
AU6819494A (en) 1993-04-26 1994-11-21 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5827690A (en) 1993-12-20 1998-10-27 Genzyme Transgenics Corporatiion Transgenic production of antibodies in milk
WO1999055369A1 (en) 1998-04-28 1999-11-04 Smithkline Beecham Corporation Monoclonal antibodies with reduced immunogenicity
BR0008758A (pt) * 1999-01-15 2001-12-04 Genentech Inc Variantes de polipeptìdeos parentais com funçãoefetora alterada, polipeptìdeos, composição ácidonucleico isolado, vetor, célula hospedeira,método para produzir uma variante depolipeptìdeo, método para o tratamento de umadesordem em mamìferos e método para produziruma região fc variante
US6737056B1 (en) 1999-01-15 2004-05-18 Genentech, Inc. Polypeptide variants with altered effector function
HK1049014A1 (zh) 1999-07-29 2003-04-25 Medarex, Inc. 抗her2/neu的人类单克隆抗体
EP1212422B1 (en) 1999-08-24 2007-02-21 Medarex, Inc. Human ctla-4 antibodies and their uses
DE10015711A1 (de) * 2000-03-29 2001-10-04 Nbt Gmbh Alkalischer Akkumulator
DK1354034T3 (da) 2000-11-30 2008-03-25 Medarex Inc Transgene transchromosomale gnavere til fremstilling af humane antistoffer
WO2002086186A1 (en) 2001-04-24 2002-10-31 Tosoh Smd, Inc. Target and method of optimizing target profile
CZ200438A3 (cs) 2001-06-13 2004-06-16 Genmab A/S Název neuveden
US7595378B2 (en) 2001-06-13 2009-09-29 Genmab A/S Human monoclonal antibodies to epidermal growth factor receptor (EGFR)
WO2003074679A2 (en) * 2002-03-01 2003-09-12 Xencor Antibody optimization
WO2004035607A2 (en) 2002-10-17 2004-04-29 Genmab A/S Human monoclonal antibodies against cd20
US20060074225A1 (en) * 2004-09-14 2006-04-06 Xencor, Inc. Monomeric immunoglobulin Fc domains
JP5620626B2 (ja) * 2005-03-31 2014-11-05 中外製薬株式会社 会合制御によるポリペプチド製造方法
US10155816B2 (en) 2005-11-28 2018-12-18 Genmab A/S Recombinant monovalent antibodies and methods for production thereof
CN110066339A (zh) * 2010-04-20 2019-07-30 根马布股份公司 含异二聚体抗体fc的蛋白及其制备方法

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2005063816A2 (en) * 2003-12-19 2005-07-14 Genentech, Inc. Monovalent antibody fragments useful as therapeutics
WO2006033386A1 (ja) * 2004-09-22 2006-03-30 Kirin Beer Kabushiki Kaisha 安定化されたヒトIgG4抗体
EP1810979A1 (en) * 2004-09-22 2007-07-25 Kirin Beer Kabushiki Kaisha STABILIZED HUMAN IgG4 ANTIBODIES
US20070105199A1 (en) * 2005-10-21 2007-05-10 Wei Yan Methods for generating monovalent IgG

Non-Patent Citations (7)

* Cited by examiner, † Cited by third party
Title
ANGAL S ET AL: "A SINGLE AMINO ACID SUBSTITUTION ABOLISHES THE HETEROGENEITY OF CHIMERIC MOUSE/HUMAN (IGG4) ANTIBODY", MOLECULAR IMMUNOLOGY, ELMSFORD, NY, US, vol. 30, no. 1, 1 January 1993 (1993-01-01), pages 105 - 108, XP000770218, ISSN: 0161-5890 *
BRUSCO A ET AL: "Molecular characterization of immunoglobulin G4 gene isoallotypes", EUROPEAN JOURNAL OF IMMUNOGENETICS, OXFORD, GB, vol. 25, no. 5, 1 October 1998 (1998-10-01), pages 349 - 355, XP002995211, ISSN: 0960-7420 *
DALL'ACQUA WILLIAM F ET AL: "Modulation of the effector functions of a human IgG1 through engineering of its hinge region", JOURNAL OF IMMUNOLOGY (BALTIMORE, MD. : 1950) 15 JUL 2006,, vol. 177, no. 2, 15 July 2006 (2006-07-15), pages 1129 - 1138, XP002497452 *
HARINGMAN JASPER J ET AL: "A randomized controlled trial with an anti-CCL2 (anti-monocyte chemotactic protein 1) monoclonal antibody in patients with rheumatoid arthritis.", ARTHRITIS AND RHEUMATISM AUG 2006, vol. 54, no. 8, August 2006 (2006-08-01), pages 2387 - 2392, XP002499902, ISSN: 0004-3591 *
HORGAN CAROL ET AL: "Studies on antigen binding by intact and hinge-deleted chimeric antibodies", JOURNAL OF IMMUNOLOGY, AMERICAN ASSOCIATION OF IMMUNOLOGISTS, US, vol. 150, no. 12, 15 June 1993 (1993-06-15), pages 5400 - 5407, XP002423580, ISSN: 0022-1767 *
SCHUURMAN J ET AL: "The inter-heavy chain disulfide bonds of IgG4 are in equilibrium with intra-chain disulfide bonds", MOLECULAR IMMUNOLOGY, ELMSFORD, NY, US, vol. 38, no. 1, 1 January 2001 (2001-01-01), pages 1 - 8, XP002329378, ISSN: 0161-5890 *
SHERIDAN CORMAC: "Pharma consolidates its grip on post-antibody landscape.", NATURE BIOTECHNOLOGY APR 2007, vol. 25, no. 4, April 2007 (2007-04-01), pages 365 - 366, XP002499901, ISSN: 1087-0156 *

Cited By (281)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8246956B2 (en) 2003-12-24 2012-08-21 Abbott Research B.V. Humanized anti-nerve growth factor antibodies
US8877491B2 (en) 2003-12-24 2014-11-04 Abbvie Inc. Polynucleotides encoding humanized anti-NGF antibodies
US8257710B2 (en) 2003-12-24 2012-09-04 Abbott Research, B.V. Method for the treatment of pain with humanized anti-nerve growth factor antibodies
US11168344B2 (en) 2005-03-31 2021-11-09 Chugai Seiyaku Kabushiki Kaisha Methods for producing polypeptides by regulating polypeptide association
US9688749B2 (en) 2005-06-07 2017-06-27 Abbvie Inc. Molecules that are able to inhibit the binding between NGF and the TrkA receptor as analgesics with prolonged effect
US12473375B2 (en) 2006-03-31 2025-11-18 Chugai Seiyaku Kabushiki Kaisha Methods for controlling blood pharmacokinetics of antibodies
US11046784B2 (en) 2006-03-31 2021-06-29 Chugai Seiyaku Kabushiki Kaisha Methods for controlling blood pharmacokinetics of antibodies
US10934344B2 (en) 2006-03-31 2021-03-02 Chugai Seiyaku Kabushiki Kaisha Methods of modifying antibodies for purification of bispecific antibodies
US10584173B2 (en) 2006-06-02 2020-03-10 Regeneron Pharmaceuticals, Inc. Nucleic acids encoding high affinity antibodies to human IL-6 receptor
US8043617B2 (en) 2006-06-02 2011-10-25 Regeneron Pharmaceuticals, Inc. Human antibodies to human IL-6 receptor
US8080248B2 (en) 2006-06-02 2011-12-20 Regeneron Pharmaceuticals, Inc. Method of treating rheumatoid arthritis with an IL-6R antibody
US8568721B2 (en) 2006-06-02 2013-10-29 Regeneron Pharmaceuticals, Inc. Method of treating rheumatoid arthritis with an anti-IL-6R antibody
US11370843B2 (en) 2006-06-02 2022-06-28 Regeneron Pharmaceuticals, Inc. High affinity antibodies to human IL-6 receptor
US9884916B2 (en) 2006-06-02 2018-02-06 Regeneron Pharmacueuticals, Inc. High affinity antibodies to human IL-6 receptor
US8183014B2 (en) 2006-06-02 2012-05-22 Regeneron Pharmaceuticals, Inc. High affinity antibodies to human IL-6 receptor
US8192741B2 (en) 2006-06-02 2012-06-05 Regeneron Pharmaceuticals, Inc. Method of treating rheumatoid arthritis with an anti-IL-6R antibody
US9308256B2 (en) 2006-06-02 2016-04-12 Regeneron Pharmaceuticals, Inc. Method of treating rheumatoid arthritis with an anti-IL-6R antibody
US10906991B2 (en) 2007-03-29 2021-02-02 Genmab A/S Bispecific antibodies and methods for production thereof
US9212230B2 (en) 2007-03-29 2015-12-15 Genmab A/S Bispecific antibodies and methods for production thereof
US12116414B2 (en) 2007-09-26 2024-10-15 Chugai Seiyaku Kabushiki Kaisha Method of modifying isoelectric point of antibody via amino acid substitution in CDR
US12122840B2 (en) 2007-09-26 2024-10-22 Chugai Seiyaku Kabushiki Kaisha Method of modifying isoelectric point of antibody via amino acid substitution in CDR
US11248053B2 (en) 2007-09-26 2022-02-15 Chugai Seiyaku Kabushiki Kaisha Method of modifying isoelectric point of antibody via amino acid substitution in CDR
US11332533B2 (en) 2007-09-26 2022-05-17 Chugai Seiyaku Kabushiki Kaisha Modified antibody constant region
WO2009103791A1 (en) * 2008-02-22 2009-08-27 Genmab A/S Methods for assissing the risk of adverse events upon treatment with igg4 antibodies
EP3153524A1 (en) 2008-12-03 2017-04-12 Genmab A/S Antibody variants having modifications in the constant region
WO2010063785A3 (en) * 2008-12-03 2010-07-29 Genmab A/S Antibody variants having modifications in the constant region
US10000570B2 (en) 2008-12-03 2018-06-19 Genmab A/S Antibody variants having modifications in the constant region
US9085625B2 (en) 2008-12-03 2015-07-21 Genmab A/S Antibody variants having modifications in the constant region
EP2389192A4 (en) * 2009-01-23 2013-01-16 Biogen Idec Inc STABILIZED FC POLYPEPTIDES WITH REDUCED EFFECTOR FUNCTION AND METHOD OF USE
US8435523B2 (en) 2009-05-04 2013-05-07 Abbott Research B.V. Antibodies against nerve growth factor (NGF) with enhanced in vivo stability
WO2010128398A1 (en) 2009-05-04 2010-11-11 Pangenetics 110 B.V. Antibodies against nerve growth factor (ngf) with enhanced in vivo stability
US9447181B2 (en) 2009-05-04 2016-09-20 Abbvie Research B.V. Antibodies against nerve growth factor (NGF) with enhanced in vivo stability
US9493578B2 (en) 2009-09-02 2016-11-15 Xencor, Inc. Compositions and methods for simultaneous bivalent and monovalent co-engagement of antigens
US12077593B2 (en) 2010-01-08 2024-09-03 Regeneron Pharmaceuticals, Inc. Stabilized formulations containing anti-interleukin-6 receptor (IL-6R) antibodies
US11098127B2 (en) 2010-01-08 2021-08-24 Regeneron Pharmaceuticals, Inc. Stabilized formulations containing anti-interleukin-6 receptor (IL-6R) antibodies
WO2011108502A1 (ja) 2010-03-02 2011-09-09 協和発酵キリン株式会社 改変抗体組成物
US10435458B2 (en) 2010-03-04 2019-10-08 Chugai Seiyaku Kabushiki Kaisha Antibody constant region variants with reduced Fcgammar binding
EP3511342A1 (en) 2010-03-10 2019-07-17 Genmab A/S Monoclonal antibodies against c-met
EP4483963A2 (en) 2010-03-10 2025-01-01 Genmab A/S Monoclonal antibodies against c-met
WO2011110642A2 (en) 2010-03-10 2011-09-15 Genmab A/S Monoclonal antibodies against c-met
EP3904391A1 (en) 2010-03-10 2021-11-03 Genmab A/S Monoclonal antibodies against c-met
WO2011116090A1 (en) 2010-03-17 2011-09-22 Abbott Research B.V. Anti-nerve growth factor (ngf) antibody compositions
US10597464B2 (en) 2010-04-20 2020-03-24 Genmab A/S Heterodimeric antibody Fc-containing proteins and methods for production thereof
EP4477668A3 (en) * 2010-04-20 2025-03-19 Genmab A/S Heterodimeric antibody fc-containing proteins and methods for production thereof
US9150663B2 (en) 2010-04-20 2015-10-06 Genmab A/S Heterodimeric antibody Fc-containing proteins and methods for production thereof
EP4477668A2 (en) 2010-04-20 2024-12-18 Genmab A/S Heterodimeric antibody fc-containing proteins and methods for production thereof
EP2560993B1 (en) * 2010-04-20 2024-06-26 Genmab A/S Heterodimeric antibody fc-containing proteins and methods for production thereof
US11866514B2 (en) 2010-04-20 2024-01-09 Genmab A/S Heterodimeric antibody Fc-containing proteins and methods for production thereof
JP2017043621A (ja) * 2010-04-20 2017-03-02 ゲンマブ エー/エス ヘテロ二量体抗体Fc含有タンパク質およびその産生方法
WO2011131746A2 (en) 2010-04-20 2011-10-27 Genmab A/S Heterodimeric antibody fc-containing proteins and methods for production thereof
JP2013531470A (ja) * 2010-04-20 2013-08-08 ゲンマブ エー/エス ヘテロ二量体抗体Fc含有タンパク質およびその産生方法
WO2011138785A3 (en) * 2010-05-05 2011-12-29 Rappaport Family Institute For Research In The Medical Sciences Use of ccl1 in therapy
US9717777B2 (en) 2010-05-05 2017-08-01 Rappaport Family Institute For Research In The Medical Sciences Use of CCL1 in therapy
US9352000B2 (en) 2010-05-05 2016-05-31 Rappaport Family Institute For Research In The Medical Sciences Use of CCL1 in therapy
US11046771B2 (en) 2010-05-27 2021-06-29 Genmab A/S Monoclonal antibodies against HER2
EP3539988A2 (en) 2010-05-27 2019-09-18 Genmab A/S Monoclonal antibodies against her2
WO2011147986A1 (en) 2010-05-27 2011-12-01 Genmab A/S Monoclonal antibodies against her2
WO2011147982A2 (en) 2010-05-27 2011-12-01 Genmab A/S Monoclonal antibodies against her2 epitope
US11091553B2 (en) 2010-05-27 2021-08-17 Genmab A/S Monoclonal antibodies against HER2
WO2011157741A2 (en) 2010-06-15 2011-12-22 Genmab A/S Human antibody drug conjugates against tissue factor
EP4434550A2 (en) 2010-06-15 2024-09-25 Genmab A/S Human antibody drug conjugates against tissue culture
EP3281956A2 (en) 2010-06-15 2018-02-14 Genmab A/S Human antibody drug conjugates against tissue factor
US9605061B2 (en) 2010-07-29 2017-03-28 Xencor, Inc. Antibodies with modified isoelectric points
WO2012022982A3 (en) * 2010-08-20 2012-06-21 Ucb Pharma S.A. Improved antibodies of the class igg4
CN103097410B (zh) * 2010-08-20 2016-06-01 Ucb医药有限公司 改善的IgG4类抗体
US12091450B2 (en) 2010-08-20 2024-09-17 UCB Biopharma SRL Antibodies of the class IGG4
CN103097410A (zh) * 2010-08-20 2013-05-08 Ucb医药有限公司 改善的IgG4类抗体
CN105859876B (zh) * 2010-08-20 2021-04-02 Ucb医药有限公司 改善的IgG4 类抗体
CN105859876A (zh) * 2010-08-20 2016-08-17 Ucb医药有限公司 改善的IgG4 类抗体
WO2012022982A2 (en) 2010-08-20 2012-02-23 Ucb Pharma S.A. Improved antibodies of the class igg4
US10562966B2 (en) 2010-08-20 2020-02-18 Ucb Biopharma Sprl Antibodies of the class IGG4
US10450381B2 (en) 2010-11-17 2019-10-22 Chugai Seiyaku Kabushiki Kaisha Methods of treatment that include the administration of bispecific antibodies
US11198732B2 (en) 2011-03-16 2021-12-14 Amgen Inc. Fc variants
US11578141B2 (en) 2011-04-20 2023-02-14 Genmab A/S Bispecific antibodies against HER2 and CD3
WO2012143523A1 (en) 2011-04-20 2012-10-26 Genmab A/S Bispecifc antibodies against her2
EP4520771A2 (en) 2011-04-20 2025-03-12 Genmab A/S Bispecifc antibodies against her2
WO2012143524A2 (en) 2011-04-20 2012-10-26 Genmab A/S Bispecific antibodies against her2 and cd3
US10851178B2 (en) 2011-10-10 2020-12-01 Xencor, Inc. Heterodimeric human IgG1 polypeptides with isoelectric point modifications
US12466897B2 (en) 2011-10-10 2025-11-11 Xencor, Inc. Heterodimeric human IgG1 polypeptides with isoelectric point modifications
US11725065B2 (en) 2011-10-11 2023-08-15 Genentech, Inc. Assembly of bispecific antibodies
US9862778B2 (en) 2011-10-11 2018-01-09 Genentech, Inc. Assembly of bispecific antibodies
US10626189B2 (en) 2011-10-11 2020-04-21 Genentech, Inc. Assembly of bispecific antibodies
US10927435B2 (en) 2011-10-11 2021-02-23 Sanofi Biotechnology Compositions for the treatment of rheumatoid arthritis and methods of using same
US11492371B2 (en) 2011-10-27 2022-11-08 Genmab A/S Production of heterodimeric proteins
US10344050B2 (en) 2011-10-27 2019-07-09 Genmab A/S Production of heterodimeric proteins
US11851476B2 (en) 2011-10-31 2023-12-26 Chugai Seiyaku Kabushiki Kaisha Antigen-binding molecule having regulated conjugation between heavy-chain and light-chain
WO2013124451A1 (en) 2012-02-22 2013-08-29 Ucb Pharma S.A. Sequence symmetric modified igg4 bispecific antibodies
US9902768B2 (en) 2012-02-22 2018-02-27 Ucb Biopharma Sprl Sequence asymmetric modified IgG4 bispecific antibodies
WO2013124450A1 (en) 2012-02-22 2013-08-29 Ucb Pharma S.A. Sequence symmetric modified igg4 bispecific antibodies
EP3670531A1 (en) 2012-02-22 2020-06-24 UCB Biopharma SRL Asymmetric, modified igg4 bispecific antibodies
US11059911B2 (en) 2012-02-22 2021-07-13 UCB Biopharma SRL Sequence symmetric modified IgG4 bispecific antibodies
EP3156416A1 (en) 2012-02-22 2017-04-19 UCB Biopharma SPRL Sequence symmetric modified igg4 bispecific antibodies
US10221251B2 (en) 2012-02-22 2019-03-05 Ucb Biopharma Sprl Sequence symmetric modified IGG4 bispecific antibodies
US11174305B2 (en) 2012-05-03 2021-11-16 Regeneron Pharmaceuticals, Inc. Human antibodies to Fel d1 and methods of use thereof
US9079948B2 (en) 2012-05-03 2015-07-14 Regeneron Pharmaceuticals, Inc. Human antibodies to Fel d1 and methods of use thereof
KR102185516B1 (ko) * 2012-05-03 2020-12-02 리제너론 파마슈티칼스 인코포레이티드 Fel d1에 대한 사람 항체 및 그것의 사용방법
US12252530B2 (en) 2012-05-03 2025-03-18 Regeneron Pharmaceuticals, Inc. Human antibodies to Fel d1 and methods of use thereof
CN104411719B (zh) * 2012-05-03 2019-05-14 瑞泽恩制药公司 针对fel d1的人源抗体及其使用方法
EP3978522A3 (en) * 2012-05-03 2022-07-06 Regeneron Pharmaceuticals, Inc. Human antibodies to fel d1 and methods of use thereof
US9475869B2 (en) 2012-05-03 2016-10-25 Regeneron Pharmaceuticals, Inc. Human antibodies to fel d1 and methods of use thereof
US10047152B2 (en) 2012-05-03 2018-08-14 Regeneron Pharmaceuticals, Inc. Human antibodies to fel D1 and methods of use thereof
US10047153B2 (en) 2012-05-03 2018-08-14 Regeneron Pharmaceuticals, Inc. Human antibodies to Fel d1 and methods of use thereof
RU2658491C2 (ru) * 2012-05-03 2018-06-21 Регенерон Фармасьютикалз, Инк. Человеческие антитела к fel d1 и способы их применения
EP3660047A1 (en) * 2012-05-03 2020-06-03 Regeneron Pharmaceuticals, Inc. Human antibodies to fel d1 and methods of use thereof
CN104411719A (zh) * 2012-05-03 2015-03-11 瑞泽恩制药公司 针对fel d1 的人源抗体及其使用方法
AU2018203087B9 (en) * 2012-05-03 2020-03-26 Regeneron Pharmaceuticals, Inc. Human antibodies to fel d1 and methods of use thereof
KR20150005666A (ko) * 2012-05-03 2015-01-14 리제너론 파마슈티칼스 인코포레이티드 Fel d1에 대한 사람 항체 및 그것의 사용방법
WO2013166236A1 (en) * 2012-05-03 2013-11-07 Regeneron Pharmaceuticals, Inc. Human antibodies to fel d1 and methods of use thereof
AU2018203087B2 (en) * 2012-05-03 2020-03-12 Regeneron Pharmaceuticals, Inc. Human antibodies to fel d1 and methods of use thereof
AU2013256251C1 (en) * 2012-05-03 2018-08-23 Regeneron Pharmaceuticals, Inc. Human antibodies to Fel d1 and methods of use thereof
US10131710B2 (en) 2013-01-14 2018-11-20 Xencor, Inc. Optimized antibody variable regions
US10472427B2 (en) 2013-01-14 2019-11-12 Xencor, Inc. Heterodimeric proteins
US9701759B2 (en) 2013-01-14 2017-07-11 Xencor, Inc. Heterodimeric proteins
US11718667B2 (en) 2013-01-14 2023-08-08 Xencor, Inc. Optimized antibody variable regions
US9650446B2 (en) 2013-01-14 2017-05-16 Xencor, Inc. Heterodimeric proteins
US10738132B2 (en) 2013-01-14 2020-08-11 Xencor, Inc. Heterodimeric proteins
US10738133B2 (en) 2013-01-14 2020-08-11 Xencor, Inc. Heterodimeric proteins
US11634506B2 (en) 2013-01-14 2023-04-25 Xencor, Inc. Heterodimeric proteins
US10487155B2 (en) 2013-01-14 2019-11-26 Xencor, Inc. Heterodimeric proteins
US11053316B2 (en) 2013-01-14 2021-07-06 Xencor, Inc. Optimized antibody variable regions
US9738722B2 (en) 2013-01-15 2017-08-22 Xencor, Inc. Rapid clearance of antigen complexes using novel antibodies
US10968276B2 (en) 2013-03-12 2021-04-06 Xencor, Inc. Optimized anti-CD3 variable regions
US11814423B2 (en) 2013-03-15 2023-11-14 Xencor, Inc. Heterodimeric proteins
US10544187B2 (en) 2013-03-15 2020-01-28 Xencor, Inc. Targeting regulatory T cells with heterodimeric proteins
US11299554B2 (en) 2013-03-15 2022-04-12 Xencor, Inc. Heterodimeric proteins
US12415849B2 (en) 2013-03-15 2025-09-16 Xencor, Inc. Heterodimeric proteins
US10106624B2 (en) 2013-03-15 2018-10-23 Xencor, Inc. Heterodimeric proteins
US10519242B2 (en) 2013-03-15 2019-12-31 Xencor, Inc. Targeting regulatory T cells with heterodimeric proteins
US9605084B2 (en) 2013-03-15 2017-03-28 Xencor, Inc. Heterodimeric proteins
US10858417B2 (en) 2013-03-15 2020-12-08 Xencor, Inc. Heterodimeric proteins
US10287364B2 (en) 2013-03-15 2019-05-14 Xencor, Inc. Heterodimeric proteins
CN103193882A (zh) * 2013-03-29 2013-07-10 浙江大学 胚胎干细胞特异性标志物GM-CSFRα及其应用
US10935554B2 (en) 2013-08-23 2021-03-02 Regeneron Pharmaceuticals, Inc. Diagnostic tests and methods for assessing safety, efficacy or outcome of allergen-specific immunotherapy (SIT)
US11673951B2 (en) 2013-09-13 2023-06-13 Beigene Switzerland Gmbh Anti-PD1 antibodies and their use as therapeutics and diagnostics
US11186637B2 (en) 2013-09-13 2021-11-30 Beigene Switzerland Gmbh Anti-PD1 antibodies and their use as therapeutics and diagnostics
US10519235B2 (en) 2013-09-13 2019-12-31 Beigene Switzerland Gmbh Anti-PD1 antibodies and their use as therapeutics and diagnostics
KR20160044063A (ko) * 2013-09-13 2016-04-22 베이진 엘티디 항-pd1 항체 및 이의 치료 및 진단 용도
US9988450B2 (en) 2013-09-13 2018-06-05 Beigene Switzerland Gmbh Anti-PD1 antibodies and their use as therapeutics and diagnostics
US9834606B2 (en) 2013-09-13 2017-12-05 Beigene, Ltd Anti-PD1 antibodies and their use as therapeutics and diagnostics
US11124576B2 (en) 2013-09-27 2021-09-21 Chungai Seiyaku Kabushiki Kaisha Method for producing polypeptide heteromultimer
US10183996B2 (en) 2014-02-28 2019-01-22 Allakos Inc. Methods and compositions for treating Siglec-8 associated diseases
CN106687125A (zh) * 2014-03-12 2017-05-17 耶达研究与开发有限公司 降低系统性调节性t细胞水平或活性来治疗cns疾病和损伤
US10858451B2 (en) 2014-03-28 2020-12-08 Xencor, Inc. Bispecific antibodies that bind to CD38 and CD3
US9822186B2 (en) 2014-03-28 2017-11-21 Xencor, Inc. Bispecific antibodies that bind to CD38 and CD3
US11840579B2 (en) 2014-03-28 2023-12-12 Xencor, Inc. Bispecific antibodies that bind to CD38 and CD3
US10647768B2 (en) 2014-05-29 2020-05-12 Macrogenics, Inc. Multi-chain polypeptide-containing tri-specific binding molecules
EP3954703A2 (en) 2014-05-29 2022-02-16 MacroGenics, Inc. Tri-specific binding molecules and methods of use thereof
US11697684B2 (en) 2014-05-29 2023-07-11 Macrogenics, Inc. Tri-specific binding molecules that specifically bind to multiple cancer antigens
US10633440B2 (en) 2014-05-29 2020-04-28 Macrogenics, Inc. Multi-chain polypeptide-containing tri-specific binding molecules that specifically bind to multiple cancer antigens
US11820818B2 (en) 2014-05-29 2023-11-21 Macrogenics, Inc. Multi-chain polypeptide-containing tri-specific binding molecules
WO2015184203A1 (en) 2014-05-29 2015-12-03 Macrogenics, Inc. Tri-specific binding molecules and methods of use thereof
WO2015184207A1 (en) 2014-05-29 2015-12-03 Macrogenics, Inc. Tri-specific binding molecules that specifically bind to multiple cancer antigens and methods of use thereof
JP2017525335A (ja) * 2014-06-12 2017-09-07 エフ.ホフマン−ラ ロシュ アーゲーF. Hoffmann−La Roche Aktiengesellschaft FcRn相互作用が変更された抗体を選択するための方法
US11512132B2 (en) 2014-07-03 2022-11-29 Beigene, Ltd. Anti-PD-L1 antibodies and their use as therapeutics and diagnostics
US10544225B2 (en) 2014-07-03 2020-01-28 Beigene, Ltd. Anti-PD-L1 antibodies and their use as therapeutics and diagnostics
US10428146B2 (en) 2014-07-22 2019-10-01 Cb Therapeutics, Inc. Anti PD-1 antibodies
US11560429B2 (en) 2014-07-22 2023-01-24 Apollomics Inc. Anti PD-1 antibodies
US10981994B2 (en) 2014-07-22 2021-04-20 Apollomics Inc. Anti PD-1 antibodies
US10435470B2 (en) 2014-08-05 2019-10-08 Cb Therapeutics, Inc. Anti-PD-L1 antibodies
US11827707B2 (en) 2014-08-05 2023-11-28 Apollomics Inc. Anti PD-L1 antibodies
US11111300B2 (en) 2014-08-05 2021-09-07 Apollomics Inc. Anti PD-L1 antibodies
US11001643B2 (en) 2014-09-26 2021-05-11 Chugai Seiyaku Kabushiki Kaisha Cytotoxicity-inducing therapeutic agent
US10913803B2 (en) 2014-11-26 2021-02-09 Xencor, Inc. Heterodimeric antibodies that bind CD3 and tumor antigens
US11859011B2 (en) 2014-11-26 2024-01-02 Xencor, Inc. Heterodimeric antibodies that bind CD3 and tumor antigens
US11225528B2 (en) 2014-11-26 2022-01-18 Xencor, Inc. Heterodimeric antibodies that bind CD3 and tumor antigens
US11111315B2 (en) 2014-11-26 2021-09-07 Xencor, Inc. Heterodimeric antibodies that bind CD3 and tumor antigens
US11945880B2 (en) 2014-11-26 2024-04-02 Xencor, Inc. Heterodimeric antibodies that bind CD3 and tumor antigens
US12129309B2 (en) 2014-11-26 2024-10-29 Xencor, Inc. Heterodimeric antibodies that bind CD3 and CD38
US11352442B2 (en) 2014-11-26 2022-06-07 Xencor, Inc. Heterodimeric antibodies that bind CD3 and CD38
US10526417B2 (en) 2014-11-26 2020-01-07 Xencor, Inc. Heterodimeric antibodies that bind CD3 and CD38
US9856327B2 (en) 2014-11-26 2018-01-02 Xencor, Inc. Heterodimeric antibodies to CD3 X CD123
US9850320B2 (en) 2014-11-26 2017-12-26 Xencor, Inc. Heterodimeric antibodies to CD3 X CD20
US10259887B2 (en) 2014-11-26 2019-04-16 Xencor, Inc. Heterodimeric antibodies that bind CD3 and tumor antigens
US10889653B2 (en) 2014-11-26 2021-01-12 Xencor, Inc. Heterodimeric antibodies that bind CD3 and tumor antigens
US11673972B2 (en) 2014-11-26 2023-06-13 Xencor, Inc. Heterodimeric antibodies that bind CD3 and tumor antigens
US12359002B2 (en) 2014-11-26 2025-07-15 Xencor, Inc. Heterodimeric antibodies that bind CD3 and tumor antigens
WO2016091891A1 (en) 2014-12-09 2016-06-16 INSERM (Institut National de la Santé et de la Recherche Médicale) Human monoclonal antibodies against axl
US10865253B2 (en) 2014-12-19 2020-12-15 Genmab A/S Rodent bispecific heterodimeric proteins
US10428155B2 (en) 2014-12-22 2019-10-01 Xencor, Inc. Trispecific antibodies
US10501552B2 (en) 2015-01-26 2019-12-10 Macrogenics, Inc. Multivalent molecules comprising DR5-binding domains
WO2016135066A1 (en) 2015-02-26 2016-09-01 INSERM (Institut National de la Santé et de la Recherche Médicale) Fusion proteins and antibodies comprising thereof for promoting apoptosis
US10227411B2 (en) 2015-03-05 2019-03-12 Xencor, Inc. Modulation of T cells with bispecific antibodies and FC fusions
US11091548B2 (en) 2015-03-05 2021-08-17 Xencor, Inc. Modulation of T cells with bispecific antibodies and Fc fusions
EP3279216A4 (en) * 2015-04-01 2019-06-19 Chugai Seiyaku Kabushiki Kaisha PROCESS FOR PREPARING POLYPEPTIDE HETERO OLIGOMER
US12359001B2 (en) 2015-04-01 2025-07-15 Chugai Seiyaku Kabushiki Kaisha Method for producing polypeptide hetero-oligomer
US11142587B2 (en) 2015-04-01 2021-10-12 Chugai Seiyaku Kabushiki Kaisha Method for producing polypeptide hetero-oligomer
US11072653B2 (en) 2015-06-08 2021-07-27 Macrogenics, Inc. LAG-3-binding molecules and methods of use thereof
EP4303235A2 (en) 2015-06-08 2024-01-10 MacroGenics, Inc. Lag-3-binding moleculkes and methods of use thereof
US11858991B2 (en) 2015-06-08 2024-01-02 Macrogenics, Inc. LAG-3-binding molecules and methods of use thereof
US11078279B2 (en) 2015-06-12 2021-08-03 Macrogenics, Inc. Combination therapy for the treatment of cancer
EP3310385A4 (en) * 2015-06-17 2018-12-19 Allakos Inc. Methods and compositions for treating fibrotic diseases
AU2016278239B2 (en) * 2015-06-17 2022-07-21 Allakos Inc. Methods and compositions for treating fibrotic diseases
AU2016278239B9 (en) * 2015-06-17 2022-08-11 Allakos Inc. Methods and compositions for treating fibrotic diseases
EP3981792A1 (en) 2015-07-30 2022-04-13 MacroGenics, Inc. Pd-1-binding molecules and methods of use thereof
US11623959B2 (en) 2015-07-30 2023-04-11 Macrogenics, Inc. PD-1-binding molecules and methods of use thereof
WO2017019846A1 (en) 2015-07-30 2017-02-02 Macrogenics, Inc. Pd-1-binding molecules and methods use thereof
EP4450088A2 (en) 2015-07-30 2024-10-23 MacroGenics, Inc. Pd-1-binding molecules and methods of use thereof
EP3456346A1 (en) 2015-07-30 2019-03-20 MacroGenics, Inc. Pd-1 and lag-3 binding molecules and methods of use thereof
US10577422B2 (en) 2015-07-30 2020-03-03 Macrogenics, Inc. PD-1-binding molecules and methods of use thereof
US11174315B2 (en) 2015-10-08 2021-11-16 Macrogenics, Inc. Combination therapy for the treatment of cancer
US10604577B2 (en) 2015-10-22 2020-03-31 Allakos Inc. Methods and compositions for treating systemic mastocytosis
US10227410B2 (en) 2015-12-07 2019-03-12 Xencor, Inc. Heterodimeric antibodies that bind CD3 and PSMA
US11623957B2 (en) 2015-12-07 2023-04-11 Xencor, Inc. Heterodimeric antibodies that bind CD3 and PSMA
US11840571B2 (en) 2015-12-14 2023-12-12 Macrogenics, Inc. Methods of using bispecific molecules having immunoreactivity with PD-1 and CTLA-4
US10954301B2 (en) 2015-12-14 2021-03-23 Macrogenics, Inc. Bispecific molecules having immunoreactivity with PD-1 and CTLA-4, and methods of use thereof
US11649262B2 (en) 2015-12-28 2023-05-16 Chugai Seiyaku Kabushiki Kaisha Method for promoting efficiency of purification of Fc region-containing polypeptide
WO2017144668A1 (en) 2016-02-26 2017-08-31 INSERM (Institut National de la Santé et de la Recherche Médicale) Antibodies having specificity for btla and uses thereof
US11072666B2 (en) 2016-03-14 2021-07-27 Chugai Seiyaku Kabushiki Kaisha Cell injury inducing therapeutic drug for use in cancer therapy
EP4509180A2 (en) 2016-03-22 2025-02-19 INSERM (Institut National de la Santé et de la Recherche Médicale) Humanized anti-claudin-1 antibodies and uses thereof
WO2017162678A1 (en) 2016-03-22 2017-09-28 INSERM (Institut National de la Santé et de la Recherche Médicale) Humanized anti-claudin-1 antibodies and uses thereof
CN109069537B (zh) * 2016-04-04 2022-04-15 亘喜生物科技(上海)有限公司 共刺激结构域中具有重复结合基序的car
CN109069537A (zh) * 2016-04-04 2018-12-21 亘喜生物科技(上海)有限公司 共刺激结构域中具有重复结合基序的car
US12460014B2 (en) 2016-04-28 2025-11-04 Chugai Seiyaku Kabushiki Kaisha Antibody-containing preparation
EP3744348A1 (en) 2016-05-06 2020-12-02 INSERM (Institut National de la Santé et de la Recherche Médicale) Pharmaceutical compositions for the treatment of chemoresistant acute myeloid leukemia (aml)
WO2017191300A1 (en) 2016-05-06 2017-11-09 INSERM (Institut National de la Santé et de la Recherche Médicale) Pharmaceutical compositions for the treatment of chemoresistant acute myeloid leukemia (aml)
US11236170B2 (en) 2016-06-14 2022-02-01 Xencor, Inc. Bispecific checkpoint inhibitor antibodies
US10787518B2 (en) 2016-06-14 2020-09-29 Xencor, Inc. Bispecific checkpoint inhibitor antibodies
US11492407B2 (en) 2016-06-14 2022-11-08 Xencor, Inc. Bispecific checkpoint inhibitor antibodies
US12054545B2 (en) 2016-06-28 2024-08-06 Xencor, Inc. Heterodimeric antibodies that bind somatostatin receptor 2
US11225521B2 (en) 2016-06-28 2022-01-18 Xencor, Inc. Heterodimeric antibodies that bind somatostatin receptor 2
US10316088B2 (en) 2016-06-28 2019-06-11 Xencor, Inc. Heterodimeric antibodies that bind somatostatin receptor 2
US10864203B2 (en) 2016-07-05 2020-12-15 Beigene, Ltd. Combination of a PD-1 antagonist and a RAF inhibitor for treating cancer
US11534431B2 (en) 2016-07-05 2022-12-27 Beigene Switzerland Gmbh Combination of a PD-1 antagonist and a RAF inhibitor for treating cancer
US11701357B2 (en) 2016-08-19 2023-07-18 Beigene Switzerland Gmbh Treatment of B cell cancers using a combination comprising Btk inhibitors
US10793632B2 (en) 2016-08-30 2020-10-06 Xencor, Inc. Bispecific immunomodulatory antibodies that bind costimulatory and checkpoint receptors
US10501543B2 (en) 2016-10-14 2019-12-10 Xencor, Inc. IL15/IL15Rα heterodimeric Fc-fusion proteins
US10550185B2 (en) 2016-10-14 2020-02-04 Xencor, Inc. Bispecific heterodimeric fusion proteins containing IL-15-IL-15Rα Fc-fusion proteins and PD-1 antibody fragments
US11352417B2 (en) 2016-12-22 2022-06-07 Regeneron Pharmaceuticals, Inc. Method of treating an allergy with allergen-specific monoclonal antibodies
US12098194B2 (en) 2017-01-20 2024-09-24 Genzyme Corporation Bone-targeting antibodies
US12049496B2 (en) 2017-01-20 2024-07-30 Sanofi Anti-TGF-beta antibodies and their use
US11242384B2 (en) 2017-01-20 2022-02-08 Sanofi Anti-TGF-beta antibodies and their use
US11555038B2 (en) 2017-01-25 2023-01-17 Beigene, Ltd. Crystalline forms of (S)-7-(1-(but-2-ynoyl)piperidin-4-yl)-2-(4-phenoxyphenyl)-4,5,6,7-tetrahydropyrazolo[1,5-a]pyrimidine-3-carboxamide, preparation, and uses thereof
US12145974B2 (en) * 2017-03-14 2024-11-19 Sunshine Lake Pharma Co., Ltd. Dual-target fusion proteins comprising FGF21 and GLP-1, connected through a Fc portion of an immunoglobulin
US11634495B2 (en) 2017-04-07 2023-04-25 Miltenyi Biotec B.V. & Co. KG Methods of activating CD32b/c comprising administering an antibody that binds BDCA-2 (CD303)
US11203638B2 (en) 2017-05-05 2021-12-21 Allakos Inc. Methods and compositions for treating perennial allergic conjunctivitis and keratoconjunctivitis
WO2018204871A1 (en) * 2017-05-05 2018-11-08 Allakos Inc. Methods and compositions for treating inflammatory gastrointestinal disorders
IL270304B1 (en) * 2017-05-05 2024-03-01 Allakos Inc Methods and preparations for the treatment of inflammatory disorders in the digestive system
IL270304B2 (en) * 2017-05-05 2024-07-01 Allakos Inc Methods and preparations for the treatment of inflammatory disorders in the digestive system
US11597768B2 (en) 2017-06-26 2023-03-07 Beigene, Ltd. Immunotherapy for hepatocellular carcinoma
US11084863B2 (en) 2017-06-30 2021-08-10 Xencor, Inc. Targeted heterodimeric Fc fusion proteins containing IL-15 IL-15alpha and antigen binding domains
WO2019057933A1 (en) 2017-09-21 2019-03-28 Imcheck Therapeutics Sas ANTIBODIES HAVING SPECIFICITY FOR BTN2 AND USES THEREOF
US12421322B2 (en) 2017-11-01 2025-09-23 Chugai Seiyaku Kabushiki Kaisha Antibody variant and isoform with lowered biological activity
US12152076B2 (en) 2017-11-08 2024-11-26 Xencor, Inc. Bispecific and monospecific antibodies using novel anti-PD-1 sequences
US11312770B2 (en) 2017-11-08 2022-04-26 Xencor, Inc. Bispecific and monospecific antibodies using novel anti-PD-1 sequences
US10981992B2 (en) 2017-11-08 2021-04-20 Xencor, Inc. Bispecific immunomodulatory antibodies that bind costimulatory and checkpoint receptors
US11786529B2 (en) 2017-11-29 2023-10-17 Beigene Switzerland Gmbh Treatment of indolent or aggressive B-cell lymphomas using a combination comprising BTK inhibitors
US11319355B2 (en) 2017-12-19 2022-05-03 Xencor, Inc. Engineered IL-2 Fc fusion proteins
US10982006B2 (en) 2018-04-04 2021-04-20 Xencor, Inc. Heterodimeric antibodies that bind fibroblast activation protein
US12180302B2 (en) 2018-04-04 2024-12-31 Xencor, Inc. Heterodimeric antibodies that bind fibroblast activation protein
US11524991B2 (en) 2018-04-18 2022-12-13 Xencor, Inc. PD-1 targeted heterodimeric fusion proteins containing IL-15/IL-15Ra Fc-fusion proteins and PD-1 antigen binding domains and uses thereof
US11505595B2 (en) 2018-04-18 2022-11-22 Xencor, Inc. TIM-3 targeted heterodimeric fusion proteins containing IL-15/IL-15RA Fc-fusion proteins and TIM-3 antigen binding domains
US11358999B2 (en) 2018-10-03 2022-06-14 Xencor, Inc. IL-12 heterodimeric Fc-fusion proteins
US12415859B2 (en) 2018-12-18 2025-09-16 Genmab A/S Methods of producing heterodimeric antibodies
WO2020148207A1 (en) 2019-01-14 2020-07-23 INSERM (Institut National de la Santé et de la Recherche Médicale) Human monoclonal antibodies binding to hla-a2
US11498969B2 (en) 2019-01-31 2022-11-15 Sanofi Biotechnology Compositions and methods for treating juvenile idiopathic arthritis
US11472890B2 (en) 2019-03-01 2022-10-18 Xencor, Inc. Heterodimeric antibodies that bind ENPP3 and CD3
WO2020188086A1 (en) 2019-03-20 2020-09-24 Imcheck Therapeutics Sas Antibodies having specificity for btn2 and uses thereof
US12440561B2 (en) 2019-04-24 2025-10-14 Sanofi Biotechnology Method of diagnosis and treatment of rheumatoid arthritis
US12297279B2 (en) 2019-06-04 2025-05-13 Sanofi Biotechnology Compositions and methods for treating pain in subjects with rheumatoid arthritis
WO2021009263A1 (en) 2019-07-16 2021-01-21 INSERM (Institut National de la Santé et de la Recherche Médicale) Antibodies having specificity for cd38 and uses thereof
WO2021058763A1 (en) 2019-09-27 2021-04-01 INSERM (Institut National de la Santé et de la Recherche Médicale) Anti-müllerian inhibiting substance antibodies and uses thereof
US20230399390A1 (en) * 2019-10-24 2023-12-14 Novago Therapeutics Ag Novel anti-nogo-a antibodies
WO2021175954A1 (en) 2020-03-04 2021-09-10 Imcheck Therapeutics Sas Antibodies having specificity for btnl8 and uses thereof
US11919956B2 (en) 2020-05-14 2024-03-05 Xencor, Inc. Heterodimeric antibodies that bind prostate specific membrane antigen (PSMA) and CD3
US12404329B2 (en) 2020-05-14 2025-09-02 Xencor, Inc. Heterodimeric antibodies that bind prostate specific membrane antigen (PSMA) and CD3
US12037380B2 (en) 2020-05-21 2024-07-16 Mabsol Ve Limited Modified immunoglobulin Fc regions
WO2021234402A2 (en) 2020-05-21 2021-11-25 Mabsolve Limited Modified immunoglobulin fc regions
US12497442B2 (en) 2020-05-21 2025-12-16 Mabsolve Limited Nucleic acids encoding modified immunoglobulin Fc regions
US11919958B2 (en) 2020-08-19 2024-03-05 Xencor, Inc. Anti-CD28 compositions
US11591401B2 (en) 2020-08-19 2023-02-28 Xencor, Inc. Anti-CD28 compositions
WO2022079199A1 (en) 2020-10-15 2022-04-21 UCB Biopharma SRL Binding molecules that multimerise cd45
US12398207B2 (en) 2021-03-09 2025-08-26 Xencor, Inc. Heterodimeric antibodies that bind CD3 and CLDN6
US11739144B2 (en) 2021-03-09 2023-08-29 Xencor, Inc. Heterodimeric antibodies that bind CD3 and CLDN6
US11859012B2 (en) 2021-03-10 2024-01-02 Xencor, Inc. Heterodimeric antibodies that bind CD3 and GPC3
WO2024115935A1 (en) 2022-11-29 2024-06-06 Inserm Methods for the treatment of b-cell lymphoma using cd39 inhibitors
WO2024170543A1 (en) 2023-02-14 2024-08-22 Institut National de la Santé et de la Recherche Médicale Anti-cd44 antibodies and uses thereof
WO2024175760A1 (en) 2023-02-24 2024-08-29 Institut National de la Santé et de la Recherche Médicale Methods for the treatment of endometriosis
WO2024261239A1 (en) 2023-06-23 2024-12-26 Imcheck Therapeutics Bispecific antibodies targeting btn3a and the pd-1/pd-l1 inhibitory axis
WO2025120015A1 (en) 2023-12-06 2025-06-12 Institut National de la Santé et de la Recherche Médicale Cd5 targeting antibodies with depleting and t or b-cell activation effects
WO2025120171A1 (en) 2023-12-08 2025-06-12 UCB Biopharma SRL Antibodies
WO2025162964A1 (en) 2024-01-30 2025-08-07 Institut National de la Santé et de la Recherche Médicale Methods for the treatment of endometriosis

Also Published As

Publication number Publication date
JP2014122226A (ja) 2014-07-03
EP2164873B1 (en) 2015-09-30
JP2010528993A (ja) 2010-08-26
US20130345406A1 (en) 2013-12-26
AU2008255352A1 (en) 2008-12-04
EP2666787B1 (en) 2022-02-09
JP6412083B2 (ja) 2018-10-24
JP6034315B2 (ja) 2016-11-30
EP2666787A1 (en) 2013-11-27
US20170029521A1 (en) 2017-02-02
EP4119579A1 (en) 2023-01-18
JP6071165B2 (ja) 2017-02-01
CA2688275A1 (en) 2008-12-04
AU2008255352B2 (en) 2014-05-22
US20210061919A1 (en) 2021-03-04
EP2164873B2 (en) 2018-09-12
US10752695B2 (en) 2020-08-25
US20100267934A1 (en) 2010-10-21
EP2164873A1 (en) 2010-03-24
JP2017071606A (ja) 2017-04-13

Similar Documents

Publication Publication Date Title
US20210061919A1 (en) STABLE IgG4 ANTIBODIES
US10906991B2 (en) Bispecific antibodies and methods for production thereof
EP3153524A1 (en) Antibody variants having modifications in the constant region
JP7432650B2 (ja) 改善されたバイオアナリシス特性およびバイオプロセシング特性のための、治療用免疫グロブリンg4の設計
HK1188226A (en) Bispecific antibodies and methods for production thereof

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 08748828

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 2688275

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 2010509682

Country of ref document: JP

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2008255352

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 2008748828

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 7495/CHENP/2009

Country of ref document: IN

ENP Entry into the national phase

Ref document number: 2008255352

Country of ref document: AU

Date of ref document: 20080530

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 12602439

Country of ref document: US