WO2005044854A2 - Antagonist anti-cd40 monoclonal antibodies and methods for their use - Google Patents
Antagonist anti-cd40 monoclonal antibodies and methods for their use Download PDFInfo
- Publication number
- WO2005044854A2 WO2005044854A2 PCT/US2004/037152 US2004037152W WO2005044854A2 WO 2005044854 A2 WO2005044854 A2 WO 2005044854A2 US 2004037152 W US2004037152 W US 2004037152W WO 2005044854 A2 WO2005044854 A2 WO 2005044854A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- monoclonal antibody
- sequence shown
- antibody
- human
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2878—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/19—Cytokines; Lymphokines; Interferons
- A61K38/20—Interleukins [IL]
- A61K38/2013—IL-2
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/39558—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/16—Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
- A61P11/06—Antiasthmatics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/12—Drugs for disorders of the urinary system of the kidneys
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
- A61P17/06—Antipsoriatics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/06—Antigout agents, e.g. antihyperuricemic or uricosuric agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P21/00—Drugs for disorders of the muscular or neuromuscular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P21/00—Drugs for disorders of the muscular or neuromuscular system
- A61P21/04—Drugs for disorders of the muscular or neuromuscular system for myasthenia gravis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/02—Drugs for disorders of the nervous system for peripheral neuropathies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P33/00—Antiparasitic agents
- A61P33/02—Antiprotozoals, e.g. for leishmaniasis, trichomoniasis, toxoplasmosis
- A61P33/06—Antimalarials
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/08—Antiallergic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
- A61P7/02—Antithrombotic agents; Anticoagulants; Platelet aggregation inhibitors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
- A61P7/04—Antihaemorrhagics; Procoagulants; Haemostatic agents; Antifibrinolytic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
- A61P7/06—Antianaemics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/14—Vasoprotectives; Antihaemorrhoidals; Drugs for varicose therapy; Capillary stabilisers
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/732—Antibody-dependent cellular cytotoxicity [ADCC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
Definitions
- the invention relates to human antibodies capable of binding to CD40, methods of using the antibodies, and methods for freatment of diseases mediated by stimulation of CD40 signaling on CD40-expressing cells.
- B cells play an important role during the normal in vivo immune response.
- a foreign antigen will bind to surface immunoglobulins on specific B cells, triggering a chain of events including endocytosis, processing, presentation of processed peptides on MHC-class II molecules, and up-regulation ofthe B7 antigen on the B cell surface.
- a specific T cell then binds to the B cell via T cell receptor (TCR) recognition ofthe processed antigen presented on the MHC-class II molecule. Stimulation through the TCR activates the T cell and initiates T-cell cytokine production.
- a second signal that further activates the T cell is an interaction between the CD28 antigen on T cells and the B7 antigen on B cells.
- CD40 ligand (CD40L or CD 154), which is not expressed on resting human T cells, is up-regulated on the T-cell surface. Binding ofthe CD40 ligand to the CD40 antigen on the B cell surface stimulates the B cell, causing the B cell to mature into a plasma cell secreting high levels of soluble immunoglobulin.
- CD40 is a 55 kDa cell-surface antigen present on the surface of both no ⁇ nal and neoplastic human B cells, dendritic cells, antigen presenting cells (APCs), endothelial cells, monocytic and epithelial cells.
- Transfonned cells from patients with low- and high-grade B-cell lymphomas, B-cell acute lymphoblastic leukemia, multiple myeloma, chronic lymphocytic leukemia, and Hodgkin's disease express CD40.
- CD40 expression is also detected in two-thirds of acute myeloblastic leukemia cases and 50% of AEDS- related lymphomas.
- Malignant B cells from several tumors of B-cell lineage express a high degree of CD40 and appear to depend on CD40 signaling for survival and proliferation.
- Immunoblastic B-cell lymphomas frequently arise in immunocompromised individuals such as allograft recipients and others receiving long-term immunosuppressive therapy, AIDS patients, and patients with primary immunodeficiency syndromes such as X-linked lymphoproliferative syndrome or Wiscott-Aldrich syndrome (Thomas et al. (1991) Adv. Cancer Res. 57:329; Sfraus et al. (1993) Ann. Intern. Med. 118:45).
- the CD40 antigen is related to the human nerve growth factor (NGF) receptor, tumor necrosis factor- ⁇ (TNF-O! receptor, and Fas, suggesting that CD40 is a receptor for a ligand with important functions in B-cell activation.
- NGF nerve growth factor
- TNF-O tumor necrosis factor- ⁇
- Fas Fas
- the CD40 receptor is expressed on activated T cells, activated platelets, and inflamed vascular smooth muscle cells. CD40 receptors can also be found on eosinophils, synovial membranes in rheumatoid arthritis, dermal fibroblasts, and other non-lymphoid cell types. Binding of CD40L to the CD40 receptor stimulates B-cell proliferation and differentiation, antibody production, isotype switching, and B-cell memory generation.
- compositions and methods are provided for treating diseases mediated by stimulation of CD40 signaling on CD40-expressing cells, including lymphomas, autoimmune diseases, and transplant rejections.
- Compositions include monoclonal antibodies capable of binding to a human CD40 antigen located on the surface of a human CD40-expressing cell, wherein the binding prevents the growth or differentiation ofthe cell.
- Compositions also include monoclonal antibodies capable of specifically binding to a human CD40 antigen expressed on the surface of a human CD40-expressing cell, said monoclonal antibody being free of significant agonist activity, wherein administration of said monoclonal antibody results in significantly less tumor volume than a similar concentration ofthe chimeric anti-CD20 monoclonal antibody EDEC-C2B8 in a staged nude mouse xenograft tumor model using the Daudi human B cell lymphoma cell line.
- Compositions also include antigen-binding fragments of these monoclonal antibodies, hybridoma cell lines producing these antibodies, and isolated nucleic acid molecules encoding the amino acid sequences of these monoclonal antibodies.
- the invention further includes pharamaceutical compositions comprising these anti-CD40 antibodies in a phannaceutically acceptable carrier.
- Methods are provided for preventing or treating a disease mediated by stimulation of CD40 signaling, comprising treating the patient with an anti-CD40 antibody or an antigen-binding fragment thereof that is free of significant agonist activity when bound to a CD40 antigen on a human CD40-expressing cell.
- Diseases mediated by stimulation of CD40-expressing cells include autoimmune diseases, cancers, and organ and tissue graft rejections.
- autoimmune diseases contemplated for treatment using the methods of the invention include systemic lupus erythematosus (SLE), rheumatoid arthritis, Crohn's disease, psoriasis, autoimmune thrombocytopenic pu ⁇ ura, multiple sclerosis, ankylosing spondylitis, myasthenia gravis, and pemphigus vulgaris.
- SLE systemic lupus erythematosus
- psoriasis rheumatoid arthritis
- autoimmune thrombocytopenic pu ⁇ ura multiple sclerosis
- ankylosing spondylitis myasthenia gravis
- pemphigus vulgaris pemphigus vulgaris.
- Such antibodies could also be used to prevent rejection of organ and tissue grafts by suppressing autoimmune responses, to treat lymphomas by depriving malignant B lymphocytes ofthe activating signal provided by CD40, and to deliver toxins to CD40-bearing cells in a
- Methods for inhibiting the growth, differentiation, and/or proliferation of human B cells and for inhibiting antibody production by B cells in a human patient are provided, as are methods for inhibiting the growth of cancer cells of a B-cell lineage.
- Methods for identifying antibodies that have antagonist activity toward CD40-expressing cells are also provided.
- the monoclonal antibodies disclosed herein have a strong affinity for CD40 and are characterized by a dissociation equilibrium constant (K D ) of at least 10 "6 M, preferably at least about 10 "7 M to about 10 "8 M, more preferably at least about 10 "8 M to about 10 "12 M.
- Monoclonal antibodies and antigen-binding fragments thereof that are suitable for use in the methods of the invention are capable of specifically binding to a human CD40 antigen expressed on the surface of a human cell. They are free of significant agonist activity but exhibit antagonist activity when bound to CD40 antigen on human cells, h one embodiment, the anti-CD40 antibody or fragment thereof exhibits antagonist activity when bound to CD40 antigen on normal human B cells. In another embodiment, the anti-CD40 antibody or fragment thereof exhibits antagonist activity when bound to CD40 antigen on malignant human B cells.
- Suitable monoclonal antibodies have human constant regions; preferably they also have wholly or partially humanized framework regions; and most preferably are fully human antibodies or antigen-binding fragments thereof.
- Examples of such monoclonal antibodies are the antibodies designated herein as CHIR-5.9 and CHIR-12.12; the monoclonal antibodies produced by the hybridoma cell lines designated 131.2F8.5.9 (refe ⁇ ed to herein as the cell line 5.9) and 153.8E2.D10.D6.12.12 (refened to herein as the cell line 12.12); a monoclonal antibody comprising an amino acid sequence selected from the group consisting ofthe sequence shown in SEQ ID NO:6, the sequence shown in SEQ ID NO:7, the sequence shown in SEQ ID NO:8, both the sequence shown in SEQ ID NO:6 and SEQ ID NO:7, and both the sequence shown in SEQ ID NO:6 and SEQ ID NO:8; a monoclonal antibody comprising an amino acid sequence selected from the group consisting ofthe sequence shown in SEQ 3D NO:2, the sequence shown in SEQ ED NO:4, the sequence shown in SEQ ED NO:5, both the sequence shown in SEQ ED NO:2 and SEQ ED NO:4, and
- Examples of such monoclonal antibodies also include a monoclonal antibody that binds to an epitope capable of binding the monoclonal antibody produced by the hybridoma cell line 12.12; a monoclonal antibody that binds to an epitope comprising residues 82-87 ofthe amino acid sequence shown in SEQ ID NO: 10 or SEQ ID NO: 12; a monoclonal antibody that competes with the monoclonal antibody CHIR-12.12 in a competitive binding assay; and a monoclonal antibody that is an antigen-binding fragment ofthe CHIR-12.12 monoclonal antibody or any ofthe foregoing monoclonal antibodies, where the fragment retains the capability of specifically binding to the human CD40 antigen.
- methods of freatment comprise administering to a patient a therapeutically effective dose of a pharmaceutical composition comprising suitable antagonist anti-CD40 antibodies or antigen-binding fragments thereof.
- a therapeutically effective dose ofthe anti-CD40 antibody or fragment thereof is in the range from about 0.01 mg/kg to about 40 mg/kg, from about 0.01 mg/kg to about 30 mg/kg, from about 0.1 mg/kg to about 30 mg/kg, from about 1 mg kg to about 30 mg/kg, from about 3 mg/kg to about 30 mg/kg, from about 3 mg/kg to about 25 mg/kg, from about 3 mg/kg to about 20 mg/kg, from about 5 mg/kg to about 15 mg/kg, or from about 7 mg/kg to about 12 mg/kg.
- the method of treatment may comprise a single adminisfration of a therapeutically effective dose or multiple administrations of a therapeutically effective dose ofthe antagonist anti-CD40 antibody or antigen-binding fragment thereof.
- the antagonist anti-CD40 antibodies identified herein as being suitable for use in the methods ofthe invention may be modified. Modifications of these antagonist anti- CD40 antibodies include, but are not limited to, immunologically active chimeric anti- CD40 antibodies, humanized anti-CD40 antibodies, and immunologically active murine anti-CD40 antibodies.
- BRIEF DESCRIPTION OF THE DRAWINGS Figure 1 shows binding of CHIR-5.9 and CHIR-12.12 monoclonal antibodies to CD40 on the surface of lymphoma cell line (Ramos).
- Figures 2A and 2B illustrate binding properties ofthe CHIR-5.9 and CHER-12.12 monoclonal anti-CD40 antibodies relative toCD40 ligand.
- Figure 2A shows that binding of CHIR-5.9 and CHIR-12.12 monoclonal antibodies to cell surface CD40 prevents subsequent CD40-ligand binding.
- Figure 2B shows that the CHIR-5.9 and CHIR-12.12 monoclonal antibodies can compete off CD40 ligand pre-bound to cell surface CD40.
- Figures 3 A and 3B show ADCC activity ofthe candidate monoclonal antibodies CHER-5.9 and CHER-12.12 against cancer cells from the lymph nodes of non-Hodgkin's lymphoma (NHL) patients. Enriched NK cells from a no ⁇ nal volunteer donor either fresh after isolation ( Figure 3A) or after culturing overnight at 37°C ( Figure 3B) were used as effector cells in this assay.
- FIG. 4 demonstrates in vivo anti-tumor activity of monoclonal antibodies CHIR- 5.9 and CHER-12.12 compared to that of rituximab using an unstaged nude mouse xenograft B cell lymphoma (Namalwa) model.
- Figure 5 demonstrates in vivo anti-tumor activity of monoclonal antibodies CHER- 5.9 and CHER-12.12 compared to that of rituximab using an unstaged nude mouse xenograft B cell lymphoma (Daudi) model.
- RC resistance to tumor challenge.
- Figure 6 demonstrates in vivo anti-tumor activity of monoclonal antibodies CHER- 5.9 and CHER-12.12 compared to that of rituximab using a staged nude mouse xenograft B cell lymphoma (Daudi) model.
- CR complete regression.
- Figure 7 shows the protocol used for determining the number of CD20 and CD40 molecules on Namalwa and Daudi cells.
- Figure 8 shows comparative ADCC ofthe mAb CHIR-12.12 and rituximab against Daudi lymphoma cells.
- Figure 9 sets forth the amino acid sequences for the light and heavy chains ofthe mAb CHIR-12.12.
- the leader (residues 1-20 of SEQ ED NO:2), variable (residues 21- 132 of SEQ ID NO:2), and constant (residues 133-239 of SEQ ID NO:2) regions ofthe light chain are shown in Figure 9A.
- the leader (residues 1-19 of SEQ ID NO:4), variable (residues 20-139 of SEQ ID NO:4), and constant (residues 140-469 of SEQ ID NO:4) regions ofthe heavy chain are shown in Figure 9B.
- the alternative constant region for the heavy chain ofthe mAb CHER.- 12.12 shown in Figure 9B reflects a substitution of a serine residue for the alanine residue at position 153 of SEQ ID NO:4.
- the complete sequence for this variant ofthe heavy chain ofthe mAb CHER-12.12 is set forth in SEQ ID NO:5.
- Figure 10 shows the coding sequence for the light chain (Figure 10 A; SEQ ED NO:l) and heavy chain ( Figure 10B; SEQ ED NO:3) for the mAb CHER-12.12.
- Figure 11 sets forth the amino acid sequences for the light and heavy chains of mAb CHIR-5.9.
- the leader (residues 1-20 of SEQ ID NO:6), variable (residues 21-132 of SEQ ED NO:6), and constant (residues 133-239 of SEQ ED NO:6) regions ofthe light chain are shown in Figure 1 IA.
- the leader (residues 1-19 of SEQ ED NO:7), variable (residues 20-144 of SEQ ED NO:7), and constant (residues 145-474 of SEQ ID NO:7) regions ofthe heavy chain are shown in Figure 1 IB.
- the alternative constant region for the heavy chain ofthe mAb CHER-5.9 shown in Figure 1 IB reflects a substitution of a serine residue for the alanine residue at position 158 of SEQ ED NO: 7.
- the complete sequence for this variant ofthe heavy chain ofthe niAB CHIR-5.9 is set forth in SEQ ED NO:8.
- Figure 12 shows the coding sequence ( Figure 12 A; SEQ ED NO: 9) for the short isoform of human CD40 (amino acid sequence shown in Figure 12B; SEQ ED NO: 10), and the coding sequence ( Figure 12C; SEQ ED NO:l 1) for the long isoform of human CD40 (amino acid sequence shown in Figure 12D).
- Figure 13 shows thermal melting temperature of CHER-12.12 in different pH formulations measured by differential scanning calorimetry (DSC).
- Tumor refers to all neoplastic cell growth and proliferation, whether malignant or benign, and all pre-cancerous and cancerous cells and tissues.
- cancer and “cancerous” refer to or describe the physiological condition in mammals that is typically characterized by unregulated cell growth. Examples of cancer include but are not limited to lymphoma and leukemia.
- Antibodies and “immunoglobulins” (Igs) are glycoproteins having the same structural characteristics. While antibodies exhibit binding specificity to an antigen, immunoglobulins include both antibodies and other antibody-like molecules that lack antigen specificity.
- polypeptides ofthe latter kind are, for example, produced at low levels by the lymph system and at increased levels by myelomas.
- antibody is used in the broadest sense and covers fully assembled antibodies, antibody fragments that can bind antigen (e.g., Fab', F'(ab) 2 , Fv, single chain antibodies, diabodies), and recombinant peptides comprising the foregoing.
- monoclonal antibody refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts.
- “Native antibodies” and “native immunoglobulins” are usually heterotetrameric glycoproteins of about 150,000 daltons, composed of two identical light (L) chains and two identical heavy (H) chains. Each light chain is linked to a heavy chain by one covalent disulfide bond, while the number of disulfide linkages varies among the heavy chains of different immunoglobulin isotypes. Each heavy and light chain also has regularly spaced intrachain disulfide bridges. Each heavy chain has at one end a variable domain (V H ) followed by a number of constant domains.
- V H variable domain
- Each light chain has a variable domain at one end (V L ) and a constant domain at its other end; the constant domain ofthe light chain is aligned with the first constant domain ofthe heavy chain, and the light chain variable domain is aligned with the variable domain ofthe heavy chain.
- Particular amino acid residues are believed to form an interface between the light- and heavy-chain variable domains.
- the term "variable” refers to the fact that certain portions ofthe variable domains differ extensively in sequence among antibodies and are used in the binding and specificity of each particular antibody for its particular antigen. However, the variability is not evenly distributed throughout the variable domains of antibodies. It is concentrated in three segments called complementarity determining regions (CDRs) or hypervariable regions both in the light-chain and the heavy-chain variable domains.
- CDRs complementarity determining regions
- variable domains The more highly conserved portions of variable domains are called the framework (FR) regions.
- the variable domains of native heavy and light chains each comprise four FR regions, largely adopting a ⁇ -sheet configuration, connected by three CDRs, which form loops connecting, and in some cases forming part of, the ⁇ -sheet structure.
- the CDRs in each chain are held together in close proximity by the FR regions and, with the CDRs from the other chain, contribute to the formation ofthe antigen-binding site of antibodies (see Kabat et al. (1991) NIHPubl. No. 91-3242, Vol. I, pages 647-669).
- the constant domains are not involved directly in binding an antibody to an antigen, but exhibit various effecter functions, such as Fc receptor (FcR) binding, participation ofthe antibody in antibody-dependent cellular toxicity, opsonization, initiation of complement dependent cytotoxicity, and mast cell degranulation.
- FcR Fc receptor
- hypervariable region when used herein refers to the amino acid residues of an antibody that are responsible for antigen binding.
- the hypervariable region comprises amino acid residues from a "complementarity determining region" or"CDR" (i.e., residues 24-34 (L1), J 50-56 (L2), and 89-97 (L3) in the light-chain variable domain and 31-35 (HI), 50-65 (H2), and 95-102 (H3) in the heavy-chain variable domain; Kabat et al. (1991) Sequences of Proteins of Immunological Interest (5 th ed., Public Health Service, National Institute of Health, Bethesda, MD) and/or those residues from a "complementarity determining region" or"CDR" (i.e., residues 24-34 (L1), J 50-56 (L2), and 89-97 (L3) in the light-chain variable domain and 31-35 (HI), 50-65 (H2), and 95-102 (H3) in the heavy-chain variable domain; Kabat et al. (1991) Sequences of Proteins of Immunological Interest (5 th ed.
- hypervariable loop i.e., residues 26-32(Ll), 50-52 (L2), and 91-96 (L3) in the light- chain variable domain and 26-32(Hl), 53-55 (H2), and 96-101 (H3) in the heavy-chain variable domain; Clothia and Lesk (1987) J. Mol. Biol. 196:901-917).
- Framework or "FR” residues are those variable domain residues other than the hypervariable region residues.
- Antibody fragments comprise a portion of an intact antibody, preferably the antigen-binding or variable region ofthe intact antibody.
- antibody fragments include Fab, Fab', F(ab')2, and Fv fragments; diabodies; linear antibodies (Zapata et al. (1995) Protein Eng. 8(10): 1057-1062); single-chain antibody molecules; and multispecific antibodies formed from antibody fragments.
- Papain digestion of antibodies produces two identical antigen-binding fragments, called "Fab” fragments, each with a single antigen-binding site, and a residual "Fc” fragment, whose name reflects its ability to crystallize readily.
- Pepsin treatment yields an F(ab')2 fragment that has two antigen- combining sites and is " still capable of cross-linking antigen.
- Fv is the minimum antibody fragment that contains a complete antigen recognition and binding site, hi a two-chain Fv species, this region consists of a dimer of one heavy- and one light-chain variable domain in tight, non-covalent association.
- one heavy- and one light-chain variable domain can be covalently linked by flexible peptide linker such that the light and heavy chains can associate in a "dimeric" structure analogous to that in a two-chain Fv species. It is in this configuration that the three CDRs of each variable domain interact to define an antigen- binding site on the surface ofthe V H -V L dimer.
- the six CDRs confer antigen-binding specificity to the antibody.
- variable domain or half of an Fv comprising only three CDRs specific for an antigen
- the Fab fragment also contains the constant domain ofthe light chain and the first constant domain (C H I) ofthe heavy chain.
- Fab fragments differ from Fab' fragments by the addition of a few residues at the carboxy terminus ofthe heavy-chain C H I domain including one or more cysteines from the antibody hinge region.
- Fab'-SH is the -designation herein for Fab' in which the cysteine residue(s) ofthe constant domains bear a free thiol group.
- F(ab')2 antibody fragments originally were produced as pairs of Fab' fragments thatfrave hinge cysteines between them. Other chemical couplings of antibody fragments are also known.
- the "light chains" of antibodies (immunoglobulins) from any vertebrate species can be assigned to one of two clearly distinct types, called kappa (K) and lambda ( ⁇ ), based on the amino acid sequences of their constant domains. Depending on the amino acid sequence ofthe constant domain of their heavy chains, immunoglobulins can be assigned to different classes.
- IgA human immunoglobulins
- IgD immunoglobulins
- IgE immunoglobulins
- IgG immunoglobulins
- IgM immunoglobulins
- label when used herein refers to a detectable compound or composition that is conjugated directly or indirectly to the antibody so as to generate a "labeled" antibody.
- the label maybe detectable by itself (e.g., radioisotope labels or fluorescent labels) or, in the case of an enzymatic label, may catalyze chemical alteration of a substrate compound or composition that is detectable.
- Radionuclides that can serve as detectable labels include, for example, 1-131, 1-123, 1-125, Y-90, Re-188, Re-186, At- 211, Cu-67, Bi-212, and Pd-109.
- the label might also be a non-detectable entity such as a toxin.
- antagonist is used in the broadest sense, and includes any molecule that partially or fully blocks, inhibits, or neutralizes a biological activity of a native target disclosed herein or the transcription or franslation thereof.
- Carriers as used herein include pharmaceutically acceptable carriers, excipients, or stabilizers that are nontoxic to the cell or mammal being exposed thereto at the dosages and concentrations employed. Often the physiologically acceptable carrier is an aqueous pH buffered solution.
- physiologically acceptable carriers include buffers such as phosphate, citrate, succinate, and other organic acids; antioxidants including ascorbic acid; low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpy ⁇ olidone; amino acids such as glycine, glutamine, asparagine, arginine or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugar alcohols such as mannitol or sorbitol; salt-forming counterions such as sodium; and/or nonionic surfactants such as TWEEN, polyethylene glycol (PEG), and Pluronics.
- buffers such as phosphate, citrate, succinate, and other organic acids
- antioxidants including ascorbic acid
- low molecular weight (less than about 10 residues) polypeptides such
- Adminisfration "in combination with” one or more further therapeutic agents includes simultaneous (concunent) and consecutive administration in any order.
- a "host cell,” as used herein, refers to a microorganism or a eukaryotic cell or cell line cultured as a unicellular entity that can be, or has been, used as a recipient for a recombinant vector or other fransfer polynucleotides, and include the progeny ofthe original cell that has been transfected. It is understood that the progeny of a single cell may not necessarily be completely identical in mo ⁇ hology or in genomic or total DNA complement as the original parent, due to natural, accidental, or deliberate mutation.
- Human effector cells are leukocytes that express one or more FcRs and perform effector functions. Preferably, the cells express at least Fc ⁇ RIII and cany out antigen- dependent cell-mediated cyotoxicity (ADCC) effector function.
- ADCC antigen- dependent cell-mediated cyotoxicity
- human leukocytes that mediate ADCC include peripheral blood mononuclear cells (PBMC), natural killer (NK) cells, monocytes, macrophages, eosinophils, and durophils, with PBMCs and NK cells being prefened.
- Antibodies that have ADCC activity are typically ofthe IgGl or IgG3 isotype.
- ADCC-mediating antibodies can be made by engineering a variable region from a non- ADCC antibody or variable region fragment to an IgGl or IgG3 isotype constant region.
- the terms "Fc receptor” or “FcR” are used to describe a receptor that binds to the Fc region of an antibody.
- the prefened FcR is a native-sequence human FcR.
- a prefened FcR is one that binds an IgG antibody (a gamma receptor) and includes receptors ofthe Fc ⁇ RI, Fc ⁇ RII, and Fc ⁇ RIII subclasses, including allelic variants and alternatively spliced forms of these receptors.
- Fc ⁇ RII receptors include Fc ⁇ RIIA (an “activating receptor") and FC7RIIB (an “inhibiting receptor”), which have similar amino acid sequences that differ primarily in the cytoplasmic domains thereof.
- Activating receptor Fc ⁇ RIIA contains an immunoreceptor tyrosine-based activation motif (IT AM) in its cytoplasmic domain.
- Inhibiting receptor Fc ⁇ RIIB contains an immunoreceptor tyrosine-based inhibition motif (ITIM) in its cytoplasmic domain (see Daeron (1997) Annu. Rev. Immunol. 15:203-234).
- ITIM immunoreceptor tyrosine-based inhibition motif
- FcRs are reviewed in Ravetch and Kinet (1991) Annu. - Rev. Immunol. 9:457-492 (1991); Capel et al. (1994) Immunomethods 4:25-34; and de Haas et al. (1995) J. Lab. Clin. Med. 126:330-341.
- Other FcRs including those to be identified in the future, are encompassed by the term "FcR" herein.
- the term also includes the neonatal receptor, FcRn, which is responsible for the transfer of maternal IgGs to the fetus (Guyer et al. (1976) J Immunol. 117:587 and Kim et al. (1994) J. Immunol. 24:249 (1994)).
- FcRn neonatal receptor
- secreting cells can be immortalized by infection with the Epstein-Ban virus (EBV).
- EBV-infected cells are difficult to clone and usually produce only relatively low yields of immunoglobulin (James and Bell (1987) J. Immunol. Methods 100:5-40).
- mice This was achieved by germ-line integration of megabase human heavy-chain and light-chain loci into mice with deletion into endogenous J H segment as described above.
- These mice (XenoMouse ® II technology (Abgenix; Fremont, California)) harbor 1,020 kb of human heavy-chain locus containing approximately 66 VH genes, complete D ⁇ and J H regions, and three different constant regions, and also harbors 800 kb of human K locus containing 32 V/c genes, JK segments, and C c genes.
- the antibodies produced in these mice closely resemble that seen in humans in all respects, including gene rea ⁇ angement, assembly, and repertoire.
- mice may be immunized with an antigen of particular interest. Sera from such immunized animals may be screened for antibody reactivity against the initial antigen.
- Lymphocytes may be isolated from lymph nodes or spleen cells and may further be selected for B cells by selecting for CD138-negative and CD 19- positive cells, hi one aspect, such B cell cultures (BCCs) may be fused to myeloma cells to generate hybridomas as detailed above. In another aspect, such B cell cultures may be screened further for reactivity against the initial antigen, preferably.
- Such screening includes ELISA with the target/antigen protein, a competition assay with known antibodies that bind the antigen of interest, and in vitro binding to transiently transfected CHO or other cells that express the target antigen.
- the present invention is directed to compositions and methods for treating human patients with diseases mediated by stimulation of CD40 signaling on CD40-expressing cells. The methods involve treatment with an anti-CD40 antibody ofthe invention, or an antigen-binding fragment thereof, where adminisfration ofthe antibody or antigen- binding fragment thereof promotes a positive therapeutic response within the patient undergoing this method of therapy.
- Anti-CD40 antibodies suitable for use in the methods ofthe invention specifically bind a human CD40 antigen expressed on the surface of a human cell and are free of significant agonist activity, but exhibit antagonist activity when bound to the CD40 antigen on a human CD40-expressing cell.
- These anti-CD40 antibodies and antigen-binding fragments thereof are refe ⁇ ed to herein as antagonist anti- CD40 antibodies.
- Such antibodies include, but are not limited to, the fully human monoclonal antibodies CHER-5.9 and CHIR-12.12 described below and monoclonal antibodies having the binding characteristics of monoclonal antibodies CHIR-5.9 and CHIR-12.12.
- the antagonist antibodies and antigen-binding fragments of these antibodies disclosed herein include antibodies and antigen-binding fragments thereof that are produced recombinantly using methods well known in the art and described herein below, and include, for example, monoclonal antibodies CHER-5.9 and CHER-12.12 that have been recombinantly produced.
- Antibodies that have the binding characteristics of monoclonal antibodies CHER- 5.9 and CHER-12.12 include antibodies that competitively interfere with binding CD40 and/or bind the same epitopes as CHIR-5.9 and CHER-12.12.
- One of skill could determine whether an antibody competitively interferes with CHER-5.9 or CHER-12.12 using standard methods.
- the antibodies When these antibodies bind CD40 displayed on the surface of human cells, such as human B cells, the antibodies are free of significant agonist activity; in some embodiments, their binding to CD40 displayed on the surface of human cells results in inhibition of proliferation and differentiation of these human cells.
- the antagonist anti-CD40 antibodies suitable for use in the methods ofthe invention include those monoclonal antibodies that can exhibit antagonist activity toward normal and malignant human cells expressing the cell-surface CD40 antigen.
- the anti-CD40 antibodies ofthe invention exhibit increased anti-tumor activity relative to the chimeric anti-CD20 monoclonal antibody IDEC-C2B8, where anti-tumor activity is assayed with equivalent amounts of these antibodies in a nude mouse xenograft tumor model using human lymphoma cell lines.
- IDEC-C2B8 (IDEC Pharmaceuticals Co ⁇ ., San Diego, California; commercially available under the fradename Rituxan®, also refe ⁇ ed to as rituximab) is a chimeric anti- CD20 monoclonal antibody containing human IgGl and kappa constant regions with murine variable regions isolated from a murine anti-CD20 monoclonal antibody, IDEC- 2B8 (Reff et al. (1994) Blood 83:435-445).
- Rituximab® is licensed for freatment of relapsed B cell low-grade or follicular non-Hodgkin's lymphoma (NHL).
- Suitable nude mouse xenograft tumor models include those using the human Burkitt's lymphoma cell lines known as Namalwa and Daudi. Prefened embodiments assay anti-tumor activity in a staged nude mouse xenograft tumor model using the Daudi human lymphoma cell line as described herein below in Example 17.
- a staged nude mouse xenograft tumor model using the Daudi lymphoma cell line is more effective at distinguishing the therapeutic efficacy of a given antibody than is an unstaged model, as in the staged model antibody dosing is initiated only after the tumor has reached a measurable size.
- antibody dosing is initiated generally within about 1 day of tumor inoculation and before a palpable tumor is present.
- the ability of an antibody to outperform Rituxan® (i.e., to exhibit increased anti-tumor activity) in a staged model is a strong indication that the antibody will be more therapeutically effective than Rituxan®.
- the target for Rituxan® is expressed on the cell surface at a higher level than is CD40.
- epivalent amount of the anti-CD40 antibody ofthe invention and Rituxan® is intended the same mg dose is administered on a per weight basis.
- the anti-CD40 antibody of the invention is dosed at 0.01 mg/kg body weight of the mouse used in the tumor model, Rituxan® is also dosed at 0.01 mg/kg body weight ofthe mouse.
- the Rituxan® is also dosed at 0.1, 1, or 10 mg/kg, respectively, ofthe body weight ofthe mouse.
- some antibodies of ttie invention result in significantly less tumor volume than an equivalent amount of Rituxan®.
- the fully human monoclonal antibody CHIR-12.12 exhibits at least a 20% increase in anti-tumor activity relative to that observed with an equivalent dose of Rituxan when assayed in the staged nude mouse xenograft tumor model using the Daudi human lymphoma cell line in the manner described in Examples herein below, and can exhibit as much as a 50% to 60% increase in anti-tumor activity in this assay.
- This increased anti-tumor activity is reflected in the greater reduction in tumor volume observed with the anti-CD40 antibody ofthe invention when compared to the equivalent dose of Rituxan®.
- the monoclonal antibody CHER-12.12 can exhibit a tumor volume that is about one-third to about one-half that observed for an equivalent dose of Rituxan®.
- Another difference in antibody efficacy is to measure in vitro the concentration of antibody needed to obtain the maximum lysis of tumor cells in vitro in the presence of NK cells.
- the anti-CD40 antibodies ofthe invention reach maximum lysis of Daudi cells at an EC50 of less than l A, and preferably VA, and most preferably, 1/10 the concentration of Rituxan®.
- the monoclonal antibodies CHIR-5.9 and CHIR-12.12 represent suitable antagonist anti-CD40 antibodies for use in the methods ofthe present invention.
- the monoclonal antibodies CHIR-5.9 and CHIR-12.12 represent suitable antagonist anti-CD40 antibodies for use in the methods ofthe present invention.
- CHIR-5.9 and CHIR-12.12 antibodies are fully human anti-CD40 monoclonal antibodies ofthe Igd isotype produced from the hybridoma cell lines 131.2F8.5.9 (refened to herein as the cell line 5.9) and 153.8E2.D10.D6.12.12 (refe ⁇ ed to herein as the cell line 12.12). These cell lines were created using splenocytes from immunized xenotypic mice containing the human IgGi heavy chain locus and the human K chain locus (XenoMouse ® technology; Abgenix; Fremont, California). The spleen cells were fused with the mouse myeloma SP2/0 cells (Siena BioSource).
- the resulting hybridomas were sub-cloned several times to create the stable monoclonal cell lines 5.9 and 12.12.
- Other antibodies of the invention may be prepared similarly using mice transgenic for human immunoglobulin loci or by other methods known in the art and/or described herein.
- nucleotide sequences encoding the light chain and heavy chain for mAb CHIR-12.12 are set forth in Figures IIA and 11B, respectively. See also SEQ ED NO:l (coding sequence for the light chain for mAb CHER-12.12), and SEQ ED NO:3 (coding sequence for the heavy chain for mAb CHIR-12.12).
- amino acid sequences for the leader, variable, and constant regions for the light chain and heavy chain ofthe CHIR-5.9 mAb are set forth in Figures 10A and 10B, respectively.
- SEQ ID NO:6 complete sequence for the light chain of mAb CHER-5.9
- SEQ LD NO:7 complete sequence for the heavy chain of mAb CHER-5.9
- SEQ ED NO:8 complete sequence for a variant ofthe heavy chain of mAb CHIR-5.9 set forth in SEQ ID NO:7, where the variant comprises a serine substitution for the alanine residue at position 158 of SEQ ID NO:7).
- hybridomas expressing CHIR-5.9 and CHIR-12.12 antibodies have been deposited with the ATCC with a patent deposit designation of PTA-5542 and PTA-5543, respectively.
- anti-CD40 antibodies of this invention have another mechanism of action against a tumor cell.
- native CHIR-5.9 and CHER-12.12 antibodies have ADCC activity.
- variable regions of the CHER-5.9 and CHIR- 12.12 antibodies can be expressed on another antibody isotype that has ADCC activity. It is also possible to conjugate native forms, recombinant forms, or antigen-binding fragments of CHER.-5.9 or CHER-12.12 to a cytotoxin, a therapeutic agent, or a radioactive metal ion or radioisotope, as noted herein below.
- the CHIR-5.9 and CHIR-12.12 monoclonal antibodies bind soluble CD40 in ELISA.-type assays, prevent the binding of CD40-ligand to cell-surface CD40, and displace the pre-bound CD40-ligand, as determined by flow cytometric assays.
- Antibodies CHER-5.9 and CHIR-12.12 compete with each other for binding to CD40 but not with 15B8, the anti-CD40 monoclonal antibody described in U.S. Provisional Application Serial No. 60/237,556, titled "Human Anti-CD40 Antibodies," filed October 2, 200O, and PCT International Application No.
- PCT/US01/30857 also titled “Human Anti-CD40 Antibodies,” filed October 2, 2001 (Attorney Docket No. PP16092.003), both of which are herein inco ⁇ orated by reference in their entirety.
- CHER-5.9 and CHER- 12.12 act as antagonist anti-CD40 antibodies.
- CHIR-5.9 and CHER-12.12 do not induce strong proliferation of human lymphocytes from no ⁇ nal subjects.
- ADCC antibody dependent cellular cytotoxicity
- the binding affinity of CHER-5.9 for human CD40 is 1.2xl0 "8 M and the binding affinity of CHER-12.12 is 5xl0 "10 M, as determined by the BiacoreTM assay.
- Suitable antagonist anti-CD40 antibodies for use in the methods ofthe present invention exhibit a sfrong single-site binding affinity for the CD40 cell-surface antigen.
- the monoclonal antibodies ofthe invention exhibit a dissociation equilibrium constant (K D ) for CD40 of at least 10 "5 M, at least 3 X 10 "5 M, preferably at least 10 "6 M to 10 "7 M, more preferably at least 10 "8 M to about 10 "12 M, measured using a standard assay such as BiacoreTM.
- CD40 antigen CD40 cell surface antigen
- CD40 receptor CD40
- TNF tumor necrosis factor
- the first isoform (also known as the "long isoform” or "isoform 1") is expressed as a 277-amino-acid precursor polypeptide (SEQ ED NO: 12 (first reported as GenBank Accession No. CAA43045, and identified as isoform 1 in GenBank Accession No.
- NP_001241 encoded by SEQ ID NO: 11 (see GenBank Accession Nos. X60592 and NM 301250)), which has a signal sequence represented by the first 19 residues.
- the second isoform also known as the "short isoform” or “isoform 2" is expressed as a 203-amino-acid precursor polypeptide (SEQ ED NO: 10 (GenBank Accession No. NP_690593), encoded by SEQ ED NO:9 (GenBank Accession No.
- NM 152854 which also has a signal sequence represented by the first 19 residues.
- the precursor polypeptides of these two isoforms of human CD40 share in common their first 165 residues (i.e., residues 1-165 of SEQ ID NO:10 and SEQ ED NO:12).
- the precursor polypeptide ofthe short isoform (shown in SEQ ID NO: 10) is encoded by a transcript variant (SEQ ID NO:9) that lacks a coding segment, which leads to a translation frame shift; the resulting CD40 isoform contains a shorter and distinct C-terminus (residues 166-203 of SEQ ID NO: 10) from that contained in the long isoform of CD40 (C-terminus shown in residues 166-277 of SEQ ED NO: 12).
- the term "CD40 antigen,” "CD40 cell surface antigen," "CD40 receptor,” or "CD40” encompasses both the short and long isoforms of CD40.
- the anti-CD40 antibodies ofthe present invention bind to an epitope of human CD40 that resides at the same location within either the short isoform or long isoform of this cell surface antigen as noted herein below.
- the CD40 antigen is displayed on the surface of a variety of cell types, as described elsewhere herein. By “displayed on the surface” and “expressed on the surface” is intended that all or a portion ofthe CD40 antigen is exposed to the exterior of the cell.
- the displayed or expressed CD40 antigen may be fully or partially glycosylated.
- agonist activity is intended that the substance functions as an agonist. An agonist combines with a receptor on a cell and initiates a reaction or activity that is similar to or the same as that initiated by the receptor's natural ligand.
- An agonist of CD40 induces any or all of, but not limited to, the following responses: B cell proliferation and differentiation, antibody production, intercellular adhesion, B cell memory generation, isotype switching, up-regulation of cell-surface expression of MHC Class II and CD80/86, and secretion of pro-inflammatory cytokines such as E -8, IL-12, and TNF.
- antagonist activity is intended that the substance functions as an antagonist.
- An antagonist of CD40 prevents or reduces induction of any of the responses induced by binding ofthe CD40 receptor to an agonist ligand, particularly CD40L.
- the antagonist may reduce induction of any one or more ofthe responses to agonist binding by 5%, 10%, 15%, 20%, 25%, 30%, 35%, preferably 40%, 45%, 50%, 55%, 60%, more preferably 70%, 80%, 85%, and most preferably 90%, 95%, 99%, or 100%.
- Methods for measuring anti-CD40 antibody and CD40-ligand binding specificity and antagonist activity include, but are not limited to, standard competitive binding assays, assays for monitoring immunoglobuhn secretion by B cells, B cell proliferation assays, Banchereau-Like-B cell proliferation assays, T cell helper assays for antibody production, co-stimulation of B cell proliferation assays, and assays for up-regulation of B cell activation markers. See, for example, such assays disclosed in WO 00/75348 and U.S. Patent No. 6,087,329, herein inco ⁇ orated by reference.
- significant agonist activity is intended an agomst activity of at least 30%, 35%, 40%, 45%, 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, or 100% greater than the agonist activity induced by a contral substance or negative control as measured in an assay of a B cell response.
- "significant" agonist activity is an agonist activity that is at least 2-fold greater or at least 3-fold greater than the agonist activity induced by a damral substance or negative control as measured in an assay of a B cell response.
- B cell response of interest is B cell proliferation
- "significant" agonist activity would be induction of a level of B cell proliferation that is at least 2-fold greater or at least 3-fold greater than the level of B cell proliferation induced by a neutral substance or negative confrol.
- a non-specific immunoglobulin for example IgGl, that does not bind to CD40 serves as the negative control.
- a substance "free of significant agonist activity” would exhibit an agonist activity of not more than about 25% greater than the agonist activity induced by a neutral substance or negative confrol, preferably not more than about 20% greater, 15% greater, 10% greater, 5% greater, 1% greater, 0.5% greater, or even not more than about 0.1% greater than the agonist activity induced by a tortral substance or negative control as measured in an assay of a B cell response.
- the antagonist anti-CD40 antibodies useful in the methods ofthe present invention are free of significant agonist activity as noted above when bound to a CD40 antigen on a human cell.
- the antagomst anti-CD40 antibody is free of significant agonist activity in one B cell response.
- the antagonist anti-CD40 antibody is free of significant agonist activity in assays of more than one B cell response (e.g., proliferation and differentiation, or proliferation, differentiation, and antibody production).
- anti-CD40 antibody encompasses any antibody that specifically recognizes the CD40 B cell surface antigen, including polyclonal antibodies, monoclonal antibodies, single-chain antibodies, and fragments thereof such as Fab, F(ab') 2 , F v , and other fragments which retain the antigen binding function ofthe parent anti-CD40 antibody.
- the antagonist anti-CD40 antibodies disclosed herein that share the binding characteristics of the monoclonal antibodies CHIR-5.9 and CHER-12.12 described above.
- Such antibodies include, but are not limited to the following: (1) the monoclonal antibodies produced by the hybridoma cell lines designated 131.2F8.5.9 (refe ⁇ ed to herein as the cell line 5.9) and 153.8E2.D10.D6.12.12 (refened to herein as the cell line 12.12), deposited with the ATCC as Patent Deposit No. PTA-5542 and Patent Deposit No.
- the antagonist anti-CD40 antibodies disclosed herein and for use in the methods ofthe present invention can be produced using any antibody production method known to those of skill in the art.
- polyclonal sera may be prepared by conventional methods, hi general, a solution containing the CD40 antigen is first used to immunize a suitable animal, preferably a mouse, rat, rabbit, or goat. Rabbits or goats are prefened for the preparation of polyclonal sera due to the volume of serum obtainable, and the availability of labeled anti-rabbit and anti-goat antibodies.
- Polyclonal sera can be prepared in a transgenic animal, preferably a mouse bearing human immunoglobulin loci, hi a prefened embodiment, Sf9 cells expressing CD40 are used as the immunogen. Immunization can also be performed by mixing or emulsifying the antigen-containing solution in saline, preferably in an adjuvant such as Freund's complete adjuvant, and injecting the mixture or emulsion parenterally (generally subcutaneously or inframuscularly). A dose of 50-200 ⁇ g/injection is typically sufficient. Immunization is generally boosted 2-6 weeks later with one or more injections ofthe protein in saline, preferably using Freund's incomplete adjuvant.
- an adjuvant such as Freund's complete adjuvant
- Polyclonal antisera are obtained by bleeding the immunized animal into a glass or plastic container, incubating the blood at 25°C for one hour, followed by incubating at 4°C for 2- 18 hours. The serum is recovered by centrifugation (e.g., 1,000 x g for 10 minutes). About 20-50 ml per bleed may be obtained from rabbits. Production ofthe Sf 9 (Spodopterafrugiperda) cells is disclosed in U.S. Patent No. 6,004,552, inco ⁇ orated herein by reference.
- sequences encoding human CD40 were recombined into a baculovirus using transfer vectors.
- the plasmids were co- fransfected with wild-type baculovirus DNA into Sf 9 cells.
- Recombinant baculovirus- infected Sf 9 cells were identified and clonally purified.
- the antibody is monoclonal in nature.
- monoclonal antibody is intended an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts. The term is not limited regarding the species or source ofthe antibody.
- the term encompasses whole immunoglobulins as well as fragments such as Fab, F(ab')2, Fv, and others which retain the antigen binding function ofthe antibody.
- Monoclonal antibodies are highly specific, being directed against a single antigenic site, i.e., the CD40 cell surface antigen in the present invention.
- each monoclonal antibody is directed against a single determinant on the antigen.
- the modifier "monoclonal" indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production ofthe antibody by any particular method.
- the monoclonal antibodies to be used in accordance with the present invention may be made by the hybridoma method first described by Kohler et al. (1975) Nature 256:495, or may be made by recombinant DNA methods (see, e.g., U.S. Patent No. 4,816,567).
- the "monoclonal antibodies” may also be isolated from phage antibody libraries using the techniques described in, for example, Clackson et al. (1991) Nature 352:624-628; Marks et al (1991) J. Mol. Biol. 222:581-597; and U.S. Patent No. 5,514,548.
- epitope is intended the part of an antigenic molecule to which an antibody is produced and to which the antibody will bind.
- Epitopes can comprise linear amino acid residues (i.e., residues within the epitope are a ⁇ anged sequentially one after another in a linear fashion), nonlinear amino acid residues (refe ⁇ ed to herein as “nonlinear epitopes”; these epitopes are not a ⁇ anged sequentially), or both linear and nonlinear amino acid residues.
- Monoclonal antibodies can be prepared using the method of Kohler et al. (1975) Nature 256:495-496, or a modification thereof. Typically, a mouse is immunized with a solution containing an antigen.
- Immunization can be performed by mixing or emulsifying the antigen-containing solution in saline, preferably in an adjuvant such as Freund's complete adjuvant, and injecting the mixture or emulsion parenterally. Any method of immunization known in the art may be used to obtain the monoclonal antibodies ofthe invention. After immunization ofthe animal, the spleen (and optionally, several large lymph nodes) are removed and dissociated into single cells. The spleen cells may be screened by applying a cell suspension to a plate or well coated with the antigen of interest. The B cells expressing membrane bound immunoglobulin specific for the antigen bind to the plate and are not rinsed away.
- an adjuvant such as Freund's complete adjuvant
- Resulting B cells or all dissociated spleen cells, are then induced to fuse with myeloma cells to form hybridomas, and are cultured in a selective medium.
- the resulting cells are plated by serial dilution and are assayed for the production of antibodies that specifically bind the antigen of interest (and that do not bind to unrelated antigens).
- the selected monoclonal antibody (mAb)- secreting hybridomas are then cultured either in vitro (e.g., in tissue culture bottles or hollow fiber reactors), or in vivo (as ascites in mice).
- the DNA encoding the monoclonal antibodies is readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of murine antibodies).
- the hybridoma cells described herein serve as a preferred source of such DNA.
- the DNA may be placed into expression vectors, which are then transfected into host cells such as E. coli cells, simian COS cells, Chinese Hamster Ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of monoclonal antibodies in the recombinant host cells.
- antibody can be produced in a cell line such as a CHO cell line, as disclosed in U.S. Patent Nos. 5,545,403; 5,545,405; and 5,998,144; incorporated herein by reference. Briefly the cell line is transfected with vectors capable of expressing a light chain and a heavy chain, respectively. By transfecting the two proteins on separate vectors, chimeric antibodies can be produced. Another advantage is the conect glycosylation ofthe antibody.
- the antagonist anti-CD40 antibody for example, the CHIR-12.12 or CHIR-5.9 antibody, or antigen-binding fragment thereof is produced in CHO cells using the GS gene expression system (Lonza Biologies, Portsmouth, New Hampshire), which uses glutamine synthetase as a marker. See, also U.S. Patent Nos. 5,122,464; 5,591,639; 5,658,759; 5,770,359; 5,827,739; 5,879,936; 5,891,693; and 5,981,216; the contents of which are herein inco ⁇ orated by reference in their entirety. Monoclonal antibodies to CD40 are known in the art.
- CD40-antigen epitope refers to a molecule that is capable of immunoreactivity with the anti-CD40 monoclonal antibodies of this invention, excluding the CD40 antigen itself.
- CD40-antigen epitopes may comprise proteins, protein fragments, peptides, carbohydrates, lipids, and other molecules, but for the pu ⁇ oses ofthe present invention are most commonly proteins, short oligopeptides, oligopeptide mimics (i e, organic compounds which mimic the antibody binding properties ofthe CD40 antigen), or combinations thereof. Suitable oligopeptide mimics are described, inter alia, in PCT application US 91/04282. Additionally, the term "anti-CD40 antibody” as used herein encompasses chimeric anti-CD40 antibodies; such chimeric anti-CD40 antibodies for use in the methods ofthe invention have the binding characteristics ofthe CHER-5.9 and CHIR- 12.12 monoclonal antibodies described herein.
- chimeric antibodies antibodies that are most preferably derived using recombinant deoxyribonucleic acid techniques and which comprise both human (including immunologically "related" species, e.g., chimpanzee) and non-human components.
- the constant region ofthe chimeric antibody is most preferably substantially identical to the constant region of a natural human antibody; the variable region ofthe chimeric antibody is most preferably derived from a non-human source and has the desired antigenic specificity to the CD40 cell-surface antigen.
- the non-human source can be any vertebrate source that can be used to generate antibodies to a human CD40 cell-surface antigen or material comprising a human CD40 cell-surface antigen.
- non-human sources include, but are not limited to, rodents (e.g., rabbit, rat, mouse, etc.; see, for example, U.S. Patent No. 4,816,567, herein inco ⁇ orated by reference) and non-human primates (e.g., Old World Monkey, Ape, etc.; see, for example, U.S. Patent Nos. 5,750,105 and 5,756,096; herein inco ⁇ orated by reference).
- rodents e.g., rabbit, rat, mouse, etc.
- non-human primates e.g., Old World Monkey, Ape, etc.
- U.S. Patent Nos. 5,750,105 and 5,756,096 see, for example, U.S. Patent Nos. 5,750,105 and 5,756,096; herein inco ⁇ orated by reference.
- the phrase "immunologically active" when used in reference to chimeric anti-CD40 antibodies means a chimeric antibody that binds human CD40.
- Chimeric antibodies comprise segments of antibodies derived from different species.
- Rituxan® is an example of a chimeric antibody with a murine variable region and a human constant region.
- humanized is intended forms of anti-CD40 antibodies that contain minimal sequence derived from non-human immunoglobulin sequences.
- humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a hypervariable region (also known as complementarity determining region or CDR) of the recipient are replaced by residues from a hypervariable region of a non- human species (donor antibody) such as mouse, rat, rabbit, or nonhuman primate having the desired specificity, affinity, and capacity.
- donor antibody such as mouse, rat, rabbit, or nonhuman primate having the desired specificity, affinity, and capacity.
- complementarity determining region refers to amino acid sequences which together define the binding affinity and specificity ofthe natural Fv region of a native immimoglobulin binding site. See, e.g., Chothia et al ( 1987) J. Mol. Biol. 196:901-917; Kabat et al (1991) U. S. Dept. of Health and Human Services, NIH Publication No. 91-3242).
- constant region refers to the portion ofthe antibody molecule that confers effector functions. In previous work directed towards producing non-immunogenic antibodies for use in therapy of human disease, mouse constant regions were substituted by human constant regions. The constant regions ofthe subject humanized antibodies were derived from human immunoglobulins.
- Humanized anti-CD40 antibodies for use in the methods ofthe present invention have binding characteristics similar to those exhibited by the CHIR-5.9 and CHIR-12.12 monoclonal antibodies described herein. Humanization can be essentially performed following the method of Winter and co-workers (Jones et al. (1986) Nature 321:522-525; Riechmann et al. (1988) Nature 332:323-327; Verhoeyen et al. (1988) Science 239:1534-1536), by substituting rodent or mutant rodent CDRs or CDR sequences for the conesponding sequences of a human antibody.
- the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable regions conespond to those of a non-human immunoglobulin and all or substantially all ofthe framework regions are those of a human immunoglobulin sequence.
- the humanized antibody optionally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immimoglobulin.
- Fc immunoglobulin constant region
- humanized antibodies may include antibodies wherein substantially less than an intact human variable domain has been substituted by the conesponding sequence from a non-human species.
- humanized antibodies are typically human antibodies in which some CDR residues and possibly some framework residues are substituted by residues from analogous sites in rodent antibodies. See, for example, U.S. Patent Nos. 5,225,539; 5,585,089; 5,693,761; 5,693,762; 5,859,205. See also U.S. Patent No. 6,180,370, and hitemational Publication No. WO 01/27160, where humanized antibodies and techniques for producing humanized antibodies having improved affinity for a predetermined antigen are disclosed.
- anti-CD40 antibodies are xenogeneic or modified anti-CD40 antibodies produced in a non-human mammalian host, more particularly a transgenic mouse, characterized by inactivated endogenous immunoglobulin (Ig) loci.
- Ig immunoglobulin loci
- competent endogenous genes for the expression of light and heavy subunits of host immunoglobulins are rendered non-functional and substituted with the analogous human immunoglobulin loci.
- These transgenic animals produce human antibodies in the substantial absence of light or heavy host immunoglobulin subunits. See, for example, U.S. Patent Nos. 5,877,397 and 5,939,598, herein inco ⁇ orated by reference.
- Fully human antibodies to CD40 are obtained by immunizing transgenic mice.
- One such mouse is obtained using XenoMouse ® technology (Abgenix; Fremont, California), and is disclosed in U.S. Patent Nos. 6,075,181, 6,091,001, and 6,114,598, all of which are inco ⁇ orated herein by reference.
- mice transgenic for the human Ig Gi heavy chain locus and the human K light chain locus were immunized with Sf 9 cells expressing human CD40. Mice can also be transgenic for other isotypes.
- Fully human antibodies useful in the methods ofthe present invention are characterized by binding properties similar to those exhibited by the CHER-5.9 and CHIR-12.12 monoclonal antibodies disclosed herein.
- Fragments ofthe anti-CD40 antibodies are suitable for use in the methods ofthe invention so long as they retain the desired affinity ofthe full-length antibody.
- a fragment of an anti-CD40 antibody will retain the ability to bind to the CD40 B cell surface antigen.
- Such fragments are characterized by properties similar to the conesponding full-length antagonist anti-CD40 antibody, that is, the fragments will specifically bind a human CD40 antigen expressed on the surface of a human cell, and are free of significant agonist activity but exhibit antagonist activity when bound to a CD40 antigen on a human CD40-expressing cell.
- Such fragments are refe ⁇ ed to herein as "antigen-binding" fragments.
- Suitable antigen-binding fragments of an antibody comprise a portion of a full- length antibody, generally the antigen-binding or variable region thereof.
- antibody fragments include, but are not limited to, Fab, F(ab') 2 , and Fv fragments and single-chain antibody molecules.
- Fab is intended a monovalent antigen-binding fragment of an immunoglobulin that is composed ofthe light chain and part ofthe heavy chain.
- F(ab') 2 is intended a bivalent antigen-binding fragment of an immunoglobulin that contains both light chains and part of both heavy chains.
- the Fv polypeptide further comprises a polypeptide linker between the V H and V L domains that enables the sFv to form the desired structure for antigen binding.
- sFv see Pluckthun (1994) in 77. e Pharmacology of Monoclonal Antibodies , Vol. 113, ed.
- Antigen-binding fragments ofthe antagonist anti-CD40 antibodies disclosed herein can also be conjugated to a cytotoxin to effect killing ofthe target cancer cells, as described herein below.
- Antibodies or antibody fragments can be isolated from antibody phage libraries generated using the techniques described in, for example, McCafferty et al. (1990) Nature 348:552-554 (1990) and U.S. Patent No. 5,514,548. Clackson et al (1991) Nature 352:624-628 and Marks et al (1991) J Mol. Biol. 222:581-597 describe the isolation of murine and human antibodies, respectively, using phage libraries.
- the antibody fragments can be isolated J&om the antibody phage libraries discussed above.
- Fab'-SH fragments can be directly recovered from E. coli and chemically coupled to form F(ab') 2 fragments (Carter et al. (1992) Bio/Technology 10:163-167).
- F(ab') 2 fragments can be isolated directly from recombinant host cell culture. Other techniques for the production of antibody fragments will be apparent to the skilled practitioner.
- Antagonist anti-CD40 antibodies useful in the methods ofthe present invention include the CHIR-5.9 and CH ⁇ R-12.12 monoclonal antibodies disclosed herein as well as antibodies differing from this antibody but retaining the CDRs; and antibodies with one or more amino acid addition(s), deletion(s), or substitutions), wherein the antagonist activity is measured by inhibition of B-cell proliferation and/or differentiation.
- the invention also encompasses de-imnxunized antagonist anti-CD40 antibodies, which can be produced as described in, for example, International Publication Nos. WO 98/52976 and WO 0034317; herein inco ⁇ orated by reference.
- fusion proteins comprising an antagonist anti-CD4O antibody ofthe invention, or a fragment thereof, which fusion proteins can be synthesized or expressed from conesponding polynucleotide vectors, as is known in the art. Such fusion proteins are described with reference to conjugation of antibodies as noted below.
- the antibodies ofthe present invention can have sequence variations produced using methods described in, for example, Patent Publication Nos.
- EP 0 983 303 Al, WO 00/34317, and WO 98/52976 inco ⁇ orated herein by reference.
- sequences ⁇ vithin the CDR can cause an antibody to bind to MHC Class II and trigger an unwanted helper T-cell response.
- a conservative substitution can allow the antibody to retain binding activity yet lose its ability to trigger an unwanted T-cell response. Any such conservative or non-conservative substitutions can be made using art-recognized methods, such as those noted elsewhere herein, and the resulting antibodies will fall within the scope ofthe invention.
- the variant antibodies can be routinely tested for antagonist activity, affinity, and specificity using methods described herein.
- an antibody produced by any ofthe methods described above, or any other method not disclosed herein, will fall within the scope ofthe invention if it possesses at least one ofthe following biological activities: inhibition of immunoglobulin secretion by normal human peripheral B cells stimulated by T cells; inhibition of survival and/or proliferation of normal human peripheral B cells stimulated by Jurkat T cells; inhibition of survival and/or proliferation of normal human peripheral B cells stimulated by CD40L-expressing cells or soluble CD40 ligand (sCD40L); inhibition of "survival" anti- apoptotic intracellular signals in any cell stimulated by sCD40L or solid-phase CD40L; inhibition of CD40 signal transduction in any cell upon ligation with sCD40L or solid- phase CD40L; and inhibition of proliferation of human malignant B cells as noted below.
- sCD40L soluble CD40 ligand
- a representative assay to detect antagonist anti-CD40 antibodies specific to the CD40-antigen epitopes identified herein is a "competitive bindmg assay.”
- Competitive binding assays are serological assays in which unknowns are detected and quantitated by their ability to inhibit the binding of a labeled known ligand to its specific antibody. This is also refe ⁇ ed to as a competitive inhibition assay.
- labeled CD40 polypeptide is precipitated by candidate antibodies in a sample, for example, in combination with monoclonal antibodies raised against one or more epitopes ofthe monoclonal antibodies ofthe invention.
- Anti-CD40 antibodies that specifically react with an epitope of interest can be identified by screening a series of antibodies prepared against a CD40 protein or fragment of the protein comprising the particular epitope ofthe CD40 protein of interest.
- epitopes of interest include epitopes comprising linear and/or nonlinear amino acid residues ofthe short isoform of human CD40 (see GenBank Accession No. NP_690593) set forth in Figure 12B (SEQ ED NO: 10), encoded by the sequence set forth in Figure 12A (SEQ ID NO:9; see also GenBank Accession No. NM_152854), or ofthe long isoform of human CD40 (see GenBank Accession Nos.
- Detection of the formation of an antibody-antigen complex between an anti-CD40 antibody and an epitope of interest can be facilitated by attaching a detectable substance to the antibody.
- Suitable detection means include the use of labels such as radionuclides, enzymes, coenzymes, fluorescers, chemiluminescers, chromogens, enzyme substrates or co-factors, enzyme inhibitors, prosthetic group complexes, free radicals, particles, dyes, and the like.
- suitable enzymes include horseradish peroxidase, alkaline phosphatase, ⁇ - galactosidase, or acetylcholinesterase;
- suitable prosthetic group complexes include sfreptavidin/biotin and avidin biotin;
- suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin; an example of a luminescent material is luminol;
- examples of bioluminescent materials include luciferase, luciferin, and aequorin; and
- suitable radioactive material include 125 1, 131 I, 35 S, or 3 H.
- Such labeled reagents may be used in a variety of well-known assays, such as radioimmunoassays, enzyme immunoassays, e.g., ELISA, fluorescent immunoassays, and the like. See for example, U.S. Patent Nos. 3,766,162; 3,791,932; 3,817,837; and 4,233,402. Any ofthe previously described antagonist anti-CD40 antibodies or antibody fragments thereof may be conjugated prior to use in the methods ofthe present invention. Methods for producing conjugated antibodies are known in the art. Thus, the anti-CD40 antibody may be labeled using an indirect labeling or indirect labeling approach.
- indirect labeling or “indirect labeling approach” is intended that a chelating agent is covalently attached to an antibody and at least one radionuclide is inserted into the chelating agent.
- Suitable labels include fluorophores, chromophores, radioactive atoms
- Enzymes are typically detected by their activity.
- horseradish peroxidase is usually detected by its ability to convert 3,3 ',5,5 '- teframethylbenzidine (TMB) to a blue pigment, quantifiable with a spectrophotometer.
- TMB 3,3 ',5,5 '- teframethylbenzidine
- Specific binding partner refers to a protein capable of binding a ligand molecule with high specificity, as for example in the case of an antigen and a monoclonal antibody specific therefore.
- Other specific binding partners include biotin and avidin or streptavidin, Ig G and protein A, and the numerous receptor-ligand couples known in the art.
- 125 I may serve as a radioactive label or as an electron-dense reagent.
- HRP may serve as enzyme or as antigen for a mAb.
- mAbs and avidin also require labels in the practice of this invention: thus, one might label a mAb with biotin, and detect its presence with avidin labeled with 125 I, or with an anti-biotin mAb labeled with HRP.
- Other permutations and possibilities will be readily apparent to those of ordinary skill in the art, and are considered as equivalents within the scope ofthe instant invention.
- the anti-CD40 antibody may be labeled using "direct labeling” or a "direct labeling approach,” where a radionuclide is covalently attached directly to an antibody (typically via an amino acid residue).
- Prefened radionuclides are provided in Srivagtava and Mease (1991) supra.
- the indirect labeling approach is particularly prefened. See also, for example, International Publication Nos. WO 00/52031 and WO 00/52473, where a linker is used to attach a radioactive label to antibodies; and the labeled forms of anti-CD40 antibodies described in U.S. Patent No. 6,015,542; herein inco ⁇ orated by reference.
- an antibody may be conjugated to a therapeutic moiety such as a cytotoxin, a therapeutic agent, or a radioactive metal ion or radioisotope.
- a therapeutic moiety such as a cytotoxin, a therapeutic agent, or a radioactive metal ion or radioisotope.
- a cytotoxin or cytotoxic agent includes any agent that is detrimental to cells.
- Examples include taxol, cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicin, doxorubicin, daunorabicin, dihydroxy anthracin dione, mitoxanfrone, mithramycin, actinomycin D, 1- dehydrotestosterone, glucocorticoids, procaine, tetracaine, lidocaine, propranolol, and puromycin and analogs or homologs thereof.
- Therapeutic agents include, but are not limited to, antimetabolites (e.g., methotrexate, 6-mercaptopurine, 6-thioguanine, cytarabine, 5-fluorouracil decarbazine), alkylating agents (e.g., mechlorethamine, thioepa chlorambucil, melphalan, carmustine (BSNU) and lomustine (CCNU), cyclophosphamide, busulfan, dibromomannitol, sfreptozotocin, mitomycin C, and cis- dichlorodiamine platinum (II) (DDP) cisplatin), anthracyclines (e.g., daunorabicin (formerly daunomycin) and doxorubicin), antibiotics (e.g., dactinomycin (formerly actinomycin), bleomycin, mithramycin, and anthramycin (AMC)), and anti-mitotic agents (e.
- Radioisotopes include, but are not limited to, 1-131, 1- 123, 1-125, Y-90, Re-188, Re-186, At-211, Cu-67, Bi-212, Bi-213, Pd-109, Tc-99, frill 1, and the like.
- the conjugates ofthe invention can be used for modifying a given biological response; the drag moiety is not to be construed as limited to classical chemical therapeutic agents.
- the drug moiety may be a protein or polypeptide possessing a desired biological activity.
- Such proteins may include, for example, a toxin such as abrin, ricin A, pseudomonas exotoxin, or diphtheria toxin; a protein such as tumor necrosis factor, interferon-alpha, interferon-beta, nerve growth factor, platelet derived growth factor, tissue plas inogen activator; or, biological response modifiers such as, for example, lymphokines, interleukin-1 ("IL-1”), interleukin-2 (“IL-2”), interleukin-6 (“E -6”), granulocyte macrophage colony stimulating factor (“GM-CSF”), granulocyte colony stimulating factor (“G-CSF”), or other growth factors.
- IL-1 interleukin-1
- IL-2 interleukin-2
- E -6 interleukin-6
- GM-CSF granulocyte macrophage colony stimulating factor
- G-CSF granulocyte colony stimulating factor
- Pinchera et al. pp. 475-506 Editrice Kurtis, Milano, Italy, 1985); "Analysis, Results, and Future Prospective ofthe Therapeutic Use of Radiolabeled Antibody in Cancer Therapy," in Monoclonal Antibodies for Cancer Detection and Therapy, ed. Baldwin et al. (Academic Press, New York, 1985), pp. 303-316; and Tho ⁇ e et al. (1982) Immunol. Rev. 62:119-158.
- an antibody can be conjugated to a second antibody to form an antibody heteroconjugate as described in U.S. Patent No. 4,676,980.
- linkers may be used between the labels and the antibodies ofthe invention (see U.S. Patent No.
- Antibodies or, antigen-binding fragments thereof may be directly labeled with radioactive iodine, indium, yttrium, or other radioactive particle known in the art (U.S. Patent No. 5,595,721). Treatment may consist of a combination of freatment with conjugated and nonconjugated antibodies administered simultaneously or subsequently (WO 00/52031 and WO 00/52473).
- Suitable biologically active variants ofthe antagonist anti-CD40 antibodies can be used in the methods ofthe present invention. Snch variants will retain the desired binding properties ofthe parent antagonist anti-CD40 antibody. Methods for making antibody variants are generally available in the art. For example, amino acid sequence variants of an antagonist anti-CD40 antibody, for example, the CHER-5.9 or CHIR-12.12 monoclonal antibody described herein, can be prepared by mutations in the cloned DNA sequence encoding the antibody of interest. Methods for mutagenesis and nucleotide sequence alterations are well known in the art. See, for example, Walker and Gaastra, eds.
- variants ofthe antagonist anti-CD40 antibody polypeptide of interest modifications are made such that variants continue to possess the desired activity, i.e., similar binding affinity and are capable of specifically binding to a human CD40 antigen expressed on the surface of a human cell, and being free of significant agonist activity but exhibiting antagonist activity when bound to a CD40 antigen on a human CD40-expressing cell.
- any mutations made in the DNA encoding the variant polypeptide must not place the sequence out of reading frame and preferably will not create complementary regions that could produce secondary mRNA structure. See EP Patent Application Publication No. 75,444.
- the constant region of an antagonist anti-CD40 antibody can be mutated to alter effector function in a number of ways.
- variants of a reference antagonist anti-CD40 antibody have amino acid sequences that have at least 70% or 75% sequence identity, preferably at least 80% or 85% sequence identity, more preferably at least 90%, 91%, 92%, 93%, 94% or 95% sequence identity to the amino acid sequence for the reference antagonist anti-CD40 antibody molecule, for example, the CHER.-5.9 or CHIR- 12.12 monoclonal antibody described herein, or to a shorter portion ofthe reference antibody molecule.
- the molecules share at least 96%, 97%, 98% or 99% sequence identity.
- percent sequence identity is determined using the Smith- Waterman homology search algorithm using an affine gap search with a gap open penalty of 12 and a gap extension penalty of 2, BLOSUM matrix of 62.
- the Smith- Waterman homology search algorithm is taught in Smith and Waterman (1981) Adv. Appl. Math. 2:482-489.
- a variant may, for example, differ from the reference antagonist anti-CD40 antibody by as few as 1 to 15 amino acid residues, as few as 1 to 10 amino acid residues, such as 6-10, as few as 5, as few as 4, 3, 2, or even 1 amino acid residue.
- the contiguous segment ofthe variant amino acid sequence may have additional amino acid residues or deleted amino acid residues with respect to the reference amino acid sequence.
- the contiguous segment used for comparison to the reference amino acid sequence will include at least 20 contiguous amino acid residues, and may be 30, 40, 50, or more amino acid residues. Co ⁇ ections for sequence identity associated with conservative residue substitutions or gaps can be made (see Smith- Waterman homology search algorithm).
- a particular polypeptide may be obtained as an acidic or basic salt, or in neutral form.
- AU such preparations that retain their biological activity when placed in suitable environmental conditions are included in the definition of antagonist anti-CD40 antibodies as used herein.
- the primary amino acid sequence ofthe polypeptide may be augmented by derivatization using sugar moieties (glycosylation) or by other supplementary molecules such as lipids, phosphate, acetyl groups and the like. It may also be augmented by conjugation with saccharides. Certain aspects of such augmentation are accomplished through post-franslational processing systems ofthe producing host; other such modifications may be introduced in vitro.
- modifications are included in the definition of an anti-CD40 antibody used herein so long as the antagonist properties ofthe anti-CD40 antibody are not destroyed. It is expected that such modifications may quantitatively or qualitatively affect the activity, either by enhancing or diminishing the activity ofthe polypeptide, in the various assays. Further, individual amino acid residues in the chain may be modified by oxidation, reduction, or other derivatization, and the polypeptide may be cleaved to obtain fragments that retain activity. Such alterations that do not destroy antagonist activity do not remove the polypeptide sequence from the definition of anti-CD40 antibodies of interest as used herein. The art provides substantial guidance regarding the preparation and use of polypeptide variants.
- anti-CD40 antibody variants In preparing the anti-CD40 antibody variants, one of skill in the art can readily determine which modifications to the native protein nucleotide or amino acid sequence will result in a variant that is suitable for use as a therapeutically active component of a pharmaceutical composition used in the methods ofthe present invention.
- Methods of Therapy Using the Antagonist Anti-CD40 Antibodies ofthe Invention are directed to the use of antagonist anti-CD40 antibodies to treat patients having a disease mediated by stimulation of CD40 signaling on CD40-expressing cells.
- CD40-expressing cell is intended no ⁇ nal and malignant B cells expressing CD40 antigen.
- Methods for detecting CD40 expression in cells are well known in the art and include, but are not limited to, PCR techniques, immunohistochemistry, flow cytometry, Western blot, ELISA, and the like.
- malignant B cell is intended any neoplastic B cell, including but not limited to B cells derived from lymphomas including low-, intermediate-, and high-grade B cell lymphomas, immunoblastic lymphomas, non-Hodgkin's lymphomas, Hodgkin's disease, Epstein-Ban Virus (EBV) induced lymphomas, and AIDS-related lymphomas, as well as B cell acute lymphoblastic leukemias, myelomas, chronic lymphocytic leukemias, acute myeloblastic leukemias, and the like.
- B cells derived from lymphomas including low-, intermediate-, and high-grade B cell lymphomas, immunoblastic lymphomas, non-Hodgkin's lymphomas, Hodgkin's disease, Epstein-Ban Virus (EBV) induced lymphomas, and AIDS-related lymphomas, as well as B cell acute lymphoblastic leukemias, myelomas, chronic lymphocytic leuk
- Treatment is herein defined as the application or adminisfration of an antagonist anti-CD40 antibody or antigen-binding fragment thereof to a patient, or application or administration of an antagonist anti-CD40 antibody or fragment thereof to an isolated tissue or cell line from a patient, where the patient has a disease, a symptom of a disease, or a predisposition toward a disease, where the purpose is to cure, heal, alleviate, relieve, alter, remedy, ameliorate, improve, or affect the disease, the symptoms ofthe disease, or the predisposition toward the disease.
- treatment is also intended the application or administration of a pharmaceutical composition comprising the antagonist anti-CD40 antibodies or fragments thereof to a patient, or application or administration of a pharmaceutical composition comprising the anti-CD40 antibodies or fragments thereof to an isolated tissue or cell line from a patient, who has a disease, a symptom of a disease, or a predisposition toward a disease, where the pu ⁇ ose is to cure, heal, alleviate, relieve, alter, remedy, ameliorate, improve, or affect the disease, the symptoms ofthe disease, or the predisposition toward the disease.
- anti-tumor activity is intended a reduction in the rate of malignant CD40- expressing cell proliferation or accumulation, and hence a decline in growth rate of an existing tumor or in a tumor that arises during therapy, and/or destruction of existing neoplastic (tumor) cells or newly formed neoplastic cells, and hence a decrease in the overall size of a tumor during therapy.
- Therapy with at least one anti-CD40 antibody (or antigen-binding fragment thereof) causes a physiological response that is beneficial with respect to treatment of disease states associated with stimulation of CD40 signaling on CD40-expressing cells in a human.
- the methods ofthe invention find use in the freatment of non-Hodgkin's lymphomas related to abnormal, uncontrollable B cell proliferation or accumulation.
- lymphomas will be refe ⁇ ed to according to the Working Formulation classification scheme, that is those B cell lymphomas categorized as low grade, intermediate grade, and high grade (see "The Non-Hodgkin's Lymphoma Pathologic Classification Project," Cancer 49(1982):2112-2135).
- low-grade B cell lymphomas include small lymphocytic, foUicular small-cleaved cell, and follicular mixed small-cleaved and large cell lymphomas; intermediate-grade lymphomas include follicular large cell, diffuse small cleaved cell, diffuse mixed small and large cell, and diffuse large cell lymphomas; and high-grade lymphomas include large cell immunoblastic, lymphoblastic, and small non-cleaved cell lymphomas ofthe Burkitt's and non-Burkitt's type. It is recognized that the methods ofthe invention are useful in the therapeutic freatment of B cell lymphomas that are classified according to the Revised European and American Lymphoma Classification (REAL) system.
- RTL Revised European and American Lymphoma Classification
- B cell lymphomas include, but are not limited to, lymphomas classified as precursor B cell neoplasms, such as B lymphoblastic leukemia/lymphoma; peripheral B cell neoplasms, including B cell chronic lymphocytic leukemia/small lymphocytic lymphoma, lymphoplasmacytoid lymphoma/immunocytoma, mantle cell lymphoma (MCL), follicle center lymphoma (follicular) (including diffuse small cell, diffuse mixed small and large cell, and diffuse large cell lymphomas), marginal zone B cell lymphoma (including exfranodal, nodal, and splenic types), hairy cell leukemia, plasmacytoma/ myeloma, diffuse large cell B cell lymphoma ofthe subtype primary mediastinal (thymic), Burkitt's lymphoma, and Burkitt's like high grade B cell lymphoma; acute leukemias; acute lymphocytic leuk
- the methods ofthe invention may be useful in preventing further tumor outgrowths arising during therapy.
- the methods ofthe invention are particularly useful in the freatment of subjects having low-grade B cell lymphomas, particularly those subjects having relapses following standard chemotherapy.
- Low-grade B cell lymphomas are more indolent than the intermediate- and high-grade B cell lymphoriias and are characterized by a relapsing/remitting course.
- treatment of these lymphomas is improved using the methods ofthe invention, as relapse episodes are reduced in number and severity.
- the antagonist anti-CD40 antibodies described herein may also find use in the treatment of inflammatory diseases and deficiencies or disorders ofthe immune system including, but not limited to, systemic lupus erythematosus, psoriasis, scleroderma, CREST syndrome, inflammatory myositis, Sjogren's syndrome, mixed connective tissue disease, rheumatoid arthritis, multiple sclerosis, inflammatory bowel disease, acute respiratory distress syndrome, pulmonary inflammation, idiopathic pulmonary fibrosis, osteoporosis, delayed type hypersensitivity, asthma, primary biliary ci ⁇ hosis, and idiopathic thrombocytopenic pu ⁇ ura.
- inflammatory diseases and deficiencies or disorders ofthe immune system including, but not limited to, systemic lupus erythematosus, psoriasis, scleroderma, CREST syndrome, inflammatory myositis, Sjogren's syndrome, mixed connective tissue disease, rheuma
- At least one antagonist anti-CD40 antibody (or antigen-binding fragment thereof) as defined elsewhere herein is used to promote a positive therapeutic response with respect to a malignant human B cell.
- positive therapeutic response with respect to cancer freatment is intended an improvement in the disease in association with the anti-tumor activity of these antibodies or fragments thereof, and/or an improvement in the symptoms associated with the disease. That is, an anti-proliferative effect, the prevention of further tumor outgrowths, a reduction in tumor size, a reduction in the number of cancer cells, and/or a decrease in one or more symptoms mediated by stimulation of CD40-expressing cells can be observed.
- an improvement in the disease may be characterized as a complete response.
- complete response is intended an absence of clinically detectable disease with normalization of any previously abnormal radiographic studies, bone manow, and cerebrospinal fluid (CSF). Such a response must persist for at least one month following treatment according to the methods ofthe invention. Alternatively, an improvement in the disease may be categorized as being a partial response.
- partial response is intended at least about a 50% decrease in all measurable tumor burden (i.e., the number of tumor cells present in the subject) in the absence of new lesions and persisting for at least one month. Such a response is applicable to measurable tumors only.
- Tumor response can be assessed for changes in tumor mo ⁇ hology (i.e., overall tumor burden, tumor size, and the like) using screening techniques such as magnetic resonance imaging (MRI) scan, x-radiographic imaging, computed tomographic (CT) scan, bioluminescent imaging, for example, luciferase imaging, bone scan imaging, and tumor biopsy sampling including bone manow aspiration (BMA).
- MRI magnetic resonance imaging
- CT computed tomographic
- BMA tumor biopsy sampling including bone manow aspiration
- the subject undergoing therapy with the antagonist anti- CD40 antibody or antigen-binding fragment thereof may experience the beneficial effect of an improvement in the symptoms associated with the disease.
- the subject may experience a decrease in the so-called B symptoms, i.e., night sweats, fever, weight loss, and/or urticaria.
- terapéuticaally effective dose or amount or “effective amount” is intended an amount of antagonist anti-CD40 antibody or antigen-binding frag ent thereof that, when administered brings about a positive therapeutic response with respect to freatment of a patient with a disease comprising stimulation of CD40-expressing cells.
- a therapeutically effective dose ofthe anti-CD40 antibody or fragment thereof is in the range from about 0.01 mg/kg to about 4O mg/kg, from about 0.01 mg kg to about 30 mg/kg, from about 0.1 mg/kg to about 30 mg/kg, from about 1 mg/kg to about 30 mg kg, from about 3 mg/kg to about 30 mg/kg, from about 3 mg/kg to about 25 mg/kg, from about 3 mg/kg to about 20 mg/kg, from about 5 mg/kg to about 15 mg/kg, or from about 7 mg/kg to about 12 mg/kg.
- the method of treatment may comprise a single administration of a therapeutically effective dose or multiple adminisfrations of a therapeutically effective dose of the antagonist anti-CD40 antibody or antigen-binding fragment thereof.
- a further embodiment ofthe invention is the use of antagonist anti-CD40 antibodies for diagnostic monitoring of protein levels in tissue as part of a clinical testing procedure, e.g., to determine the efficacy of a given freatment regimen. Detection can be facilitated by coupling the antibody to a detectable substance. Examples of detectable substances mclude various enzymes, prosthetic groups, fluorescent aterials, luminescent materials, bioluminescent materials, and radioactive materials.
- suitable enzymes include horseradish peroxidase, alkaline phosphatase, ⁇ -galactosidase, or acetylcholinesterase;
- suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin;
- suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin;
- an example of a luminescent material includes luminol;
- examples of bioluminescent materials include luciferase, luciferin, and aequorin;
- suitable radioactive material include 125 I, 131 I, 35 S, or 3 H.
- the anti-CD40 antibodies described herein can further be used to provide reagents, e.g., labeled antibodies that can be used, for example, to identify cells expressing CD40. This can be very useful in determining the cell type of an unknown sample. Panels of monoclonal antibodies can be used to identify tissue by species and/or by organ type. In a similar fashion, these anti-CD40 antibodies can be used to screen tissue culture cells for contamination (i.e., screen for the presence of a mixture of CD40- expressing and non-CD40 expressing cells in a culture).
- the antagonist anti-CD40 antibodies can be used in combination with known chemotherapeutics and cytokines for the treatment of disease states comprising stimulated CD40-expressing cells.
- the anti-CD40 antibodies ofthe invention can be used in combination with cytokines such as interleukin-2.
- the anti-CD40 antibodies ofthe invention can be used in combination with rituximab (EDEC-C2B8; Rituxan®; DDEC Pharmaceuticals Corp., San Diego, California).
- the antagonist anti-CD40 antibodies described herein, or antigen- binding fragments thereof are administered in combination with at least one other cancer therapy, including, but not limited to, surgery or surgical procedures (e.g.
- chemotherapeutic agents include, but are not limited to, fludarabine or fludarabine phosphate, chlorambucil, vincristine, pentostatin, 2- chlorodeoxyadenosine (cladribine), cyclophosphamide, doxorubicin, prednisone, and combinations thereof, for example, anthracycline-containing regimens such as CAP (cyclophosphamide, doxorubicin plus prednisone), CHOP (cyclophosphamide, vincristine, prednisone plus doxorubicin), VAD (vincritsine, doxorubicin, plus dexamethasone), MP (melphalan plus prednisone), and other cytotoxic and/or therapeutic agents used in chemotherapy such as
- the methods ofthe invention encompass coadminisfration, using separate formulations or a single pharmaceutical formulation, or and consecutive administration in either order.
- these therapies can be given simultaneously, i.e., the antagonist anti-CD40 antibody or antigen-binding fragment thereof is administered concunently or within the same time frame as the other cancer therapy (i.e., the therapies are going on concunently, but the antagonist anti-CD40 antibody or antigen-binding fragment thereof is not administered precisely at the same time as the other cancer therapy).
- the antagonist anti-CD40 antibody ofthe present invention or antigen-binding fragment thereof may also be administered prior to or subsequent to the other cancer therapy. Sequential administration ofthe different cancer therapies may be performed regardless of whether the treated subject responds to the first course of therapy to decrease the possibility of remission or relapse.
- the combined therapies comprise adminisfration ofthe antagonist anti-CD40 antibody or antigen-binding fragment thereof in combination with administration of a cytotoxic agent, preferably the antagonist anti-CD40 antibody or antigen-binding fragment thereof is administered prior to administering the cytotoxic agent.
- the antagonist anti-CD40 antibodies described herein, or antigen-binding fragments thereof are administered in combination with chemotherapy, and optionally in combination with autologous bone manow transplantation, wherein the antibody and the chemotherapeutic agent(s) may be administered sequentially, in either order, or simultaneously (i.e., concunently or within the same time frame).
- chemotherapeutic agents include, but are not limited to, fludarabine or fludarabine phosphate, chlorambucil, vincristine, pentostatin, 2- chlorodeoxyadenosine (cladribine), cyclophosphamide, doxorubicin, prednisone, and combinations thereof, for example, anthracycline-containing regimens such as CAP (cyclophosphamide, doxorubicin plus prednisone), CHOP (cyclophosphamide, vincristine, prednisone plus doxorubicin), VAD (vincritsine, doxorubicin, plus dexamethasone), MP (melphalan plus prednisone), and other cytotoxic and/or therapeutic agents used in chemotherapy such as mitoxanfrone, daunorabicin, idarabicin, asparaginase, and antimetabohtes, including, but not limited to, cytarabine,
- the antagonist anti-CD40 antibody for example, the monoclonal antibody CHIR-12.12 or CHER-5.9, or an antigen-binding fragment thereof is administered prior to treatment with the chemotherapeutic agent.
- the antagonist anti-CD40 antibody is administered after treatment with the chemotherapeutic agent, h yet other embodiments, the chemotherapeutic agent is administered simultaneously with the antagonist anti-CD40 antibody or antigen-binding fragment thereof.
- the antagonist anti-CD40 antibody for example, the monoclonal antibody CHIR-12.12 or CHER-5.9, or antigen-binding fragment thereof is administered in combination with fludarabine or fludarabine phosphate.
- the antagonist anti-CD40 antibody or antigen- binding fragment thereof is administered prior to adminisfration of fludarabine or fludarabine phosphate.
- the antagonist anti-CD40 antibody or antigen-binding fragment thereof is administered after freatment with fludarabine or fludarabine phosphate.
- the fludarabine or fludarabine phosphate is administered simultaneously with the antagonist anti-CD40 antibody or antigen-binding fragment thereof.
- chlorambucil, an alkylating drag is administered in combination with an antagonist anti-CD40 antibody described herein, for example, the monoclonal antibody CHIR-12.12 or CHER-5.9, or an antigen-binding fragment thereof.
- the antagonist anti-CD40 antibody or antigen-binding fragment thereof is admimstered prior to adminisfration of chlorambucil.
- the antagonist anti-CD40 antibody or antigen-binding fragment thereof is administered after freatment with chlorambucil.
- the chlorambucil is administered simultaneously with the antagonist anti- CD40 antibody or antigen-binding fragment thereof.
- anthracycline-containing regimens such as CAP
- an antagonist anti-CD40 antibody described herein for example, the monoclonal antibody CHIR-12.12 or CHER-5.9, or antigen-binding fragment thereof, h one such embodiment, the antagonist anti-CD40 antibody or antigen-binding fragment thereof is administered prior to administration of anthracycline-containing regimens. In other embodiments, the antagonist anti-CD40 antibody or antigen-binding fragment thereof is administered after treatment with anthracycline-containing regimens.
- the anthracycline-containing regimen is administered simultaneously with the antagonist anti-CD40 antibody or antigen-bindmg fragment thereof.
- an antagonist anti-CD40 antibody described herein for example, the monoclonal antibody CHIR-12.12 or CHER-5.9, or an antigen-binding fragment thereof, is administered in combination with alemtuzumab (Campath ® ; distributed by Berlex Laboratories, Richmond, California).
- Alemtuzumab is a recombinant humanized monoclonal antibody (Campath-IH) that targets the CD52 antigen expressed on malignant B cells.
- the antagonist anti- CD40 antibody or antigen-binding fragment thereof is administered prior to administration of alemtuzumab.
- the antagonist anti-CD40 antibody or antigen-binding fragment thereof is administered after freatment with alemtuzumab.
- the alemtuzumab is administered simultaneously with the antagonist anti-CD40 antibody or antigen-binding fragment thereof.
- an antagonist anti-CD40 antibody described herein for example, the monoclonal antibody CHIR-12.12 or CHIR-5.9, or antigen-binding fragment thereof, is administered in combination with a therapeutic anti-CD20 antibody targeting the CD20 antigen on malignant B cells, for example, rituximab (Rituxan ® ), the folly human antibody HuMax-CD20, R-1594, EV1MU-106, TRU-015, AME-133, tositumomab/I-131 tositumomab (Bexxar®), or ibritumomab tiuxetan (Zevalin®).
- the antagonist anti-CD40 antibody or antigen-binding fragment thereof is administered prior to administration ofthe anti-CD20 antibody, h other embodiments, the antagonist anti-CD40 antibody or antigen-binding fragment thereof is administered after freatment with the anti-CD20 antibody. In yet other embodiments, the anti-CD20 antibody is administered simultaneously with the antagonist anti-CD40 antibody or antigen-binding fragment thereof.
- an antagonist anti-CD40 antibody described herein for example, the monoclonal antibody CHIR-12.12 or CHIR-5.9, or antigen-binding fragment thereof, is administered in combination with a small molecule-based cancer therapy, including, but not limited to, microtubule and/or topoisomerase inhibitors (for example, the mitotic inhibitor dolastatin and dolastatin analogues; the tubulin-binding agent T900607; XLl 19; and the topoisomerase inhibitor aminocamptothecin), SDX-105 (bendamustine hydrochloride), ixabepilone (an epothilone analog, also refened to as BMS-247550), protein kinase C inhibitors, for example, midostaurin ((PKC-412, CGP 41251, N-benzoylstaurosporine), pixanfrone, eloxatin (an antineoplastic agent), ganite (gallium nitrate),
- the antagonist anti-CD40 antibody or antigen-binding fragment thereof is administered prior to adminisfration ofthe small molecule-based cancer therapy. In other embodiments, the antagonist anti-CD40 antibody or antigen-binding fragment thereof is administered after treatment with the small molecule-based cancer therapy. In yet other embodiments, the small molecule-based cancer therapy is administered simultaneously with the antagonist anti-CD40 antibody or antigen-binding fragment thereof.
- an antagonist anti-CD40 antibody described herein for example, the monoclonal antibody CHIR-12.12 or CHIR-5.9 or an antigen-binding fragment thereof, can be used in combination with vaccine/immunotherapy-based cancer therapy, including, but not limited to, vaccine approaches (for example, Id-KLH, oncophage, vitalethine), personalized immunotherapy or active idiotype immunotherapy (for example, MyVax ® Personalized Immunotherapy, formally designated GTOP-99), Promune® (CpG 7909, a synthetic agonist for toll-like receptor 9 (TLR9)), interferon- alpha therapy, interleukin-2 (IL-2) therapy, IL-12 therapy, IL-15 therapy, or IL-21 therapy; or steroid therapy.
- vaccine approaches for example, Id-KLH, oncophage, vitalethine
- personalized immunotherapy or active idiotype immunotherapy for example, MyVax ® Personalized Immunotherapy, formally designated GTOP-99
- the antagonist anti-CD40 antibody or antigen-binding fragment thereof is administered prior to adminisfration ofthe vaccine/immunotherapy-based cancer therapy.
- the antagonist anti-CD40 antibody or antigen-binding fragment thereof is admimstered after freatment with the vaccine/immunotherapy-based cancer therapy.
- the vaccine/immunotherapy-based cancer therapy is administered simultaneously with the antagonist anti-CD40 antibody or antigen-binding fragment thereof.
- an antagonist anti-CD40 antibody described herein, for example, the monoclonal antibody CHIR-12.12 or CHER-5.9, or an antigen-binding fragment thereof, can be used in combination with EL-2.
- EL-2 an agent known to expand the number of natural killer (NK) effector cells in treated patients, can be admimstered prior to, or concomitantly with, the antagonist anti-CD40 antibody ofthe invention or antigen-binding fragment thereof.
- This expanded number of NK effector cells may lead to enhanced ADCC activity ofthe administered antagonist anti-CD40 antibody or antigen-binding fragment thereof.
- IL-21 serves as the immunotherapeutic agent to stimulate NK cell activity when administered in combination with an antagonist anti-CD40 antibody described herein, for example, the monoclonal antibody CHIR-12.12 or CHIR-5.9, or an antigen-binding fragment thereof.
- combination therapy with two or more therapeutic agents and an antagonist anti-CD40 antibody described herein can also be used for treatment of a freatment of disease states comprising stimulated CD40-expressing cells, for example, B cell-related cancers, and autoimmune and/or inflammatory disorders.
- examples include triple combination therapy, where two chemotherapeutic agents are administered in combination with an antagonist anti-CD40 antibody described herein, and where a chemotherapeutic agent and another anti-cancer monoclonal antibody (for example, alemtuzumab, rituximab, or anti-CD23 antibody) are administered in combination with an antagonist anti-CD40 antibody described herein.
- combinations of fludarabine, cyclophosphamide, and the antagonist anti-CD40 antibody for example, the monoclonal antibody CHER-12.12 or CHER-5.9 or an antigen-binding fragment thereof; and combinations of fludarabine, an anti-CD20 antibody, for example, rituximab (Rituxan ® ; EDEC Pharmaceuticals Co ⁇ ., San Diego, California), and the antagonist anti-CD40 antibody, for example, the monoclonal antibody CHER-12.12 or CHIR-5.9 or an antigen- binding fragment thereof.
- the antagonist anti-CD40 antibodies of this invention are administered at a concentration that is therapeutically effective to prevent or freat CD40-expressing cell- mediated diseases such as SLE, PBC, ITP, multiple sclerosis, psoriasis, Crohn's disease, graft rejection, and B-cell lymphoma.
- the antibodies maybe formulated using a variety of acceptable excipients known in the art.
- the antibodies are admimstered by injection, either intravenously or intraperitoneally. Methods to accomplish this adminisfration are known to those of ordinary skill in the art.
- compositions which may be topically or orally administered, or which may be capable of transmission across mucous membranes Intravenous adminisfration occurs preferably by infusion over a period of about 1 to about 10 hours, more preferably over about 1 to about 8 hours, even more preferably over about 2 to about 7 hours, still more preferably over about 4 to about 6 hours, depending upon the anti-CD40 antibody being administered.
- the initial infusion with the pharmaceutical composition may be given over a period of about 4 to about 6 hours with subsequent infusions delivered more quickly.
- Subsequent infusions may be administered over a period of about 1 to about 6 hours, including, for example, about 1 to about 4 hours, about 1 to about 3 hours, or about 1 to about 2 hours.
- a pharmaceutical composition ofthe invention is formulated to be compatible with its intended route of adminisfration.
- routes of administration include parenteral, (e.g., intravenous ( V), intramuscular (IM), intradermal, subcutaneous (SC), or infusion), oral and pulmonary (e.g., inhalation), nasal, fransdermal (topical), transmucosal, and rectal administration.
- Solutions or suspensions used for parenteral, intradermal, or subcutaneous application can include the following components: a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerin, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetefraacetic acid; buffers such as acetates, mecanictes or phosphates and agents for the adjustment of tonicity such as sodium chloride or dextrose. pH can be adjusted with acids or bases, such as hydrochloric acid or sodium hydroxide.
- a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerin, propylene glycol or other synthetic solvents
- antibacterial agents such as benzyl alcohol or methyl parabens
- the parenteral preparation can be enclosed in ampoules, disposable syringes, or multiple dose vials made of glass or plastic.
- the anti-CD40 antibodies are typically provided by standard technique within a phannaceutically acceptable buffer, for example, sterile saline, sterile buffered water, propylene glycol, combinations ofthe foregoing, etc.
- Methods for preparing parenterally administrable agents are described in Remington 's Pharmaceutical Sciences (18 th ed.; Mack Publishing Company, Eaton, Pennsylvania, 1990), herein inco ⁇ orated by reference. See also, for example, WO 98/56418, which describes stabilized antibody pharmaceutical formulations suitable for use in the methods ofthe present invention.
- the amount of at least one anti-CD40 antibody or fragment thereof to be admimstered is readily determined by one of ordinary skill in the art without undue experimentation. Factors influencing the mode of adminisfration and the respective amount of at least one antagonist anti-CD40 antibody (or fragment thereof) include, but are not limited to, the the severity ofthe disease, the history ofthe disease, and the age, height, weight, health, and physical condition ofthe individual undergoing therapy. Similarly, the amount of antagonist anti-CD40 antibody or fragment thereof to be administered will be dependent upon the mode of administration and whether the subject will undergo a single dose or multiple doses of this anti-tumor agent. Generally, a higher dosage of anti-CD40 antibody or fragment thereof is prefened with increasing weight of the subject undergoing therapy.
- the dose of anti-CD40 antibody or fragment thereof to be administered is in the range from about 0.003 mg/kg to about 50 mg/kg, preferably in the range of 0.01 mg/kg to about 40 mg/kg.
- the dose can be 0.01 mg/kg, 0.03 mg/kg, 0.1 mg/kg, 0.3 mg/kg, 0.5 mg/kg, 1 mg/kg, 1.5 mg/kg, 2 mg/kg, 2.5 mg/kg, 3 mg/kg, 5 mg/kg, 7 mg/kg, 10 mg/kg, 15 mg/kg, 20 mg/kg, 25 mg/kg, 30 mg/kg, 35 mg/kg, 40 mg/kg, 45 mg/kg, or 50 mg kg.
- the method comprises adminisfration of multiple doses of antagonist anti-CD40 antibody or fragment thereof.
- the method may comprise adminisfration of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, or more therapeutically effective doses of a pharmaceutical composition comprising an antagonist anti-CD40 antibody or fragment thereof.
- the frequency and duration of administration of multiple doses ofthe pharmaceutical compositions comprising anti-CD40 antibody or fragment thereof can be readily determined by one of skill in the art without undue experimentation.
- treatment of a subject with a therapeutically effective amount of an antibody can include a single treatment or, preferably, can include a series of treatments.
- a subject is treated with antagonist anti-CD40 antibody or antigen-binding fragment thereof in the range of between about 0.1 to 20 mg/kg body weight, once per week for between about 1 to 10 weeks, preferably between about 2 to 8 weeks, more preferably between about 3 to 7 weeks, and even more preferably for about 4, 5, or 6 weeks. Treatment may occur annually to prevent relapse or upon indication of relapse. It will also be appreciated that the effective dosage of antibody or antigen-binding fragment thereof used for freatment may increase or decrease over the course of a particular freatment. Changes in dosage may result and become apparent from the results of diagnostic assays as described herein.
- the dosing regimen includes a first administration of a therapeutically effective dose of at least one anti-CD40 antibody or fragment thereof on days!, 7, 14, and 21 of a treatment period.
- the dosing regimen includes a first administration of a therapeutically effective dose of at least one anti- CD40 antibody or fragment thereof on days 1, 2, 3, 4, 5, 6, and 7 of a week in a treatment period.
- Treatment periods may be subsequent or separated from each other by a day, a week, 2 weeks, a month, 3 months, 6 months, or a year.
- the therapeutically effective doses of antagonist anti-CD40 antibody or antigen-binding fragment thereof ranges from about 0.003 mg/kg to about 50 mg/kg, from about 0.01 mg/kg to about 40 mg/kg, from about 0.01 mg/kg to about 30 mg/kg, from about 0.1 mg/kg to about 30 mg/kg, from about 0.5 mg/kg to about 30 mg/kg, from about 1 mg/kg to about 30 mg/kg, from about 3 mg/kg to about 30 mg/kg, from about 3 mg/kg to about 25 mg/kg, from about 3 mgkg to about 20 mg/kg, from about 5 mg/kg to about 15 mgkg, or from about 7 mg/kg to about 12 mg/kg.
- the dose of any one antagonist anti-CD40 antibody or antigen-binding fragment thereof can be 0.003 mg/kg, 0.01 mg/kg, 0.03 mg/kg, 0.1 mg/kg, 0.3 mg/kg, 0.5 mg/kg, 1 mg/kg, 1.5 mg/kg, 2 mg/kg, 2.5 mg/kg, 3 mg/kg, 5 mg/kg, 7 mg/kg, 10 mg/kg, 15 mg/kg, 20 mg/kg, 25 mg/kg, 30 mg/kg, 35 mg/kg, 40 mg/kg, 45 mg/kg, 50 mg/kg, or other such doses falling within the range of about 0.003 mg/kg to about 50 mg/kg.
- the same therapeutically effective dose of an antagonist anti- CD40 antibody or antigen-binding fragment thereof can be administered throughout each week of antibody dosing.
- different therapeutically effective doses of an antagonist anti-CD40 antibody or antigen-binding fragment thereof can be used over the course of a treatment period.
- the initial therapeutically effective dose of an antagonist anti-CD40 antibody or antigen-binding fragment thereof as defined elsewhere herein can be in the lower dosing range (i.e., about 0.003 mg/kg to about 20 mg/kg) with subsequent doses falling within the higher dosing range (i.e., from about 20 mg/kg to about 50 mg/kg).
- the initial therapeutically effective dose of an antagonist anti-CD40 antibody or antigen-binding fragment thereof as defined elsewhere herein can be in the upper dosing range (i.e., about 20 mg/kg to about 50 mg/kg) with subsequent doses falling within the lower dosing range (i.e., 0.003 mg/kg to about 20 mg/kg).
- the initial therapeutically effective dose ofthe antagonist anti-CD40 antibody or antigen-binding fragment thereof is about 20 mg/kg to about 35 mg/kg, including about 20 mg/kg, about 25 mg/kg, about 30 mg/kg, and about 35 mg/kg, and subsequent therapeutically effective doses ofthe antagonist anti-CD40 antibody or antigen binding fragment thereof are about 5 mgkg to about 15 mg/kg, including about 5 mg/kg, 8 mg/kg, 10 mg/kg, 12 mg/kg, and about 15 mg/kg.
- antagonist anti-CD40 antibody therapy is initiated by administering a "loading dose" ofthe antibody or antigen-binding fragment thereof to the subject in need of antagonist anti-CD40 antibody therapy.
- loading dose is intended an initial dose ofthe antagonist anti-CD40 antibody or antigen-binding fragment thereof that is administered to the subject, where the dose ofthe antibody or antigen-binding fragment thereof administered falls within the higher dosing range (i.e., from about 20 mg/kg to about 50 mg/kg).
- the "loading dose” can be administered as a single adminisfration, for example, a single infusion where the antibody or antigen- binding fragment thereof is administered IV, or as multiple administrations, for example, multiple infusions where the antibody or antigen-binding fragment thereof is administered IV, so long as the complete "loading dose" is administered within about a 24-hour period.
- the subject is then administered one or more additional therapeutically effective doses ofthe antagonist anti- CD40 antibody or antigen-binding fragment thereof.
- Subsequent therapeutically effective doses can be administered, for example, according to a weekly dosing schedule, or once every two weeks, once every three weeks, or once every four weeks. In such embodiments, the subsequent therapeutically effective doses generally fall within the lower dosing range (i.e., 0.003 mg/kg to about 20 mg/kg).
- the subsequent therapeutically effective doses ofthe antagonist anti-CD40 antibody or antigen-binding fragment thereof are administered according to a "maintenance schedule," wherein the therapeutically effective dose ofthe antibody or antigen-binding fragment thereof is administered once a month, once every 6 weeks, once every two months, once every 10 weeks, once every three months, once every 14 weeks, once every four months, once every 18 weeks, once every five months, once every 22 weeks, once every six months, once every 7 months, once every 8 months, once every 9 months, once every 10 months, once every 11 months, or once every 12 months:
- the therapeutically effective doses ofthe antagonist anti-CD40 antibody or antigen- binding fragment thereof fall within the lower dosing range (i.e., 0.003 mg/kg to about 20 mg/kg), particularly when the subsequent doses are administered at more frequent intervals, for example, once every two weeks to once every month, or within the higher dosing range (i.e., from about 20 mg/
- the antagonist anti-CD40 antibodies present in the pharmaceutical compositions described herein for use in the methods ofthe invention may be native or obtained by recombinant techniques, and may be from any source, including mammalian sources such as, e.g., mouse, rat, rabbit, primate, pig, and human.
- mammalian sources such as, e.g., mouse, rat, rabbit, primate, pig, and human.
- polypeptides are derived from a human source, and more preferably are recombinant, human proteins from hybridoma cell lines.
- the pharmaceutical compositions useful in the methods of the invention may comprise biologically active variants ofthe antagonist anti-CD40 antibodies ofthe invention.
- variants should retain the desired biological activity ofthe native polypeptide such that the pharmaceutical composition comprising the variant polypeptide has the same therapeutic effect as the pharmaceutical composition comprising the native polypeptide when administered to a subject. That is, the variant anti-CD40 antibody will serve as a therapeutically active component in the pharmaceutical composition in a manner similar to that observed for the native antagonist antibody, for example CHIR-5.9 or CHER- 12.12 as expressed by the hybridoma cell line 5.9 or 12.12, respectively. Methods are available in the art for determining whether a variant anti-CD40 antibody retains the desired biological activity, and hence serves as a therapeutically active component in the pharmaceutical composition.
- Biological activity of antibody variants can be measured using assays specifically designed for measuring activity ofthe native antagonist antibody, including assays described in the present invention.
- Any pharmaceutical composition comprising an antagonist anti-CD40 antibody having the binding properties described herein as the therapeutically active component can be used in the methods ofthe invention.
- liquid, lyophihzed, or spray-dried compositions comprising one or more ofthe antagonist anti-CD40 antibodies ofthe invention may be prepared as an aqueous or nonaqueous solution or suspension for subsequent administration to a subject in accordance with the methods ofthe invention.
- Each of these compositions will comprise at least one ofthe antagonist anti-CD40 antibodies ofthe present invention as a therapeutically or prophylactically active component.
- the anti-CD40 antibody is specifically inco ⁇ orated into the composition to bring about a desired therapeutic or prophylactic response with regard to freatment, prevention, or diagnosis of a disease or condition within a subject when the pharmaceutical composition is administered to that subject.
- the pharmaceutical compositions comprise appropriate stabilizing agents, bulking agents, or both to minimize problems associated with loss of protein stability and biological activity during preparation and storage.
- Formulants may be added to pharmaceutical compositions comprising an antagonist anti-CD40 antibody ofthe invention. These formulants may include, but are not limited to, oils, polymers, vitamins, carbohydrates, amine acids, salts, buffers, albumin, surfactants, or bulking agents.
- carbohydrates include sugar or sugar alcohols such as mono-, di-, or polysaccharides, or water soluble glucans.
- the saccharides or glucans can include fructose, glucose, mannose, sorbose, xylose, maltose, sucrose, dextran, pullulan, dextrin, a and ⁇ cyclodextrin, soluble starch, hydroxyethyl starch, and carboxymethylcellulose, or mixtures thereof.
- “Sugar alcohol” is defined as a C 4 to C 8 hydrocarbon having a hydroxyl group and includes galactitol, inositol, mannitol, xylitol, sorbitol, glycerol, and arabitol. These sugars or sugar alcohols may be used individually or in combination.
- the sugar or sugar alcohol concentration is between 1.0% and 7% w/v., more preferably between 2.0% and 6.0% w/v.
- amino acids include levorotary (L) forms of carnitine, arginine, and betaine; however, other amino acids may be added.
- Prefened polymers include polyvinylpyrrolidone (PVP) with an average molecular weight between 2,000 and 3,000, or polyethylene glycol (PEG) with an average molecular weight between 3,000 and 5,000.
- PVP polyvinylpyrrolidone
- PEG polyethylene glycol
- Surfactants that can be added to the formulation are shown in EP Nos. 270,799 and 268,110.
- antibodies can be chemically modified by covalent conjugation to a polymer to increase their circulating half-life, for example.
- Prefened polymers, and methods to attach them to peptides are shown in U.S. Patent Nos. 4,766,106; 4,179,337; 4,495,285; and 4,609,546; which are all hereby inco ⁇ orated by reference in their entireties.
- Prefened polymers are polyoxyethylated polyols and polyethylene glycol (PEG).
- PEG is soluble in water at room temperature and has the general formula: R(O ⁇ CH 2 — CH 2 ) n O— R where R can be hydrogen, or a protective group such as an alkyl or alkanol group.
- the protective group has between 1 and 8 carbons, more preferably it is methyl.
- n is a positive integer, preferably between 1 and 1,000, more preferably between 2 and 500.
- the PEG has a prefened average molecular weight between 1,000 and 40,000, more preferably between 2,000 and 20,000, most preferably between 3,000 and 12,000.
- PEG has at least one hydroxy group, more preferably it is a terminal hydroxy group. It is this hydroxy group which is preferably activated to react with a free amino group on the inhibitor.
- the type and amount ofthe reactive groups may be varied to achieve a covalently conjugated PEG/antibody ofthe present invention.
- Water-soluble polyoxyethylated polyols are also useful in the present invention.
- POG polyoxyethylated sorbitol
- polyoxyethylated glucose polyoxyethylated glycerol
- POG polyoxyethylated glycerol
- the antagonist anti-CD40 antibody or antigen-binding fragment thereof should retain its physical and/or chemical stability and have the desired biological activity, i.e., one or more ofthe antagonist activities defined herein above, including, but not limited to, inhibition of immunoglobulin secretion by normal human peripheral B cells stimulated by T cells; inhibition of survival and/or proliferation of normal human peripheral B cells stimulated by Jurkat T cells; inhibition of survival and/or proliferation of normal human peripheral B cells stimulated by CD40L-expressing cells or soluble CD40 ligand (sCD40L); inhibition of "survival" anti-apoptotic intracellular signals in any cell stimulated by sCD40L or solid-phase CD40L; inhibition of CD40 signal fransduction in any cell upon ligation with sCD40L or solid-phase CD40L; and inhibition of proliferation of human malignant B cells as noted elsewhere herein.
- the antagonist activities defined herein above including, but not limited to, inhibition of immunoglobulin secretion by normal human peripheral B cells stimulated by T cells; inhibition of
- a stable antibody pharmaceutical formulation provides for stability ofthe antagonist anti-CD40 antibody or antigen-binding fragment thereof when stored at room temperature (about 25°C) for at least 1 month, at least 3 months, or at least 6 months, and or is stable at about 2-8°C for at least 6 months, at least 9 months, at least 12 months, at least 18 months, at least 24 months.
- a protein such as an antibody when formulated in a pharmaceutical composition, is considered to retain its physical stability at a given point in time if it shows no visual signs (i.e., discoloration or loss of clarity) or measurable signs (for example, using size- exclusion chromatography (SEC) or UV light scattering) of precipitation, aggregation, and/or denaturation in that pharmaceutical composition.
- SEC size- exclusion chromatography
- UV light scattering for example, using size- exclusion chromatography (SEC) or UV light scattering
- a protein such as an antibody when formulated in a pharmaceutical composition, is considered to retain its chemical stability at a given point in time if measurements of chemical stability are indicative that the protein (i.e., antibody) retains the biological activity of interest in that pharmaceutical composition.
- Methods for monitoring changes in chemical stability include, but are not limited to, methods to detect chemically altered forms ofthe protein such as result from clipping, using, for example, SDS-PAGE, SEC, and/or matrix-assisted laser deso ⁇ tion ionization/time of flight mass spectrometry; and degradation associated with changes in molecular charge (for example, associated with deamidation), using, for example, ion-exchange chromatography. See, for example, the methods disclosed herein below.
- An antagonist anti-CD40 antibody or antigen-binding fragment thereof when formulated in a pharmaceutical composition, is considered to retain a desired biological activity at a given point in time if the desired biological activity at that time is within about 30%), preferably within about 20% ofthe desired biological activity exhibited at the time the pharmaceutical composition was prepared as determined in a suitable assay for the desired biological activity.
- Assays for measuring the desired biological activity ofthe antagonist anti-CD40 antibodies disclosed herein, and antigen-binding fragments thereof can be performed as described in the Examples herein. See also the assays described in Schultze et al. (1998) Proc. Natl. Acad. Sci. USA 92:8200-8204; Denton et al (1998) Pediatr. Transplant.
- the antagonist anti-CD40 antibody for example, the CHIR-12.12 or CHIR-5.9 monoclonal antibody, or antigen-binding fragment thereof is fonnulated in a liquid pharmaceutical formulation.
- the antagonist anti-CD40 antibody or antigen binding fragment thereof can be prepared using any method known in the art, including those methods disclosed herein above.
- the antagonist anti-CD40 antibody for example, the CHIR-12.12 or CHIR- 5.9 monoclonal antibody, or antigen-binding fragment thereof is recombinantly produced in a CHO cell line. Following its preparation and purification, the antagonist anti-CD40 antibody or antigen-binding fragment thereof can be formulated as a liquid pharmaceutical formulation in the manner set forth herein.
- the antagonist anti-CD40 antibody or antigen-binding fragment thereof is to be stored prior to its formulation, it can be frozen, ro example, at ⁇ -20°C, and then thawed at room temperature for further formulation.
- the liquid pharmaceutical formulation comprises a therapeutically effective amount of the antagonist anti-CD40 antibody or antigen-binding fragment thereof.
- the amount of antibody or antigen-binding fragment thereof present in the formulation takes into consideration the route of administration and desired dose volume.
- the liquid pharmaceutical composition comprises the antagonist anti-CD40 antibody, for example, the CHIR-12.12 or CHER-5.9 antibody, or antigen- binding fragment thereof at a concenfration of about 0.1 mg/ml to about 50.0 mg/ml, about 0.5 mg/ml to about 40.0 mg/ml, about 1.0 mg/ml to about 30.0 mg/ml, about 5.0 mg/ml to about 25.0 mg/ml, about 5.0 mg/ml to about 20.0 mg/ml, or about 15.0 mg/ml to about 25.0 mg/ml.
- the antagonist anti-CD40 antibody for example, the CHIR-12.12 or CHER-5.9 antibody, or antigen- binding fragment thereof at a concenfration of about 0.1 mg/ml to about 50.0 mg/ml, about 0.5 mg/ml to about 40.0 mg/ml, about 1.0 mg/ml to about 30.0 mg/ml, about 5.0 mg/ml to about 25.0 mg/ml, about 5.0 mg/
- the liquid pharmaceutical composition comprises the antagonist anti-CD40 antibody or antigen-binding fragment thereof at a concentration of about 0.1 mg/ml to about 5.0 mg/ml, about 5.0 mg/ml to about 10.0 mg/ml, about 10.0 mg/ml to about 15.0 mg/ml, about 15.0 mg/ml to about 20.0 mg/ml, about 20.0 mg/ml to about 25.0 mg/ml, about 25.0 mg/ml to about 30.0 mg/ml, about 30.0 mg/ml to about 35.0 mg/ml, about 35.0 mg/ml to about 40.0 mg/ml, about 40.0 mg/ml to about 45.0 mg/ml, or about 45.0 mg/ml to about 50.0 mg/ml.
- the liquid pharmaceutical composition comprises the antagonist anti-CD40 antibody or antigen-binding fragment thereof at a concenfration of about 15.0 mg/ml, about 16.0 mg/ml, about 17.0 mg/ml, about 18.0 mg/ml, about 19.0 mg/ml, about 20.0 mg/ml, about 21.0 mg/ml, about 22.0 mg/ml, about 23.0 mg/ml, about 24.0 mg/ml, or about 25.0 mg/ml.
- the liquid pharmaceutical composition comprises the antagonist anti-CD40 antibody, for example, the CHIR-12.12 or CHIR-5.9 antibody, or antigen- binding fragment thereof and a buffer that maintains the pH of the formulation in the range of about pH 5.0 to about pH 7.0, including about pH 5.0, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8, 5.9, 6.0, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, 7.0, and other such values within the range of about pH 5.0 to about pH 7.0.
- a buffer that maintains the pH of the formulation in the range of about pH 5.0 to about pH 7.0, including about pH 5.0, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8, 5.9, 6.0, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, 7.0, and other such values within the range of about pH 5.0 to about pH 7.0.
- the buffer maintains the pH ofthe formulation in the range of about pH 5.0 to about pH 6.5, about pH 5.0 to about pH 6.0, about pH 5.0 to about pH 5.5, about pH 5.5 to about 7.0, about pH 5.5 to about pH 6.5, or about pH 5.5 to about pH 6.0.
- Any suitable buffer that maintains the pH ofthe liquid anti-CD40 antibody formulation in the range of about pH 5.0 to about pH 7.0 can be used in the formulation, so long as the physicochemical stability and desired biological activity ofthe antibody are retained as noted herein above.
- Suitable buffers include, but are not limited to, conventional acids and salts thereof, where the counter ion can be, for example, sodium, potassium, ammonium, calcium, or magnesium.
- Examples of conventional acids and salts thereof that can be used to buffer the pharmaceutical liquid formulation include, but are not limited to, succinic acid or succinate, citric acid or citrate, acetic acid or acetate, tartaric acid or tartarate, phosphoric acid or phosphate, gluconic acid or gluconate, glutamic acid or glutamate, aspartic acid or aspartate, maleic acid or maleate, and malic acid or malate buffers.
- the buffer concentration within the formulation can be from about 1 mM to about 50 mM, including about 1 mM, 2 mM, 5 mM, 8 mM, 10 mM, 15 mM, 20 mM, 25 mM, 30 mM, 35 mM, 40 mM, 45 mM, 50 mM, or other such values within the range of about 1 mM to about 50 mM.
- the buffer concentration within the formulation is from about 5 mM to about 15 mM, including about 5 mM, 6 mM, 7 mM, 8 mM, 9 mM, 10 mM, 11 mM, 12 mM, 13 mM, 14 mM, 15 mM, or other such values within the range of about 5 mM to about 15 mM.
- the liquid pharmaceutical formulation comprises a therapeutically effective amount ofthe antagonist anti-CD40 antibody, for example, the CHIR-12.12 or CHIR-5.9 monoclonal antibody, or antigen-binding fragment thereof and succinate buffer or turite buffer at a concenfration that maintains the pH ofthe formulation in the range of about pH 5.0 to about pH 7.0, preferably about pH 5.0 to about pH 6.5.
- succinate buffer or "citrate buffer” is intended a buffer comprising a salt of succinic acid or a salt of citric acid, respectively.
- the succinate or citrate counterion is the sodium cation, and thus the buffer is sodium succinate or sodium turite, respectively.
- succinate or citrate buffer concenfration within the formulation can be from about 1 mM to about 50 mM, including about 1 M, 2 mM, 5 mM, 8 mM, 10 mM, 15 mM, 20 mM, 25 mM, 30 mM, 35 mM, 40 mM, 45 mM, 50 mM, or other such values within the range of about 1 mM to about 50 mM.
- the buffer concentration within the formulation is from about 5 mM to about 15 mM, including about 5 mM, 6 mM, 7 mM, 8 mM, 9 mM, 10 mM, 11 mM, 12 mM, 13 mM, 14 mM, or about 15 mM.
- the liquid pharmaceutical formulation comprises the antagonist anti-CD40 antibody, for example, the CHER-12.12 or CHER-5.9 monoclonal antibody, or antigen- binding fragment thereof at a concenfration of about 0.1 mg/ml to about 50.0 mg/ml, or about 5.0 mg/ml to about 25.0 mg/ml, and succinate or mecanicte buffer, for example, sodium succinate or sodium mecanicte buffer, at a concenfration of about 1 mM to about 20 mM, about 5 mM to about 15 mM, preferably about 10 mM.
- the antagonist anti-CD40 antibody for example, the CHER-12.12 or CHER-5.9 monoclonal antibody, or antigen- binding fragment thereof at a concenfration of about 0.1 mg/ml to about 50.0 mg/ml, or about 5.0 mg/ml to about 25.0 mg/ml
- succinate or latinte buffer for example, sodium succinate or sodium gulte buffer
- the liquid pharmaceutical formulation comprising a therapeutically effective amount of the antagonist anti-CD40 antibody, for example, the CHIR-12.12 or CHIR-5.9 monoclonal antibody, or antigen-binding fragment thereof, and a buffer to maintain the pH of the formulation within the range of about pH 5.0 to about pH 7.0 can further comprise an amount of an isotonizing agent sufficient to render the formulation near isotonic.
- the antagonist anti-CD40 antibody for example, the CHIR-12.12 or CHIR-5.9 monoclonal antibody, or antigen-binding fragment thereof
- a buffer to maintain the pH of the formulation within the range of about pH 5.0 to about pH 7.0 can further comprise an amount of an isotonizing agent sufficient to render the formulation near isotonic.
- the aqueous formulation has an osmolarity of about 240 mmol/kg to about 360 mmol/kg, preferably about 240 to about 340 mmol/kg, more preferably about 250 to about 330 mmol/kg, even more preferably about 260 to about 320 mmol/kg, still more preferably about 270 to about 310 mmol/kg.
- Methods of deterinining the isotonicity of a solution are known to those skilled in the art. See, for example, Setnikar et al. (1959) J. Am. Pharm. Assoc. 48:628.
- the isotonizing agent can be any reagent capable of adjusting the osmotic pressure ofthe liquid pharmaceutical formulation of the present invention to a value nearly equal to that of a body fluid. It is desirable to use a physiologically acceptable isotonizing agent.
- the liquid pharmaceutical formulation comprising a therapeutically effective amount ofthe antagonist anti-CD40 antibody, for example, the CHER-12.12 or CHER-5.9 monoclonal antibody, or antigen-binding fragment thereof, and a buffer to maintain the pH ofthe formulation within the range of about pH 5.0 to about pH 7.0, can further comprise components that can be used to provide isotonicity, for example, sodium chloride; amino acids such as alanine, valine, and glycine; sugars and sugar alcohols (polyols), including, but not limited to, glucose, dextrose, fructose, sucrose, maltose, mannitol, trehalose, glycerol, sorbitol, and xylitol; acetic acid, other organic acids or their salts, and relatively minor amounts of citrates or phosphates.
- the antagonist anti-CD40 antibody for example, the CHER-12.12 or CHER-5.9 monoclonal antibody, or antigen-binding fragment thereof,
- the liquid pharmaceutical formulation comprising a therapeutically effective amount ofthe antagonist anti-CD40 antibody, for example, the CHIR-12.12 or CHER-5.9 monoclonal antibody, or antigen-binding fragment thereof, and a buffer to maintain the pH ofthe formulation within the range of about pH 5.0 to about pH 7.0, further comprises sodium chloride as the isotonizing agent.
- concentration of sodium chloride in the formulation will depend upon the contribution of other components to tonicity.
- the concentration of sodium chloride is about 50 mM to about 300 mM, about 50 mM to about 250 mM, about 50 mM to about 200 mM, about 50 mM to about 175 mM, about 50 mM to about 150 mM, about 75 mM to about 175 mM, about 75 mM to about 150 mM, about 100 mM to about 175 mM, about 100 mM to about 200 mM, about 100 mM to about 150 mM, about 125 mM to about 175 mM, about 125 mM to about 150 mM, about 130 mM to about 170 mM, about 130 mM to about 160 mM, about 135 mM to about 155 mM, about 140 mM to about 155 mM, or about 145 mM to about 155 mM.
- the concentration of sodium chloride is about 150 mM. In other such embodiments, the concentration of sodium chloride is about 150 mM, the buffer is sodium succinate or sodium turite buffer at a concenfration of about 5 mM to about 15 mM, the liquid pharmaceutical formulation comprises a therapeutically effective amount ofthe antagonist anti-CD40 antibody, for example, the CHIR-12.12 or CHER-5.9 monoclonal antibody, or antigen-binding fragment thereof, and the formulation has a pH of about pH 5.0 to about pH 7.0, about pH 5.0 to about pH 6.0, or about pH 5.5 to about pH 6.5.
- the liquid pharmaceutical formulation comprises the antagonist anti- CD40 antibody, for example, the CHER-12.12 or CHER-5.9 monoclonal antibody, or antigen-binding fragment thereof, at a concentration of about 0.1 mg/ml to about 50.0 mg/ml or about 5.0 mg/ml to about 25.0 mg/ml, about 150 mM sodium chloride, and about 10 mM sodium succinate or sodium citrate, at a pH of about pH 5.5.
- Protein degradation due to freeze thawing or mechanical shearing during processing of a liquid pharmaceutical formulations ofthe present invention can be inhibited by inco ⁇ oration of surfactants into the formulation in order to lower the surface tension at the solution-air interface.
- the liquid pharmaceutical formulation comprises a therapeutically effective amount ofthe antagonist anti-CD40 antibody, for example, the CHER-12.12 or CHIR-5.9 monoclonal antibody, or antigen-binding fragment thereof, a buffer to maintain the pH ofthe formulation within the range of about pH 5.0 to about pH 7.0, and further comprises a surfactant
- the liquid pharmaceutical formulation comprises a therapeutically effective amount ofthe antagonist anti-CD40 antibody, for example, the CHER-12.12 or CHER-5.9 monoclonal antibody, or antigen-binding fragment thereof, a buffer to maintain the pH ofthe formulation within the range of about pH 5.0 to about pH 7.0, an isotonizing agent such as sodium chloride at a concentration of about 50 mM to about 300 mM, and further comprises a surfactant.
- Typical surfactants employed are nonionic surfactants, including polyoxyethylene sorbitol esters such as polysorbate 80 (Tween 80) and polysorbate 20 (Tween 20); polyoxypropylene-polyoxyethylene esters such as Pluronic F68; polyoxyethylene alcohols such as Brij 35; simethicone; polyethylene glycol such as PEG400; lysophosphatidylcholine; and polyoxyethylene-p-t-octylphenol such as Triton X-100.
- Classic stabilization of pharmaceuticals by surfactants or emulsifiers is described, for example, in Levine et al. (1991) J. Parenteral Sci. Technol.
- a prefened surfactant employed in the practice ofthe present invention is polysorbate 80. Where a surfactant is included, it is typically added in an amount from about 0.001 % to about 1.0% (w/v), about 0.001% to about 0.5%, about 0.001% to about 0.4%, about 0.001% to about 0.3%, about 0.001% to about 0.2%, about 0.005% to about 0.5%, about 0.005% to about 0.2%, about 0.01% to about 0.5%, about 0.01% to about 0.2%, about 0.03% to about 0.5%>, about 0.03% to about 0.3%, about 0.05% to about 0.5%, or about 0.05% to about 0.2%.
- the liquid pharmaceutical formulation comprises a therapeutically effective amount ofthe antagonist anti-CD40 antibody, for example, the CHER-12.12 or CHER-5.9 monoclonal antibody, or antigen-binding fragment thereof
- the buffer is sodium succinate or sodium citrate buffer at a concentration of about 1 mM to about 50 mM, about 5 mM to about 25 mM, or about 5 mM to about 15 mM
- the fomiulation has a pH of about pH 5.0 to about pH 7.0, about pH 5.0 to about pH 6.0, or about pH 5.5 to about pH 6.5
- the formulation fiirther comprises a surfactant, for example, polysorbate 80, in an amount from about 0.001% to about 1.0% or about 0.001%) to about 0.5%.
- Such formulations can optionally comprise an isotonizing agent, such as sodium chloride at a concenfration of about 50 mM to about 300 mM, about 50 mM to about 200 mM, or about 50 mM to about 150 mM.
- an isotonizing agent such as sodium chloride at a concenfration of about 50 mM to about 300 mM, about 50 mM to about 200 mM, or about 50 mM to about 150 mM.
- the liquid pharmaceutical formulation comprises the antagonist anti-CD40 antibody, for example, the CHIR- 12.12 or CHER-5.9 monoclonal antibody, or antigen-binding fragment thereof, at a concentration of about 0.1 mg/ml to about 50.0 mg/ml or about 5.0 mg/ml to about 25.0 mg/ml, including about 20.0 mg/ml; about 50 mM to about 200 mM sodium chloride, includmg about 150 mM sodium chloride; sodium succinate or sodium mecanicte at about 5 mM to about 20 mM, including about 10 mM sodium succinate or sodium citrate; sodium chloride at a concenfration of about 50 mM to about 200 mM, including about 150 mM; and optionally a surfactant, for example, polysorbate 80, in an amount from about 0.001%o to about 1.0%, including about 0.001% to about 0.5%; where the liquid pharmaceutical formulation has a pH of about pH 5.0 to about pH 7.0, about pH 5.0 to
- the liquid pharmaceutical formulation can be essentially free of any preservatives and other carriers, excipients, or stabilizers noted herein above.
- the formulation can include one or more preservatives, for example, antibacterial agents, pharmaceutically acceptable carriers, excipients, or stabilizers described herein above provided they do not adversely affect the physicochemical stability ofthe antagonist anti- CD40 antibody or antigen-binding fragment thereof.
- acceptable carriers, excipients, and stabilizers include, but are not limited to, additional buffering agents, co- solvents, surfactants, antioxidants including ascorbic acid and methionine, chelating agents such as EDTA, metal complexes (for example, Zn-protein complexes), and biodegradable polymers such as polyesters.
- liquid pharmaceutical fomiulation or other pharmaceutical composition described herein can be lyophihzed to prevent degradation.
- Methods for lyophilizing liquid compositions are known to those of ordinary skill in the art.
- the composition may be reconstituted with a sterile diluent (Ringer's solution, distilled water, or sterile saline, for example) that may include additional ingredients.
- the composition is preferably administered to subjects using those methods that are known to those skilled in the art.
- the present invention also provides for the use of an antagonist anti-CD40 antibody or antigen-binding fragment thereof in the manufacture of a medicament for treating a subject for a cancer characterized by neoplastic B cell growth, wherein the medicament is coordinated with freatment with at least one other cancer therapy.
- Cancers characterized by neoplastic B cell growth include, but are not limited to, the B cell- related cancers discussed herein above, for example, non-Hodgkin's lymphoma, chronic lymphocytic leukemia, multiple myeloma, B cell lymphoma, high-grade B cell lymphoma, intermediate-grade B cell lymphoma, low-grade B cell lymphoma, B cell acute lympohoblastic leukemia, myeloblastic leukemia, Hodgkin's disease, plasmacytoma, follicular lymphoma, follicular small cleaved lymphoma, follicular large cell lymphoma, follicular mixed small cleaved lymphoma, diffuse small cleaved cell lymphoma, diffuse small lymphocytic lymphoma, prolymphocytic leukemia, lymphoplasmacytic lymphoma, marginal zone lymphoma, mucosal associated lymphoid tissue
- the medicament comprising the antagonist anti- CD40 antibody or antigen-binding fragment thereof is to be used either prior to, during, or after treatment ofthe subject with at least one other cancer therapy.
- suitable chemotherapeutic agents include, but are not limited to, fludarabine or fludarabine phosphate, chlorambucil, vincristine, pentostatin, 2-chlorodeoxyadenosine (cladribine), cyclophosphamide, doxorubicin, prednisone, and combinations thereof, for example, anthracycline-containing regimens such as CAP (cyclophosphamide, doxorubicin plus • prednisone), CHOP (cyclophosphamide, vincristine, prednisone plus doxorubicin), VAD (vincritsine, doxorubic
- CAP cyclophosphamide, doxorubicin plus • prednisone
- CHOP cyclophosphamide, vin
- the present invention provides for the use ofthe anti-CD40 antibody, for example, the monoclonal antibody CHIR-12.12 or CHER-5.9, or antigen- binding fragment thereof in the manufacture of a medicament for treating a B cell lymphoma, for example non-Hodgkin's lymphoma, in a subject, wherein the medicament is coordinated with freatment with at least one other cancer therapy selected from the group consisting of chemotherapy, anti-cancer antibody therapy, small molecule-based cancer therapy, and vaccine/immunotherapy-based cancer therapy, wherein the medicament is to be used either prior to, during, or after freatment ofthe subject with the other cancer therapy or, in the case of multiple combination therapies, either prior to, during, or after treatment of the subj ect with the other cancer therapies.
- the anti-CD40 antibody for example, the monoclonal antibody CHIR-12.12 or CHER-5.9, or antigen- binding fragment thereof in the manufacture of a medicament for treating a B cell lymphoma, for example non-Ho
- the invention provides for the use of the monoclonal antibody CHIR-12.12 or CHER-5.9, or antigen-binding fragment thereof, in the manufacture of a medicament for treating a B cell lymphoma, for example, non- Hodgkin's lymphoma, in a subject, wherein the medicament is coordinated with freatment with chemotherapy, where the chemotherapeutic agent is selected from the group consisting of cytoxan, doxorubicin, vincristine, prednisone, and combinations thereof, for example CHOP.
- the invention provides for the use of the monoclonal antibody CHER-12.12 or CHER-5.9, or antigen-binding fragment thereof, in the manufacture of a medicament for treating a B cell lymphoma, for example non- Hodgkin's lymphoma, in a subject, wherein the medicament is coordinated with freatment with at least one other anti-cancer antibody selected from the group consisting of alemtuzumab (Campath ® ) or other anti-CD52 antibody targeting the CD52 cell-surface glycoprotein on malignant B cells; rituximab (Rituxan ), the folly human antibody HuMax-CD20, R-1594, EMMU-106, TRU-015, AME-133, tositumomab/I-131 tositumomab (Bexxar®), ibritumomab tiuxetan (Zevalin®), or any other therapeutic anti- CD20 antibody targeting the CD20 antigen on malignant B cells;
- the present invention provides for the use ofthe monoclonal antibody CHIR-12.12 or CHIR-5.9, or antigen-binding fragment thereof, in the manufacture of a medicament for treating a B cell lymphoma, for example non- Hodgkin's lymphoma, in a subject, wherein the medicament is coordinated with treatment with at least one other small molecule-based cancer therapy selected from the group consisting of microtubule and or topoisomerase inhibitors (for example, the mitotic inhibitor dolastatin and dolastatin analogues; the tubulin-binding agent T900607; XLl 19; and the topoisomerase inhibitor aminocamptothecin), SDX-105 (bendamustine hydrochloride), ixabepilone (an epothilone analog, also refe ⁇ ed to as BMS-247550), protein kinase C inhibitors, for example, midostaurin ((PKC-412, CGP 41251, N- benzo
- the present invention provides for the use ofthe monoclonal antibody CHIR-12.12 or CHIR-5.9, or antigen-binding fragment thereof, in the manufacture of a medicament for treating a B cell lymphoma, for example non- Hodgkin's lymphoma, in a subject, wherein the medicament is coordinated with treatment with at least one other vaccine/immunotherapy-based cancer therapy selected from the group consisting of vaccine approaches (for example, Id-KLH, oncophage, vitalethine), personalized immunotherapy or active idiotype immunotherapy (for example, MyVax ® Personalized Immunotherapy, formally designated GTOP-99), Promune® (CpG 7909, a synthetic agonist for toll-like receptor 9 (TLR9)), interleukin-2 (IL-2) therapy, IL-12 therapy; IL-15 therapy, and IL-21 therapy, and any combinations thereof; wherein the medicament is to be used either prior to, during, or after treatment of the subject with the other cancer therapy or,
- vaccine approaches for
- the present invention provides for the use ofthe anti-CD40 antibody, for example, the monoclonal antibody CHIR-12.12 or CHER-5.9, or antigen- binding fragment thereof in the manufacture of a medicament for treating a B cell-related leukemia, for example B-cell acute lymphocytic leukemia (B-ALL), in a subject, wherein the medicament is coordinated with freatment with at least one other cancer therapy selected from the group consisting of chemotherapy and anti-metabolite therapy, wherein the medicament is to be used either prior to, during, or after treatment ofthe subject with the other cancer therapy or, in the case of multiple combination therapies, either prior to, during, or after treatment ofthe subject with the other cancer therapies.
- B-ALL B-cell acute lymphocytic leukemia
- Examples of such embodiments include, but are not limited to, those instances where the medicament comprising the antagonist anti-CD40 antibody, for example, the monoclonal antibody CHER-12.12 or CHIR-5.9, or antigen-binding fragment thereof is coordinated with treatment with a chemotherapeutic agent or anti-metabolite selected from the group consisting of cytoxan, doxorubicin, vincristine, prednisone, cytarabine, mitoxantrone, idarubicin, asparaginase, methotrexate, 6-thioguanine, 6-mercaptopurine, and combinations thereof; wherein the medicament is to be used either prior to, during, or after freatment ofthe subject with the other cancer therapy or, in the case of multiple combination therapies, either prior to, during, or after treatment ofthe subject with the other cancer therapies.
- a chemotherapeutic agent or anti-metabolite selected from the group consisting of cytoxan, doxorubicin, vincristine, pred
- the medicament is coordinated with freatment with cytarabine plus daunorabicin, cytarabine plus mitoxantrone, and/or cytarabine plus idarubicin; wherein the medicament is to be used either prior to, during, or after freatment ofthe B-ALL subject with the other cancer therapy or, in the case of multiple combination therapies, either prior to, during, or after treatment ofthe subject with the other cancer therapies.
- the invention also provides for the use of an antagonist anti-CD40 antibody, for example, the monoclonal antibody CHER-12.12 or CHER-5.9 disclosed herein, or antigen- , binding fragment thereof in the manufacture of a medicament for treating a subject for a cancer characterized by neoplastic B cell growth, including the B cell-related cancers described herein above, wherein the medicament is used in a subject that has been pretreated with at least one other cancer therapy.
- pretreated or pretreatment is intended the subject has received one or more other cancer therapies (i.e., been treated with at least one other cancer therapy) prior to receiving the medicament comprising the antagonist anti-CD40 antibody or antigen-binding fragment thereof.
- Pretreated or “pretreatment” includes subjects that have been treated with at least one other cancer therapyy within 2 years, within 18 months, within 1 year, within 6 months, within 2 months, within 6 weeks, within 1 month, within 4 weeks, within 3 weeks, within 2 weeks, within 1 week, within 6 days, within 5 days, within 4 days, within 3 days, within 2 days, or even within 1 day prior to initiation of treatment with the medicament comprising the antagonist anti-CD40 antibody, for example, the monoclonal antibody CHER-12.12 or CHER-5.9 disclosed herein, or antigen-binding fragment thereof. It is not necessary that the subject was a responder to pretreatment with the prior cancer therapy, or prior cancer therapies.
- the subject that receives the medicament comprising the antagonist anti-CD40 antibody or antigen-binding fragment thereof could have responded, or could have failed to respond (i.e. the cancer was refractory), to pretreatment with the prior cancer therapy, or to one or more ofthe prior cancer therapies where pretreatment comprised multiple cancer therapies.
- Examples of other cancer therapies for which a subject can have received pretreatment prior to receiving the medicament comprising the antagomst anti-CD40 antibody or antigen-binding fragment thereof include, but are not limited to, surgery; radiation therapy; chemotherapy, optionally in combination with autologous bone manow transplant, where suitable chemotherapeutic agents include, but are not limited to, those listed herein above; other anti-cancer monoclonal antibody therapy, including, but not limited to, those anti-cancer antibodies listed herein above; small molecule-based cancer therapy, including, but not limited to, the small molecules listed herein above; vaccine/immunotherapy-based cancer therapies, including, but limited to, those listed herein above; steroid therapy; other cancer therapy; or any combination thereof.
- Treatment in the context of coordinated use of a medicament described herein with one or more other cancer therapies is herein defined as the application or administration of the medicament or of the other cancer therapy to a subject, or application or administration ofthe medicament or other cancer therapy to an isolated tissue or cell line from a subject, where the subject has a cancer characterized by neoplastic B cell growth, a symptom associated with such a cancer, or a predisposition toward development of such a cancer, where the pmpose is to cure, heal, alleviate, relieve, alter, remedy, ameliorate, improve, or affect the cancer, any associated symptoms ofthe cancer, or the predisposition toward the development ofthe cancer.
- the following examples are offered by way of illustration and not by way of limitation.
- the antagonist anti-CD40 antibodies used in the examples below are CHER.-5.9 and CHER-12.12.
- the CHER.-5.9 and CHER-12.12 anti-CD40 antibodies are human IgGi subtype anti-human CD40 monoclonal antibodies (mAbs) generated by immunization of transgenic mice bearing the human IgG ! heavy chain locus and the human K light chain locus (XenoMouse ® technology; Abgenix; Fremont, California).
- mAbs human IgGi subtype anti-human CD40 monoclonal antibodies
- CHIR-5.9 and CHER-12.12 bind specifically to human CD40 and can prevent CD40 ligand binding. Both mAbs can compete off CD40-ligand pre-bound to cell surface CD40.
- Both antibodies are sfrong antagonists and inhibit in vitro CD40 ligand- mediated proliferation of normal B cells, as well as cancer cells from NHL and CLL patients. In vitro, both antibodies kill cancer cell lines as well as primary cancer cells from NHL patients by ADCC. Dose-dependent anti-tumor activity was seen in a xenograft human lymphoma model. The binding affinity of CHIR-5.9 to human CD40 is 1.2xl0 "8 M and the binding affinity of CHER-12.12 to human CD40 is 5xl0 "10 M.
- CMCC# 12047 Mouse hybridoma line 131.2F8.5.9 (CMCC# 12047) and hybridoma line 153.8E2.D10.D6.12.12 (CMCC#12056) have been deposited with the American Type Culture Collection [ATCC; 10801 University Boulevard., Manassas, Virginia 20110-2209 (USA)] under Patent Deposit Number PTA-5542 and PTA-5543, respectively. The following protocols have been used in the examples described below.
- ELISA plates were coated with 2 ⁇ g/ml goat anti-human IgG MAb (The Jackson Laboratory, Bar Harbor, Maine) or with 2 ⁇ g/ml goat anti-human IgM MAb 4102 (Bio Source International, California) in 0.05 M carbonate buffer (pH 9.6), by incubation for 16 hours at 4°C. Plates were washed 3 times with PBS-0.05 % Tween-20 (PBS-Tween) and saturated with BSA for 1 hour. After 2 washes the plates were incubated for 2 hour at 37°C with different dilutions ofthe test samples.
- PBS-Tween PBS-0.05 % Tween-20
- PBMC Peripheral Blood Mononuclear Cells
- the tubes were centrifuged at 1700 ⁇ m for 30 minutes at room temperature with the brake on the centrifuge turned off. As much ofthe top layer (plasma) as possible was removed, minimizing the vacuum in order to avoid removing the second layer of solution.
- the second layer which contains the B and T lymphocytes, was collected using a sterile Pasteur pipette, and place in two 50-ml polystyrene tubes. The collection was diluted with 3 x the volume of cold RPMI with no additives, and the tubes were centrifuged at 1000 RPM for 10 minutes.
- the media was removed by aspiration, and the cells from both 50-ml tubes were resuspended in a total of 10 ml cold RPMI (with additives) and fransfe ⁇ ed to a 15-ml tube. The cells were counted using the hemacytometer, then centrifuged at 1000 RPM for 10 minutes. The media was removed and the cells resuspended in 4 ml RPMI. This fraction contained the PBMC.
- the tube containing the PBMC and beads was placed into the magnetic holder for 2 minutes, then the solution was transfe ⁇ ed to a new 5-ml tube in the magnetic holder. After 2 minutes, the solution was transfe ⁇ ed to a new 15-ml tube. This step was repeated four more times, and the solutions ofthe first four times were collected in the 15-ml tube, then centrifuged at 1000 RPM for 5 minutes. This step produced the pellet for T-cell separation. 100 ⁇ l RPMI (with additives) was added to collect the beads, and the solution was fransfe ⁇ ed into a 0.7-ml tube.
- the washing step was repeated 2 more times for a total of 3 washes.
- the cells were counted before the last centrifugation. This step completed the B-cell purification. Cells were stored in 90% FCS and 10% DMSO and frozen at - 800°C.
- the human T cell Enrichment Column (R&D systems, anti-h CD 3 column kit) was prepared using 20 ml of 1 X column wash buffer by mixing 2 ml of 10 X column wash buffer and 18 ml of sterile distilled water. The column was cleaned with 70% ethanol and placed on top of a 15-ml tube. The top cap of the column was removed first to avoid drawing air into the bottom ofthe column. Next, the bottom cap was removed, and the tip was cleaned with 70% ethanol. The fluid within the column was allowed to drain into the 15-ml tube. A new sterile 15-ml tube was placed under the column after the column buffer had drained to the level ofthe white filter.
- the B-cell depleted PBMC fraction was suspended in 1 ml of buffer and added to the top ofthe column. The cells were allowed to incubate with the column at room temperature for 10 minutes. The T- cells were eluted from the column with 4 aliquots of 2 ml each of 1 X column wash buffer. The collected T-cells were centrifuged at 1000 RPM for 5 minutes. The supernatant was removed and the cells resuspended in 10 ml RPMI. Cells were counted and centrifuged one more time. The supernatant was removed, completing the T-cell purification. Cells were stored in 90% FCS and 10% DMSO and frozen at -80°C.
- the RPMI composition contained 10% FCS (inactivated at 56°C for 45 min), 1 % Pen/Strep (100 u/ml Penicillin, 0.1 ⁇ g/ml Streptomycin), 1% Glutamate, 1% sodium puravate, 50 ⁇ M 2-ME.
- Flow Cytofluorometric Assay Ramos cells (106 cells/sample) were incubated in 100 ⁇ l primary antibody (10 ⁇ g/ml in PBS-BSA) for 20 min at 4°C.
- the fused cells were then distributed between the wells of 96- well tissue culture plates, so that each well contained 1 growing hybridoma on average. After 10-14 days the supernatants ofthe hybridoma populations were screened for specific antibody production. For the screening of specific antibody production by the hybridoma clones, the supernatants from each well were pooled and tested for anti-CD 40 activity specificity by ELISA first. The positives were then used for fluorescent cell staining of EBV-fransformed B cells as described for the FACS assay above. Positive hybridoma cells were cloned twice by limiting dilution in IMDM/FBS containing 0.5 ng/ml hIL-6.
- Example 1 Production of Anti-CD40 Antibodies Several fully human, antagonist anti-CD40 monoclonal antibodies of IgGl isotype were generated. Transgenic mice bearing the human IgGl heavy chain locus and the human K chain locus (Abgenix ⁇ -1 XenoMouse ® technology (Abgenix; Fremont, California)) were used to generate these antibodies. SF9 insect cells expressing CD40 extracellular domain were used as immunogen. A total of 31 mice spleens were fused with the mouse myeloma SP2/0 cells to generate 895 antibodies that recognize recombinant CD40 in ELISA (Tables IA and IB).
- hybridomas produced using Abgenix XenoMouse ® technology may contain mouse lambda light chain instead of human kappa chain.
- the antibodies containing mouse light lambda chain were selected out.
- a subset of 260 antibodies that also showed binding to cell-surface CD40 were selected for further analysis.
- Stable hybridomas selected during a series of subcloning procedures were used for further characterization in binding and functional assays. Table 1A.
- Clones from 7 mother hybridomas were identified to have antagonist activity. Based on their relative antagonist potency and ADCC activities, two hybridoma clones were selected. Their names are: 131.2F8.5.9 (5.9) and 153.8E2.D10.D6.12.12 (12.12). Clones from 7 other hybridomas were identified as having antagonist activity (Table 2 above). Based on their relative antagonistic potency and ADCC activities, two hybridoma clones were selected for further evaluation. They are named 131.2F8.5.9 (5.9) and 153.8E2.D10.D6.12.12 (12.12). The binding profile of these two antibodies to CD40+ lymphoma cell line is shown as a flow cytometric histogram in Figure 1.
- Example 2 Polynucleotide and Amino Acid Sequences of Human Anti-CD40 Antibodies
- the cDNAs encoding the variable regions ofthe candidate antibodies were amplified by PCR, cloned, and sequenced.
- the amino acid sequences for the light chain and heavy chain ofthe CHER-12.12 antibody are set forth in Figures 9 A and 9B, respectively. See also SEQ ED NO:2 (light chain for mAb CHIR-12.12) and SEQ ED NO:4 (heavy chain for mAb CHIR-12.12).
- a variant ofthe heavy chain for mAb CHIR- 12.12 is shown in Figure 9B (see also SEQ ID NO:5), which differs from SEQ ID NO:4 in having a serine residue substituted for the alanine residue at position 153 of SEQ ID NO:4.
- the nucleotide sequences encoding the light chain and heavy chain ofthe CHER- 12.12 antibody are set forth in Figures 10A and 10B, respectively. See also SEQ ED NO:l (coding sequence for light chain for mAb CHIR-12.12) and SEQ ED NO:3 (coding sequence for heavy chain for mAb CHER-12.12).
- the amino acid sequences for the light chain and heavy chain ofthe CHER-5.9 antibody are set forth in Figures 1 IA and 11B, respectively.
- Example 3 Effect of CHER-5.9 and CHIR-12.12 on the CD40/CD40L Interaction
- the candidate antibodies CHJR-5.9 and CHER-12.12 prevent the binding of CD40 ligand to cell surface CD40 and displace the pre-bound CD40 ligand.
- Antibodies CHER- 5.9 and CHIR-12.12 were tested for their ability to prevent CD40-ligand binding to CD40 on the surface of a lymphoma cell line (Ramos). Binding of both antibodies (unlabeled) prevented the subsequent binding of PE-CD40 ligand as measured by flow cytometric assays (Figure 2A). In a second set of assays the two antibodies were tested for their ability to replace CD40 ligand pre-bound to cell surface CD40. Both antibodies were effective for competing out pre-bound CD40 ligand, with CHER-5.9 being slightly more effective than CHIR-12.12 ( Figure 2B).
- Example 4 CHER-5.9 and CHER-12.12 Bind to a Different Epitope on CD40 Than 15B8
- the candidate monoclonal antibodies CHER-5.9 and CHER-12.12 compete with each other for binding to CD40 but not with 15B8, an IgG 2 anti-CD40 mAb (see
- Example 5 Binding Properties of Selected Hybridomas Protein A was immobilized onto CM5 biosensor chips via amine coupling.
- Human anti-CD40 monoclonal antibodies at 1.5 ⁇ g/ml, were captured onto the modified biosensor surface for 1.5 minutes at 10 ⁇ l/min.
- Recombinant soluble CD40-his was flowed over the biosensor surface at varying concentrations.
- Antibody and antigen were diluted in 0.01 M HEPES pH 7.4, 0.15 M NaCI, 3 mM EDTA, 0.005% Surfactant P20 (HBS-EP).
- Kinetic and affinity constants were determined using the Biaevaluation software with a 1:1 interaction model/global fit. As shown in Table 3 below, there is 121-fold difference in the off rate of CHIR- 5.9 and CHER-12.12 resulting in 24-fold higher affinity for CHIR-12.12.
- CHER-5.9 and CHER-12.12 are Potent Antagonists for CD40-Mediated Proliferation of Human Lymphocytes from No ⁇ nal Subjects Engagement of CD40 by CD40 ligand induces proliferation of human B cells. An antagonist anti-CD40 antibody is expected to inhibit this proliferation.
- Two candidate antibodies (CHER-5.9 and CHER-12.12) were tested for their ability to inhibit CD40 tigand-induced proliferation of PBMC from normal human subjects.
- Formaldehyde-fixed CHO cells transfectant-expressing CD40 ligand (CD40L) were used as a source of CD40 ligand.
- Human PBMC were cultured for 4 days with the formaldehyde-fixed CHO cells expressing CD40-ligand in the presence of varying concentrations of anti-CD40 mAb CHIR-5.9 or CHIR-12.12.
- the proliferation was measured by tritiated-thymidine inco ⁇ oration.
- Cells were pulsed with tritiated-labeled thymidine at 37°C for 14-18 hours. Both antibodies were found to be very effective for inhibiting CD40 ligand- induced proliferation of human PBMC (Table 4A, mAb CHER-5.9, Table 4B, mAb CHIR-12.12).
- PBMC peripheral blood mononuclear cell
- follow-up assessments with 4 additional donors of PBMC were carried out for mAb CHER-12.12 with similar trends observed.
- a wide range of antibody concentrations (0.01 ⁇ g/ml to 100 ⁇ g/ml) was used in these assays. Nearly complete inhibition of CD40 ligand-induced proliferation could be achieved at 0.1 ⁇ g/ml concenfration of antibodies in most cases.
- both candidate antibodies seem similar in their potency for inhibition of CD40 ligand-induced proliferation of normal PBMC.
- Average % inhibition of human PBMC at 0.1 ⁇ g/ml 3 107 Average % inhibition of human PBMC at 0.01 ⁇ g/ml -1 74 Average % inhibition of human PBMC at 0.001 ⁇ g/ml -7 0 Average % inhibition of human PBMC at 0.0001 ⁇ g/ ml -8 -17 49.65
- human PBMC In addition to B cells, human PBMC also contain natural killer cells that can mediate antibody dependent cytotoxicity (ADCC).
- ADCC antibody dependent cytotoxicity
- Example 7 CHIR-5.9 and CHIR-12.12 Do Not Induce Sfrong Proliferation of Human B Cells from No ⁇ nal Subjects
- CD40 ligand activates no ⁇ nal B cells and B-cell lymphoma cells to proliferate. Binding of some anti-CD40 antibodies (agonist) can provide a similar stimulatory signal for the proliferation of normal and cancer B cells. Antibodies with strong B cell stimulatory activity are not suitable candidates for therapeutic treatment of B cell lymphomas. The two candidate antibodies were tested for their ability to induce proliferation of B cells from normal volunteer donors. The B cells purified by Ficoll- Hypaque Plus gradient centrifugation from normal donor PBMC were cultured in 96-well plates with varying concentrations of candidate antibodies (range of 0.001 to 100 ⁇ g/ml) for a total of 4 days.
- PBMC peripheral blood mononuclear cells
- CD40-ligand CD40-ligand
- human PBMC In addition to _B cells, human PBMC contain cell types that bear Fc receptors (FcR) for IgGl molecules that can provide cross linking of anti-CD40 antibodies bound to CD40 on B cells. This cross-linking could potentially enhance stimulatory activity of anti-CD40 antibodies.
- FcR Fc receptors
- Example 8 CHIR-5.9 and CHIR-12.12 Are Able to Kill CD40-Bearing Target Cells bv ADCC
- the candidate antibodies can kill CD40-bearing target cells (lymphoma lines) by the mechanism of ADCC.
- Both CHIR-5.9 and CHIR-12.12 are folly human antibodies of IgGl isotype and are expected to have the ability to induce the killing of target cells by the mechanism of ADCC.
- Ttiey were tested for their ability to kill cancer cell lines in in vitro assays. Two human lymphoma cell lines (Ramos and Daudi) were selected as target cells for these assays. PBMC or enriched NK cells from 8 normal volunteer donors were used as effector cells in these assays.
- Example 9 CD40 Is Present on the Surface of NHL Cells from Lymph Node Biopsy Patients
- NHL cells were isolated from biopsied lymph nodes from patients and were preserved in liquid nitrogen until use. Cell viability at the time of analysis exceeded 90%.
- the cells from two rituximab-sensitive and three rituximab-resistant patients (five patients in total) were stained with either a direct labeled 15B8-FITC or 15B8 plus anti- huIgG 2 -FITC and analyzed by Flow cytometry. NHL cells from all the patients were found to express CD40.
- Table 10 shows that an average of 76% of NHL cells express CD40 (a range of 60-91%).
- Example 10 CHIR-5.9 and CHER-12.12 Do Not Stimulate Proliferation of Cancer Cells from the Lymph Nodes of NHL Patients
- CD40 ligand is known to provide a stimulatory signal for the survival and proliferation of lymphoma cells from NHL patients. Binding of some anti-CD40 antibodies (agonist) can provide a similar stimulatory signal for the proliferation of patient cancer cells.
- Antibodies with sfrong B cell stimulatory activity are not suitable candidate for therapeutic treatment of B cell lymphomas.
- the two candidate antibodies were tested for their ability to induce proliferation of NHL cells from 3 patients.
- the cells isolated from lymph node (LN) biopsies were cultured with varying concentrations of candidate antibodies (range of 0.01 to 300 ⁇ g/ml) for a total of 3 days.
- the cell proliferation was measured by inco ⁇ oration of tritiated thymidine. Neither of the two candidate mAbs induced any proliferation of cancer cells at any concenfration tested (Table 11). Antibodies even in the presence of exogenously added IL-4, a B cell growth factor, did not induce proliferation of NHL cells (tested in one ofthe thee patient cells. These results indicate that CHIR-5.9 and CHER-12.12 are not agonist anti-CD40 antibodies and do not stimulate proliferation in vitro of NHL cells from patients.
- Example 11 CHIR-5.9 and CHIR-12.12 Can Block CD40 Ligand-Mediated
- NHL cells from patients were cultured in suspension over CD40L- expressing feeder in the presence of IL-4.
- Example 12 Effect of CHER-5.9 on Number of Viable NHL Cells When Cultured with CD40-Ligand Bearing Cells Effects of CHER-5.9 on the viable NHL cell numbers when cultured with CD40- ligand bearing cells over an extended period of time (days 7, 10, and 14) were investigated.
- CD40 ligand-mediated signaling tlirough CD40 is important for B cell survival.
- This set of experiments evaluated the effect of anti-CD40 antibodies on NHL cell numbers at days 7, 10, and 14. NHL cells from five patients were cultured in suspension over CD40L-expressing inadiated feeder cells in the presence of IL-4.
- the confrol human IgG and CHIR-5.9 antibodies were added at concentrations of 10 ⁇ g/ml at day 0 and day 7.
- CHIR-5.9 and CHIR-12.12 are Able to Kill Cancer Cells from the Lymph Nodes of NHL Patients by ADCC
- Both CHER-5.9 and CHIR-12.12 are fully human antibodies of IgGi isotype and were shown to induce the killing of lymphoma cell lines in vitro by the mechanism of ADCC (Table 9). They were tested for their ability to kill cancer cells from a single NHL patient in in vitro assays. Enriched NIC cells from normal volunteer donor either fresh after isolation or after culturing overnight at 37°C were used as effector cells in this assay. Similar results were obtained with both freshly isolated NK cells and NK cells -99-
- Example 14 CHIR-5.9 and CHIR-12.12 Can Block CD40-Mediated Survival and Proliferation of Cancer Cells from CLL Patients
- the candidate antibodies can block CD40-mediated survival and proliferation of cancer cells from CLL patients.
- CLL cells from patients were cultured in suspension over , CD40L-expressing formaldehyde-fixed CHO cells under two different conditions: addition of human isotype antibody IgG (control); and addition of either CHIR-5.9 or CHER-12.12 monoclonal antibody. All antibodies were added at concentrations of 1, 10, and 100 ⁇ g/mL in the absence of IL-4. The cell counts were performed at 24 and 48 h by MTS assay.
- Example 15 CHIR-5.9 and CHIR-12.12 Show Anti-Tumor Activity in Animal Models Pharmacology/in vivo efficacy
- the candidate mAbs are expected to produce desired pharmacological effects to reduce tumor burden by either/both of two anti-tumor mechanisms, blockade of proliferation/survival signal and induction of ADCC.
- the cunently available human lymphoma xenograft models use long-term lymphoma cell lines that, in contrast to primary cancer cells, do not depend on CD40 stimulation for their growth and survival. Therefore the component of these mAbs' anti-tumor activity based on blocking the tumor proliferation/survival signal is not expected to contribute to anti-tumor efficacy in these models.
- ADCC cancer cell killing mechanisms
- blocking of survival signal are expected to contribute to anti-tumor activities in human lymphoma patients. This is likely to increase the chance of achieving efficacy in human lymphoma patients.
- the candidate anti-CD40 mAbs also showed a trend toward tumor growth inhibition in a second B cell lymphoma model (non- validated Daudi model, data not shown).
- T cell-deficient nude mice were whole-body inadiated at 3 Gy to further suppress the immune system one day before tumor inoculation.
- Tumor cells were inoculated subcutaneously in the right flank at 5xl0 6 cells per mouse.
- Treatment was initiated either one day after tumor implantation (unstaged subcutaneous xenograft human B cell lymphoma models, Namalwa and Daudi) or when tumor volume reached 200-400 mm 3 (staged Daudi model, usually 15 days after tumor inoculation).
- Tumor-bearing mice were injected anti-CD40 mAbs intraperitoneally (i.p.) once a week at the indicated doses. Tumor volumes were recorded twice a week.
- anti-CD40 monoclonal antibodies were further compared in a staged xenograft Daudi model, in which treatment started when the subcutaneous tumor was palpable, anti-CD40 mAb CHIR-12.12 at 1 mg/kg caused significant tumor reduction
- Example 16 Pharmacokinetics of CHER-5.9 and CHER-12.12
- the pharmacokinetics of anti-CD40 mAb in mice was studied after single IV and IP dose administration.
- Anti-CD40 mAb exhibited high systemic bioavailability after EP adminisfration, and prolonged terminal half-life (>5 days) (data not shown).
- This pilot study was conducted to aid in the design of pharmacology studies; however, it is of little to no importance for the development activity of this mAb since this folly human mAb does not cross react with mouse CD40.
- Example 17 Characterization of Epitope for Monoclonal Antibodies CHIR-12.12 and CHER-5.9 To determine the location ofthe epitope on CD40 recognized by monoclonal antibodies CHER-12.12 and CHIR-5.9, SDS-PAGE and Western blot analysis were performed. Purified CD40 (0.5 ⁇ g) was separated on a 4-12% NUPAGE gel under reducing and non-reducing conditions, transfe ⁇ ed to PVDF membranes, and probed with monoclonal antibodies at 10 ⁇ g/ml concenfration. Blots were probed with alkaline phosphatase conjugated anti-human IgG and developed using the Western Blue R stabilized substrate for alkaline phosphatase (Promega).
- results indicate that anti-CD40 monoclonal antibody CHER.- 12.12 recognizes epitopes on both the non-reduced and reduced forms of CD40, with the non-reduced form of CD40 exhibiting greater intensity than the reduced form of CD40 (Table 15; blots not shown).
- the fact that recognition was positive for both forms of CD40 indicates that this antibody interacts with a conformational epitope part of which is a linear sequence.
- Monoclonal antibody CHER-5.9 primarily recognizes the non-reduced form of CD40 suggesting that this antibody interacts with a primarily conformational epitope (Table 15; blots not shown). Table 15. Domain identification.
- CD40 To map the antigenic region on CD40, the four extracellular domains of CD40 were cloned and expressed in insect cells as GST fusion proteins. The secretion ofthe four domains was ensured with a GP67 secretion signal. Insect cell supernatant was analyzed by SDS-PAGE and western blot analysis to identify the domain containing the epitope. Monoclonal antibody CHER-12.12 recognizes an epitope on Domain 2 under both reducing and non-reducing conditions (Table 16; blots not shown). In contrast, monoclonal antibody CHER-5.9 exhibits very weak recognition to Domain 2 (Table 16; blots not shown). Neither of these antibodies recognize Domains 1, 3, or 4 in this analysis.
- peptides were synthesized from the extracellular Domain 2 of CD40, which conesponds to the sequence PCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICT (residues 61-104 ofthe sequence shown in SEQ ID NO:10 or SEQ ED NO:12).
- SPOTs membranes (Sigma) containing thirty-five lOmer peptides with a 1-amino-acid offset were generated.
- Western blot analysis with mAb CHER- 12.12 and anti-human IgG beta- galactosidase as secondary antibody was performed.
- the blot was stripped and reprobed with mAb CHIR-5.9 to determine the region recognized by this antibody SPOTs analysis probing with anti-CD40 monoclonal antibody CHIR-12.12 at 10 ⁇ g/ml yielded positive reactions with spots 18 tlirough 22.
- the sequence region covered by these peptides is shown in Table 17.
- the linear epitopes identified by the SPOTs analyses are within the CD40 Bl module.
- the sequence ofthe CD40 Bl module is: HKYCDPNLGLRVQQKGTSETDTIC (residues 80-103 of SEQ ED NO: 10 or SEQ ED NO: 12).
- Within the linear epitope identified for CHER-12.12 is C83. It is known that this cysteine residue forms a disulphide bond with C103. It is likely that the conformational epitope ofthe CHER-12.12 mAb contains this disulfide bond (C83-C103) and/or su ⁇ ounding amino acids conformationally close to C 103.
- Example 18 Number of CD20 and CD40 Molecules on Namalwa and Daudi Cells
- the number of CD20 and CD40 molecules on Namalwa and Daudi cells was determined as outlined in Figure 7, using antibody concenfrations of 0.01, 0.1, 1, 10, and 100 ⁇ g/ml. As can be seen in Figure 7, the average number of CD20 molecules (target for rituximab) is greater on both the Namalwa and Daudi cell lines than is the number of CD40 molecules (target for mAb CHIR-12.12).
- Example 19 ADCC of mAb CHIR-12.12 and Rituximab Against Daudi Lymphoma Cells
- the rituximab and candidate mAb CHER-12.12 were tested in vitro for ADCC activity at variable concentrations against lymphoma cell line Daudi as target (T) cells and purified NK cells from healthy human volunteers as effector (E) cells.
- Freshly isolated human NK cells were mixed with calcein-labeled Daudi lymphoma cells at an E:T ratio of 10. The cell mixture was incubated for 4 hours at 37°C in the presence ofthe stated concentrations of either mAb CHER-12.12 or rituximab.
- the calcein level released from lysed target cells in the supernatant was measured as Arbitrary Fluorescent Units (AFU).
- AFU Arbitrary Fluorescent Units
- the percent specific lysis was calculated as: 100 x (AFU test - AFU spontaneous release)/(AFU maximal release - AFU spontaneous release), where AFU spontaneous release is the calcein released by target cells in the absence of antibody or NK cells, and AFU maximal release is the calcein released by target cells upon lysis by detergent.
- Antibody concentration-dependent Daudi cell lysis was observed (Figure 8; Table 19 below).
- Example 20 CHER-12.12 Blocks CD40L-Mediated CD40 Survival and Signaling
- CD40L Soluble CD40 ligand activates B cells and induces various aspects of functional responses, including enhancement of survival and proliferation, and activation of NFKB, ERK MAPIC, PI3K/Akt, and p38 signaling pathways.
- CD40L- mediated CD40 stimulation provides survival signals by reduction of cleaved PARP and induction ofthe anti-apoptotic proteins, XIAP and Mcl-1, in normal B cells.
- CD40L- mediated CD40 stimulation also recruits TRAF2 and TRAF3 to bind CD40 cytoplasmic domain.
- CHIR-12.12 directly inhibited all of these stimulation effects on no ⁇ nal human B cells. For example, CHER-12.12 treatment resulted in increased cleavage of caspase-9, caspase-3, and PARP as well as reduction of
- IKK IKLB kinase
- CHIR-12.12 did not trigger these apoptotic effects without initial CD40L-mediated CD40 stimulation.
- CHIR-12.12 inhibited survival mediated by CD40 ligand by inducing cleavage of PARP.
- CD40L-mediated CD40 stimulation provided survival signals as it did not result in increases of cleaved caspase-9, cleaved caspase-3, or cleaved PARP over time, indicating that the cells were not undergoing apoptosis.
- treatment with CHER- 12.12 resulted in an increase of these cleavage products, indicating that CHIR-12.12 freatment abrogated the effects of CD40L binding on survival signaling in sCD40L-stimulated normal B cells, restoring B cell apoptosis (data not shown).
- CHIR-12.12 inhibited expression of "survival" anti-apoptotic proteins.
- 0.6 x 10 6 normal human B cells from healthy donors 0.6 x 10 6 normal human B cells from healthy donors
- sCD40L (Alexis Corp., Bingham, Nottinghamshire, UK).
- CHER-12.12 (10 ⁇ g/ml) and confrol IgG were then added.
- Cells were collected at 0, 20 minutes, 2 hours, 6 hours, 18 hours, and 26 hours.
- Mcl-1, XIAP, CD40, and ⁇ -actin controls were detected in cell lysates by Western blot. Briefly, sCD40L stimulation resulted in sustained expression of Mcl-1 and XIAP over time. However, treatment ofthe sCD40L-stimulated cells with CHER 12.12 resulted in a decrease in expression of these proteins overtime (data not shown).
- CHIR-12.12 treatment inhibited phosphorylation oflKKa (Ser 180) and IKK ⁇ (Ser 181) in normal B cells.
- 1.0 x 10 normal human B cells from healthy donors were stimulated with 1 ⁇ g/ml sCD40L (Alexis Corp., Bingham, Nottinghamshire, UK).
- CHIR-12.12 (10 ⁇ g/ml) and confrol IgG were then added. Cells were collected at 0 and 20 minutes.
- Phosphorylated EKK ⁇ (Serl80) and IKK ⁇ (Ser 181) and total EKK ⁇ controls were detected in cell lysates by Western blot.
- CHIR-12.12 (0.01, 0.1, 0.2, 0.5, 1.0 ⁇ g/ml) and control IgG were then added. Cells were collected at 24 hours. Cleaved PARP, and ⁇ -actin confrols were detected in cell lysates by Western blot. Briefly, CHIR-12.12 treatment resulted in increase of PARP cleavage in sCD40L stimulated cells in a dose-dependent manner and therefore abrogated the survival signaling pathway in sCD40L-stimulated normal B cells (data not shown) .
- CHIR-12.12 inhibited expression of "survival" anti-apoptotic proteins in a dose- dependent manner.
- 0.6 x 10 6 no ⁇ nal human B cells from healthy donors were stimulated with 1 ⁇ g/ml sCD40L (Alexis Corp., Bingham, Nottinghamshire, UK).
- CHIR-12.12 0.5, 2, and 10 ⁇ g/ml
- control IgG were then added.
- Cells were collected at 22 hours.
- Mcl-1, XIAP, cleaved PARP, and ⁇ - actin confrols were detected in cell lysates by Western blot.
- CHIR-12.12 treatment reduced Mcl-1 and XIAP expression and increased cleaved PARP expression in sCD40L-stimulated cells in a dose-dependent manner, and thus abrogated these blockades to the apoptotic pathway in sCD40L-stimulated no ⁇ nal B cells (data not shown).
- CHIR-12.12 did not affect expression of anti-apoptotic proteins, cleaved-PARP, and XIAP, in the absence of soluble CD40L signaling.
- 1.0 x 10 6 normal human B cells from healthy donors (percent purity between 85-95%) were treated with CHIR-12.12 (10 ⁇ g/ml) and confrol IgG only (i.e., cells were not pre-stimulated with sCD40L before adding antibody). Cells were collected at 0, 4, 14, and 16 hours.
- XIAP, cleaved PARP, and ⁇ -actin confrols were detected in cell lysates by Western blot.
- CHIR-12.12 inhibits phosphorylation oflKKa (Serl80) and IKK ⁇ (Serl81), Akt, ERK, and p38 in normal B cells.
- 1.0 x 10 6 normal human B cells from healthy donors (percent purity between 85-95%) were serum starved in 1% FBS-containing media and stimulated with 1 ⁇ g/ml sCD40L (Alexis Corp., Bingham, Nottinghamshire, UK). The cultures were treated with CHIR-12.12 (1 and 10 ⁇ g/ml) and control IgG. Cells were collected at 0 and 20 minutes.
- Phospho-IKK ⁇ , phospho-IKK ⁇ , total EKK ⁇ , phospho- ERK, total ERK, phospho-Akt, total Akt, phospho-p38, and total p38 were detected in cell lysates by Western blot. Briefly, sCD40L stimulation resulted in increases in IKK ⁇ / ⁇ phosphorylation, ERK phosphorylation, Akt phosphorylation, andp38 phosphorylation, thus leading to survival and or proliferation ofthe cells. Treatment ofthe cells with CHIR-12.12 abrogated the effects of sCD40L stimulation on these signaling pathways in no ⁇ nal B cells (data not shown).
- CHIR 12.12 inhibits multiple signaling pathways such as PI3K and MEK /ERK in the CD40 signaling cascade.
- 1.0 x 10 6 normal human B cells from healthy donors (percent purity between 85-95%) were serum starved in 1%> FBS-containing media and stimulated with 1 ⁇ g/ml sCD40L (Alexis Corp., Bingham, Nottinghamshire, UK).
- the cultures were also treated with CHER-12.12 (1 and 10 ⁇ g/ml), Wortmanin, (a PDK/Akt inhibitor; 1 and 10 ⁇ M), LY 294002 (a PI3K/Akt inhibitor; 10 and 30 ⁇ M), and PD 98095 (a MEK inhibitor; 10 and 30 ⁇ g/ml).
- CHIR-12.12 inhibits the binding of signaling molecules TRAF2 and TRAF3 to the cytoplasmic domain ofCD40 in normal B cells.
- 4.0 x 10 6 normal human B cells from healthy donors (percent purity between 85-95%) were serum starved for four hours in 1% FBS- containing media and stimulated with 1 ⁇ g/ml sCD40L (Alexis Corp., Bingham, Nottinghamshire, UK) for 20 minutes. Cells were collected at 0 and 20 minutes.
- CD40 was immunoprecipitated using polyclonal anti-CD40 (Santa Cruz Biotechnology, CA), and was probed in a Western blot with anti-TRAF2 mAb (Santa Cruz Biotechnology, CA), anti-TRAF3 mAb (Santa Cruz Biotechnology, CA), and anti-CD40 mAb (Santa Cruz Biotechnology, CA). Briefly, the results show that TRAF2 and TRAF3 co-precipitated with CD40 after sCD40L stimulation. In contrast, treatment with CHER-12.12 abrogated formation of the CD40-TRAF2/3 signaling complex in sCD40L-stimulated normal B cells. There were no changes in CD40 expression (data not shown).
- the results of these experiments, and the results in the examples outlined above, indicate that the CHER-12.12 antibody is a dual action antagonist anti-CD40 monoclonal antibody having a unique combination of attributes.
- This folly human monoclonal antibody blocks CD40L-mediated CD40 signaling pathways for survival and proliferation of B cells; this antagonism leads to ultimate cell death.
- CHIR-12.12 also mediates recognition and binding by effector cells, initiating antibody dependent cellular cytotoxicity (ADCC). Once CHER-12.12 is bound to effector cells, cytolytic enzymes are released, leading to B-cell apoptosis and lysis.
- CHIR-12.12 is a more potent anti-tumor antibody than is rituximab when compared in pre-clinical tumor models.
- Example 21 Agonist and Antagonist Activity Against Primary Cancer Cell from NHL. CLL. and NM Patients
- the candidate mAbs is tested for a variety of activities (listed below) against primary cancer cells from NHL and CLL. and multiple myeloma patients.
- Annexin V assay 3-4 NHL patients, 4 CLL patients, and 4 MM patients
- Reversing survival signal by Annexin V assay (3 NHL patients, 3 CLL patients and 3 MM patients)
- Example 22 Identification of Relevant Animal Species for Toxicity Studies As these two candidate antibodies do not cross-react with rodent CD40, other species must be identified for testing toxicologic effects. The ability ofthe two candidate anti-CD40 antibodies to cross-react with animal
- CD40 is tested by flow cytometric assays. Rat, rabbit, dog, cynomolgus monkeys and marmoset monkeys are tested for this study.
- the candidate antibodies show antagonist activity upon binding to CD40 on human B cells.
- lymphocytes from species that show binding to candidate antibodies are tested in proliferation assays for antagonist activity.
- the lymphocytes from the species selected for antagonistic binding of candidate antibodies are further tested for their ability to serve as effector cells for killing CD40-expressing lymphoma cell lines through the mechanism of ADCC.
- the selected animal species are tested in an EHC study for the tissue- binding pattern of candidate antibodies. The animal species responding to the candidate antibodies in these assays in a manner similar to that observed for human cells are chosen for toxicology studies.
- Initial studies indicate that the candidate anti-CD40 mAbs cross-react with cynomolgus monkey CD40.
- Example 23 Tumor Targeting Profile of CHER-5.9 and CHER-12.12 To determine the relative tumor targeting profile of CHER-12.12 and CHER-5.9 mAbs, fluorescent-labeled candidate mAbs and isotype control antibodies are administered into tumor-bearing mice. Tumor specimens and no ⁇ nal organs are harvested at different time points after dosing. The accumulation of labeled antibody in tumors and normal organs is analyzed.
- Example 24 Mechanism of Action of CHIR-5.9 and CHIR-12.12
- ADCC is mediated by binding of effecter cells such as NK, marcrophage, and monocytes to the Fc portion of antibody through Fc receptor. Mice deficient in activating Fc receptors as well as antibodies engineered to disrupt Fc binding to those receptors will block the ADCC mediated tumor growth inhibition. Loss or significantly reduced tumor inhibition in this model will suggest that the tumor growth inhibition by these two candidate mAbs is mainly mediated by ADCC mechanism.
- Example 25 Liquid Pharmaceutical Formulation for Antagonist Anti-CD40 Antibodies
- the objective of this study was to investigate the effects of solution pH on stability ofthe antagonist anti-CD40 antibody CHER-12.12 by both biophysical and biochemical methods in order to select the optimum solution environment for this antibody.
- Differential Scanning Calorimetry (DSC) results showed that the conformation stability of CHER-12.12 is optimal in formulations having pH 5.5-6.5.
- SEC-HPLC Size-Exclusion HPLC
- CEX-HPLC Cation-Exchange HPLC
- one recommended liquid pharmaceutical formulation comprising this antibody is a formulation comprising CHER-12.12 at about 20 mg/ml formulated in about 10 mM sodium succinate, about 150 mM sodium chloride, and having a pH of about pH 5.5.
- the CHIR-12.12 antibody used in the formulation studies is a human monoclonal antibody produced by a CHO cell culture process.
- This MAb has a molecular weight of 150 kDa and consists of two light chains and two heavy chains linked together by disulfide bands. It is targeted against the CD40 cell surface receptor on CD40-expressing cells, including normal and malignant B cells, for freatment of various cancers and autoimmune/inflammatory diseases.
- the anti-CD40 drug substance used for this study was a CHO-derived purified anti-CD40 (CHER-12.12) bulk lot.
- the composition ofthe drug substance was 9.7 mg/ml CHIR-12.12 antibody in 10 mM sodium citrate, 150 mM sodium chloride, at pH 6.5.
- the control sample in the study was the received drag substance, followed by freezing at ⁇ - 60°C, thawing at RT and testing along with stability samples at predetermined time points.
- the stability samples were prepared by dialysis ofthe drag substance against different pH solutions and the CHER-12.12 concenfration in each sample was determined by UV 280 as presented in Table 20.
- SDS-PAGE Fragmentation and aggregation were estimated using 4-20% Tris-Glycine Gel under non-reducing and reducing conditions. Protein was detected by Coomassie blue staining.
- SEC-HPLC Size Exclusion Chromatograph
- CEX-HPLC Cation Exchange Chromatography
- the CHIR-12.12 formulation samples at pH 4.5-9.0 were incubated at 40°C for 2 months and subjected to SDS-PAGE analysis (data not shown). Under non-reducing conditions, species with molecular weight (MW) of 23 kDa and 27 kDa were observed in formulations above pH 5.5, and species with MW of 51 kDa were observed in all formulations, but appeared less at pH 5.0-5.5. A species with MW of 100 kDa could be seen at pH 7.5 and pH 9.0. Under reducing conditions, CHIR-12.12 was reduced into free heavy chains and light chains with MW of 50 kDa and 24 kDa, respectively.
- MW molecular weight
- SEC-HPLC analysis detected the intact CHIR-12.12 as the main peak species, an aggregation species as a front peak species separate from the main peak species, a large fragment species as a shoulder peak on the back ofthe main peak species, and small fragment species were detected post-main peak species. After incubation at 5°C and 25°C for 3 months, negligible amounts of protein fragments and aggregates ( ⁇ 1.0% ) were detected in the above formulations and the CHER-12.12 main peak species remained -118-
- Table 21 SEC-HPLC results of CHER-12.12 stability samples under real-time and accelerated storage conditions.
- CEX-HPLC analysis detected the intact CHER-12.12 as the main peak species, acidic variants eluted earlier than the main peak species, and C-terminal lysine addition variants eluted post-main peak species.
- Table 22 shows the dependence ofthe percentages ofthe remaining main peak CHIR-12.12 species and acidic variants on solution pH.
- the control sample already contained a high degree of acidic species ( ⁇ 33%), probably due to early-stage fermentation and purification processes.
- Table 22 Percentage of peak area by CEX-HPLC for CHIR-12.12 in different pH formulations under real-time and accelerated storage conditions.
- this antibody is a formulation comprising CHIR-12.12 at about 20 mg/ml formulated in about 10 mM sodium succinate, about 150 mM sodium chloride, and having a pH of about pH 5.5.
- the overall objective is to provide an effective therapy for B cell tumors by targeting them with an anti-CD40 IgGl.
- These tumors include B-cell lymphoma, Chronic Lymphocytic Lyphoma (CLL), Acute Lymphoblastic Leukemia (ALL), Multiple Myeloma (MM), Waldenstrom's Macroglobulinemia, and Systemic Castleman's Disease.
- RTA01/2153087vl The signal for these diseases is determined in phase II although some measure of activity may be obtained in phase I. Initially the agent is studied as a single agent, but will be combined with other agents, chemotherapeutics, and other antibodies, as development proceeds.
- Phase I Evaluate safety and pharmacokinetics - dose escalation in subjects with B cell malignancies. • Choose dose based on safety, tolerability, and change in serum markers of CD40. In general an MTD is sought but other indications of efficacy (depletion of CD40+ B cells, etc.) may be adequate for dose finding. • Consideration of more than one dose especially for different indications, e.g., the CLL dose may be different than the NHL. Thus, some dose finding may be necessary in phase II. • Patients are dosed weekly with real-time pharmacokinetic (Pk) sampling. Initially a 4- week cycle is the maximum dosing allowed. The Pk may be highly variable depending on the disease studied, density of CD40 etc.
- RTA01/2153087vl CD40 signaling may lead to cell death. More than one dose, and more than one schedule maybe tested in a randomized phase II setting.
- Phase III Phase III will depend on where the signal is detected in phase II, and what competing therapies are considered to be the standard. If the signal is in a stage of disease where there is no standard of therapy, then a single arm, well-controlled study could serve as a pivotal trial. If there are competing agents that are considered standard, then head-to-head studies are conducted.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Veterinary Medicine (AREA)
- Engineering & Computer Science (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Public Health (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Immunology (AREA)
- Neurology (AREA)
- Diabetes (AREA)
- Hematology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biomedical Technology (AREA)
- Pulmonology (AREA)
- Biochemistry (AREA)
- Neurosurgery (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Physical Education & Sports Medicine (AREA)
- Biophysics (AREA)
- Rheumatology (AREA)
- Heart & Thoracic Surgery (AREA)
- Cardiology (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Dermatology (AREA)
- Urology & Nephrology (AREA)
- Pain & Pain Management (AREA)
- Gastroenterology & Hepatology (AREA)
- Epidemiology (AREA)
- Vascular Medicine (AREA)
- Oncology (AREA)
- Tropical Medicine & Parasitology (AREA)
Priority Applications (22)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP2006538540A JP5019881B2 (ja) | 2003-11-04 | 2004-11-04 | アンタゴニスト抗cd40モノクローナル抗体およびそれらを使用するための方法 |
| AU2004287879A AU2004287879C1 (en) | 2003-11-04 | 2004-11-04 | Antagonist anti-CD40 monoclonal antibodies and methods for their use |
| DE602004023961T DE602004023961D1 (de) | 2003-11-04 | 2004-11-04 | Antagonist-anti-cd40-monoklonale antikörper und anwendungsverfahren |
| CN2004800390435A CN1905897B (zh) | 2003-11-04 | 2004-11-04 | 拮抗性抗-cd40单克隆抗体和它们的使用方法 |
| KR1020067010885A KR101403910B1 (ko) | 2003-11-04 | 2004-11-04 | 길항제 항-cd40 단클론성 항체 및 그것의 사용 방법 |
| RSP-2010/0041A RS51230B (sr) | 2003-11-04 | 2004-11-04 | Antagonist anti-cd40 monoklonalna antitela i metode za njihovu upotrebu |
| DK04810510T DK1682180T3 (da) | 2003-11-04 | 2004-11-04 | Monoklonale antagonist-anti-CD40-antistoffer og fremgangsmåder til anvendelse deraf |
| EP04810510A EP1682180B1 (en) | 2003-11-04 | 2004-11-04 | Antagonist anti-cd40 monoclonal antibodies and methods for their use |
| CA2544949A CA2544949C (en) | 2003-11-04 | 2004-11-04 | Antagonist anti-cd40 monoclonal antibodies and methods for their use |
| ZA200604419A ZA200604419B (en) | 2003-11-04 | 2004-11-04 | Antagonist anti-CD40 monoclonal antibodies and methods for their use |
| SI200431280T SI1682180T1 (sl) | 2003-11-04 | 2004-11-04 | Antagonist anti cd monoklonskih antiteles in postopek za njihovo uporabo |
| HR20100066T HRP20100066T1 (hr) | 2003-11-04 | 2004-11-04 | Antagonisti anti-cd-40 monoklonalnih antitijela i metode njihove upotrebe |
| US10/577,390 US20080057070A1 (en) | 2004-11-04 | 2004-11-04 | Antagonist Anti-Cd40 Monoclonal Antibodies and Methods for Their Use |
| HK07100895.9A HK1095270B (en) | 2003-11-04 | 2004-11-04 | Antagonist anti-cd40 monoclonal antibodies and methods for their use |
| AT04810510T ATE447412T1 (de) | 2003-11-04 | 2004-11-04 | Antagonist-anti-cd40-monoklonale antikörper und anwendungsverfahren |
| PL04810510T PL1682180T3 (pl) | 2003-11-04 | 2004-11-04 | Antagonistyczne przeciwciała monoklonalne anty-CD40 i sposoby ich zastosowania |
| IL175225A IL175225A (en) | 2003-11-04 | 2006-04-26 | Antagonist anti-cd40 monoclonal antibody, an isolated nucleic acid encoding the antibody, a hybridoma cell line capable of producing the antibody, use of the antibody and pharmaceutical compositions comprising it |
| US11/932,472 US8277810B2 (en) | 2003-11-04 | 2007-10-31 | Antagonist anti-CD40 antibodies |
| AU2011201529A AU2011201529B2 (en) | 2003-11-04 | 2011-04-05 | Antagonist anti-CD40 monoclonal antibodies and methods for their use |
| US13/612,070 US8637032B2 (en) | 2003-11-04 | 2012-09-12 | Antagonist anti-CD40 monoclonal antibodies and methods for their use |
| US14/134,339 US20140205602A1 (en) | 2003-11-04 | 2013-12-19 | Antagonist anti-cd40 monoclonal antibodies and methods for their use |
| US15/241,136 US20170081416A1 (en) | 2003-11-04 | 2016-08-19 | Antagonist anti-cd40 monoclonal antibodies and methods for their use |
Applications Claiming Priority (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US51733703P | 2003-11-04 | 2003-11-04 | |
| US60/517,337 | 2003-11-04 | ||
| US52557903P | 2003-11-26 | 2003-11-26 | |
| US60/525,579 | 2003-11-26 | ||
| US56571004P | 2004-04-27 | 2004-04-27 | |
| US60/565,710 | 2004-04-27 |
Related Parent Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US10/578,387 Continuation-In-Part US20070218060A1 (en) | 2003-11-04 | 2004-11-04 | Use of Antagonist Anti-Cd40 Monoclonal Antibodies for Treatment of Multiple Myeloma |
| PCT/US2004/037281 Continuation-In-Part WO2005044855A2 (en) | 2003-11-04 | 2004-11-04 | Use of antagonist anti-cd40 monoclonal antibodies for treatment of multiple myeloma |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US10/577,390 A-371-Of-International US20080057070A1 (en) | 2004-11-04 | 2004-11-04 | Antagonist Anti-Cd40 Monoclonal Antibodies and Methods for Their Use |
| US11/932,472 Continuation-In-Part US8277810B2 (en) | 2003-11-04 | 2007-10-31 | Antagonist anti-CD40 antibodies |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2005044854A2 true WO2005044854A2 (en) | 2005-05-19 |
| WO2005044854A3 WO2005044854A3 (en) | 2005-08-11 |
Family
ID=34577667
Family Applications (3)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2004/037152 Ceased WO2005044854A2 (en) | 2003-11-04 | 2004-11-04 | Antagonist anti-cd40 monoclonal antibodies and methods for their use |
| PCT/US2004/036957 Ceased WO2005044306A2 (en) | 2003-11-04 | 2004-11-04 | Use of antagonist anti-cd40 antibodies for treatment of autoimmune and inflammatory diseases and organ transplant rejection |
| PCT/US2004/036958 Ceased WO2005044294A2 (en) | 2003-11-04 | 2004-11-04 | Method of therapy for cancers expressing the cd40 antigen |
Family Applications After (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2004/036957 Ceased WO2005044306A2 (en) | 2003-11-04 | 2004-11-04 | Use of antagonist anti-cd40 antibodies for treatment of autoimmune and inflammatory diseases and organ transplant rejection |
| PCT/US2004/036958 Ceased WO2005044294A2 (en) | 2003-11-04 | 2004-11-04 | Method of therapy for cancers expressing the cd40 antigen |
Country Status (22)
| Country | Link |
|---|---|
| EP (6) | EP1694360B1 (https=) |
| JP (6) | JP4746552B2 (https=) |
| KR (2) | KR101403910B1 (https=) |
| CN (2) | CN1905897B (https=) |
| AT (3) | ATE447412T1 (https=) |
| AU (3) | AU2004287482B2 (https=) |
| CA (3) | CA2544949C (https=) |
| CY (3) | CY1110231T1 (https=) |
| DE (3) | DE602004028037D1 (https=) |
| DK (4) | DK1694360T3 (https=) |
| EC (2) | ECSP066607A (https=) |
| ES (3) | ES2333971T3 (https=) |
| HR (2) | HRP20100066T1 (https=) |
| IL (1) | IL175225A (https=) |
| MA (1) | MA28331A1 (https=) |
| PL (4) | PL1682180T3 (https=) |
| PT (4) | PT1682180E (https=) |
| RS (2) | RS51230B (https=) |
| SG (1) | SG148143A1 (https=) |
| SI (3) | SI1682178T1 (https=) |
| WO (3) | WO2005044854A2 (https=) |
| ZA (1) | ZA200604419B (https=) |
Cited By (31)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2006138181A2 (en) | 2005-06-14 | 2006-12-28 | Amgen Inc. | Self-buffering protein formulations |
| WO2007053767A1 (en) * | 2005-11-01 | 2007-05-10 | Novartis Ag | Uses of anti-cd40 antibodies |
| WO2007089445A2 (en) | 2006-01-27 | 2007-08-09 | Amgen Inc. | Ang2 and vegf inhibitor combinations |
| WO2007124299A2 (en) | 2006-04-21 | 2007-11-01 | Novartis Ag | Antagonist anti-cd40 antibody pharmaceutical compositions |
| CN101351478A (zh) * | 2005-11-01 | 2009-01-21 | 诺华有限公司 | 抗cd40抗体的应用 |
| US20090041773A1 (en) * | 2005-05-18 | 2009-02-12 | Novartis Vaccines And Diagnostics , Inc. | Methods for diagnosis and treatment of proliferative disorders mediated by cd40 signaling |
| EP2211902A1 (en) * | 2007-11-09 | 2010-08-04 | Novartis AG | Uses of anti-cd40 antibodies |
| EP2312315A1 (en) | 2005-05-18 | 2011-04-20 | Novartis AG | Methods for diagnosis and treatment of diseases having an autoimmune and/or inflammatory component |
| US7951368B2 (en) | 2007-06-25 | 2011-05-31 | Amgen Inc. | Compositions of specific binding agents to hepatocyte growth factor |
| WO2012075111A1 (en) | 2010-11-30 | 2012-06-07 | Novartis Ag | Uses of anti-cd40 antibodies in combination therapy for b cell-related cancers |
| US8277810B2 (en) | 2003-11-04 | 2012-10-02 | Novartis Vaccines & Diagnostics, Inc. | Antagonist anti-CD40 antibodies |
| AU2007338791B2 (en) * | 2006-12-21 | 2014-03-13 | Amgen Inc | Stable buffered formulations containing polypeptides |
| US8828396B2 (en) | 2010-11-15 | 2014-09-09 | Novartis Ag | Silent Fc variants of anti-CD40 antibodies |
| WO2016029043A1 (en) | 2014-08-21 | 2016-02-25 | The General Hospital Corporation | Tumor necrosis factor superfamily and tnf-like ligand muteins and methods of preparing and using the same |
| WO2017220990A1 (en) | 2016-06-20 | 2017-12-28 | Kymab Limited | Anti-pd-l1 antibodies |
| US9974855B2 (en) | 2015-09-04 | 2018-05-22 | Primatope Therapeutics Inc. | Humanized anti-CD40 antibodies and methods of administering thereof |
| US9987356B2 (en) | 2011-03-11 | 2018-06-05 | Beth Israel Deaconess Medical Center, Inc. | Anti-CD40 antibodies and methods of administering thereof |
| US10111958B2 (en) | 2012-05-04 | 2018-10-30 | Novartis Ag | Anti-CD40 antibody formulation |
| WO2019241730A2 (en) | 2018-06-15 | 2019-12-19 | Flagship Pioneering Innovations V, Inc. | Increasing immune activity through modulation of postcellular signaling factors |
| US10633444B2 (en) | 2016-04-18 | 2020-04-28 | Celldex Therapeutics, Inc. | Agonistic antibodies that bind CD40 |
| WO2020227159A2 (en) | 2019-05-03 | 2020-11-12 | Flagship Pioneering Innovations V, Inc. | Methods of modulating immune activity |
| WO2021127217A1 (en) | 2019-12-17 | 2021-06-24 | Flagship Pioneering Innovations V, Inc. | Combination anti-cancer therapies with inducers of iron-dependent cellular disassembly |
| WO2022006179A1 (en) | 2020-06-29 | 2022-01-06 | Flagship Pioneering Innovations V, Inc. | Viruses engineered to promote thanotransmission and their use in treating cancer |
| WO2022165171A1 (en) | 2021-01-28 | 2022-08-04 | Regeneron Pharmaceuticals, Inc. | Compositions and methods for treating cytokine release syndrome |
| EP4209499A1 (en) | 2015-08-13 | 2023-07-12 | Amgen Inc. | Charged depth filtration of antigen-binding proteins |
| US11939388B2 (en) | 2016-07-14 | 2024-03-26 | Genmab A/S | Multispecific antibodies against CD40 and CD137 |
| WO2024151687A1 (en) | 2023-01-09 | 2024-07-18 | Flagship Pioneering Innovations V, Inc. | Genetic switches and their use in treating cancer |
| US12234294B2 (en) | 2021-11-05 | 2025-02-25 | Kiniksa Pharmaceuticals, Gmbh | Pharmaceutical composition of a humanized anti-CD40 antibody |
| WO2025184567A1 (en) | 2024-03-01 | 2025-09-04 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for re-dosing aav using anti-cd40 antagonistic antibody to suppress host anti-aav antibody response |
| WO2025184603A2 (en) | 2024-03-01 | 2025-09-04 | Regeneron Pharmaceuticals, Inc. | The use of cd40 inhibitors for inhibiting an immune response and enabling immunogen administration and re-administration |
| US12570751B2 (en) | 2017-08-04 | 2026-03-10 | Genmab A/S | Binding agents binding to PD-L1 and CD137 and use thereof |
Families Citing this family (55)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US7658924B2 (en) | 2001-10-11 | 2010-02-09 | Amgen Inc. | Angiopoietin-2 specific binding agents |
| DE10303974A1 (de) | 2003-01-31 | 2004-08-05 | Abbott Gmbh & Co. Kg | Amyloid-β(1-42)-Oligomere, Verfahren zu deren Herstellung und deren Verwendung |
| ATE447412T1 (de) * | 2003-11-04 | 2009-11-15 | Novartis Vaccines & Diagnostic | Antagonist-anti-cd40-monoklonale antikörper und anwendungsverfahren |
| WO2005044307A2 (en) * | 2003-11-04 | 2005-05-19 | Chiron Corporation | Methods of therapy for b cell-related cancers |
| US20050281815A1 (en) * | 2004-02-26 | 2005-12-22 | Dani Eshel | CD40 splice variants and their uses |
| US8691224B2 (en) | 2005-11-30 | 2014-04-08 | Abbvie Inc. | Anti-Aβ globulomer 5F7 antibodies |
| HRP20140240T4 (hr) | 2005-11-30 | 2017-02-24 | Abbvie Inc. | Monoklonalna antitijela protiv amiloidnih beta proteina i njihova upotreba |
| NZ592159A (en) | 2005-12-09 | 2012-12-21 | Amc Amsterdam | Means and methods for influencing the stability of antibody producing cells |
| US9005974B2 (en) | 2005-12-09 | 2015-04-14 | Academish Medisch Centrum Bij De Universiteit Van Amsterdam | Means and methods for influencing the stability of cells |
| US8455626B2 (en) | 2006-11-30 | 2013-06-04 | Abbott Laboratories | Aβ conformer selective anti-aβ globulomer monoclonal antibodies |
| US8895004B2 (en) | 2007-02-27 | 2014-11-25 | AbbVie Deutschland GmbH & Co. KG | Method for the treatment of amyloidoses |
| CN101910414B (zh) | 2007-11-07 | 2016-01-13 | 健泰科生物技术公司 | 用于评估b细胞淋巴瘤对抗cd40抗体治疗的响应性的方法和组合物 |
| JO2913B1 (en) | 2008-02-20 | 2015-09-15 | امجين إنك, | Antibodies directed towards angiopoietin-1 and angiopoietin-2 proteins and their uses |
| CN102459639A (zh) | 2009-04-18 | 2012-05-16 | 健泰科生物技术公司 | 用于评估b细胞淋巴瘤对抗cd40抗体治疗的响应性的方法 |
| US9273118B2 (en) | 2009-07-15 | 2016-03-01 | Aimm Therapeutics B.V. | Means and methods for producing high affinity antibodies |
| US8987419B2 (en) | 2010-04-15 | 2015-03-24 | AbbVie Deutschland GmbH & Co. KG | Amyloid-beta binding proteins |
| EP3533803B1 (en) | 2010-08-14 | 2021-10-27 | AbbVie Inc. | Anti-amyloid-beta antibodies |
| MX2019000046A (es) | 2010-11-04 | 2023-10-05 | Boehringer Ingelheim Int | Anticuerpos anti-il-23. |
| AU2016201742B2 (en) * | 2010-11-15 | 2017-11-02 | Novartis Ag | Silent Fc variants of anti-CD40 antibodies |
| CN103429615B (zh) | 2010-12-02 | 2018-03-16 | 埃姆医疗有限公司 | 用于生产高亲和力抗体的方式和方法 |
| JP5458188B2 (ja) | 2011-02-17 | 2014-04-02 | 協和発酵キリン株式会社 | 抗cd40抗体の高濃度製剤 |
| US9713636B2 (en) * | 2011-02-28 | 2017-07-25 | Napajen Pharma, Inc. | Nucleic acid/polysaccharide complex |
| HUE038848T2 (hu) | 2011-04-21 | 2018-11-28 | Bristol Myers Squibb Co | CD40-antagonista antitest polipeptidek |
| CN107233569B (zh) | 2011-10-25 | 2021-08-31 | 普罗西纳生物科学有限公司 | 抗体制剂和方法 |
| ES2716823T3 (es) | 2011-11-17 | 2019-06-17 | Jung Gundram | Anticuerpos biespecíficos para uso médico |
| PL3326649T3 (pl) * | 2012-05-03 | 2022-04-25 | Boehringer Ingelheim International Gmbh | Przeciwciała anty-il-23p19 |
| KR102270618B1 (ko) * | 2012-10-30 | 2021-06-30 | 아펙시젠, 인코포레이티드 | 항-cd40 항체 및 사용 방법 |
| CA2891764A1 (en) | 2012-11-19 | 2014-05-22 | Baliopharm Ag | Recombinant bispecific antibody binding to cd20 and cd95 |
| CN105636984A (zh) * | 2013-06-13 | 2016-06-01 | 法斯特弗沃德制药有限公司 | 用于治疗慢性炎症和预防胃肠道癌或纤维化的cd40信号转导抑制剂和其他化合物,该其他化合物是胆汁酸、胆汁酸衍生物、tgr5受体激动剂、fxr激动剂或其组合 |
| CA2938193C (en) | 2014-01-31 | 2023-05-02 | Aimm Therapeutics B.V. | Means and methods for producing stable antibodies |
| EP3113796A1 (en) | 2014-03-07 | 2017-01-11 | Bristol-Myers Squibb Company | Method of using antibody polypeptides that antagonize cd40 to treat ibd |
| CN108025068A (zh) * | 2014-03-12 | 2018-05-11 | 耶达研究与开发有限公司 | 降低系统性调节性t细胞水平或活性来治疗cns的疾病和损伤 |
| US10519237B2 (en) | 2014-03-12 | 2019-12-31 | Yeda Research And Development Co. Ltd | Reducing systemic regulatory T cell levels or activity for treatment of disease and injury of the CNS |
| CA2942245C (en) | 2014-03-12 | 2021-11-02 | Yeda Research And Development Co. Ltd. | Reducing systemic regulatory t cell levels or activity for treatment of disease and injury of the cns |
| US10618963B2 (en) | 2014-03-12 | 2020-04-14 | Yeda Research And Development Co. Ltd | Reducing systemic regulatory T cell levels or activity for treatment of disease and injury of the CNS |
| CN106132429A (zh) * | 2014-03-19 | 2016-11-16 | 百时美施贵宝公司 | 使用针对cd40l的域抗体治疗移植物排斥的方法 |
| EP3708679A1 (en) | 2014-07-24 | 2020-09-16 | Boehringer Ingelheim International GmbH | Biomarkers useful in the treatment of il-23a related diseases |
| EA202193002A2 (ru) | 2014-09-03 | 2022-03-31 | Бёрингер Ингельхайм Интернациональ Гмбх | Соединение, нацеленное на ил-23a и фно-альфа, и его применение |
| CN116059378A (zh) | 2014-12-10 | 2023-05-05 | 明尼苏达大学董事会 | 用于治疗疾病的遗传修饰的细胞、组织和器官 |
| AU2016215535B2 (en) | 2015-02-04 | 2021-09-16 | Boehringer Ingelheim International Gmbh | Methods of treating inflammatory diseases |
| CN107810198B (zh) | 2015-05-29 | 2021-09-03 | 艾伯维公司 | 抗cd40抗体及其用途 |
| BR112018006251A2 (pt) | 2015-09-30 | 2018-10-16 | Janssen Biotech Inc | anticorpos antagonistas que se ligam especificamente a cd40 humano e métodos de uso |
| CN111344304B (zh) * | 2017-06-01 | 2023-09-01 | Pb免疫治疗公司 | 新型抗cd40抗体及其用途 |
| AU2018278051A1 (en) * | 2017-06-01 | 2020-01-30 | Jiangsu Hengrui Medicine Co., Ltd. | Anti-CD40 antibody, antigen binding fragment thereof and medical use thereof |
| KR102665710B1 (ko) | 2017-08-24 | 2024-05-14 | 노보 노르디스크 에이/에스 | Glp-1 조성물 및 그 용도 |
| KR102850216B1 (ko) * | 2018-01-29 | 2025-08-26 | 더 리젠츠 오브 더 유니버시티 오브 캘리포니아 | Tlr2-매개 질환 및 장애를 치료하기 위한 요법 및 방법 |
| JP2021513367A (ja) * | 2018-02-12 | 2021-05-27 | ダイアベーツ−フリー, インコーポレイテッド | 改善されたアンタゴニスト的抗ヒトcd40モノクローナル抗体 |
| WO2020102454A1 (en) | 2018-11-13 | 2020-05-22 | Regents Of The University Of Minnesota | Cd40 targeted peptides and uses thereof |
| AR117091A1 (es) * | 2018-11-19 | 2021-07-07 | Bristol Myers Squibb Co | Anticuerpos monoclonales antagonistas contra cd40 y sus usos |
| TW202535466A (zh) | 2019-09-09 | 2025-09-16 | 德商百靈佳殷格翰國際股份有限公司 | 抗-il-23p19抗體調配物 |
| JP7761567B2 (ja) | 2020-02-18 | 2025-10-28 | ノヴォ ノルディスク アー/エス | 医薬製剤 |
| CN111763259B (zh) * | 2020-09-03 | 2020-12-15 | 北京百奥赛图基因生物技术有限公司 | 抗cd40抗体及其用途 |
| US20240343817A1 (en) * | 2021-07-14 | 2024-10-17 | Staidson (Beijing) Biopharmaceuticals Co., Ltd. | Antibody that specifically recognizes cd40 and application thereof |
| TW202328197A (zh) * | 2021-09-24 | 2023-07-16 | 大陸商正大天晴藥業集團股份有限公司 | 抗cd40抗體及其用途 |
| CN117229396A (zh) * | 2022-06-06 | 2023-12-15 | 普米斯生物技术(珠海)有限公司 | 抗cd40抗体及其用途 |
Family Cites Families (99)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| FR901228A (fr) | 1943-01-16 | 1945-07-20 | Deutsche Edelstahlwerke Ag | Système d'aimant à entrefer annulaire |
| NL154600B (nl) | 1971-02-10 | 1977-09-15 | Organon Nv | Werkwijze voor het aantonen en bepalen van specifiek bindende eiwitten en hun corresponderende bindbare stoffen. |
| US3817837A (en) | 1971-05-14 | 1974-06-18 | Syva Corp | Enzyme amplification assay |
| US3766162A (en) | 1971-08-24 | 1973-10-16 | Hoffmann La Roche | Barbituric acid antigens and antibodies specific therefor |
| US4179337A (en) | 1973-07-20 | 1979-12-18 | Davis Frank F | Non-immunogenic polypeptides |
| US4233402A (en) | 1978-04-05 | 1980-11-11 | Syva Company | Reagents and method employing channeling |
| NZ201918A (en) | 1981-09-18 | 1987-04-30 | Genentech Inc | N-terminal methionyl analogues of bovine growth hormone |
| JPS5896026A (ja) | 1981-10-30 | 1983-06-07 | Nippon Chemiphar Co Ltd | 新規ウロキナ−ゼ誘導体およびその製造法ならびにそれを含有する血栓溶解剤 |
| DE3377363D1 (en) | 1982-03-31 | 1988-08-18 | Ajinomoto Kk | Gene coding for interleukin-2 polypeptide, recombinant dna carrying said gene, cell lines possessing the recombinant dna,and method for producing interleukin-2 using said cells |
| CA1341562C (en) | 1982-03-31 | 2007-11-27 | Tadatsugu Taniguchi | Gene coded for interleukin-2 polypeptide, recombinant dna carrying the said gene, a living cell line possessing the recombinant dna, and method for producing interleukin-2 using the said cell |
| BE893016R (fr) | 1982-04-29 | 1982-08-16 | Amatucci Aldo | Turbine a vent |
| DE3380726D1 (en) | 1982-06-24 | 1989-11-23 | Japan Chem Res | Long-acting composition |
| US4992271A (en) | 1982-09-23 | 1991-02-12 | Cetus Corporation | Formulation for lipophilic IL-2 proteins |
| IE56026B1 (en) | 1982-10-19 | 1991-03-27 | Cetus Corp | Cysteine-depleted muteins of biologically active proteins |
| US5700913A (en) | 1982-12-15 | 1997-12-23 | Ajinomoto Co., Inc. | Unglycosylated human interleukin-2 polypeptides |
| CA1247080A (en) | 1983-03-08 | 1988-12-20 | Commonwealth Serum Laboratories Commission | Antigenically active amino acid sequences |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US4518584A (en) | 1983-04-15 | 1985-05-21 | Cetus Corporation | Human recombinant interleukin-2 muteins |
| WO1985000817A1 (en) | 1983-08-10 | 1985-02-28 | Amgen | Microbial expression of interleukin ii |
| US4604377A (en) | 1984-03-28 | 1986-08-05 | Cetus Corporation | Pharmaceutical compositions of microbially produced interleukin-2 |
| US4530787A (en) | 1984-03-28 | 1985-07-23 | Cetus Corporation | Controlled oxidation of microbially produced cysteine-containing proteins |
| US4656132A (en) | 1984-03-28 | 1987-04-07 | Cetus Corporation | Method of improving the yield of heterologous protein produced by cultivating recombinant bacteria |
| US4569790A (en) | 1984-03-28 | 1986-02-11 | Cetus Corporation | Process for recovering microbially produced interleukin-2 and purified recombinant interleukin-2 compositions |
| US4572798A (en) | 1984-12-06 | 1986-02-25 | Cetus Corporation | Method for promoting disulfide bond formation in recombinant proteins |
| US4752585A (en) | 1985-12-17 | 1988-06-21 | Cetus Corporation | Oxidation-resistant muteins |
| CA1340265C (en) | 1985-01-18 | 1998-12-15 | Kirston E. Koths | Oxidation resistant muteins |
| US5981216A (en) | 1985-04-01 | 1999-11-09 | Alusuisse Holdings A.G. | Transformed myeloma cell-line and a process for the expression of a gene coding for a eukaryotic polypeptide employing same |
| US5206344A (en) | 1985-06-26 | 1993-04-27 | Cetus Oncology Corporation | Interleukin-2 muteins and polymer conjugation thereof |
| US4748234A (en) | 1985-06-26 | 1988-05-31 | Cetus Corporation | Process for recovering refractile bodies containing heterologous proteins from microbial hosts |
| US4766106A (en) | 1985-06-26 | 1988-08-23 | Cetus Corporation | Solubilization of proteins for pharmaceutical compositions using polymer conjugation |
| US4676980A (en) | 1985-09-23 | 1987-06-30 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Target specific cross-linked heteroantibodies |
| US4816440A (en) | 1985-09-26 | 1989-03-28 | Cetus Corporation | Stable formulation of biologically active proteins for parenteral injection |
| GB8601597D0 (en) | 1986-01-23 | 1986-02-26 | Wilson R H | Nucleotide sequences |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| US4745180A (en) | 1986-06-27 | 1988-05-17 | Cetus Corporation | Solubilization of proteins for pharmaceutical compositions using heparin fragments |
| US4946778A (en) | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
| US5260203A (en) | 1986-09-02 | 1993-11-09 | Enzon, Inc. | Single polypeptide chain binding molecules |
| US4931544A (en) | 1986-09-04 | 1990-06-05 | Cetus Corporation | Succinylated interleukin-2 for pharmaceutical compositions |
| US4831175A (en) | 1986-09-05 | 1989-05-16 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Backbone polysubstituted chelates for forming a metal chelate-protein conjugate |
| CA1292686C (en) | 1986-10-27 | 1991-12-03 | Ze'ev Shaked | Pharmaceutical compositions of recombinant interleukin-2 and formulation process |
| CA1294215C (en) | 1986-10-27 | 1992-01-14 | Ze'ev Shaked | Pharmaceutical compositions of recombinant beta-interferon and formulation processes |
| US4894226A (en) | 1986-11-14 | 1990-01-16 | Cetus Corporation | Solubilization of proteins for pharmaceutical compositions using polyproline conjugation |
| US4873192A (en) | 1987-02-17 | 1989-10-10 | The United States Of America As Represented By The Department Of Health And Human Services | Process for site specific mutagenesis without phenotypic selection |
| US4931543A (en) | 1987-05-11 | 1990-06-05 | Cetus Corporation | Process for recovering microbially produced interleukin-2 |
| GB8717430D0 (en) | 1987-07-23 | 1987-08-26 | Celltech Ltd | Recombinant dna product |
| US5879936A (en) | 1988-04-18 | 1999-03-09 | Aluguisse Holding A.G. | Recombinant DNA methods, vectors and host cells |
| US5078997A (en) | 1988-07-13 | 1992-01-07 | Cetus Corporation | Pharmaceutical composition for interleukin-2 containing physiologically compatible stabilizers |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| DE69019727T2 (de) | 1989-09-21 | 1995-10-19 | Idemitsu Kosan Co | Arylstyrolpolymer und -copolymer und verfahren zu ihrer herstellung. |
| US5859205A (en) | 1989-12-21 | 1999-01-12 | Celltech Limited | Humanised antibodies |
| DE69120146T2 (de) | 1990-01-12 | 1996-12-12 | Cell Genesys Inc | Erzeugung xenogener antikörper |
| US6075181A (en) | 1990-01-12 | 2000-06-13 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US5891693A (en) | 1990-01-25 | 1999-04-06 | Alusuisse Holdings A.G. | Recombinant DNA methods vectors and host cells |
| IE66205B1 (en) | 1990-06-14 | 1995-12-13 | Paul A Bartlett | Polypeptide analogs |
| US5877397A (en) | 1990-08-29 | 1999-03-02 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| GB9022543D0 (en) | 1990-10-17 | 1990-11-28 | Wellcome Found | Antibody production |
| MX9204374A (es) | 1991-07-25 | 1993-03-01 | Idec Pharma Corp | Anticuerpo recombinante y metodo para su produccion. |
| US5756096A (en) | 1991-07-25 | 1998-05-26 | Idec Pharmaceuticals Corporation | Recombinant antibodies for human therapy |
| US5962406A (en) | 1991-10-25 | 1999-10-05 | Immunex Corporation | Recombinant soluble CD40 ligand polypeptide and pharmaceutical composition containing the same |
| US5229109A (en) | 1992-04-14 | 1993-07-20 | Board Of Regents, The University Of Texas System | Low toxicity interleukin-2 analogues for use in immunotherapy |
| US5874082A (en) | 1992-07-09 | 1999-02-23 | Chiron Corporation | Humanized anti-CD40 monoclonal antibodies and fragments capable of blocking B cell proliferation |
| US5397703A (en) | 1992-07-09 | 1995-03-14 | Cetus Oncology Corporation | Method for generation of antibodies to cell surface molecules |
| WO1994012520A1 (en) | 1992-11-20 | 1994-06-09 | Enzon, Inc. | Linker for linked fusion polypeptides |
| CA2115811A1 (en) | 1993-02-17 | 1994-08-18 | Claus Krebber | A method for in vivo selection of ligand-binding proteins |
| US5595721A (en) | 1993-09-16 | 1997-01-21 | Coulter Pharmaceutical, Inc. | Radioimmunotherapy of lymphoma using anti-CD20 |
| ES2222463T3 (es) | 1993-12-23 | 2005-02-01 | Immunex Corporation | Uso de anticuerpos monoclonales o ligandos oligomericos solubles en la fabricacion de un medicamento para la prevencion o tratamiento de trastornos neoplasicos. |
| CA2184356A1 (en) | 1994-03-03 | 1995-09-08 | Russell P. Rother | Terminal complement inhibitor fusion genes and proteins |
| US6091001A (en) | 1995-03-29 | 2000-07-18 | Abgenix, Inc. | Production of antibodies using Cre-mediated site-specific recombination |
| US5830698A (en) | 1997-03-14 | 1998-11-03 | Idec Pharmaceuticals Corporation | Method for integrating genes at specific sites in mammalian cells via homologous recombination and vectors for accomplishing the same |
| EP0983303B1 (en) | 1997-05-21 | 2006-03-08 | Biovation Limited | Method for the production of non-immunogenic proteins |
| CA2635352C (en) | 1997-06-13 | 2012-09-11 | Genentech, Inc. | Stabilized antibody formulation |
| CN1261285A (zh) | 1997-06-20 | 2000-07-26 | 拜奥根有限公司 | 治疗性蛋白抑制剂综合症的cd154阻断治疗 |
| US6051228A (en) * | 1998-02-19 | 2000-04-18 | Bristol-Myers Squibb Co. | Antibodies against human CD40 |
| DZ2788A1 (fr) | 1998-05-15 | 2003-12-01 | Bayer Ag | Agonistes et antagonistes selectifs à IL-2. |
| US6168785B1 (en) | 1998-07-16 | 2001-01-02 | Institut Pasteur | Biological applications of new peptides of IL-2 and derivatives and use as therapeutic agents |
| AU776910B2 (en) | 1998-12-08 | 2004-09-23 | Merck Patent Gesellschaft Mit Beschrankter Haftung | Modifying protein immunogenicity |
| US6737056B1 (en) | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
| US20020006901A1 (en) | 1999-02-05 | 2002-01-17 | Aldo T. Iacono | Use of aerosolized cyclosporine for prevention and treatment of pulmonary disease |
| MY133346A (en) | 1999-03-01 | 2007-11-30 | Biogen Inc | Kit for radiolabeling ligands with yttrium-90 |
| US20020102208A1 (en) | 1999-03-01 | 2002-08-01 | Paul Chinn | Radiolabeling kit and binding assay |
| AU4057300A (en) | 1999-03-30 | 2000-10-16 | Board Of Regents, The University Of Texas System | Compositions and methods for modifying toxic effects of proteinacious compounds |
| JP2003508016A (ja) | 1999-04-16 | 2003-03-04 | エフ.ホフマン−ラ ロシュ アーゲー | Cd40/cd40lキメラポリペプチドをコードする核酸、それらの生成方法及びそれらの使用 |
| US6946129B1 (en) | 1999-06-08 | 2005-09-20 | Seattle Genetics, Inc. | Recombinant anti-CD40 antibody and uses thereof |
| CZ20021186A3 (cs) | 1999-10-04 | 2002-11-13 | Chiron Corporation | Farmaceutické prostředky obsahující stabilizovaný kapalný polypeptid |
| US6849425B1 (en) | 1999-10-14 | 2005-02-01 | Ixsys, Inc. | Methods of optimizing antibody variable region binding affinity |
| AU1590201A (en) * | 1999-11-09 | 2001-06-06 | Chiron Corporation | Compositions and methods for treating autoimmune diseases and transplant rejections |
| EP2213743A1 (en) | 2000-04-12 | 2010-08-04 | Human Genome Sciences, Inc. | Albumin fusion proteins |
| AU2001259215A1 (en) * | 2000-04-28 | 2001-11-12 | La Jolla Institute For Allergy And Immunology | Human anti-cd40 antibodies and methods of making and using same |
| US20030059427A1 (en) * | 2000-04-28 | 2003-03-27 | Force Walker R. | Isolation and characterization of highly active anti-CD40 antibody |
| EP1322383B9 (en) | 2000-10-02 | 2006-09-06 | Chiron Corporation | Methods of therapy for b-cell malignancies using antagonist anti-cd40 antibodies |
| AR039067A1 (es) | 2001-11-09 | 2005-02-09 | Pfizer Prod Inc | Anticuerpos para cd40 |
| AU2002346581A1 (en) * | 2001-11-26 | 2003-06-10 | Chiron Corporation | Antagonist anti-cd40 monoclonal antibody therapy for multiple sclerosis treatment |
| US20040132101A1 (en) | 2002-09-27 | 2004-07-08 | Xencor | Optimized Fc variants and methods for their generation |
| ATE447412T1 (de) * | 2003-11-04 | 2009-11-15 | Novartis Vaccines & Diagnostic | Antagonist-anti-cd40-monoklonale antikörper und anwendungsverfahren |
| KR101128777B1 (ko) * | 2003-11-04 | 2012-04-13 | 조마 테크놀로지 리미티드 | 다발성 골수종을 치료하기 위한 길항제 항-cd40단클론성 항체의 용도 |
| PL1680141T3 (pl) * | 2003-11-04 | 2011-04-29 | Novartis Vaccines & Diagnostics Inc | Sposoby leczenia guzów litych wykazujących ekspresję antygenu powierzchniowego CD40 |
| SI1682177T1 (sl) * | 2003-11-04 | 2010-12-31 | Novartis Vaccines & Diagnostic | Uporaba antagonističnih anti-CD40 protiteles za zdravljenje kronične limfocitne levkemije |
| WO2005044307A2 (en) * | 2003-11-04 | 2005-05-19 | Chiron Corporation | Methods of therapy for b cell-related cancers |
| JP6039343B2 (ja) | 2012-10-04 | 2016-12-07 | キヤノン株式会社 | 電子機器、電子機器の制御方法、プログラム、記憶媒体 |
-
2004
- 2004-11-04 AT AT04810510T patent/ATE447412T1/de active
- 2004-11-04 ZA ZA200604419A patent/ZA200604419B/xx unknown
- 2004-11-04 PL PL04810510T patent/PL1682180T3/pl unknown
- 2004-11-04 EP EP04810420A patent/EP1694360B1/en not_active Expired - Lifetime
- 2004-11-04 CA CA2544949A patent/CA2544949C/en not_active Expired - Fee Related
- 2004-11-04 DK DK04810420.2T patent/DK1694360T3/da active
- 2004-11-04 SG SG200808017-8A patent/SG148143A1/en unknown
- 2004-11-04 PT PT04810510T patent/PT1682180E/pt unknown
- 2004-11-04 KR KR1020067010885A patent/KR101403910B1/ko not_active Expired - Fee Related
- 2004-11-04 DK DK09075395.5T patent/DK2149585T3/da active
- 2004-11-04 SI SI200431514T patent/SI1682178T1/sl unknown
- 2004-11-04 DE DE602004028037T patent/DE602004028037D1/de not_active Expired - Lifetime
- 2004-11-04 EP EP10006780A patent/EP2255828A1/en not_active Withdrawn
- 2004-11-04 WO PCT/US2004/037152 patent/WO2005044854A2/en not_active Ceased
- 2004-11-04 JP JP2006538513A patent/JP4746552B2/ja not_active Expired - Lifetime
- 2004-11-04 DK DK04810510T patent/DK1682180T3/da active
- 2004-11-04 CA CA002544948A patent/CA2544948A1/en not_active Abandoned
- 2004-11-04 DK DK04810421.0T patent/DK1682178T3/da active
- 2004-11-04 EP EP09075395.5A patent/EP2149585B1/en not_active Expired - Lifetime
- 2004-11-04 PL PL04810420T patent/PL1694360T3/pl unknown
- 2004-11-04 HR HR20100066T patent/HRP20100066T1/hr unknown
- 2004-11-04 WO PCT/US2004/036957 patent/WO2005044306A2/en not_active Ceased
- 2004-11-04 KR KR1020067010894A patent/KR101125127B1/ko not_active Expired - Fee Related
- 2004-11-04 PL PL09075395T patent/PL2149585T3/pl unknown
- 2004-11-04 ES ES04810510T patent/ES2333971T3/es not_active Expired - Lifetime
- 2004-11-04 PT PT90753955T patent/PT2149585E/pt unknown
- 2004-11-04 PT PT04810421T patent/PT1682178E/pt unknown
- 2004-11-04 AU AU2004287482A patent/AU2004287482B2/en not_active Ceased
- 2004-11-04 EP EP04810510A patent/EP1682180B1/en not_active Expired - Lifetime
- 2004-11-04 PT PT04810420T patent/PT1694360E/pt unknown
- 2004-11-04 WO PCT/US2004/036958 patent/WO2005044294A2/en not_active Ceased
- 2004-11-04 ES ES04810421T patent/ES2346977T3/es not_active Expired - Lifetime
- 2004-11-04 SI SI200431525T patent/SI1694360T1/sl unknown
- 2004-11-04 EP EP04810421A patent/EP1682178B8/en not_active Expired - Lifetime
- 2004-11-04 RS RSP-2010/0041A patent/RS51230B/sr unknown
- 2004-11-04 RS RS20130482A patent/RS53073B/sr unknown
- 2004-11-04 ES ES09075395T patent/ES2435410T3/es not_active Expired - Lifetime
- 2004-11-04 EP EP10007970A patent/EP2248830A1/en not_active Withdrawn
- 2004-11-04 PL PL04810421T patent/PL1682178T3/pl unknown
- 2004-11-04 DE DE602004023961T patent/DE602004023961D1/de not_active Expired - Lifetime
- 2004-11-04 DE DE602004028505T patent/DE602004028505D1/de not_active Expired - Lifetime
- 2004-11-04 JP JP2006538514A patent/JP4765039B2/ja not_active Expired - Fee Related
- 2004-11-04 AT AT04810421T patent/ATE473016T1/de active
- 2004-11-04 CN CN2004800390435A patent/CN1905897B/zh not_active Expired - Lifetime
- 2004-11-04 CN CN200480037489.4A patent/CN1938045B/zh not_active Expired - Lifetime
- 2004-11-04 SI SI200431280T patent/SI1682180T1/sl unknown
- 2004-11-04 CA CA2544853A patent/CA2544853C/en not_active Expired - Fee Related
- 2004-11-04 AU AU2004287879A patent/AU2004287879C1/en not_active Ceased
- 2004-11-04 JP JP2006538540A patent/JP5019881B2/ja not_active Expired - Lifetime
- 2004-11-04 AT AT04810420T patent/ATE476448T1/de active
-
2006
- 2006-04-26 IL IL175225A patent/IL175225A/en not_active IP Right Cessation
- 2006-06-05 MA MA29078A patent/MA28331A1/fr unknown
- 2006-06-05 EC EC2006006607A patent/ECSP066607A/es unknown
-
2010
- 2010-01-15 CY CY20101100045T patent/CY1110231T1/el unknown
- 2010-09-28 CY CY20101100869T patent/CY1110803T1/el unknown
- 2010-10-18 CY CY20101100931T patent/CY1110839T1/el unknown
- 2010-12-13 JP JP2010277537A patent/JP2011072317A/ja not_active Withdrawn
-
2011
- 2011-02-18 JP JP2011033969A patent/JP2011126900A/ja not_active Withdrawn
- 2011-02-25 JP JP2011040922A patent/JP2011105769A/ja not_active Withdrawn
- 2011-04-05 AU AU2011201529A patent/AU2011201529B2/en not_active Ceased
-
2012
- 2012-03-05 EC ECSP12006607 patent/ECSP12006607A/es unknown
-
2013
- 2013-11-13 HR HRP20131085TT patent/HRP20131085T1/hr unknown
Cited By (66)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US8277810B2 (en) | 2003-11-04 | 2012-10-02 | Novartis Vaccines & Diagnostics, Inc. | Antagonist anti-CD40 antibodies |
| US8637032B2 (en) | 2003-11-04 | 2014-01-28 | Novartis Vaccines And Diagnostics, Inc. | Antagonist anti-CD40 monoclonal antibodies and methods for their use |
| US20090041773A1 (en) * | 2005-05-18 | 2009-02-12 | Novartis Vaccines And Diagnostics , Inc. | Methods for diagnosis and treatment of proliferative disorders mediated by cd40 signaling |
| US8337851B2 (en) * | 2005-05-18 | 2012-12-25 | Novartis Ag | Methods of monitoring the efficacy of anti-CD40 antibodies in treating a subject for a CD40-expressing cancer |
| EP2312315A1 (en) | 2005-05-18 | 2011-04-20 | Novartis AG | Methods for diagnosis and treatment of diseases having an autoimmune and/or inflammatory component |
| EP3673919A1 (en) | 2005-06-14 | 2020-07-01 | Amgen Inc. | Self-buffering protein formulations |
| EP3351269A1 (en) | 2005-06-14 | 2018-07-25 | Amgen Inc. | Self-buffering protein formulations |
| WO2006138181A2 (en) | 2005-06-14 | 2006-12-28 | Amgen Inc. | Self-buffering protein formulations |
| CN101351478A (zh) * | 2005-11-01 | 2009-01-21 | 诺华有限公司 | 抗cd40抗体的应用 |
| US8926979B2 (en) | 2005-11-01 | 2015-01-06 | Novartis Ag | Treatment of cancer or pre-malignant conditions using anti-CD40 antibodies |
| CN101325970B (zh) * | 2005-11-01 | 2013-08-14 | 诺华有限公司 | 抗cd40抗体的应用 |
| RU2442605C2 (ru) * | 2005-11-01 | 2012-02-20 | Новартис Аг | Применения антител против cd40 |
| AU2006308606C1 (en) * | 2005-11-01 | 2013-07-25 | Novartis Ag | Uses of anti-CD40 antibodies |
| WO2007053767A1 (en) * | 2005-11-01 | 2007-05-10 | Novartis Ag | Uses of anti-cd40 antibodies |
| AU2006308606B2 (en) * | 2005-11-01 | 2013-03-28 | Novartis Ag | Uses of anti-CD40 antibodies |
| WO2007089445A2 (en) | 2006-01-27 | 2007-08-09 | Amgen Inc. | Ang2 and vegf inhibitor combinations |
| JP2013129673A (ja) * | 2006-04-21 | 2013-07-04 | Novartis Ag | 拮抗剤抗cd40抗体薬学的組成物 |
| WO2007124299A3 (en) * | 2006-04-21 | 2008-01-03 | Novartis Ag | Antagonist anti-cd40 antibody pharmaceutical compositions |
| WO2007124299A2 (en) | 2006-04-21 | 2007-11-01 | Novartis Ag | Antagonist anti-cd40 antibody pharmaceutical compositions |
| EA018301B1 (ru) * | 2006-04-21 | 2013-07-30 | Новартис Аг | Фармацевтические композиции, содержащие антагонистическое моноклональное антитело к cd40, и их применение |
| AU2007240507B2 (en) * | 2006-04-21 | 2013-07-18 | Novartis Ag | Antagonist anti-CD40 antibody pharmaceutical compositions |
| JP2009534401A (ja) * | 2006-04-21 | 2009-09-24 | ノバルティス アーゲー | 拮抗剤抗cd40抗体薬学的組成物 |
| US8945564B2 (en) | 2006-04-21 | 2015-02-03 | Novartis Ag | Antagonist anti-CD40 antibody pharmaceutical compositions |
| AU2007338791B2 (en) * | 2006-12-21 | 2014-03-13 | Amgen Inc | Stable buffered formulations containing polypeptides |
| US7951368B2 (en) | 2007-06-25 | 2011-05-31 | Amgen Inc. | Compositions of specific binding agents to hepatocyte growth factor |
| EP2211902A1 (en) * | 2007-11-09 | 2010-08-04 | Novartis AG | Uses of anti-cd40 antibodies |
| US8828396B2 (en) | 2010-11-15 | 2014-09-09 | Novartis Ag | Silent Fc variants of anti-CD40 antibodies |
| US9221913B2 (en) | 2010-11-15 | 2015-12-29 | Novartis Ag | Silent Fc variants of anti-CD40 antibodies |
| US9688768B2 (en) | 2010-11-15 | 2017-06-27 | Novartis Ag | Silent Fc variants of anti-CD40 antibodies |
| US9828433B2 (en) | 2010-11-15 | 2017-11-28 | Novartis Ag | Nucleic acids encoding silent Fc variants of anti-CD40 antibodies |
| US10323096B2 (en) | 2010-11-15 | 2019-06-18 | Novartis Ag | Nucleic acids encoding silent Fc variants of anti-CD40 antibodies |
| US11124578B2 (en) | 2010-11-15 | 2021-09-21 | Novartis Ag | Method of treating transplant rejection with silent Fc variants of anti-CD40 antibodies |
| WO2012075111A1 (en) | 2010-11-30 | 2012-06-07 | Novartis Ag | Uses of anti-cd40 antibodies in combination therapy for b cell-related cancers |
| US9987356B2 (en) | 2011-03-11 | 2018-06-05 | Beth Israel Deaconess Medical Center, Inc. | Anti-CD40 antibodies and methods of administering thereof |
| US10561728B2 (en) | 2011-03-11 | 2020-02-18 | Beth Israel Deaconess Medical Center, Inc. | Polynucleotides encoding anti-CD40 antibodies |
| US11612659B2 (en) | 2012-05-04 | 2023-03-28 | Novartis Ag | Anti-CD40 antibody formulation delivery device |
| US10111958B2 (en) | 2012-05-04 | 2018-10-30 | Novartis Ag | Anti-CD40 antibody formulation |
| US10588976B2 (en) | 2012-05-04 | 2020-03-17 | Novartis Ag | Anti-CD40 antibody formulation |
| WO2016029043A1 (en) | 2014-08-21 | 2016-02-25 | The General Hospital Corporation | Tumor necrosis factor superfamily and tnf-like ligand muteins and methods of preparing and using the same |
| EP4470648A2 (en) | 2015-08-13 | 2024-12-04 | Amgen Inc. | Charged depth filtration of antigen-binding proteins |
| EP4209499A1 (en) | 2015-08-13 | 2023-07-12 | Amgen Inc. | Charged depth filtration of antigen-binding proteins |
| US11439706B2 (en) | 2015-09-04 | 2022-09-13 | Primatope Therapeutics Inc. | Polynucleotides encoding a humanized anti-CD40 antibody |
| US12514924B2 (en) | 2015-09-04 | 2026-01-06 | Primatope Therapeutics Inc. | Humanized anti-CD40 antibodies and uses thereof |
| US9974855B2 (en) | 2015-09-04 | 2018-05-22 | Primatope Therapeutics Inc. | Humanized anti-CD40 antibodies and methods of administering thereof |
| US10772958B2 (en) | 2015-09-04 | 2020-09-15 | Primatope Therapeutics Inc. | Humanized anti-CD40 antibodies and methods of administering thereof |
| US10633444B2 (en) | 2016-04-18 | 2020-04-28 | Celldex Therapeutics, Inc. | Agonistic antibodies that bind CD40 |
| US10941201B2 (en) | 2016-04-18 | 2021-03-09 | Celldex Therapeutics, Inc. | Methods of inducing or enhancing an immune response comprising administering agonistic anti-CD40 antibodies |
| US10865244B2 (en) | 2016-04-18 | 2020-12-15 | Celldex Therapeutics, Inc. | Nucleic acids encoding agonistic antibodies that bind CD40 |
| US12297266B2 (en) | 2016-04-18 | 2025-05-13 | Celldex Therapeutics, Inc. | Agonistic antibodies that bind human CD40 and uses thereof |
| WO2017220989A1 (en) | 2016-06-20 | 2017-12-28 | Kymab Limited | Anti-pd-l1 and il-2 cytokines |
| WO2017220990A1 (en) | 2016-06-20 | 2017-12-28 | Kymab Limited | Anti-pd-l1 antibodies |
| WO2017220988A1 (en) | 2016-06-20 | 2017-12-28 | Kymab Limited | Multispecific antibodies for immuno-oncology |
| US11939388B2 (en) | 2016-07-14 | 2024-03-26 | Genmab A/S | Multispecific antibodies against CD40 and CD137 |
| US12077596B2 (en) | 2016-07-14 | 2024-09-03 | Genmab A/S | Multispecific antibodies against CD40 and CD137 |
| US12570751B2 (en) | 2017-08-04 | 2026-03-10 | Genmab A/S | Binding agents binding to PD-L1 and CD137 and use thereof |
| WO2019241730A2 (en) | 2018-06-15 | 2019-12-19 | Flagship Pioneering Innovations V, Inc. | Increasing immune activity through modulation of postcellular signaling factors |
| WO2020227159A2 (en) | 2019-05-03 | 2020-11-12 | Flagship Pioneering Innovations V, Inc. | Methods of modulating immune activity |
| WO2021127217A1 (en) | 2019-12-17 | 2021-06-24 | Flagship Pioneering Innovations V, Inc. | Combination anti-cancer therapies with inducers of iron-dependent cellular disassembly |
| WO2022006179A1 (en) | 2020-06-29 | 2022-01-06 | Flagship Pioneering Innovations V, Inc. | Viruses engineered to promote thanotransmission and their use in treating cancer |
| WO2022165171A1 (en) | 2021-01-28 | 2022-08-04 | Regeneron Pharmaceuticals, Inc. | Compositions and methods for treating cytokine release syndrome |
| US12274747B2 (en) | 2021-01-28 | 2025-04-15 | Regeneron Pharmaceuticals, Inc. | Compositions and methods for treating cytokine release syndrome |
| EP4538292A2 (en) | 2021-01-28 | 2025-04-16 | Regeneron Pharmaceuticals, Inc. | Compositions and methods for treating cytokine release syndrome |
| US12234294B2 (en) | 2021-11-05 | 2025-02-25 | Kiniksa Pharmaceuticals, Gmbh | Pharmaceutical composition of a humanized anti-CD40 antibody |
| WO2024151687A1 (en) | 2023-01-09 | 2024-07-18 | Flagship Pioneering Innovations V, Inc. | Genetic switches and their use in treating cancer |
| WO2025184603A2 (en) | 2024-03-01 | 2025-09-04 | Regeneron Pharmaceuticals, Inc. | The use of cd40 inhibitors for inhibiting an immune response and enabling immunogen administration and re-administration |
| WO2025184567A1 (en) | 2024-03-01 | 2025-09-04 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for re-dosing aav using anti-cd40 antagonistic antibody to suppress host anti-aav antibody response |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP1682180B1 (en) | Antagonist anti-cd40 monoclonal antibodies and methods for their use | |
| EP1682177B1 (en) | Use of antagonist anti-cd40 antibodies for treatment of chronic lymphocytic leukemia | |
| EP1684805B1 (en) | Use of antagonist anti-cd40 monoclonal antibodies for treatment of multiple myeloma | |
| EP1684869B1 (en) | Methods of therapy for b cell-related cancers | |
| US20080057070A1 (en) | Antagonist Anti-Cd40 Monoclonal Antibodies and Methods for Their Use | |
| WO2005044305A2 (en) | Methods of therapy for solid tumors expressing the cd40 cell-surface antigen | |
| HK1095270B (en) | Antagonist anti-cd40 monoclonal antibodies and methods for their use | |
| HK1139964B (en) | Use of antagonistic anti-cd40 monoclonal antibodies | |
| ZA200802168B (en) | Antagonist anti-CD40 monoclonal antibodies and methods for their use | |
| HK1095269B (en) | Use of antagonist anti-cd40 antibodies for treatment of chronic lymphocytic leukemia | |
| MXPA06004983A (en) | Antagonist anti-cd40 monoclonal antibodies and methods for their use | |
| HK1094162B (en) | Use of antagonist anti-cd40 monoclonal antibodies for treatment of multiple myeloma |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 200480039043.5 Country of ref document: CN |
|
| AK | Designated states |
Kind code of ref document: A2 Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BW BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE EG ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NA NI NO NZ OM PG PH PL PT RO RU SC SD SE SG SK SL SY TJ TM TN TR TT TZ UA UG US UZ VC VN YU ZA ZM ZW |
|
| AL | Designated countries for regional patents |
Kind code of ref document: A2 Designated state(s): GM KE LS MW MZ NA SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IS IT LU MC NL PL PT RO SE SI SK TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
| WWE | Wipo information: entry into national phase |
Ref document number: 175225 Country of ref document: IL |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2006538540 Country of ref document: JP Ref document number: 2544949 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: PA/a/2006/004983 Country of ref document: MX |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 12006500893 Country of ref document: PH |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2004287879 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2006/04419 Country of ref document: ZA Ref document number: 200604419 Country of ref document: ZA Ref document number: DZP2006000268 Country of ref document: DZ |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2004810510 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 1020067010885 Country of ref document: KR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 06054042 Country of ref document: CO Ref document number: 06054042A Country of ref document: CO Ref document number: 1540/KOLNP/2006 Country of ref document: IN |
|
| ENP | Entry into the national phase |
Ref document number: 2004287879 Country of ref document: AU Date of ref document: 20041104 Kind code of ref document: A |
|
| WWP | Wipo information: published in national office |
Ref document number: 2004287879 Country of ref document: AU |
|
| WWP | Wipo information: published in national office |
Ref document number: 2004810510 Country of ref document: EP |
|
| WWP | Wipo information: published in national office |
Ref document number: 1020067010885 Country of ref document: KR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 10577390 Country of ref document: US |
|
| WWE | Wipo information: entry into national phase |
Ref document number: P-2010/0041 Country of ref document: RS |