WO2004016282A1 - Vaccine compositions containing amyloid beta1-6 antigen arrays - Google Patents

Vaccine compositions containing amyloid beta1-6 antigen arrays Download PDF

Info

Publication number
WO2004016282A1
WO2004016282A1 PCT/EP2003/007864 EP0307864W WO2004016282A1 WO 2004016282 A1 WO2004016282 A1 WO 2004016282A1 EP 0307864 W EP0307864 W EP 0307864W WO 2004016282 A1 WO2004016282 A1 WO 2004016282A1
Authority
WO
WIPO (PCT)
Prior art keywords
vims
seq
aβl
peptide
composition
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2003/007864
Other languages
English (en)
French (fr)
Inventor
Martin F. Bachmann
Alain Tissot
Rainer Ortmann
Rainer LÜÖND
Matthias Staufenbiel
Peter Frey
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Cytos Biotechnology AG
Novartis Pharma AG
Original Assignee
Cytos Biotechnology AG
Novartis Pharma AG
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to MXPA05000819A priority Critical patent/MXPA05000819A/es
Priority to AU2003250110A priority patent/AU2003250110C1/en
Priority to NZ537688A priority patent/NZ537688A/en
Priority to JP2004528447A priority patent/JP4644488B2/ja
Priority to EP03787750A priority patent/EP1524994B1/en
Priority to HK05109064.7A priority patent/HK1077009B/en
Priority to AT03787750T priority patent/ATE506964T1/de
Priority to BR0312792-3A priority patent/BR0312792A/pt
Priority to DK03787750.3T priority patent/DK1524994T3/da
Application filed by Cytos Biotechnology AG, Novartis Pharma AG filed Critical Cytos Biotechnology AG
Priority to SI200332018T priority patent/SI1524994T1/sl
Priority to CA2492930A priority patent/CA2492930C/en
Priority to CN038197340A priority patent/CN1674934B/zh
Priority to DE60336902T priority patent/DE60336902D1/de
Publication of WO2004016282A1 publication Critical patent/WO2004016282A1/en
Priority to IL166227A priority patent/IL166227A/en
Anticipated expiration legal-status Critical
Priority to NO20050894A priority patent/NO337574B1/no
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/385Haptens or antigens, bound to carriers
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0007Nervous system antigens; Prions
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/40Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum bacterial
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/42Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum viral
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/28Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/525Virus
    • A61K2039/5256Virus expressing foreign proteins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/525Virus
    • A61K2039/5258Virus-like particles
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/60Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
    • A61K2039/6031Proteins
    • A61K2039/6075Viral proteins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/64Medicinal preparations containing antigens or antibodies characterised by the architecture of the carrier-antigen complex, e.g. repetition of carrier-antigen units

Definitions

  • the present invention is related to the fields of molecular biology, virology, immunology and medicine.
  • the invention provides a composition comprising an ordered and repetitive antigen or antigenic determinant array, and in particular an A ⁇ l-6 peptide-VLP-composition. More specifically, the invention provides a composition comprising a virus-like particle and at least one A ⁇ l-6 peptide bound thereto.
  • the invention also provides a process for producing the conjugates and the ordered and repetitive arrays, respectively.
  • the compositions of the invention are useful in the production of vaccines for the treatment of Alzheimer's disease and as a pharmaccine to prevent or cure Alzheimer's disease and to efficiently induce immune responses, in particular antibody responses. Furthermore, the compositions of the invention are particularly useful to efficiently induce self-specific immune responses within the indicated context.
  • AD Alzheimer's disease
  • AD Alzheimer's disease
  • the main pathological signs of Alzheimer's disease are age-related changes in behaviour, deposition of ⁇ -amyloid into insoluble plaques, called the neuritic plaques or AD plaques, neurofibrillary tangles composed of tau protein within neurons, and loss of neurons throughout the forebrain.
  • AD the neuritic plaques
  • FAD familial AD
  • the pathological abnormalities of AD are more widespread, severe and occur earlier in FAD than in late onset or sporadic AD. Mutations in the APP gene, the presenilin 1 and the presenilin 2 genes have been correlated with FAD.
  • AD Alzheimer's Disease
  • amyloidogenesis insoluble fibrous masses
  • a ⁇ amyloid ⁇
  • a ⁇ is proteolytically cleaved from a much larger glycoprotein known as Amyloid Precursor Protein (APP), which comprises isoforms of 695-770 amino acids with a single hydrophobic transmembrane region.
  • APP Amyloid Precursor Protein
  • a ⁇ forms a group of peptides up to 43 amino acids in length showing considerable amino- and carboxy-terminal heterogeneity (truncation) as well as modifications (Roher, A. E., Palmer, K. C, Chau, V., & Ball, M. J. (1988) J. Cell Biol. 107, 2703-2716. Roher, A. E., Palmer, K. C, Yurewicz, E. C, Ball, M. J., & Greenberg, B. D. (1993) J. Neurochem. 61, 1916- 1926).
  • Prominent isoforms are A ⁇ l-40 and 1-42. It has a high propensity to form ⁇ - sheets aggregating into fibrils, which
  • a ⁇ peptide has a central role in the neuropathology of Alzheimers disease. Region specific, extracellular accumulation of A ⁇ peptide is accompanied by microgliosis, cytoskeletal changes, dystrophic neuritis and synaptic loss. These pathological alterations are thought to be linked to the cognitive decline that defines the disease.
  • amyloid beta protein or, in particular, A ⁇ 1-28 in amounts of up to 10 "2 mg/dose in the absence of any adjuvants and without any linkage of the amyloid beta protein or A ⁇ 1-28 to a carrier, for the treatment of Alzheimer's disease, is described in EP 526'511.
  • Example III Proliferation of splenocytes from mice immunized using the abovementionned strategy was reported in Example III (Screen for therapeutic Efficacy against established AD) of WO 99/27944, showing that A ⁇ l-42 specific T-cells were induced by the vaccination procedure.
  • Coupling of A ⁇ fragments to sheep anti-mouse IgG, and immunization of said coupled fragment in the presence of the adjuvant CFA/IFA is reported in WO 9927944.
  • compositions comprising A ⁇ fragments linked to polypeptides such as diphtheria toxin for promoting an immune response against A ⁇ is also disclosed in WO 99/27944. However, no data of immunization are provided.
  • a monoclonal antibody recognizing an epitope within the N-terminus (1-16) of A ⁇ has been shown to protect PC 12 cells from neuro toxicity of fibrillar ⁇ -amyloid, and to disaggregate ⁇ -amyloid in vitro (Solomon B. et al., Proc.Natl. Acad. Sci. USA (1997)).
  • a monoclonal antibody raised against A ⁇ l-28 was also shown to suppress ⁇ -amyloid aggregation in vitro (Solomon B. et al., Proc. Natl. Acad. Sci. USA (1996)). Frenkel et al., (J. Neuroimmunol.
  • a ⁇ l-42 is fibrillogenic, and indeed, the vaccine composition described in WO 99/27944 used A ⁇ l-42 treated in such a way that it can form aggregates. It has been shown that those fibrils are toxic for neuronal cell cultures (Yankner et al, Science 245: 417-420 (1989)), and that a toxic effect is also observed when injected into animal brains (Sigurdson et al, Neurobiol. Aging 17: 893-901 (1996); NASAdson et al, Neurobiol. Aging 18: 591-608 (1997)). Walsh et al., (Nature 416:535-539 (2002)) report that natural oligomers of A ⁇ are formed within intracellular vesicles.
  • Mucosal administration of an antigen associated with ⁇ -amyloid plaques has been described in WO99/27949. Mucosal administration is said to suppress certain cytokine responses associated with Alzheimer's disease, and to enhance certain other cytokine responses associated with the suppression of inflammatory responses linked to the disease. It is thought that suppression of the inflammatory responses is effected by the "elicitation of T-cells characterized by an anti-inflammatory cytokine profile".
  • Suitable antigens as described in WO9927949, include antigens specific for AD, and which are recognized by immune T-cells of a human or animal host.
  • antibodies cross-reacting to the antigen may be elicited, their binding to the antigen may be suboptimal.
  • the fine specificity of those elicited antibody may also not correspond to the specificity of antibodies elicited against the antigen itself, as additional sid-chains different from the residues present on the full-length A ⁇ are present in the epitope.
  • a 15-mer amino-acid sequence may contain T-cell epitopes. Display of the epitope YYEFRH (SEQ ID NO: 90) on the protein 111 of filamentous phage coat, of which 3-5 copies only are usually present on each phage, is also disclosed in WO 01/18169.
  • a ⁇ analogues wherein A ⁇ is modified to include T helper epitopes have been described (WO 01/62284). Immunization of TgRND8+ mice, transgenic for human APP, with the A ⁇ analogue resulted in a 4- to 7.5-fold higher antibody titer over immunization with A ⁇ l-42 in the absence of adjuvant.
  • the autopsy of a patient immunised with aggregated A ⁇ l-42 in the Adjuvant QS21 has revealed the presence of a T-lymphocyte meningoencephalitis and infiltration of cerebral white matter by macrophages (Nicoll, J.A. et al., Nature Med. 9: 448-452 (2003)). Recently, a publication has reported 18 cases of meningoencephalitis in patients immunized by the ANI 792, a vaccine composed of aggregated A ⁇ l-42 and QS-21 as adjuvant (Orgogozo J.-M. et al., Neurology 61 : 46-54 (2003)). T-cell activation is reported as a potential mechanism responsible for the disease, while there was no clear relation between disease and anti-A ⁇ l-42 titers in the serum.
  • a ⁇ peptides are made immunogenic through binding to a VLP and do not require an adjuvant.
  • One way to improve the efficiency of vaccination is thus to increase the degree of repetitiveness of the antigen applied.
  • viruses induce prompt and efficient immune responses in the absence of any adjuvants both with and without T -cell help (Bachmann and Zinkemagel, Ann. Rev. Immunol: 15:235- 270 (1991)).
  • viruses Although viruses often consist of few proteins, they are able to trigger much stronger immune responses than their isolated components.
  • B-cell responses it is known that one crucial factor for the immunogenicity of viruses is the repetitiveness and order of surface epitopes. Many viruses exhibit a quasi-crystalline surface that displays a regular array of epitopes which efficiently crosslinks epitope- specific immunoglobulins on B cells (Bachmann and Zinkemagel, Immunol. Today 77:553-558 (1996)). This crosslinking of surface immunoglobulins on B cells is a strong activation signal that directly induces cell-cycle progression and the production of lgM antibodies.
  • Such triggered B cells are able to activate T helper cells, which in turn induce a switch from lgM to IgG antibody production in B cells and the generation of long-lived B cell memory - the goal of any vaccination (Bachmann and Zinkemagel, Ann. Rev. Immunol. 15:235-210 (1997)).
  • Viral structure is even linked to the generation of anti-antibodies in autoimmune disease and as a part of the natural response to pathogens (see Fehr, T., et al, J Exp. Med. 755:1785-1792 (1997)).
  • antibodies presented by a highly organized viral surface are able to induce strong anti-antibody responses.
  • the immune system usually fails to produce antibodies against self-derived structures.
  • compositions comprising A ⁇ peptides (A ⁇ l-15, A ⁇ l-27 and A ⁇ 33-42, which is a self-antigen in mice) bound to a VLP.
  • a ⁇ peptides A ⁇ l-15, A ⁇ l-27 and A ⁇ 33-42, which is a self-antigen in mice
  • the abovementionned human A ⁇ peptides bound to the VLP of RNA phage Q ⁇ induced high A ⁇ specific titers in human APP transgenic mice (described in Example ) demonstrating that tolerance to the self-antigen A ⁇ could be overcome by immunizing with A ⁇ peptides bound to a VLP.
  • a ⁇ l-6 peptide which is bound to a core particle having a structure with an inherent repetitive organization, and hereby in particular to virus-like-particles (VLPs) and subunits of VLPs, respectively, leading to highly ordered and repetitive conjugates represent a potent immunogen for the induction of antibodies specific for A ⁇ l-6. Therefore, the present invention provides a prophylactic and therapeutic mean for the treatment of Alzheimer's disease, which is based on an ordered and repetitive A ⁇ l-6 -core particle array, and in particular on a
  • VLP-A ⁇ l-6 peptide conjugate and -array are provided.
  • This prophylactic and therapeutic is able to induce high titers of anti-A ⁇ l-6 peptide antibodies, which are cross-reactive to soluble A ⁇ and are capable of binding to human amyloid plaques of a human APP transgenic mouse model and to AD amyloid plaques.
  • the elicited antibodies do not bind to APP on brain sections.
  • the present invention provides for new compositions, vaccines and methods of treatment of AD.
  • the compositions and vaccines comprising A ⁇ 1-6 peptides are devoid of T-cell epitopes and induce antibodies binding AD plaques and soluble A ⁇ .
  • the A ⁇ 1-6 peptides are presented to the immune system of the patient in a highly repetitive and ordered fashion through binding of the A ⁇ peptides or to a core particle, preferably to a VLP, and even more preferably to a VLP of a RNA phage.
  • the antigen or antigenic determinant is the human amyloid beta peptide A ⁇ l-6 (DAEFRH; SEQ ID NO: 75) being a fragment of A ⁇ (DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAI1GLMVGGVV1A (SEQ ID NO: 91), wherein the human amyloid beta peptide A ⁇ l-6 is bound to the core particle and VLP, respectively.
  • the amyloid beta protein is provided in SEQ ID NO: 92.
  • the amyloid beta precursor protein is provided in SEQ ID NO: 93.
  • the present invention provides for a composition
  • a composition comprising: (a) a core particle with at least one first attachment site; and (b) at least one antigen or antigenic determinant with at least one second attachment site, wherein said antigen or antigenic determinant is a A ⁇ l-6 peptide, and wherein said second attachment site being selected from the group consisting of (i) an attachment site not naturally occurring with said antigen or antigenic determinant; and (ii) an attachment site naturally occurring with said antigen or antigenic determinant, wherein said second attachment site is capable of association to said first attachment site; and wherein said antigen or antigenic determinant and said core particle interact through said association to form an ordered and repetitive antigen array.
  • Preferred embodiments of core particles suitable for use in the present invention are a vims, a vims-like particle, a bacteriophage, a vims-like particle of a RNA-phage, a bacterial pilus or flagella or any other core particle having an inherent repetitive structure capable of forming an ordered and repetitive antigen array in accordance with the present invention.
  • the A ⁇ fragments of the present invention are soluble and generally do not form aggregates. Moreover, they are bound, and preferably covalently bound to a core particle and VLP, respectively. Therefore, the compositions of the invention do not bear the risk of inducing toxic effects such as seeding of amyloid deposition. It is an unexpected finding of this invention that a high titer of antibodies cross- reactive with soluble A ⁇ and AD amyloid plaques could be obtained with a composition comprising the A ⁇ l-6 peptide bound to a a core particle and VLP, respectively. In particular, VLP have been shown to mediate induction of antibodies against self antigens, thus breaking self-tolerance (WO 02/056905, the disclosure of which is herewith incorporated by reference in its entirety).
  • the small size of this epitope precludes the presence of T-cell epitopes, thus providing new compositions that do not induce A ⁇ specific T-cell responses.
  • the elicited antibodies do not bind to APP on brain sections.
  • the present invention provides for a safe vaccine composition for the prevention and treatment of AD.
  • the invention provides a composition comprising an ordered and repetitive antigen or antigenic determinant array, and hereby in particular A ⁇ 1 -6 peptide VLP conjugates. More specifically, the invention provides a composition comprising a vims-like particle and at least one A ⁇ l-6 peptide bound thereto. The invention also provides a process for producing the conjugates and the ordered and repetitive arrays, respectively.
  • the compositions of the invention are useful in the production of vaccines for the treatment of Alzheimer's disease and as a pharmaccine to prevent or cure Alzheimer's disease and to efficiently induce immune responses, in particular antibody responses. Furthermore, the compositions of the invention are particularly useful to efficiently induce self-specific immune responses within the indicated context.
  • a A ⁇ l-6 peptide is bound to a core particle and VLP, respectively, typically in an oriented manner, yielding an ordered and repetitive A ⁇ 1 - 6 peptide antigen array. Furthermore, the highly repetitive and organized structure of the core particles and VLPs, respectively, mediates the display of the A ⁇ peptide in a highly ordered and repetitive fashion leading to a highly organized and repetitive antigen array. Furthermore, binding of the A ⁇ l-6 peptide to the core particle and VLP, respectively, provides T helper cell epitopes, since the core particle and VLP is foreign to the host immunized with the core particle- A ⁇ l-6 peptide array and VLP- A ⁇ l-6 peptide array, respectively.
  • the A ⁇ l-6 peptide is chemically synthesized, while the core particle and the VLP, repespectively, is expressed and purified from an expression host suitable for the folding and assembly of the core particle and the VLP, repespectively.
  • the A ⁇ l-6 peptide array is then assembled by binding the A ⁇ l- 6 peptide to the core particle and the VLP, repespectively.
  • the present invention provides for a composition comprising (a) a vims-like particle, and (b) at least one antigen or antigenic determinant, wherein said antigen or said antigenic determinant is an A ⁇ 1 -6 peptide, and wherein said at least one antigen or antigenic determinant is bound to said vims-like particle.
  • the present invention provides for a pharmaceutical composition comprising (a) the inventive composition, and (b) an acceptable pharmaceutical carrier.
  • the present invention provides for a vaccine composition
  • a vaccine composition comprising a composition, wherein said composition comprising (a) a vims-like particle; and (b) at least one antigen or antigenic determinant, wherein said antigen or said antigenic determinant is a A ⁇ l-6 peptide; and wherein said at least one antigen or antigenic determinant is bound to said vims-like particle.
  • the present invention provides for a method of immunization comprising administering the inventive composition, the inventive pharmaceutical composition or the inventive vaccine to an animal.
  • the present invention provides for a process for producing an inventive composition
  • a process for producing an inventive composition comprising (a) providing a vims-like particle; and (b) providing at least one antigen or antigenic determinant, wherein said antigen or said antigenic determinant is a A ⁇ l-6 peptide; (c) combining said vims-like particle and said at least one antigen or antigenic determinant so that said at least one antigen or antigenic determinant is bound to said virus-like particle.
  • the present invention provides a process for producing a composition of claim 1 comprising: (a) providing a core particle with at least one first attachment site; (b) providing at least one antigen or antigenic determinant with at least one second attachment site, wherein said antigen or antigenic determinant is a A ⁇ l-6 peptide, and wherein said second attachment site being selected from the group consisting of (i) an attachment site not naturally occurring with said antigen or antigenic determinant; and (ii) an attachment site naturally occurring with said antigen or antigenic determinant; and wherein said second attachment site is capable of association to said first attachment site; and (c) combining said core particle and said at least one antigen or antigenic determinant, wherein said antigen or antigenic determinant and said core particle interact through said association to form an ordered and repetitive antigen array.
  • the present invention provides for a use of a composition of claim 1 for the manufacture of a medicament for treatment of Alzheimer's disease.
  • the present invention provides for a use of a composition of claim 1 for the preparation of a medicament for the therapeutic or prophylactic treatment of Alzheimer's disease.
  • the present invention provides for a use of a composition of claim 1, either in isolation or in combination with other agents, or with explicit absence of specific substances such as adjuvants, for the manufacture of a composition, pharmaceutical composition, vaccine, drug or medicament for therapy or prophylaxis of Alzheimer's disease, and/or for stimulating the mammalian immune system.
  • the invention provides, in particular, vaccine compositions which are suitable for preventing and/or attenuating Alzheimer's disase or conditions related thereto.
  • the invention further provides immunization and vaccination methods, respectively, for preventing and/or attenuating Alzheimer's disease or conditions related thereto in humans.
  • the inventive compositions may be used prophylactically or therapeutically.
  • the invention provides methods for preventing and/or attenuating Alzheimer's disease or conditions related thereto which are caused or exacerbated by "self gene products, i.e. "self antigens” as used herein.
  • the invention provides methods for inducing immunological responses in animals and individuals, respectively, which lead to the production of antibodies that prevent and/or attenuate Alzheimer's disease or conditions related thereto, which are caused or exacerbated by "self gene products.
  • compositions of the invention when compositions of the invention are administered to an animal or a human, they may be in a composition which contains salts, buffers, adjuvants, or other substances which are desirable for improving the efficacy of the composition.
  • compositions of the invention are said to be “pharmacologically acceptable” if their administration can be tolerated by a recipient individual. Further, the compositions of the invention will be administered in a "therapeutically effective amount” (i.e., an amount that produces a desired physiological effect).
  • compositions of the present invention may be administered by various methods known in the art, but will normally be administered by injection, infusion, inhalation, oral administration, or other suitable physical methods.
  • the compositions may alternatively be administered intramuscularly, intravenously, or subcutaneously.
  • Components of compositions for administration include sterile aqueous (e.g., physiological saline) or non-aqueous solutions and suspensions.
  • non- aqueous solvents are propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable organic esters such as ethyl oleate.
  • Carriers or occlusive dressings can be used to increase skin permeability and enhance antigen absorption.
  • FIG. 1 depicts the SDS-PAGE gel, run under reducing conditions, showing the result of the coupling of the A ⁇ l-6 peptide (NH2-DAEFRHGGC-CONH2) (SEQ ID NO: 77) to the VLP of Q ⁇ coat protein.
  • FIG. 2 shows the ELISA analysis of the antibodies specific for A ⁇ l-6 in sera of mice immunized with A ⁇ l-6 peptide coupled to the VLP of Q ⁇ coat protein.
  • FIG. 3 shows the ELISA analysis of the antibodies specific for A ⁇ l-40 in sera of mice immunized with A ⁇ l-6 peptide coupled to the VLP of Q ⁇ coat protein.
  • FIG. 4 A-B show a brain section of an APP23 mouse (A) and an entorhinal cortex section from an AD patient (B) stained with sera of mice immunized with A ⁇ l-6 peptide coupled to the VLP of Q ⁇ coat protein.
  • FIG. 5 A-E show brain sections of an APP23 mouse stained with sera of mice immunized with A ⁇ l-6 peptide coupled to the VLP of Q ⁇ coat protein, or with a polyclonal rabbit antisemm specific for the C-terminus of human or mouse APP.
  • FIG.6 shows the result of the immunization of rhesus monkeys with human A ⁇ l-6 coupled to Q ⁇ VLP as measured in an ELISA assay.
  • FIG. 7 shows the result of the binding to plaques of sera from monkeys immunized with human A ⁇ l-6 coupled to Q ⁇ VLP, as measured by histology on human AD and transgenic mouse plaques.
  • FIG. 8 depicts the SDS-PAGE analysis of the coupling of murine A ⁇ l-6 to AP205 VLP.
  • FIG. 9 shows the result of the immunisation of mice with murine A ⁇ l-6 coupled to AP205 as measured in an ELISA assay.
  • FIG. 10 shows the analysis by ELISA of the anti-A ⁇ 40 and anti-A ⁇ 42 titers in the sera of "Swedish/London" transgenic mice immunized with Q ⁇ hA ⁇ l-6 between 9.5 and 19 months of age.
  • FIG. 11 shows the immunohistochemical staining of brain sections of "Swedish/London" transgenic mice immunized with Q ⁇ hA ⁇ l-6 or PBS .
  • FIG. 12 shows the quantification of plaque deposition in "Swedish/London" transgenic mice immunized with Q ⁇ hA ⁇ l-6, Q ⁇ or PBS between 9.5 and 19 months of age.
  • FIG. 13 shows the quantification of plaque deposition in "Swedish/London” transgenic mice immunized with Q ⁇ hA ⁇ l-6 or PBS between 13.5 and 19 months of age.
  • FIG. 14 shows the analysis by ELISA of the anti-A ⁇ 40 and anti-A ⁇ 42 titers in the sera of "Swedish" transgenic mice immunized with Q ⁇ hA ⁇ l-6.
  • FIG. 15 shows the immunohistochemical staining of brain sections from "Swedish” transgenic mice immunized with Q ⁇ hA ⁇ l-6 or PBS.
  • FIG. 16 shows the quantification of plaque deposition in "Swedish" transgenic mice immunized with Q ⁇ hA ⁇ l-6 or PBS. DETAILED DESCRIPTION OF THE INVENTION
  • a ⁇ l-6 peptide refers to peptides having a sequence corresponding to the human A ⁇ l-6 sequence, or homologous to the human A ⁇ l-6 sequence. Sequences homologuous to the human A ⁇ l-6 sequence include, but are not limited to the A ⁇ l-6 sequences of other species and hereby including, but not limited to, the sequence of primate, rabbit, guinea pig, Xenopus Laevis, frog, mouse and rat A ⁇ l-6.
  • the A ⁇ l-6 sequences from Xenopus Laevis or frog although differing from human A ⁇ l-6 at two positions, have conservative mutations (Ala-Ser, Phe-Tyr), and are still considered to be homologuous to A ⁇ l-6 in accordance with this definition.
  • the A ⁇ l-6 peptide is typically modified, such that a second attachment site is attached thereto.
  • the second attachment site is modified with a linker or an amino acid linker comprising a second attachment site for binding to a core particle and VLP, respectively. While referring herein to A ⁇ l-6 peptides, a modified A ⁇ l-6 peptide, as indicated above, i.e.
  • a ⁇ l-6 peptides with a second attachment site attached thereto shall be encompassed. Typically, however, the modifications are explicitly indicated in the specification. Further preferred embodiments of an A ⁇ l-6 peptide being an antigen or antigenic determinant in accordance with the present invention become apparent as this specification proceeds.
  • Adjuvant refers to non-specific stimulators of the immune response or substances that allow generation of a depot in the host which when combined with the vaccine and pharmaceutical composition, respectively, of the present invention may provide for an even more enhanced immune response.
  • adjuvants can be used. Examples include complete and incomplete Freund's adjuvant, aluminum hydroxide and modified muramyldipeptide.
  • Further adjuvants are mineral gels such as aluminum hydroxide, surface active substances such as lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, keyhole limpet hemocyanins, dinitrophenol, and potentially useful human adjuvants such as BCG (bacille Calmette-Guerin) and Corynebacterium parvum. Such adjuvants are also well known in the art.
  • compositions of the invention include, but are not limited to, Monophosphoryl lipid immunomodulator, AdjuVax 100a, QS-21, QS-18, CRL1005, Aluminum salts (Alum), MF-59, OM-174, OM-197, OM-294, and Virosomal adjuvant technology.
  • the adjuvants can also comprise a mixture of these substances.
  • Immunologically active saponin fractions having adjuvant activity derived from the bark of the South American tree Quillaja Saponaria Molina are known in the art.
  • QS21 also known as QA21
  • QS21 is an Hplc purified fraction from the Quillaja Saponaria Molina tree and it's method of its production is disclosed (as QA21) in U.S. Pat. No. 5,057,540.
  • Quillaja saponin has also been disclosed as an adjuvant by Scott et al, Int. Archs. Allergy Appl. Immun., 1985, 77, 409.
  • Monosphoryl lipid A and derivatives thereof are known in the art.
  • a preferred derivative is 3 de-o-acylated monophosphoryl lipid A, and is known from British Patent No. 2220211. Further preferred adjuvants are described in WO00/00462, the disclosure of which is herein incorporated by reference.
  • an advantageous feature of the present invention is the high immunogenicty of the inventive compositions.
  • vaccines and pharmaceutical compositions devoid of adjuvants are provided, in further alternative or preferred embodiments, leading to vaccines and pharmaceutical compositions for treating AD being devoid of adjuvants and, thus, having a superior safety profile since adjuvants may cause side-effects.
  • the term "devoid” as used herein in the context of vaccines and pharmaceutical compositions for treating AD refers to vaccines and pharmaceutical compositions that are used without adjuvants.
  • Amino acid linker An "amino acid linker”, or also just termed “linker” within this specification, as used herein, either associates the antigen or antigenic determinant with the second attachment site, or more preferably, already comprises or contains the second attachment site, typically - but not necessarily - as one amino acid residue, preferably as a cysteine residue.
  • amino acid linker does not intend to imply that such an amino acid linker consists exclusively of amino acid residues, even if an amino acid linker consisting of amino acid residues is a preferred embodiment of the present invention.
  • amino acid residues of the amino acid linker are, preferably, composed of naturally occuring amino acids or unnatural amino acids known in the art, all-L or all-D or mixtures thereof.
  • an amino acid linker comprising a molecule with a sulfhydryl group or cysteine residue is also encompassed within the invention.
  • Such a molecule comprise preferably a C1-C6 alkyl-, cycloalkyl (C5,C6), aryl or heteroaryl moiety.
  • a linker comprising preferably a C1-C6 alkyl-, cycloalkyl- (C5,C6), aryl- or heteroaryl- moiety and devoid of any amino acid(s) shall also be encompassed within the scope of the invention.
  • Association between the antigen or antigenic determinant or optionally the second attachment site and the amino acid linker is preferably by way of at least one covalent bond, more preferably by way of at least one peptide bond.
  • Animal As used herein, the term “animal” is meant to include, for example, humans, sheep, elks, deer, mule deer, minks, mammals, monkeys, horses, cattle, pigs, goats, dogs, cats, rats, mice, birds, chicken, reptiles, fish, insects and arachnids.
  • Antibody As used herein, the term “antibody” refers to molecules which are capable of binding an epitope or antigenic determinant. The term is meant to include whole antibodies and antigen-binding fragments thereof, including single-chain antibodies.
  • the antibodies are human antigen binding antibody fragments and include, but are not limited to, Fab, Fab' and F(ab')2, Fd, single-chain Fvs (scFv), single-chain antibodies, disulfide-linked Fvs (sdFv) and fragments comprising either a V or V H domain.
  • the antibodies can be from any animal origin including birds and mammals.
  • the antibodies are human, murine, rabbit, goat, guinea pig, camel, horse or chicken.
  • human antibodies include antibodies having the amino acid sequence of a human immunoglobulin and include antibodies isolated from human immunoglobulin libraries or from animals transgenic for one or more human immunoglobulins and that do not express endogenous immunoglobulins, as described, for example, in U.S. Patent No. 5,939,598 by Kucherlapati et al.
  • Antigen refers to a molecule capable of being bound by an antibody or a T cell receptor (TCR) if presented by MHC molecules.
  • TCR T cell receptor
  • An antigen is additionally capable of being recognized by the immune system and/or being capable of inducing a humoral immune response and/or cellular immune response leading to the activation of B- and/or T-lymphocytes. This may, however, require that, at least in certain cases, the antigen contains or is linked to a Th cell epitope and is given in adjuvant.
  • An antigen can have one or more epitopes (B- and T- epitopes).
  • Antigenic determinant As used herein, the term "antigenic determinant" is meant to refer to that portion of an antigen that is specifically recognized by either B- or T-lymphocytes. B-lymphocytes responding to antigenic determinants produce antibodies, whereas T-lymphocytes respond to antigenic determinants by proliferation and establishment of effector functions critical for the mediation of cellular and/or humoral immunity.
  • association refers to the binding of the first and second attachment sites that is preferably by way of at least one non-peptide bond.
  • the nature of the association may be covalent, ionic, hydrophobic, polar or any combination thereof, preferably the nature of the association is covalent.
  • first attachment site refers to an element of non-natural or natural origin, to which the second attachment site located on the antigen or antigenic determinant may associate.
  • the first attachment site may be a protein, a polypeptide, an amino acid, a peptide, a sugar, a polynucleotide, a natural or synthetic polymer, a secondary metabolite or compound (biotin, fluorescein, retinol, digoxigenin, metal ions, phenylmethylsulfonylfluoride), or a combination thereof, or a chemically reactive group thereof.
  • the first attachment site is located, typically and preferably on the surface, of the core particle such as, preferably the vims-like particle. Multiple first attachment sites are present on the surface of the core and vims-like particle, respectively, typically in a repetitive configuration.
  • Attachment Site, Second refers to an element associated with the antigen or antigenic determinant to which the first attachment site located on the surface of the core particle and vims-like particle, respectively, may associate.
  • the second attachment site of the antigen or antigenic determinant may be a protein, a polypeptide, a peptide, a sugar, a polynucleotide, a natural or synthetic polymer, a secondary metabolite or compound (biotin, fluorescein, retinol, digoxigenin, metal ions, phenylmethylsulfonylfluoride), or a combination thereof, or a chemically reactive group thereof.
  • At least one second attachment site is present on the antigen or antigenic determinant.
  • the term "antigen or antigenic determinant with at least one second attachment site" refers, therefore, to an antigen or antigenic constmct comprising at least the antigen or antigenic determinant and the second attachment site.
  • bound refers to binding or attachment that may be covalent, e.g., by chemically coupling, or non-covalent, e.g., ionic interactions, hydrophobic interactions, hydrogen bonds, etc. Covalent bonds can be, for example, ester, ether, phosphoester, amide, peptide, imide, carbon-sulfur bonds, carbon-phosphoms bonds, and the like.
  • bound is broader than and includes terms such as “coupled,” “fused” and "attached”.
  • Coat protein(s) refers to the protein(s) of a bacteriophage or a RNA-phage capable of being incorporated within the capsid assembly of the bacteriophage or the RNA-phage.
  • the term "CP” is used.
  • the specific gene product of the coat protein gene of RNA-phage Q ⁇ is referred to as "Q ⁇ CP”
  • the "coat proteins” of bacteriophage Q ⁇ comprise the "Q ⁇ CP” as well as the Al protein.
  • the capsid of Bacteriophage Q ⁇ is composed mainly of the Q ⁇ CP, with a minor content of the Al protein.
  • the VLP Q ⁇ coat protein contains mainly Q ⁇ CP, with a minor content of A 1 protein.
  • Core particle refers to a rigid stmcture with an inherent repetitive organization.
  • a core particle as used herein may be the product of a synthetic process or the product of a biological process.
  • Coupled refers to attachment by covalent bonds or by strong non-covalent interactions, typically and preferably to attachment by covalent bonds. Any method normally used by those skilled in the art for the coupling of biologically active materials can be used in the present invention.
  • Effective Amount refers to an amount necessary or sufficient to realize a desired biologic effect.
  • An effective amount of the composition would be the amount that achieves this selected result, and such an amount could be determined as a matter of routine by a person skilled in the art.
  • an effective amount for treating an immune system deficiency could be that amount necessary to cause activation of the immune system, resulting in the development of an antigen specific immune response upon exposure to antigen.
  • the term is also synonymous with "sufficient amount.”
  • Epitope As used herein, the term “epitope” refers to continuous or discontinuous portions of a polypeptide having antigenic or immunogenic activity in an animal, preferably a mammal, and most preferably in a human. An epitope is recognized by an antibody or a T cell through its T cell receptor in the context of an MHC molecule.
  • an "immunogenic epitope,” as used herein, is defined as a portion of a polypeptide that elicits an antibody response or induces a T-cell response in an animal, as determined by any method known in the art. (See, for example, Geysen et al, Proc. Natl. Acad. Sci. USA 57:3998-4002 (1983)).
  • the term "antigenic epitope,” as used herein, is defined as a portion of a protein to which an antibody can immunospecifically bind its antigen as determined by any method well known in the art. Immunospecific binding excludes non-specific binding but does not necessarily exclude cross-reactivity with other antigens.
  • Antigenic epitopes need not necessarily be immunogenic. Antigenic epitopes can also be T-cell epitopes, in which case they can be bound immunospecifically by a T-cell receptor within the context of an MHC molecule.
  • An epitope can comprise 3 amino acids in a spatial conformation which is unique to the epitope. Generally, an epitope consists of at least about 5 such amino acids, and more usually, consists of at least about 8-10 such amino acids. If the epitope is an organic molecule, it may be as small as Nitrophenyl.
  • Fusion refers to the combination of amino acid sequences of different origin in one polypeptide chain by in-frame combination of their coding nucleotide sequences.
  • the term “fusion” explicitly encompasses internal fusions, i.e., insertion of sequences of different origin within a polypeptide chain, in addition to fusion to one of its termini.
  • Immune response refers to a humoral immune response and/or cellular immune response leading to the activation or proliferation of B- and/or T-lymphocytes and/or and antigen presenting cells. In some instances, however, the immune responses may be of low intensity and become detectable only when using at least one substance in accordance with the invention.
  • Immunogenic refers to an agent used to stimulate the immune system of a living organism, so that one or more functions of the immune system are increased and directed towards the immunogenic agent.
  • An "immunogenic polypeptide” is a polypeptide that elicits a cellular and/or humoral immune response, whether alone or linked to a carrier in the presence or absence of an adjuvant.
  • antigen presenting cell may be activated.
  • a substance which "enhances" an immune response refers to a substance in which an immune response is observed that is greater or intensified or deviated in any way with the addition of the substance when compared to the same immune response measured without the addition of the substance.
  • the lytic activity of cytotoxic T cells can be measured, e.g. using a 51 Cr release assay, in samples obtained with and without the use of the substance during immunization.
  • the amount of the substance at which the CTL lytic activity is enhanced as compared to the CTL lytic activity without the substance is said to be an amount sufficient to enhance the immune response of the animal to the antigen.
  • the immune response in enhanced by a factor of at least about 2, more preferably by a factor of about 3 or more.
  • the amount or type of cytokines secreted may also be altered.
  • the amount of antibodies induced or their subclasses may be altered.
  • Immunization refers to conferring the ability to mount a substantial immune response (comprising antibodies and/or cellular immunity such as effector CTL) against a target antigen or epitope. These terms do not require that complete immunity be created, but rather that an immune response be produced which is substantially greater than baseline. For example, a mammal may be considered to be immunized against a target antigen if the cellular and/or humoral immune response to the target antigen occurs following the application of methods of the invention.
  • Natural origin As used herein, the term “natural origin” means that the whole or parts thereof are not synthetic and exist or are produced in nature.
  • Non-natural As used herein, the term generally means not from nature, more specifically, the term means from the hand of man.
  • Non-natural origin As used herein, the term “non-natural origin” generally means synthetic or not from nature; more specifically, the term means from the hand of man.
  • Ordered and repetitive antigen or antigenic determinant array generally refers to a repeating pattern of antigen or antigenic determinant, characterized by a typically and preferably uniform spacial arrangement of the antigens or antigenic determinants with respect to the core particle and vims-like particle, respectively.
  • the repeating pattern may be a geometric pattern.
  • suitable ordered and repetitive antigen or antigenic determinant arrays are those which possess strictly repetitive paracrystalline orders of antigens or antigenic determinants, preferably with spacings of 0.5 to 30 nanometers, more preferably 5 to 15 nanometers.
  • Pili As used herein, the term "pili" (singular being “pilus”) refers to extracellular stmctures of bacterial cells composed of protein monomers (e.g., pilin monomers) which are organized into ordered and repetitive patterns. Further, pili are stmctures which are involved in processes such as the attachment of bacterial cells to host cell surface receptors, inter-cellular genetic exchanges, and cell-cell recognition. Examples of pili include Type-1 pili, P-pili, F1C pili, S-pili, and 987P-pili. Additional examples of pili are set out below.
  • Pilus-like structure refers to stmctures having characteristics similar to that of pili and composed of protein monomers.
  • a "pilus-like structure” is a stmcture formed by a bacterial cell which expresses modified pilin proteins that do not form ordered and repetitive arrays that are identical to those of natural pili.
  • Polypeptide refers to a molecule composed of monomers (amino acids) linearly linked by amide bonds (also known as peptide bonds). It indicates a molecular chain of amino acids and does not refer to a specific length of the product. Thus, peptides, dipeptides, tripeptides, oligopeptides and proteins are included within the definition of polypeptide. This term is also intended to refer to post-expression modifications of the polypeptide, for example, glycosolations, acetylations, phosphorylations, and the like. A recombinant or derived polypeptide is not necessarily translated from a designated nucleic acid sequence. It may also be generated in any manner, including chemical synthesis.
  • Residue As used herein, the term “residue” is meant to mean a specific amino acid in a polypeptide backbone or side chain.
  • Self antigen As used herein, the tern “self antigen” refers to proteins encoded by the hosf s DNA and products generated by proteins or RNA encoded by the hosf s DNA are defined as self. In addition, proteins that result from a combination of two or several self-molecules or that represent a fraction of a self-molecule and proteins that have a high homology two self-molecules as defined above (>95%, preferably >97%, more preferably >99%) may also be considered self.
  • treatment refers to prophylaxis and/or therapy.
  • the term refers to a prophylactic treatment which increases the resistance of a subject to infection with a pathogen or, in other words, decreases the likelihood that the subject will become infected with the pathogen or will show signs of illness attributable to the infection, as well as a treatment after the subject has become infected in order to fight the infection, e.g., reduce or eliminate the infection or prevent it from becoming worse.
  • the term "vaccine” refers to a formulation which contains the composition of the present invention and which is in a form that is capable of being administered to an animal.
  • the vaccine comprises a conventional saline or buffered aqueous solution medium in which the composition of the present invention is suspended or dissolved.
  • the composition of the present invention can be used conveniently to prevent, ameliorate, or otherwise treat a condition.
  • the vaccine Upon introduction into a host, the vaccine is able to provoke an immune response including, but not limited to, the production of antibodies and/or cytokines and/or the activation of cytotoxic T cells, antigen presenting cells, helper T cells, dendritic cells and/or other cellular responses.
  • the vaccine of the present invention additionally includes an adjuvant which can be present in either a minor or major proportion relative to the compound of the present invention.
  • Vims-like particle VLP
  • virus-like particle refers to a structure resembling a vims particle.
  • a vims-like particle in accordance with the invention is non replicative and noninfectious since it lacks all or part of the viral genome, in particular the replicative and infectious components of the viral genome.
  • a vims-like particle in accordance with the invention may contain nucleic acid distinct from their genome.
  • a typical and preferred embodiment of a vims-like particle in accordance with the present invention is a viral capsid such as the viral capsid of the corresponding vims, bacteriophage, or RNA-phage.
  • viral capsid or “capsid”, as interchangeably used herein, refer to a macromolecular assembly composed of viral protein subunits. Typically and preferably, the viral protein subunits assemble into a viral capsid and capsid, respectively, having a structure with an inherent repetitive organization, wherein said stmcture is, typically, spherical or tubular.
  • capsids of RNA-phages or HBcAg's have a spherical form of icosahedral symmetry.
  • capsid-like stmcture refers to a macromolecular assembly composed of viral protein subunits reproducing the capsid morphology in the above defined sense but deviating from the typical symmetrical assembly while maintaining a sufficient degree of order and repetitiveness.
  • Vims-like particle of a bacteriophage refers to a vims-like particle resembling the stmcture of a bacteriophage, being non replicative and noninfectious, and lacking at least the gene or genes encoding for the replication machinery of the bacteriophage, and typically also lacking the gene or genes encoding the protein or proteins responsible for viral attachment to or entry into the host.
  • VLP of RNA phage coat protein The capsid structure formed from the self- assembly of 180 subunits of RNA phage coat protein and optionally containing host RNA is referred to as a "VLP of RNA phage coat protein".
  • VLP of Q ⁇ coat protein A specific example is the VLP of Q ⁇ coat protein.
  • the VLP of Q ⁇ coat protein may either be assembled exclusively from Q ⁇ CP subunits (generated by expression of a Q ⁇ CP gene containing, for example, a TAA stop codon precluding any expression of the longer Al protein through suppression, see Kozlovska, T.M., et al., Intervirology 39: 9-15 (1996)), or additionally contain Al protein subunits in the capsid assembly.
  • Vims particle refers to the morphological form of a vims. In some virus types it comprises a genome surrounded by a protein capsid; others have additional stmctures (e.g., envelopes, tails, etc.).
  • stmctures e.g., envelopes, tails, etc.
  • One, a, or an When the terms “one,” “a,” or “an” are used in this disclosure, they mean “at least one” or “one or more,” unless otherwise indicated.
  • certain embodiments of the invention involve the use of recombinant nucleic acid technologies such as cloning, polymerase chain reaction, the purification of DNA and RNA, the expression of recombinant proteins in prokaryotic and eukaryotic cells, etc.
  • recombinant nucleic acid technologies such as cloning, polymerase chain reaction, the purification of DNA and RNA, the expression of recombinant proteins in prokaryotic and eukaryotic cells, etc.
  • Such methodologies are well known to those skilled in the art and can be conveniently found in published laboratory methods manuals (e.g., Sambrook, J. et al, eds., Molecular Cloning, A Laboratory Manual, 2nd. edition, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (1989); Ausubel, F. et al., eds., Current Protocols in Molecular Biology, John H. Wiley & Sons, Inc.
  • compositions of the invention comprise, or alternatively consist of (a) a core particle with at least one first attachment site; and (b) at least one antigen or antigenic determinant with at least one second attachment site, wherein said antigen or antigenic determinant is an A ⁇ l-6 peptide, and wherein said second attachment site being selected from the group consisting of (i) an attachment site not naturally occurring with said antigen or antigenic determinant; and (ii) an attachment site naturally occurring with said antigen or antigenic determinant, wherein said second attachment site is capable of association to said first attachment site; and wherein said antigen or antigenic determinant and said core particle interact through said association to form an ordered and repetitive antigen array.
  • compositions of the invention comprise, or alternatively consist of, a vims-like particle and at least one antigen or antigenic determinant, wherein the antigen or antigenic determinant is a A ⁇ l-6 peptide, and wherein the at least one antigen or antigenic determinant is bound to the vims-like particle so as to form an ordered and repetitive antigen-VLP-array.
  • the invention conveniently enables the practitioner to construct such a composition, inter alia, for treatment and/or prophylactic prevention of Alzheimer's disease.
  • Vims-like particles in the context of the present application refer to stmctures resembling a vims particle but which are not pathogenic. In general, vims- like particles lack the viral genome and, therefore, are noninfectious. Also, vims-like particles can be produced in large quantities by heterologous expression and can be easily purified.
  • the core particle comprises, or is selected from a group consisting of, a vims, a bacterial pilus, a stmcture formed from bacterial pilin, a bacteriophage, a vims-like particle, a vims-like particle of a RNA phage, a viral capsid particle or a recombinant form thereof.
  • a vims known in the art having an ordered and repetitive coat and/or core protein stmcture may be selected as a core particle of the invention; examples of suitable vimses include Sindbis and other alphavimses, rhabdovimses (e.g.
  • vesicular stomatitis vims vesicular stomatitis vims
  • picomavimses e.g., human rhino vims, Aichi vims
  • togavimses e.g., rubella vims
  • orthomyxoviruses e.g., Thogoto vims, Batken vims, fowl plague vims
  • polyomaviruses e.g., polyomavirus BK, polyomavims JC, avian polyomavims BFDV
  • parvoviruses rotavimses, Norwalk vims, foot and mouth disease vims, a retrovims, Hepatitis B vims, Tobacco mosaic vims, Flock House Virus, and human Papilomavims, and preferably a RNA phage, bacteriophage Q ⁇ , bacteriophage R17, bacteriophage Ml 1,
  • the invention utilizes genetic engineering of a vims to create a fusion between an ordered and repetitive viral envelope protein and a first attachment site being comprised by, or alternatively or preferably being a heterologous protein, peptide, antigenic determinant or a reactive amino acid residue of choice.
  • a vims to create a fusion between an ordered and repetitive viral envelope protein and a first attachment site being comprised by, or alternatively or preferably being a heterologous protein, peptide, antigenic determinant or a reactive amino acid residue of choice.
  • Other genetic manipulations known to those in the art may be included in the constmction of the inventive compositions; for example, it may be desirable to restrict the replication ability of the recombinant vims through genetic mutation.
  • the virus used for the present invention is replication incompetent due to chemical or physical inactivation or, as indicated, due to lack of a replication competent genome.
  • the viral protein selected for fusion to the first attachment site should have an organized and repetitive stmcture.
  • Such an organized and repetitive structure includes paracrystalline organizations with a spacing of 5-30 nm, preferably 5-15 nm, on the surface of the vims.
  • the creation of this type of fusion protein will result in multiple, ordered and repetitive first attachment sites on the surface of the vims and reflect the normal organization of the native viral protein.
  • the first attachment site may be or be a part of any suitable protein, polypeptide, sugar, polynucleotide, peptide (amino acid), natural or synthetic polymer, a secondary metabolite or combination thereof that may serve to specifically attach the antigen or antigenic determinant leading an ordered and repetitive antigen array.
  • the core particle is a recombinant alphavims, and more specifically, a recombinant Sinbis vims.
  • Alphavimses are positive stranded RNA viruses that replicate their genomic RNA entirely in the cytoplasm of the infected cell and without a DNA intermediate (Strauss, J. and Strauss, E., Microbiol. Rev. 55:491-562 (1994)).
  • Sindbis Xiong, C. et al, Science 243:1188-1191 (1989); Schlesinger, S., Trends Biotechnol. 77:18-22 (1993)
  • Semliki Forest Virus SFV
  • alphaviral core particles of the invention may be done by means generally known in the art of recombinant DNA technology, as described by the aforementioned articles, which are inco ⁇ orated herein by reference.
  • a variety of different recombinant host cells can be utilized to produce a viral- based core particle for antigen or antigenic determinant attachment.
  • alphavimses are known to have a wide host range; Sindbis virus infects cultured mammalian, reptilian, and amphibian cells, as well as some insect cells (Clark, H., J. Natl. Cancer Inst.
  • BHK, COS, Vero, HeLa and CHO cells are particularly suitable for the production of heterologous proteins because they have the potential to glycosylate heterologous proteins in a manner similar to human cells (Watson, E. et al, Glycobiology 4:221, (1994)) and can be selected (Zang, M.
  • polynucleotide vectors into host cells can be effected by methods described in standard laboratory manuals (see, e.g., Sambrook, J. et al, eds., MOLECULAR CLONING, A LABORATORY MANUAL, 2nd. edition, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (1989), Chapter 9; Ausubel, F. et al., eds., CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, John H. Wiley & Sons, Inc.
  • Packaged RNA sequences can also be used to infect host cells. These packaged RNA sequences can be introduced to host cells by adding them to the culture medium. For example, the preparation of non-infective alpahviral particles is described in a number of sources, including "Sindbis Expression System", Version C (Invitrogen Catalog No. K750-1).
  • mammalian cells When mammalian cells are used as recombinant host cells for the production of viral-based core particles, these cells will generally be grown in tissue culture. Methods for growing cells in culture are well known in the art (see, e.g., Celis, J., ed., CELL BIOLOGY, Academic Press, 2 nd edition, (1998); Sambrook, J. et al, eds., MOLECULAR CLONING, A LABORATORY MANUAL, 2nd. edition, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (1989); Ausubel, F. et al, eds., CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, John H. Wiley & Sons, Inc. (1997); Freshney, R., CULTURE OF ANIMAL CELLS, Alan R. Liss, Inc. (1983)).
  • RNA vimses suitable for use as core particle in the present invention include, but are not limited to, the following: members of the family Reoviridae, including the genus Orthoreovirus (multiple serotypes of both mammalian and avian retrovimses), the genus Orbivims (Bluetongue vims, Eugenangee vims, Kemerovo vims, African horse sickness vims, and Colorado Tick Fever vims), the genus Rotavims (human rotavims, Kansas calf diarrhea vims, murine rotavims, simian rotavims, bovine or ovine rotavims, avian rotavims); the family Picomaviridae, including the genus Enterovims (poliovims, Coxsackie vims A and B, enteric cytopathic human o ⁇ han (ECHO) vimses, hepatitis A, C, D, E and G vi
  • Illustrative DNA vimses that may be used as core particle include, but are not limited to: the family Poxviridae, including the genus Orthopoxvirus (Variola major, Variola minor, Monkey pox Vaccinia, Cowpox, Buffalopox, Rabbitpox, Ectromelia), the genus Leporipoxvims (Myxoma, Fibroma), the genus Avipoxvims (Fowlpox, other avian poxvims), the genus Capripoxvims (sheeppox, goatpox), the genus Suipoxvims (Swinepox), the genus Parapoxvims (contagious postular dermatitis vims, pseudocowpox, bovine papular stomatitis vims); the family Iridoviridae (African swine fever virus, Frog vimses 2 and 3, Lymp
  • a bacterial pilin, a subportion of a bacterial pilin, or a fusion protein which contains either a bacterial pilin or subportion thereof is used to prepare compositions and vaccine compositions, respectively, of the invention.
  • pilin proteins include pilins produced by Escherichia coli, Haemophilus in ⁇ uenzae, Neisseria meningitidis, Neisseria gonorrhoeae, Caulobacter crescentus, Pseudomonas stutzeri, and Pseudomonas aeruginosa.
  • amino acid sequences of pilin proteins suitable for use with the present invention include those set out in GenBank reports AJ000636, AJ132364, AF229646, AF051814, AF051815, and X00981, the entire disclosures of which are inco ⁇ orated herein by reference.
  • Bacterial pilin proteins are generally processed to remove N-terminal leader sequences prior to export of the proteins into the bacterial periplasm. Further, as one skilled in the art would recognize, bacterial pilin proteins used to prepare compositions and vaccine compositions, respectively, of the invention will generally not have the naturally present leader sequence.
  • pilin protein suitable for use in the present invention is the P-pilin of E. coli (GenBank report AF237482 (SEQ ID NO:l)).
  • An example of a Type-1 E. coli pilin suitable for use with the invention is a pilin having the amino acid sequence set out in GenBank report P04128 (SEQ ID NO:2), which is encoded by nucleic acid having the nucleotide sequence set out in GenBank report M27603 (SEQ ID NO:3).
  • GenBank report P04128 SEQ ID NO:2
  • SEQ ID NO:3 The entire disclosures of these GenBank reports are inco ⁇ orated herein by reference.
  • the mature form of the above referenced protein would generally be used to prepare compositions and vaccine compositions, respectively, of the invention.
  • Bacterial pilins or pilin subportions suitable for use in the practice of the present invention will generally be able to associate to form ordered and repetitive antigen arrays.
  • Pilin proteins are then purified by chromatography, after which pilin dimers are formed by dialysis against 5 mM tris(hydroxymethyl) aminomethane hydrochloride (pH 8.0). Eshdat et al. also found that pilin dimers reassemble to form pili upon dialysis against the 5 mM tris(hydroxymethyl) aminomethane (pH 8.0) containing 5 mM MgCl .
  • pilin proteins may be modified to contain a first attachment site to which an antigen or antigenic determinant is linked through a second attachment site.
  • antigens or antigenic determinants can be directly linked through a second attachment site to amino acid residues which are naturally resident in these proteins. These modified pilin proteins may then be used in vaccine compositions of the invention.
  • Bacterial pilin proteins used to prepare compositions and vaccine compositions, respectively, of the invention may be modified in a manner similar to that described herein for HBcAg.
  • cysteine and lysine residues may be either deleted or substituted with other amino acid residues and first attachment sites may be added to these proteins.
  • pilin proteins may either be expressed in modified form or may be chemically modified after expression.
  • intact pili may be harvested from bacteria and then modified chemically.
  • pili or pilus-like stmctures are harvested from bacteria (e.g., E. coli) and used to form compositions and vaccine compositions of the invention.
  • bacteria e.g., E. coli
  • pili suitable for preparing compositions and vaccine compositions is the Type-1 pilus of E. coli, which is formed from pilin monomers having the amino acid sequence set out in SEQ ID NO:2.
  • pili or pilus-like stmctures may be modified in a variety of ways. For example, a first attachment site can be added to the pili to which antigens or antigen determinants may be attached through a second attachment site.
  • bacterial pili or pilus-like structures can be harvested and modified to lead to ordered and repetitive antigen arrays.
  • Antigens or antigenic determinants could be linked to naturally occurring cysteine resides or lysine residues present in Pili or pilus-like stmctures. In such instances, the high order and repetitiveness of a naturally occurring amino acid residue would guide the coupling of the antigens or antigenic determinants to the pili or pilus-like structures.
  • the pili or pilus-like stmctures could be linked to the second attachment sites of the antigens or antigenic determinants using a heterobifunctional cross-linking agent.
  • compositions and vaccine compositions of the invention When structures which are naturally synthesized by organisms (e.g., pili) are used to prepare compositions and vaccine compositions of the invention, it will often be advantageous to genetically engineer these organisms so that they produce stmctures having desirable characteristics.
  • the E. coli from which these pili are harvested may be modified so as to produce stmctures with specific characteristics.
  • modifications of pilin proteins include the insertion of one or more lysine residues, the deletion or substitution of one or more of the naturally resident lysine residues, and the deletion or substitution of one or more naturally resident cysteine residues (e.g., the cysteine residues at positions 44 and 84 in SEQ ID NO:2).
  • pilin genes which result in the expression products containing a first attachment site other than a lysine residue (e.g., a EOS or JUN domain).
  • suitable first attachment sites will generally be limited to those which do not prevent pilin proteins from forming pili or pilus-like stmctures suitable for use in vaccine compositions of the invention.
  • Pilin genes which naturally reside in bacterial cells can be modified in vivo (e.g., by homologous recombination) or pilin genes with particular characteristics can be inserted into these cells.
  • pilin genes could be introduced into bacterial cells as a component of either a replicable cloning vector or a vector which inserts into the bacterial chromosome.
  • the inserted pilin genes may also be linked to expression regulatory control sequences (e.g., a lac operator).
  • the pili or pilus-like stmctures used in compositions and vaccine compositions, respectively, of the invention will be composed of single type of a pilin subunit.
  • Pili or pilus-like stmctures composed of identical subunits will generally be used because they are expected to form structures which present highly ordered and repetitive antigen arrays.
  • compositions of the invention also include compositions and vaccines comprising pili or pilus-like stmctures formed from heterogenous pilin subunits.
  • the pilin subunits which form these pili or pilus-like stmctures can be expressed from genes naturally resident in the bacterial cell or may be introduced into the cells. When a naturally resident pilin gene and an introduced gene are both expressed in a cell which forms pili or pilus-like stmctures, the result will generally be stmctures formed from a mixture of these pilin proteins.
  • each pilin gene when two or more pilin genes are expressed in a bacterial cell, the relative expression of each pilin gene will typically be the factor which determines the ratio of the different pilin subunits in the pili or pilus-like stmctures.
  • the expression of at least one of the pilin genes can be regulated by a heterologous, inducible promoter.
  • promoters as well as other genetic elements, can be used to regulate the relative amounts of different pilin subunits produced in the bacterial cell and, hence, the composition of the pili or pilus-like stmctures.
  • the antigen or antigenic determinant can be linked to bacterial pili or pilus-like stmctures by a bond which is not a peptide bond
  • bacterial cells which produce pili or pilus-like stmctures used in the compositions of the invention can be genetically engineered to generate pilin proteins which are fused to an antigen or antigenic determinant.
  • Such fusion proteins which form pili or pilus-like structures are suitable for use in vaccine compositions of the invention.
  • the core particle is a vims-like particle, wherein the vims-like particle is a recombinant vims-like particle.
  • the skilled artisan can produce VLPs using recombinant DNA technology and vims coding sequences which are readily available to the public.
  • the coding sequence of a vims envelope or core protein can be engineered for expression in a baculovims expression vector using a commercially available baculovims vector, under the regulatory control of a vims promoter, with appropriate modifications of the sequence to allow functional linkage of the coding sequence to the regulatory sequence.
  • the coding sequence of a vims envelope or core protein can also be engineered for expression in a bacterial expression vector, for example.
  • VLPs include, but are not limited to, the capsid proteins of Hepatitis B vims (Ulrich, et al, Virus Res. 50:141-182 (1998)), measles vims (Wames, et al, Gene 750:173-178 (1995)), Sindbis vims, rotavims (US 5,071,651 and US 5,374,426), foot-and-mouth-disease vims (Twomey, et al, Vaccine 75:1603-1610, (1995)), Norwalk vims (Jiang, X., et al, Science 250:1580-1583 (1990); Matsui, S.M., et al, J. Clin. Invest.
  • the retroviral GAG protein (WO 96/30523), the retrotransposon Ty protein pi, the surface protein of Hepatitis B vims (WO 92/11291), human papilloma vims (WO 98/15631), RNA phages, Ty, fr-phage, GA-phage, AP205-phage and Q ⁇ -phage.
  • the VLP of the invention is not limited to any specific form.
  • the particle can be synthesized chemically or through a biological process, which can be natural or non-natural.
  • this type of embodiment includes a vims-like particle or a recombinant form thereof.
  • the VLP can comprise, or alternatively essentially consist of, or alternatively consist of recombinant polypeptides, or fragments thereof, being selected from recombinant polypeptides of Rotavims, recombinant polypeptides of Norwalk vims, recombinant polypeptides of Alphavims, recombinant polypeptides of Foot and Mouth Disease virus, recombinant polypeptides of measles vims, recombinant polypeptides of Sindbis vims, recombinant polypeptides of Polyoma vims, recombinant polypeptides of Retrovims, recombinant polypeptides of Hepatitis B vims (e.g., a HBcAg), recombinant polypeptides of Tobacco mosaic vims, recombinant polypeptides of Flock House Vims, recombinant polypeptides of human Papill
  • the vims- like particle can further comprise, or alternatively essentially consist of, or alternatively consist of, one or more fragments of such polypeptides, as well as variants of such polypeptides.
  • Variants of polypeptides can share, for example, at least 80%, 85%, 90%, 95%, 97%, or 99% identity at the amino acid level with their wild-type counte ⁇ arts.
  • the vims-like particle comprises, consists essentially of, or alternatively consists of recombinant proteins, or fragments thereof, of a RNA-phage.
  • the RNA-phage is selected from the group consisting of a) bacteriophage Q ⁇ ; b) bacteriophage R17; c) bacteriophage fr; d) bacteriophage GA; e) bacteriophage SP; f) bacteriophage MS2; g) bacteriophage Mi l; h) bacteriophage MX1; i) bacteriophage NL95; k) bacteriophage f2; 1) bacteriophage PP7, and m) bacteriophage AP205.
  • the vims-like particle comprises, or alternatively consists essentially of, or alternatively consists of recombinant proteins, or fragments thereof, of the RNA-bacteriophage Q ⁇ or of the RNA-bacteriophage fr, or of the RNA-bacteriophage AP205.
  • the recombinant proteins comprise, or alternatively consist essentially of, or alternatively consist of coat proteins of RNA phages.
  • RNA-phage coat proteins forming capsids or VLPs, or fragments of the bacteriophage coat proteins compatible with self-assembly into a capsid or a VLP are, therefore, further preferred embodiments of the present invention.
  • Bacteriophage Q ⁇ coat proteins for example, can be expressed recombinantly in E. coli. Further, upon such expression these proteins spontaneously form capsids. Additionally, these capsids form a stmcture with an inherent repetitive organization.
  • bacteriophage coat proteins which can be used to prepare compositions of the invention include the coat proteins of RNA bacteriophages such as bacteriophage Q ⁇ (SEQ ID NO:4; PIR Database, Accession No. VCBPQ ⁇ referring to Q ⁇ CP and SEQ ID NO: 5; Accession No. AAA16663 referring to Q ⁇ Al protein), bacteriophage R17 (SEQ ID NO:6; PIR Accession No. VCBPR7), bacteriophage fr (SEQ ID NO:7; PIR Accession No. VCBPFR), bacteriophage GA (SEQ ID NO:8; GenBank Accession No. NP-040754), bacteriophage SP (SEQ ID NO:9; GenBank Accession No.
  • bacteriophage PP7 SEQ ID NO: 16
  • bacteriophage AP205 SEQ ID NO: 28
  • Al protein of bacteriophage Q ⁇ SEQ ID NO: 5
  • C-terminal truncated forms missing as much as 100, 150 or 180 amino acids from its C-terminus may be inco ⁇ orated in a capsid assembly of Q ⁇ coat proteins.
  • the percentage of Q ⁇ Al protein relative to Q ⁇ CP in the capsid assembly will be limited, in order to ensure capsid formation.
  • Q ⁇ coat protein has also been found to self-assemble into capsids when expressed in E. coli (Kozlovska TM. et al, GENE 137: 133-137 (1993)).
  • the capsid contains 180 copies of the coat protein, which are linked in covalent pentamers and hexamers by disulfide bridges (Golmohammadi, R.
  • Capsids or VLPs made from recombinant Q ⁇ coat protein may contain, however, subunits not linked via disulfide links to other subunits within the capsid, or incompletely linked. However, typically more than about 80%) of the subunits are linked via disulfide bridges to each other within the VLP.
  • bands corresponding to monomeric Q ⁇ coat protein as well as bands corresponding to the hexamer or pentamer of Q ⁇ coat protein are visible.
  • Q ⁇ capsid protein also shows unusual resistance to organic solvents and denaturing agents. Surprisingly, we have observed that DMSO and acetonitrile concentrations as high as 30%), and Guanidinium concentrations as high as 1 M do not affect the stability of the capsid.
  • DMSO and acetonitrile concentrations as high as 30% do not affect the stability of the capsid.
  • the high stability of the capsid of Q ⁇ coat protein is an advantageous feature, in particular, for its use in immunization and vaccination of mammals and humans in accordance of the present invention.
  • VLP composed from Q ⁇ coat proteins where the N-terminal methionine has not been removed, or VLPs comprising a mixture of Q ⁇ coat proteins where the N-terminal methionine is either cleaved or present are also within the scope of the present invention.
  • RNA phage coat proteins have also been shown to self-assemble upon expression in a bacterial host (Kastelein, RA. et al, Gene 23: 245-254 (1983), Kozlovskaya, TM. et al, Dokl Akad. Nauk SSSR 287: 452-455 (1986), Adhin, MR. et al, Virology 170: 238-242 (1989), Ni, CZ., et al, Protein Sci.
  • the Q ⁇ phage capsid contains, in addition to the coat protein, the so called read-through protein Al and the maturation protein A2. Al is generated by suppression at the UGA stop codon and has a length of 329 aa.
  • the capsid of phage Q ⁇ recombinant coat protein used in the invention is devoid of the A2 lysis protein, and contains RNA from the host.
  • the coat protein of RNA phages is an RNA binding protein, and interacts with the stem loop of the ribosomal binding site of the replicase gene acting as a translational repressor during the life cycle of the vims.
  • the sequence and stmctural elements of the interaction are known (Witherell, GW. & Uhlenbeck, OC. Biochemistry 28: 71- 76 (1989); Lim F. et al., J. Biol. Chem. 271: 31839-31845 (1996)).
  • the stem loop and RNA in general are known to be involved in the vims assembly (Golmohammadi, R. et al, Structure 4: 543-5554 (1996)).
  • the vims-like particle comprises, or alternatively consists essentially of, or alternatively consists of recombinant proteins, or fragments thereof, of a RNA-phage, wherein the recombinant proteins comprise, alternatively consist essentially of or alternatively consist of mutant coat proteins of a RNA phage, preferably of mutant coat proteins of the RNA phages mentioned above.
  • the mutant coat proteins of the RNA phage have been modified by removal of at least one, or alternatively at least two, lysine residue by way of substitution, or by addition of at least one lysine residue by way of substitution; alternatively, the mutant coat proteins of the RNA phage have been modified by deletion of at least one, or alternatively at least two, lysine residue, or by addition of at least one lysine residue by way of insertion.
  • the deletion, substitution or addition of at least one lysine residue allows varying the degree of coupling, i.e. the amount of A ⁇ l-6 peptides per subunits of the VLP of the RNA-phages, in particular, to match and tailor the requirements of the vaccine.
  • the vims-like particle comprises, or alternatively consists essentially of, or alternatively consists of recombinant proteins, or fragments thereof, of the RNA-bacteriophage Q ⁇ , wherein the recombinant proteins comprise, or alternatively consist essentially of, or alternatively consist of coat proteins having an amino acid sequence of SEQ ID NO:4, or a mixture of coat proteins having amino acid sequences of SEQ ID NO:4 and of SEQ ID NO: 5 or mutants of SEQ ID NO: 5 and wherein the N-terminal methionine is preferably cleaved.
  • the vims-like particle comprises, consists essentially of or alternatively consists of recombinant proteins of Q ⁇ , or fragments thereof, wherein the recombinant proteins comprise, or alternatively consist essentially of, or alternatively consist of mutant Q ⁇ coat proteins.
  • these mutant coat proteins have been modified by removal of at least one lysine residue by way of substitution, or by addition of at least one lysine residue by way of substitution.
  • these mutant coat proteins have been modified by deletion of at least one lysine residue, or by addition of at least one lysine residue by way of insertion.
  • Q ⁇ mutants for which exposed lysine residues are replaced by arginines can also be used for the present invention.
  • the following Q ⁇ coat protein mutants and mutant Q ⁇ VLPs can, thus, be used in the practice of the invention: "Q ⁇ -240" (Lysl3-Arg; SEQ ID NO: 17), "Q ⁇ -243" (Asn 10-Lys; SEQ ID NO: 18), "Q ⁇ -250” (Lys 2-Arg, Lysl3-Arg; SEQ ID NO: 19), "Q ⁇ -251” (SEQ ID NO:20) and "Q ⁇ -259” (Lys 2-Arg, Lysl6-Arg; SEQ ID NO:21).
  • the vims-like particle comprises, consists essentially of or alternatively consists of recombinant proteins of mutant Q ⁇ coat proteins, which comprise proteins having an amino acid sequence selected from the group of a) the amino acid sequence of SEQ ID NO: 17; b) the amino acid sequence of SEQ ID NO: 18; c) the amino acid sequence of SEQ ID NO: 19; d) the amino acid sequence of SEQ ID NO:20; and e) the amino acid sequence of SEQ ID NO: 21.
  • the constmction, expression and purification of the above indicated Q ⁇ coat proteins, mutant Q ⁇ coat protein VLPs and capsids, respectively, are described in WO 02/056905. In particular is hereby referred to Example 18 of above mentioned application.
  • the vims-like particle comprises, or alternatively consists essentially of, or alternatively consists of recombinant proteins of Q ⁇ , or fragments thereof, wherein the recombinant proteins comprise, consist essentially of or alternatively consist of a mixture of either one of the foregoing Q ⁇ mutants and the corresponding Al protein.
  • the vims-like particle comprises, or alternatively essentially consists of, or alternatively consists of recombinant proteins, or fragments thereof, of RNA-phage AP205.
  • the AP205 genome consists of a maturation protein, a coat protein, a replicase and two open reading frames not present in related phages; a lysis gene and an open reading frame playing a role in the translation of the maturation gene (Klovins,J., et al, J. Gen. Virol. 83: 1523-33 (2002)).
  • AP205 coat protein can be expressed from plasmid pAP283-58 (SEQ ID NO: 27), which is a derivative of pQblO (Kozlovska, T. M.. et al, Gene 757:133-37 (1993)), and which contains an AP205 ribosomal binding site.
  • AP205 coat protein may be cloned into pQbl85, downstream of the ribosomal binding site present in the vector. Both approaches lead to expression of the protein and formation of capsids as described in the co-pending US provisional patent application with the title "Molecular Antigen Arrays" (Atty. Docket No. 1700.0310000) and having been filed on July 17, 2002, which is inco ⁇ orated by reference in its entirety.
  • Vectors pQblO and pQbl85 are vectors derived from pGEM vector, and expression of the cloned genes in these vectors is controlled by the trp promoter (Kozlovska, T. M.
  • Plasmid pAP283-58 (SEQ ID NO:27) comprises a putative AP205 ribosomal binding site in the following sequence, which is downstream of the Xbal site, and immediately upstream of the ATG start codon of the AP205 coat protein: tct ⁇ g ⁇ ATTTTCTGCGCACCCAT CCCGGGTGGCGCCCAAAGTGAGGAAAATCAC ⁇ tg (SEQ ID NO:57).
  • the vector pQbl85 comprises a Shine Delagamo sequence downstream from the Xbal site and upstream of the start codon (tctflgaTTAACCCAACGCGTAGGAG TCAGGCC ⁇ tg (SEQ ID NO:58), Shine Delagamo sequence underlined).
  • the vims-like particle comprises, or alternatively essentially consists of, or alternatively consists of recombinant coat proteins, or fragments thereof, of the RNA-phage AP205.
  • This preferred embodiment of the present invention thus, comprises AP205 coat proteins that form capsids.
  • Such proteins are recombinantly expressed, or prepared from natural sources.
  • AP205 coat proteins produced in bacteria spontaneously form capsids, as evidenced by Electron Microscopy (EM) and immunodiffusion.
  • EM Electron Microscopy
  • SEQ ID NO: 28 The stmctural properties of the capsid formed by the AP205 coat protein (SEQ ID NO: 28) and those formed by the coat protein of the AP205 RNA phage are nearly indistinguishable when seen in EM.
  • AP205 VLPs are highly immunogenic, and can be linked with antigens and/or antigenic determinants to generate vaccine constructs displaying the antigens and/or antigenic determinants oriented in a repetitive manner. High titers are elicited against the so displayed antigens showing that bound antigens and/or antigenic determinants are accessible for interacting with antibody molecules and are immunogenic
  • the vims-like particle comprises, or alternatively essentially consists of, or alternatively consists of recombinant mutant coat proteins, or fragments thereof, of the RNA-phage AP205.
  • Assembly-competent mutant forms of AP205 VLPs including AP205 coat protein with the subsitution of proline at amino acid 5 to threonine (SEQ ID NO: 29), may also be used in the practice of the invention and leads to a further preferred embodiment of the invention.
  • AP205 P5-T mutant coat protein can be expressed from plasmid pAP281-32 (SEQ ID No. 30), which is derived directly from pQbl85, and which contains the mutant AP205 coat protein gene instead of the Q ⁇ coat protein gene.
  • Vectors for expression of the AP205 coat protein are transfected into E. coli for expression of the AP205 coat protein.
  • Suitable E. coli strains include, but are not limited to, E. coli K802, JM 109, RR1.
  • Suitable vectors and strains and combinations thereof can be identified by testing expression of the coat protein and mutant coat protein, respectively, by SDS-PAGE and capsid formation and assembly by optionally first purifying the capsids by gel filtration and subsequently testing them in an immunodiffusion assay (Ouchterlony test) or Electron Microscopy (Kozlovska, T. M.. et al, Gene 757:133-37 (1993)).
  • AP205 coat proteins expressed from the vectors pAP283-58 and pAP281-32 may be devoid of the initial Methionine amino-acid, due to processing in the cytoplasm of E. coli. Cleaved, uncleaved forms of AP205 VLP or mixtures thereof are further preferred embodiments of the invention.
  • the vims-like particle comprises, or alternatively essentially consists of, or alternatively consists of a mixture of recombinant coat proteins, or fragments thereof, of the RNA-phage AP205 and of recombinant mutant coat proteins, or fragments thereof, of the RNA- phage AP205.
  • the vims-like particle comprises, or alternatively essentially consists of, or alternatively consists of fragments of recombinant coat proteins or recombinant mutant coat proteins of the RNA-phage AP205.
  • Recombinant AP205 coat protein fragments capable of assembling into a VLP and a capsid, respectively are also useful in the practice of the invention. These fragments may be generated by deletion, either internally or at the termini of the coat protein and mutant coat protein, respectively. Insertions in the coat protein and mutant coat protein sequence or fusions of antigen sequences to the coat protein and mutant coat protein sequence, and compatible with assembly into a VLP, are further embodiments of the invention and lead to chimeric AP205 coat proteins, and particles, respectively. The outcome of insertions, deletions and fusions to the coat protein sequence and whether it is compatible with assembly into a VLP can be determined by electron microscopy.
  • the particles formed by the AP205 coat protein, coat protein fragments and chimeric coat proteins described above can be isolated in pure form by a combination of fractionation steps by precipitation and of purification steps by gel filtration using e.g. Sepharose CL-4B, Sepharose CL-2B, Sepharose CL-6B columns and combinations thereof.
  • Other methods of isolating vims-like particles are known in the art, and may be used to isolate the vims-like particles (VLPs) of bacteriophage AP205.
  • VLPs vims-like particles
  • the use of ultracentrifugation to isolate VLPs of the yeast retrotransposon Ty is described in U.S. Patent No. 4,918,166, which is inco ⁇ orated by reference herein in its entirety.
  • RNA-phage coat proteins can be modified such that one or more reactive amino acid residues can be inserted by way of insertion or substitution.
  • those modified forms of bacteriophage coat proteins can also be used for the present invention.
  • variants of proteins which form capsids or capsid-like stmctures e.g., coat proteins of bacteriophage Q ⁇ , bacteriophage R17, bacteriophage fr, bacteriophage GA, bacteriophage SP, bacteriophage AP205, and bacteriophage MS2
  • coat proteins of bacteriophage Q ⁇ , bacteriophage R17, bacteriophage fr, bacteriophage GA, bacteriophage SP, bacteriophage AP205, and bacteriophage MS2 can also be used to prepare compositions of the present invention.
  • the invention further includes compositions and vaccine compositions, respectively, which further includes variants of proteins which form capsids or capsid-like stmctures, as well as methods for preparing such compositions and vaccine compositions, respectively, individual protein subunits used to prepare such compositions, and nucleic acid molecules which encode these protein subunits.
  • variant forms of wild-type proteins which form capsids or capsid-like structures and retain the ability to associate and form capsids or capsid-like stmctures.
  • compositions and vaccine compositions comprising proteins, which comprise, or alternatively consist essentially of, or alternatively consist of amino acid sequences which are at least 80%, 85%, 90%, 95%, 97%, or 99% identical to wild-type proteins which form ordered arrays and have an inherent repetitive structure, respectively.
  • nucleic acid molecules which encode proteins used to prepare compositions of the present invention.
  • the invention further includes compositions comprising proteins, which comprise, or alternatively consist essentially of, or alternatively consist of amino acid sequences which are at least 80%, 85%, 90%), 95%, 97%, or 99% identical to any of the amino acid sequences shown in SEQ ID NOs:4-21.
  • Proteins suitable for use in the present invention also include C-terminal truncation mutants of proteins which form capsids or capsid-like stmctures, or VLPs.
  • Specific examples of such truncation mutants include proteins having an amino acid sequence shown in any of SEQ ID NOs:4-21 where 1, 2, 5, 7, 9, 10, 12, 14, 15, or 17 amino acids have been removed from the C-terminus.
  • theses C-terminal truncation mutants will retain the ability to form capsids or capsid-like stmctures.
  • Further proteins suitable for use in the present invention also include N-terminal truncation mutants of proteins which form capsids or capsid-like stmctures.
  • tmncation mutants include proteins having an amino acid sequence shown in any of SEQ ID NOs:4-21 where 1, 2, 5, 7, 9, 10, 12, 14, 15, or 17 amino acids have been removed from the N-terminus.
  • these N-terminal truncation mutants will retain the ability to form capsids or capsid-like stmctures.
  • Additional proteins suitable for use in the present invention include N- and C-terminal truncation mutants which form capsids or capsid-like stmctures.
  • Suitable tmncation mutants include proteins having an amino acid sequence shown in any of SEQ ID NOs:4-21 where 1, 2, 5, 7, 9, 10, 12, 14, 15, or 17 amino acids have been removed from the N-terminus and 1, 2, 5, 7, 9, 10, 12, 14, 15, or 17 amino acids have been removed from the C-terminus.
  • these N-terminal and C-terminal truncation mutants will retain the ability to form capsids or capsid-like stmctures.
  • compositions comprising proteins which comprise, or alternatively consist essentially of, or alternatively consist of, amino acid sequences which are at least 80%, 85%, 90%, 95%, 97%, or 99% identical to the above described tmncation mutants.
  • the invention thus includes compositions and vaccine compositions prepared from proteins which form capsids or VLPs, methods for preparing these compositions from individual protein subunits and VLPs or capsids, methods for preparing these individual protein subunits, nucleic acid molecules which encode these subunits, and methods for vaccinating and/or eliciting immunological responses in individuals using these compositions of the present invention.
  • the invention includes vims-like particles or recombinant forms thereof.
  • the particles used in compositions of the invention are composed of a Hepatitis B core protein (HBcAg) or a fragment of a HBcAg.
  • the particles used in compositions of the invention are composed of a Hepatitis B core protein (HBcAg) or a fragment of a HBcAg protein, which has been modified to either eliminate or reduce the number of free cysteine residues.
  • HBcAg Hepatitis B core protein
  • Zhou et al. J. Virol. 6 ⁇ 5:5393-5398 (1992) demonstrated that HBcAgs which have been modified to remove the naturally resident cysteine residues retain the ability to associate and form capsids.
  • VLPs suitable for use in compositions of the invention include those comprising modified HBcAgs, or fragments thereof, in which one or more of the naturally resident cysteine residues have been either deleted or substituted with another amino acid residue (e.g., a serine residue).
  • the HBcAg is a protein generated by the processing of a Hepatitis B core antigen precursor protein.
  • a number of isotypes of the HBcAg have been identified and their amino acids sequences are readily available to those skilled in the art.
  • compositions and vaccine compositions, respectively, of the invention will be prepared using the processed form of a HBcAg (i.e., a HBcAg from which the N-terminal leader sequence of the Hepatitis B core antigen precursor protein have been removed).
  • the HBcAgs when HBcAgs are produced under conditions where processing will not occur, the HBcAgs will generally be expressed in "processed" form.
  • these proteins when an E. coli expression system directing expression of the protein to the cytoplasm is used to produce HBcAgs of the invention, these proteins will generally be expressed such that the N-terminal leader sequence of the Hepatitis B core antigen precursor protein is not present.
  • Hepatitis B vims-like particles which can be used for the present invention, is disclosed, for example, in WO 00/32227, and hereby in particular in Examples 17 to 19 and 21 to 24, as well as in WO 01/85208, and hereby in particular in Examples 17 to 19, 21 to 24, 31 and 41, and in WO 02/056905. For the latter application, it is in particular referred to Example 23, 24, 31 and 51. All three documents are explicitly inco ⁇ orated herein by reference.
  • the present invention also includes HBcAg variants which have been modified to delete or substitute one or more additional cysteine residues. It is known in the art that free cysteine residues can be involved in a number of chemical side reactions.
  • ⁇ side reactions include disulfide exchanges, reaction with chemical substances or metabolites that are, for example, injected or formed in a combination therapy with other substances, or direct oxidation and reaction with nucleotides upon exposure to UV light.
  • Toxic adducts could thus be generated, especially considering the fact that HBcAgs have a strong tendency to bind nucleic acids.
  • the toxic adducts would thus be distributed between a multiplicity of species, which individually may each be present at low concentration, but reach toxic levels when together.
  • HBcAgs in vaccine compositions which have been modified to remove naturally resident cysteine residues is that sites to which toxic species can bind when antigens or antigenic determinants are attached would be reduced in number or eliminated altogether.
  • HBcAg variants suitable for use in the practice of the present invention have been identified. Yuan et al, (J. Virol. 75:10122-10128 (1999)), for example, describe variants in which the isoleucine residue at position corresponding to position 97 in SEQ ID NO:22 is replaced with either a leucine residue or a phenylalanine residue.
  • HBcAg variants differ in amino acid sequence at a number of positions, including amino acid residues which corresponds to the amino acid residues located at positions 12, 13, 21, 22, 24, 29, 32, 33, 35, 38, 40, 42, 44, 45, 49, 51, 57, 58, 59, 64, 66, 67, 69, 74, 77, 80, 81, 87, 92, 93, 97, 98, 100, 103, 105, 106, 109, 113, 116, 121, 126, 130, 133, 135, 141, 147, 149, 157, 176, 178, 182 and 183 in SEQ ID NO:25.
  • Further HBcAg variants suitable for use in the compositions of the invention, and which may be further modified according to the disclosure of this specification are described in WO
  • HBcAgs As noted above, generally processed HBcAgs (i.e., those which lack leader sequences) will be used in the compositions and vaccine compositions, respectively, of the invention.
  • the present invention includes vaccine compositions, as well as methods for using these compositions, which employ the above described variant HBcAgs.
  • the amino acid sequence of a polypeptide has an amino acid sequence that is at least 80%, 85%, 90%, 95%, 97% or 99% identical to one of the above wild- type amino acid sequences, or a subportion thereof, can be determined conventionally using known computer programs such the Bestfit program.
  • Bestfit or any other sequence alignment program to determine whether a particular sequence is, for instance, 95% identical to a reference amino acid sequence, the parameters are set such that the percentage of identity is calculated over the full length of the reference amino acid sequence and that gaps in homology of up to 5% of the total number of amino acid residues in the reference sequence are allowed.
  • amino acid sequences of the hereinabove mentioned HBcAg variants and precursors are relatively similar to each other.
  • reference to an amino acid residue of a HBcAg variant located at a position which corresponds to a particular position in SEQ ID NO:25 refers to the amino acid residue which is present at that position in the amino acid sequence shown in SEQ ID NO:25.
  • the homology between these HBcAg variants is for the most part high enough among Hepatitis B vimses that infect mammals so that one skilled in the art would have little difficulty reviewing both the amino acid sequence shown in SEQ ID NO:25 and that of a particular HBcAg variant and identifying "corresponding" amino acid residues.
  • the HBcAg amino acid sequence shown in SEQ ID NO:24 which shows the amino acid sequence of a HBcAg derived from a vims which infect woodchucks, has enough homology to the HBcAg having the amino acid sequence shown in SEQ ID NO:25 that it is readily apparent that a three amino acid residue insert is present in SEQ ID NO:25 between amino acid residues 155 and 156 of SEQ ID NO:25.
  • the invention also includes vaccine compositions which comprise HBcAg variants of Hepatitis B vimses which infect birds, as wells as vaccine compositions which comprise fragments of these HBcAg variants.
  • vaccine compositions which comprise HBcAg variants of Hepatitis B vimses which infect birds, as wells as vaccine compositions which comprise fragments of these HBcAg variants.
  • HBcAg variants one, two, three or more of the cysteine residues naturally present in these polypeptides could be either substituted with another amino acid residue or deleted prior to their inclusion in vaccine compositions of the invention.
  • cysteine residues of the Hepatitis B vims capsid protein have been either deleted or substituted with another amino acid residue.
  • compositions and vaccine compositions, respectively, of the invention will contain HBcAgs from which the C-terminal region (e.g., amino acid residues 145-185 or 150-185 of SEQ ID NO: 25) has been removed.
  • additional modified HBcAgs suitable for use in the practice of the present invention include C-terminal truncation mutants. Suitable tmncation mutants include HBcAgs where 1, 5, 10, 15, 20, 25, 30, 34, 35, amino acids have been removed from the C-terminus.
  • HBcAgs suitable for use in the practice of the present invention also include N-terminal tmncation mutants. Suitable truncation mutants include modified HBcAgs where 1, 2, 5, 7, 9, 10, 12, 14, 15, or 17 amino acids have been removed from the N-terminus. Further HBcAgs suitable for use in the practice of the present invention include
  • Suitable tmncation mutants include HBcAgs where 1, 2, 5, 7, 9, 10, 12, 14, 15, and 17 amino acids have been removed from the N-terminus and 1, 5, 10, 15, 20, 25, 30, 34, 35 amino acids have been removed from the C-terminus.
  • the invention further includes compositions and vaccine compositions, respectively, comprising HBcAg polypeptides comprising, or alternatively essentially consisting of, or alternatively consisting of, amino acid sequences which are at least 80%, 85%, 90%, 95%, 97%, or 99% identical to the above described tmncation mutants.
  • a lysine residue is introduced into a
  • compositions of the invention are prepared using a HBcAg comprising, or alternatively consisting of, amino acids 1-144, or 1-149, 1- 185 of SEQ ID NO:25, which is modified so that the amino acids corresponding to positions 79 and 80 are replaced with a peptide having the amino acid sequence of Gly-Gly-Lys-Gly-Gly (SEQ ID NO:33) resulting in the HBcAg polypeptide having the sequence shown in SEQ ID NO: 26.
  • compositions are particularly useful in those embodiments where an antigenic determinant is coupled to a VLP of HBcAg.
  • cysteine residues at positions 48 and 107 of SEQ ID NO:25 are mutated to serine.
  • the invention further includes compositions comprising the corresponding polypeptides having amino acid sequences shown in any of the hereinabove mentioned Hepatitis B core antigen precursor variants which also have above noted amino acid alterations. Further included within the scope of the invention are additional HBcAg variants which are capable of associating to form a capsid or VLP and have the above noted amino acid alterations.
  • compositions and vaccine compositions comprising HBcAg polypeptides which comprise, or alternatively consist of, amino acid sequences which are at least 80%, 85%, 90%, 95%, 97% or 99% identical to any of the wild-type amino acid sequences, and forms of these proteins which have been processed, where appropriate, to remove the N-terminal leader sequence and modified with above noted alterations.
  • Compositions or vaccine compositions of the invention may comprise mixtures of different HBcAgs.
  • these vaccine compositions may be composed of HBcAgs which differ in amino acid sequence.
  • vaccine compositions could be prepared comprising a "wild-type" HBcAg and a modified HBcAg in which one or more amino acid residues have been altered (e.g., deleted, inserted or substituted).
  • preferred vaccine compositions of the invention are those which present highly ordered and repetitive antigen arrays, wherein the antigen is a A ⁇ 1-6 peptide.
  • the at least one A ⁇ l-6 peptide is bound to said virus-like particle and core particle, respectively, by at least one covalent bond.
  • the least one A ⁇ l-6 peptide is bound to the vims-like particle and core particle, respectively, by at least one covalent bond, said covalent bond being a non-peptide bond leading to a A ⁇ l-6 peptide array and A ⁇ l-6 peptide -VLP conjugate, respectively.
  • This A ⁇ l-6 peptide array and conjugate, respectively has typically and preferably a repetitive and ordered stmcture since the at least one A ⁇ l-6 peptide is bound to the VLP and ccore particle, respectively, in an oriented manner.
  • a ⁇ l-6 peptide -VLP array and conjugate is ensured by an oriented and directed as well as defined binding and attachment, respectively, of the at least one A ⁇ l-6 peptide to the VLP and core particle, respectively, as will become apparent in the following.
  • the typical inherent highly repetitive and organized stmcture of the VLPs and core particles, respectively advantageously contributes to the display of the A ⁇ l-6 peptide in a highly ordered and repetitive fashion leading to a highly organized and repetitive A ⁇ l-6 peptide -VLP array and conjugate, respectively.
  • the preferred inventive conjugates and arrays differ from prior art conjugates in their highly organized structure, dimensions, and in the repetitiveness of the antigen on the surface of the array.
  • the preferred embodiment of this invention furthermore, allows expression of the particle in an expression host guaranteeing proper folding and assembly of the VLP, to which the antigen, i.e the A ⁇ l-6 peptide, is then further coupled
  • the present invention discloses methods of binding of A ⁇ l-6 peptide to VLPs.
  • the A ⁇ 1 -6 peptide is bound to the VLP by way of chemical cross-linking, typically and preferably by using a heterobifunctional cross-linker.
  • a heterobifunctional cross-linker typically and preferably by using a heterobifunctional cross-linker.
  • the hetero-bifunctional cross-linker contains a functional group which can react with preferred first attachment sites, i.e. with the side-chain amino group of lysine residues of the VLP or at least one VLP subunit, and a further functional group which can react with a preferred second attachment site, i.e.
  • the first step of the procedure is the reaction of the VLP with the cross-linker.
  • the product of this reaction is an activated VLP, also called activated carrier.
  • unreacted cross-linker is removed using usual methods such as gel filtration or dialysis.
  • the A ⁇ l-6 peptide is reacted with the activated VLP, and this step is typically called the coupling step.
  • Unreacted A ⁇ l-6 peptide may be optionally removed in a fourth step, for example by dialysis.
  • Several heterobifunctional cross-linkers are known to the art.
  • cross- linkers include the preferred cross- linkers SMPH (Pierce), Sulfo-MBS, Sulfo-EMCS, Sulfo-GMBS, Sulfo-SIAB, Sulfo- SMPB, Sulfo-SMCC, SVSB, SIA and other cross-linkers available for example from the Pierce Chemical Company (Rockford, IL, USA) , and having one functional group reactive towards amino groups and one functional group reactive towards cysteine residues.
  • the above mentioned cross-linkers all lead to formation of a thioether linkage.
  • Another class of cross-linkers suitable in the practice of the invention is characterized by the introduction of a disulfide linkage between the A ⁇ 1 - 6 peptide and the VLP upon coupling.
  • Preferred cross-linkers belonging to this class include for example SPDP and Sulfo-LC-SPDP (Pierce).
  • the extent of derivatization of the VLP with cross-linker can be influenced by varying experimental conditions such as the concentration of each of the reaction partners, the excess of one reagent over the other, the pH, the temperature and the ionic strength.
  • the degree of coupling, i.e. the amount of A ⁇ l-6 peptides per subunits of the VLP can be adjusted by varying the experimental conditions described above to match the requirements of the vaccine.
  • a particularly favored method of binding of A ⁇ l-6 peptides to the VLP is the linking of a lysine residue on the surface of the VLP with a cysteine residue on the A ⁇ l-6 peptide.
  • fusion of an amino acid linker containing a cysteine residue, as a second attachment site or as a part thereof, to A ⁇ l-6 for coupling to the VLP may be required.
  • amino acid linkers are favored.
  • amino acid linkers are the hinge region of Immunoglobulins, glycine serine linkers (GGGGS) n (SEQ ID NO: 38), and glycine linkers (G) n all further containing a cysteine residue as second attachment site and optionally further glycine residues.
  • amino acid linkers are N-terminal gammal: CGDKTHTSPP (SEQ ID NO: 39); C-terminal gamma 1 : DKTHTSPPCG (SEQ ID NO: 40); N-terminal gamma 3 CGGPKPSTPPGSSGGAP (SEQ ID NO: 41); C-terminal gamma 3 PKPSTPPGSSGGAPGGCG (SEQ ID NO: 42); N-terminal glycine linker GCGGGG (SEQ ID NO: 43) and C-terminal glycine linker: GGGGCG (SEQ ID NO 44).
  • amino acid linkers particularly suitable in the practice of the invention are CGKKGG (SEQ ID NO: 46), or CGDEGG (SEQ ID NO: 31) for N-terminal linkers, or GGKKGC (SEQ ID NO: 45) and GGEDGC (SEQ ID NO: 32), for the C-terminal linkers.
  • CGKKGG SEQ ID NO: 46
  • CGDEGG SEQ ID NO: 31
  • GGKKGC SEQ ID NO: 45
  • GGEDGC SEQ ID NO: 32
  • the terminal cysteine is optionally C-terminally amidated.
  • GGCG SEQ ID NO: 47
  • GGC GGC or GGC-NH2
  • NH2 stands for amidation
  • linkers at the C-terminus of the peptide or CGG at its N-terminus are preferred as amino acid linkers.
  • glycine residues will be inserted between bulky amino acids and the cysteine to be used as second attachment site, to avoid potential steric hindrance of the bulkier amino acid in the coupling reaction.
  • the amino acid linker GGC-NH2 is fused to the C-terminus of A ⁇ l-6.
  • the cysteine residue present on the A ⁇ l-6 peptide has to be in its reduced state to react with the hetero-bifunctional cross-linker on the activated VLP, that is a free cysteine or a cysteine residue with a free sulfhydryl group has to be available.
  • the cysteine residue to function as binding site is in an oxidized form, for example if it is forming a disulfide bridge, reduction of this disulfide bridge with e.g. DTT, TCEP or ⁇ -mercaptoethanol is required.
  • Other methods of binding the A ⁇ l-6 peptide to the VLP include methods wherein the A ⁇ 1 -6 peptide is cross-linked to the VLP using the carbodiimide EDC, and NHS.
  • the A ⁇ l-6 peptide is attached to the VLP using a homo-bifunctional cross-linker such as glutaraldehyde, DSG, BM[PEO] 4 , BS 3 , (Pierce Chemical Company, Rockford, IL, USA) or other known homo-bifunctional cross-linkers whith functional groups reactive towards amine groups or carboxyl groups of the VLP.
  • a homo-bifunctional cross-linker such as glutaraldehyde, DSG, BM[PEO] 4 , BS 3 , (Pierce Chemical Company, Rockford, IL, USA) or other known homo-bifunctional cross-linkers whith functional groups reactive towards amine groups or carboxyl groups of the VLP.
  • Other methods of binding the VLP to a A ⁇ 1 -6 peptide include methods where the VLP is biotinylated, and the A ⁇ l-6 peptide expressed as a streptavidin-fusion protein, or methods wherein both the A ⁇ l-6 peptide and the VLP are biotinylated, for example as described in WO 00/23955.
  • the A ⁇ l-6 peptide may be first bound to streptavidin or avidin by adjusting the ratio of A ⁇ l-6 peptide to streptavidin such that free binding sites are still available for binding of the VLP, which is added in the next step.
  • all components may be mixed in a "one pot" reaction.
  • ligand-receptor pairs where a soluble form of the receptor and of the ligand is available, and are capable of being cross-linked to the VLP or the A ⁇ l-6 peptide, may be used as binding agents for binding A ⁇ l-6 peptide to the VLP.
  • either the ligand or the receptor may be fused to the A ⁇ l-6 peptide, and so mediate binding to the VLP chemically bound or fused either to the receptor, or the ligand respectively. Fusion may also be effected by insertion or substitution.
  • the present invention the
  • VLP is the VLP of a RNA phage, and in a more preferred embodiment, the VLP is the VLP of RNA phage Q ⁇ coat protein.
  • One or several antigen molecules i.e. a A ⁇ l-6 peptide
  • a specific feature of the VLP of the coat protein of RNA phages and in particular of the Q ⁇ coat protein VLP is thus the possibility to couple several antigens per subunit. This allows for the generation of a dense antigen array.
  • the binding and attachment, respectively, of the at least one A ⁇ l-6 peptide to the vims-like particle is by way of interaction and association, respectively, between at least one first attachment site of the vims-like particle and at least one second attachment of the antigen or antigenic determinant.
  • VLPs or capsids of Q ⁇ coat protein display a defined number of lysine residues on their surface, with a defined topology with three lysine residues pointing towards the interior of the capsid and interacting with the RNA, and four other lysine residues exposed to the exterior of the capsid. These defined properties favor the attachment of antigens to the exterior of the particle, rather than to the interior of the particle where the lysine residues interact with RNA.
  • VLPs of other RNA phage coat proteins also have a defined number of lysine residues on their surface and a defined topology of these lysine residues.
  • the first attachment site is a lysine residue and/or the second attachment comprises sulfhydryl group or a cysteine residue.
  • the first attachment site is a lysine residue and the second attachment is a cysteine residue.
  • the A ⁇ l-6 peptide is bound via a cysteine residue, to lysine residues of the VLP of RNA phage coat protein, and in particular to the VLP of Q ⁇ coat protein.
  • VLPs derived from RNA phages are their high expression yield in bacteria that allows production of large quantities of material at affordable cost.
  • the inventive conjugates and arrays differ from prior art conjugates in their highly organized stmcture, dimensions, and in the repetitiveness of the antigen on the surface of the array.
  • the use of the VLPs as carriers allow the formation of robust antigen arrays and conjugates, respectively, with variable antigen density.
  • the use of VLPs of RNA phages, and hereby in particular the use of the VLP of RNA phage Q ⁇ coat protein allows achieving very high epitope density. In particular, a density of more than 1.5 epitopes per subunit could be reached by coupling the human A ⁇ l-6 peptide to the VLP of Q ⁇ coat protein.
  • compositions of VLPs of RNA phage coat proteins with a high epitope density can be effected using the teaching of this application.
  • an average number of A ⁇ l-6 peptide per subunit of 0.5, 0.6, 0.7, 0.8, 0.9, 1.0, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6 , 1.7, 1.8, 1.9, 2.0, 2.1, 2.2, 2.3, 2.4 2.5, 2.6, 2.7, 2.8, 2.9, or higher is preferred.
  • the second attachment site may be either naturally or non- naturally present with the antigen or the antigenic determinant. In the case of the absence of a suitable natural occurring second attachment site on the antigen or antigenic determinant, such a, then non-natural second attachment has to be engineered to the antigen.
  • lysine residues are exposed on the surface of the VLP of Q ⁇ coat protein. Typically these residues are derivatized upon reaction with a cross-linker molecule. In the instance where not all of the exposed lysine residues can be coupled to an antigen, the lysine residues which have reacted with the cross- linker are left with a cross-linker molecule attached to the ⁇ -amino group after the derivatization step. This leads to disappearance of one or several positive charges, which may be detrimental to the solubility and stability of the VLP.
  • Q ⁇ -240 (Lysl3-Arg; SEQ ID NO:17), Q ⁇ -250 (Lys 2-Arg, Lysl3-Arg; SEQ ID NO: 19) and Q ⁇ -259 (Lys 2-Arg, Lysl6-Arg; SEQ ID NO:21).
  • the constructs were cloned, the proteins expressed, the VLPs purified and used for coupling to peptide and protein antigens.
  • Q ⁇ -251 (SEQ ID NO: 20 was also constmcted, and guidance on how to express, purify and couple the VLP of Q ⁇ -251 coat protein can be found throughout the application.
  • a Q ⁇ mutant coat protein with one additional lysine residue suitable for obtaining even higher density arrays of antigens.
  • This mutant Q ⁇ coat protein, Q ⁇ -243 (Asn 10-Lys; SEQ ID NO: 18), was cloned, the protein expressed, and the capsid or VLP isolated and purified, showing that introduction of the additional lysine residue is compatible with self-assembly of the subunits to a capsid or VLP.
  • a ⁇ l-6 peptide arrays and conjugates, respectively may be prepared using VLP of Q ⁇ coat protein mutants.
  • a particularly favored method of attachment of antigens to VLPs, and in particular to VLPs of RNA phage coat proteins is the linking of a lysine residue present on the surface of the VLP of RNA phage coat proteins with a cysteine residue added to the antigen, i.e. the A ⁇ l-6 peptide.
  • a cysteine residue In order for a cysteine residue to be effective as second attachment site, a sulfhydryl group must be available for coupling. Thus, a cysteine residue has to be in its reduced state, that is, a free cysteine or a cysteine residue with a free sulfhydryl group has to be available.
  • cysteine residue to function as second attachment site is in an oxidized form, for example if it is forming a disulfide bridge
  • reduction of this disulfide bridge with e.g. DTT, TCEP or ⁇ -mercaptoethanol is required.
  • concentration of reductand, and the molar excess of reductand over antigen has to be adjusted for each antigen.
  • a titration range, starting from concentrations as low as 10 ⁇ M or lower, up to 10 to 20 mM or higher reductand if required is tested, and coupling of the antigen to the carrier assessed.
  • the pH of the dialysis or equilibration buffer is lower than 7, preferably 6.
  • the compatibility of the low pH buffer with antigen activity or stability has to be tested.
  • Epitope density on the VLP of RNA phage coat proteins can be modulated by the choice of cross-linker and other reaction conditions.
  • the cross- linkers Sulfo-GMBS and SMPH typically allow reaching high epitope density.
  • Derivatization is positively influenced by high concentration of reactands, and manipulation of the reaction conditions can be used to control the number of antigens coupled to VLPs of RNA phage coat proteins, and in particular to VLPs of Q ⁇ coat protein.
  • the position at which it should be fused, inserted or generally engineered has to be chosen.
  • the selection of the position of the second attachment site may, by way of example, be based on a crystal stmcture of the antigen.
  • Such a crystal stmcture of the antigen may provide information on the availability of the C- or N-termini of the molecule (determined for example from their accessibility to solvent), or on the exposure to solvent of residues suitable for use as second attachment sites, such as cysteine residues.
  • Exposed disulfide bridges as is the case for Fab fragments, may also be a source of a second attachment site, since they can be generally converted to single cysteine residues through mild reduction, with e.g. 2-mercaptoethylamine, TCEP, ⁇ - mercaptoethanol or DTT. Mild reduction conditions not affecting the immunogenicity of the antigen will be chosen.
  • the second attachment site will be added such that it allows generation of antibodies against the site of interaction with the natural ligands.
  • the location of the second attachment site will be selected such that steric hindrance from the second attachment site or any amino acid linker containing the same is avoided.
  • an antibody response directed at a site distinct from the interaction site of the self-antigen with its natural ligand is desired.
  • the second attachment site may be selected such that it prevents generation of antibodies against the interaction site of the self-antigen with its natural ligands.
  • the A ⁇ l-6 peptide comprises a single second attachment site or a single reactive attachment site capable of association with the first attachment sites on the core particle and the VLPs or VLP subunits, respectively.
  • the provision of a single second attachment site or a single reactive attachment site on the antigen thus, ensures a single and uniform type of binding and association, respectively leading to a very highly ordered and repetitive array.
  • the binding and association, respectively is effected by way of a lysine- (as the first attachment site) and cysteine- (as a second attachment site) interaction, it is ensured, in accordance with this preferred embodiment of the invention, that only one cysteine residue per antigen, independent whether this cysteine residue is naturally or non-naturally present on the antigen, is capable of binding and associating, respectively, with the VLP and the first attachment site of the core particle, respectively.
  • an amino acid linker is bound to the antigen or the antigenic determinant by way of at least one covalent bond.
  • the amino acid linker comprises, or alternatively consists of, the second attachment site.
  • the amino acid linker comprises a sulfhydryl group or a cysteine residue.
  • the amino acid linker is cysteine.
  • the at least one antigen or antigenic determinant i.e. the A ⁇ l-6 peptide is fused to the virus-like particle.
  • a VLP is typically composed of at least one subunit assembling into a VLP.
  • the antigen or antigenic determinant preferably the at least one A ⁇ l-6 peptide is fused to at least one subunit of the vims-like particle or of a protein capable of being inco ⁇ orated into a VLP generating a chimeric VLP-subunit- A ⁇ l-6 peptide protein fusion.
  • Fusion of the A ⁇ l-6 peptides can be effected by insertion into the VLP subunit sequence, or by fusion to either the N- or C-terminus of the VLP-subunit or protein capable of being inco ⁇ orated into a VLP.
  • fusion proteins of a peptide to a VLP subunit the fusion to either ends of the subunit sequence or internal insertion of the peptide within the subunit sequence are encompassed.
  • Fusion may also be effected by inserting the A ⁇ l-6 peptide sequences into a variant of a VLP subunit where part of the subunit sequence has been deleted, that are further referred to as truncation mutants.
  • Tmncation mutants may have N- or C- terminal, or internal deletions of part of the sequence of the VLP subunit.
  • the specific VLP HBcAg with, for example, deletion of amino acid residues 79 to 81 is a truncation mutant with an internal deletion. Fusion of A ⁇ l-6 peptides to either the N- or C-terminus of the truncation mutants VLP-subunits also lead to embodiments of the invention.
  • fusion of an epitope into the sequence of the VLP subunit may also be effected by substitution, where for example for the specific VLP HBcAg, amino acids 79-81 are replaced with a foreign epitope.
  • fusion as referred to hereinafter, may be effected by insertion of the A ⁇ l-6 peptide sequence in the sequence of a VLP subunit, by substitution of part of the sequence of the VLP subunit with the A ⁇ l-6 peptide, or by a combination of deletion, substitution or insertions.
  • the chimeric A ⁇ l-6 peptide- VLP subunit will be in general capable of self- assembly into a VLP.
  • VLP displaying epitopes fused to their subunits are also herein referred to as chimeric VLPs.
  • the vims-like particle comprises or alternatively is composed of at least one VLP subunit.
  • the vims-like particle comprises or alternatively is composed of a mixture of chimeric VLP subunits and non-chimeric VLP subunits, i.e. VLP subunits not having an antigen fused thereto, leading to so called mosaic particles. This may be advantageous to ensure formation of, and assembly to a VLP.
  • the proportion of chimeric VLP-subunits may be 1, 2, 5, 10, 20, 30, 40, 50, 60, 70, 80, 90, 95% or higher.
  • Flanking amino acid residues may be added to either end of the sequence of the peptide or epitope to be fused to either end of the sequence of the subunit of a VLP, or for internal insertion of such peptidic sequence into the sequence of the subunit of a VLP.
  • Glycine and serine residues are particularly favored amino acids to be used in the flanking sequences added to the peptide to be fused.
  • Glycine residues confer additional flexibility, which may diminish the potentially destabilizing effect of fusing a foreign sequence into the sequence of a VLP subunit.
  • the VLP is a Hepatitis B core antigen VLP.
  • Fusion proteins of the A ⁇ l-6 peptide to either the N-terminus of a HBcAg (Neyrinck, S. et al, Nature Med. 5:1157-1163 (1999)) or insertions in the so called major immunodominant region (MIR) have been described (Pumpens, P. and Grens, E., Intervirology 44:98-114 (2001)), WO 01/98333), and are preferred embodiments of the invention.
  • Naturally occurring variants of HBcAg with deletions in the MIR have also been described (Pumpens, P.
  • Example 6 We also describe by way of example (Example 6) the insertion of an epitope into the MIR of HBcAg, resulting in a chimeric self- assembling HBcAg.
  • An important factor for the optimization of the efficiency of self-assembly and of the display of the epitope to be inserted in the MIR of HBcAg is the choice of the insertion site, as well as the number of amino acids to be deleted from the HBcAg sequence within the MIR (Pumpens, P. and Grens, E., Intervirology 44:98-114 (2001); EP 0 421 635; U.S. Patent No.
  • HBcAg contains a long arginine tail (Pumpens, P. and Grens, E., Intervirology 44:98-114 (2001))which is dispensable for capsid assembly and capable of binding nucleic acids (Pumpens, P.
  • the VLP is a VLP of a
  • RNA phage The major coat proteins of RNA phages spontaneously assemble into VLPs upon expression in bacteria, and in particular in E. coli.
  • bacteriophage coat proteins which can be used to prepare compositions of the invention include the coat proteins of RNA bacteriophages such as bacteriophage Q ⁇ (SEQ ID NO:4; PIR Database, Accession No. VCBPQ ⁇ referring to Q ⁇ CP and SEQ ID NO: 5; Accession No. AAA16663 referring to Q ⁇ Al protein) and bacteriophage fr (SEQ ID NO: 7; PIR Accession No. VCBPFR).
  • the at least one A ⁇ l-6 peptide is fused to a Q ⁇ coat protein.
  • Fusion protein constmcts wherein epitopes have been fused to the C-terminus of a tmncated form of the Al protein of Q ⁇ , or inserted within the Al protein have been described (Kozlovska, T. M., et al, Intervirology, 59:9-15 (1996)).
  • the Al protein is generated by suppression at the UGA stop codon and has a length of 329 aa, or 328 aa, if the cleavage of the N-terminal methionine is taken into account.
  • the production of mosaic particles may be effected in a number of ways. Kozlovska et al, Intervirology, 59:9-15 (1996), describe three methods, which all can be used in the practice of the invention.
  • efficient display of the fused epitope on the VLPs is mediated by the expression of the plasmid encoding the Q ⁇ Al protein fusion having a UGA stop codong between CP and CP extension in a E. coli strain harboring a plasmid encoding a cloned UGA suppressor tRNA which leads to translation of the UGA codon into T ⁇ (plSM3001 plasmid (Smiley B.K., et al, Gene 754:33-40 (1993))).
  • the CP gene stop codon is modified into UAA, and a second plasmid expressing the Al protein-A ⁇ l-6 peptide fusion is cotransformed.
  • the second plasmid encodes a different antibiotic resistance and the origin of replication is compatible with the first plasmid (Kozlovska, T. M., et al, Intervirology 59:9-15 (1996)).
  • CP and the Al protein-A ⁇ l-6 peptide fusion are encoded in a bicistronic manner, operatively linked to a promoter such as the T ⁇ promoter, as described in FIG. 1 of Kozlovska et al, Intervirology, 59:9-15 (1996).
  • the A ⁇ l-6 peptide is inserted between amino acid 2 and 3 (numbering of the cleaved CP, that is wherein the N-terminal methionine is cleaved) of the fr CP, thus leading to a A ⁇ l-6 peptide-fr CP fusion protein.
  • Vectors and expression systems for constmction and expression of fr CP fusion proteins self- assembling to VLP and useful in the practice of the invention have been described (Pushko P. et al, Prot. Eng -5:883-891 (1993)).
  • the A ⁇ l- 6 peptide sequence is inserted into a deletion variant of the fr CP after amino acid 2, wherein residues 3 and 4 of the fr CP have been deleted (Pushko P. et al, Prot. Eng. [5:883-891 (1993)).
  • RNA phage is also falling under the scope of the invention.
  • the A ⁇ l-6 peptide is fused to a capsid protein of papillomavirus.
  • the A ⁇ l-6 peptide is fused to the major capsid protein LI of bovine papillomavirus type 1 (BPV-1).
  • BPV-1 bovine papillomavirus type 1
  • Purification of the assembled particles displaying the fused A ⁇ l-6 peptide can be performed in a number of ways, such as for example gel filtration or sucrose gradient ultracentrifugation (Chackerian, B. et al, Proc. Natl. Acad. Sci. USA 96:2313-2318 (1999), WO 00/23955).
  • the A ⁇ l-6 peptide is fused to a Ty protein capable of being inco ⁇ orated into a Ty VLP.
  • the A ⁇ l-6 peptide is fused to the pi or capsid protein encoded by the TYA gene (Roth, J.F., Yeast 16:185-195 (2000)).
  • the yeast retrotransposons Tyl, 2, 3 and 4 have been isolated from Saccharomyces Serevisiae, while the retrotransposon Tfl has been isolated from Schizosaccharomyces Pombae (Boeke, J.D.
  • the retrotransposons Tyl and 2 are related to the copia class of plant and animal elements, while Ty3 belongs to the gypsy family of retrotransposons, which is related to plants and animal retroviruses.
  • the pi protein also referred to as Gag or capsid protein, has a length of 440 amino acids.
  • PI is cleaved during maturation of the VLP at position 408, leading to the p2 protein, the essential component of the VLP. Fusion proteins to pi and vectors for the expression of said fusion proteins in
  • Yeast have been described (Adams, S.E., et al, Nature 329:68-10 (1987)). So, for example, a A ⁇ l-6 peptide may be fused to pi by inserting a sequence coding for the A ⁇ l-6 peptide into the BamHI site of the pMA5620 plasmid (Adams, S.E., et al, Nature 329:68-10 (1987)).
  • the cloning of sequences coding for foreign epitopes into the pMA5620 vector leads to expression of fusion proteins comprising amino acids 1-381 of pi of Tyl-15, fused C-terminally to the N-terminus of the foreign epitope.
  • N-terminal fusion of a A ⁇ l-6 peptide, or internal insertion into the pi sequence, or substitution of part of the pi sequence are also meant to fall within the scope of the invention.
  • insertion of a A ⁇ l-6 peptide into the Ty sequence between amino acids 30-31, 67-68, 113-114 and 132-133 of the Ty protein pi leads to preferred embodiments of the invention.
  • VLPs suitable for fusion of A ⁇ l-6 peptides are, for example, Retrovims-like-particles (WO9630523), HIV2 Gag (Kang, Y.C., et al, Biol. Chem. 550:353-364 (1999)), Cowpea Mosaic Vims (Taylor, K.M.et al, Biol. Chem. 550:387-392 (1999)), parvovims VP2 VLP (Rueda, P. et al, Virology 263:89-99 (1999)), HBsAg (US 4,722,840, EP0020416B1).
  • VLPs suitable for the practice of the invention are also those described in Intervirology 59:1 (1996). Further examples of VLPs contemplated for use in the invention are: HPV-1, HPV-6, HPV-11, HPV-16, HPV- 18, HPV-33, HPV-45, CRPV, COPV, HIV GAG, Tobacco Mosaic Vims. Vims-like particles of SV-40, Polyomavims, Adenovirus, He ⁇ es Simplex Vims, Rotavims and Norwalk vims have also been made, and chimeric VLPs of those VLPs comprising a A ⁇ l-6 peptide are also within the scope of the present invention.
  • a ⁇ l-6 peptides suitable for generating vaccines of the invention are modified with an amino acid linker for binding to a VLP.
  • Those A ⁇ l-6 peptides include, but are not limited to: A ⁇ l-6 fused C-terminally to the linker GGC.
  • Amino acid linkers suitable for fusion to the N- terminus of A ⁇ l-6 fragments include but are not limited to the sequence CGG and CGHGNKS.
  • Linkers suitable for fusion to the C-terminus of A ⁇ l-6 include but are not limited to the sequence GGC.
  • the C-terminal Cysteine is amidated.
  • a ⁇ l-6 is fused to an amino acid linker and has the sequence: "NH2-DAEFRHGGC-CONH2, wherein the C-terminal Cysteine is amidated, which is indicated by the C-terminal "-CONH2", and the N-terminus of the peptide is free, which is further indicated by "NH2-”.
  • Amino acid linkers are preferably short, to avoid induction of immune responses against amino acids of said linker, but should allow the induction of antibodies cross-reactive with soluble A ⁇ and AD plaques and may facilitate the interaction of antibodies with the A ⁇ l-6 peptide.
  • amino acid linker Other suitable properties of the amino acid linker are flexibility, and preferably lack of bulky amino acids which might interfere with coupling, and/or generate an immune response against the linker itself.
  • amino acid linker containing a cysteine residue as second attachment site is fused to the C-terminus of the A ⁇ l-6 peptide.
  • Additional A ⁇ fragments suitable in the practice of the invention include A ⁇ fragments corresponding to the aforementioned fragments, also modified as described above, from other animal species and eliciting Antibodies cross-reactive with human amyloid plaques and soluble human A ⁇ .
  • Examples of such fragments are A ⁇ l-6 from primates (DAEFRH; SEQ ID NO: 84), rabbit (DAEFRH; SEQ ID NO: 85), guinea pig (DAEFRH: SEQ ID NO: 88), mouse (DAEFGH; SEQ ID NO: 76), rat (DAEFGH SEQ ID NO: 87), and xaenopus laevis (DSEYRH; 86).
  • mice models differ from each other in the level of overexpression of the transgene, the AD mutations present on the transgene and the promoter under which overexpression of the transgene is directed. These animal models fail to display all of the pathological signs of AD, which are in particular age-related changes in behaviour, deposition of ⁇ -amyloid into insoluble plaques, neurofibrillary tangles within neurons, and loss of neurons throughout the forebrain (Chapman, P.F. Nature 408: 915-916 (2000)). Memory deficits and methods to identify them could however be identified in those models, and may be used in testing the effect of the compositions of the invention in animal models (Chen, G.
  • the plasmid pQ ⁇ lO (Kozlovska, TM, et al, Gene 757:133-137) was used as an initial plasmid for the constmction of pQ ⁇ -240.
  • the mutation Lysl3-»Arg was created by inverse PCR.
  • the inverse primers were designed in inverted tail-to-tail directions: 5'-GGTAACATCGGTCGAGATGGAAAACAAACTCTGGTCC-3' (SEQ ID NO: 48) and
  • the products of the first PCR were used as templates for the second PCR reaction, in which an upstream primer
  • PCR reactions were performed with PCR kit reagents and according to producer protocol (MBI Fermentas, Vilnius,
  • E.coli cells harbouring pQ ⁇ -240 supported efficient synthesis of 14-kD protein co migrating upon SDS-PAGE with control Q ⁇ coat protein isolated from Q ⁇ phage particles.
  • Constmction of pQ ⁇ -243 The plasmid pQ ⁇ lO was used as an initial plasmid for the constmction of pQ ⁇ - 243.
  • the mutation AsnlO— >Lys was created by inverse PCR.
  • the inverse primers were designed in inverted tail-to-tail directions: 5'-GGCAAAATTAGAGACTGTTACTTTAGGTAAGATCGG -3'
  • the products of the first PCR were used as templates for the second PCR reaction, in which an upstream primer
  • 5'-CGATGCATTTCATCCTTAGTTATCAATACGCTGGGTTCAG- 3' (SEQ ID NO: 51) were used.
  • the product of the second PCR was digested with Xbal and Mphl 1031 and cloned into the pQ ⁇ lO expression vector, which was cleaved by the same restriction enzymes.
  • the PCR reactions were performed with PCR kit reagents and according to producer protocol (MBI Fermentas, Vilnius, Lithuania).
  • E.coli cells harbouring pQ ⁇ -243 supported efficient synthesis of 14-kD protein co migrating upon SDSD-PAGE with control Q ⁇ coat protein isolated from Q ⁇ phage particles.
  • the plasmid pQ ⁇ -240 was used as an initial plasmid for the constmction of pQ ⁇ -250.
  • the mutation Lys2- Arg was created by site-directed mutagenesis.
  • 5'-GATTTAGGTGACACTATAG-3' (SEQ ID NO: 55) were used for the synthesis of the mutant PCR- fragment, which was introduced into the pQ ⁇ -185 expression vector at the unique restriction sites Ncol and Hindlll.
  • the PCR reactions were performed with PCR kit reagents and according to producer protocol (MBI Fermentas, Vilnius, Lithuania).
  • the plasmid pQ ⁇ lO was used as an initial plasmid for the constmction of pQ ⁇ - 251.
  • the mutation Lysl ⁇ Arg was created by inverse PCR.
  • the inverse primers were designed in inverted tail-to-tail directions: 5'-GATGGACGTCAAACTCTGGTCCTCAATCCGCGTGGGG -3'
  • the plasmid pQ ⁇ -251 was used as an initial plasmid for the constmction of pQ ⁇ -259.
  • the mutation Lys2-»Arg was created by site-directed mutagenesis.
  • 5'-GATTTAGGTGACACTATAG-3' (SEQ ID NO: 55) were used for the synthesis of the mutant PCR-fragment, which was introduced into the pQ ⁇ -185 expression vector at the unique restriction sites Nco7 and Hindlll.
  • the PCR reactions were performed with PCR kit reagents and according to producer protocol (MBI Fermentas, Vilnius, Lithuania).
  • E.coli cells harbouring pQ ⁇ -259 supported efficient synthesis of 14-kD protein co migrating upon SDS-PAGE with control Q ⁇ coat protein isolated from Q ⁇ phage particles.
  • E.coli JM109 was transformed with Q ⁇ coat protein expression plasmids.
  • 5 ml of LB liquid medium containing 20 ⁇ g/ml ampicillin were inoculated with clones transformed with with Q ⁇ coat protein expression plasmids.
  • the inoculated culture was incubated at 37 °C for 16-24 h without shaking.
  • the prepared inoculum was subsequently diluted 1 :100 in 100-300 ml of fresh LB medium, containing 20 ⁇ g/ml ampicillin. and incubated at 37°C overnight without shaking.
  • the resulting second inoculum was diluted 1 :50 in M9 medium containing 1 % Casamino acids and 0.2 % glucose in flasks, and incubated at 37 °C overnight under shaking.
  • Buffer NET 20 mM Tris-HCl, pH 7.8 with 5mM EDTA and
  • a saturated ammonium sulphate solution was added dropwise under stirring to the above pooled lysate.
  • the volume of the SAS was adjusted to be one fifth of total volume, to obtain 20%> of saturation.
  • the solution was left standing overnight, and was centrifuged the next day at 14 000 ⁇ m, for 20 min.
  • the pellet was washed with a small amount of 20% ammonium sulphate, and centrifuged again .
  • the obtained supematants were pooled, and SAS was added dropwise to obtain 40%) of saturation.
  • the solution was left standing overnight, and was centrifuged the next day at 14 000 ⁇ m, for 20 min.
  • the obtained pellet was solubilised in NET buffer.
  • the capsid or VLP protein resolubilized in NET buffer was loaded on a Sepharose CL- 4B column. Three peaks eluted during chromatography. The first one mainly contained membranes and membrane fragments, and was not collected. Capsids were contained in the second peak, while the third one contained other E.coli proteins.
  • the peak fractions were pooled, and the NaCl concentration was adjusted to a final concentration of 0.65 M.
  • a volume of PEG solution corresponding to one half of the pooled peak fraction was added dropwise under stirring. The solution was left to stand overnight without stirring.
  • the capsid protein was sedimented by centrifugation at 14 000 ⁇ m for 20 min. It was then solubilized in a minimal volume of NET and loaded again on the Sepharose CL- 4B column.
  • the peak fractions were pooled, and precipitated with ammonium sulphate at 60% of saturation (w/v). After centrifugation and resolubilization in NET buffer, capsid protein was loaded on a Sepharose CL-6B column for rechromatography.
  • the resolubilized protein was then purified further on a Sepharose 2B column and finally on a Sepharose 6B column.
  • the capsid peak was finally extensively dialyzed against water and lyophilized as described above.
  • the assembly of the coat protein into a capsid was confirmed by electron microscopy.
  • Q ⁇ -259 Cells E. coli JM 109, transformed with pQ ⁇ -259 ) were resuspended in LB and sonicated. The debris were washed once with 10 ml of LB and a second time with 10 ml of 0,7 M urea in LB. The protein was purified by two gel-filtration chromatogaphy steps, on a Sepharose CL-4 B column. The protein was dialyzed and lyophilized, as described above. The assembly of the coat protein into a capsid was confirmed by electron microscopy.
  • the cDNA of AP205 coat protein (CP) (SEQ ID NO: 28) was assembled from two cDNA fragments generated from phage AP205 RNA by using a reverse transcription-PCR technique and cloning in the commercial plasmid pCR 4-TOPO for sequencing. Reverse transcription techniques are well known to those of ordinary skill in the relevant art.
  • the first fragment, contained in plasmid p205-246, contained 269 nucleotides upstream of the CP sequence and 74 nucleotides coding for the first 24 N-terminal amino acids of the CP.
  • the second fragment contained in plasmid p205-262, contained 364 nucleotides coding for amino acids 12-131 of CP and an additional 162 nucleotides downstream of the CP sequence. Both p205-246 and p205-262 were a generous gift from J. Klovins.
  • the plasmid 283.-58 was designed by two-step PCR, in order to fuse both CP fragments from plasmids p205-246 and p205-262 in one full-length CP sequence.
  • TCAGCAAGTCTG-3' (SEQ ID NO: 82) pi .48: 5'-CAGACTTGCTGAAAATGTAGTTGATAAACGA- GTTGGATCACTC-3' (SEQ ID NO: 83)
  • the first two PCR reactions two fragments were generated.
  • the first fragment was generated with primers pi.45 and pi.48 and template p205-246.
  • the second fragment was generated with primers pi.47 and pi.46, and template p205- 262. Both fragments were used as templates for the second PCR reaction, a splice- overlap extension, with the primer combination pi .45 and pi .46 or pi .44 and pi .46 .
  • the product of the two second-step PCR reactions were digested with Xbal or Ncol respectively, and Hindlll, and cloned with the same restriction sites into pQblO or pQbl85 respectively, two pGEM-derived expression vectors under the control of E.coli tryptophan operon promoter.
  • pAP283-58 SEQ ID NO: 27
  • pAP281-32 SEQ ID NO: 30
  • Pro5 ⁇ Thr SEQ ID NO: 29
  • the coat protein sequences were verified by DNA sequencing.
  • PAP283-58 contains 49 nucleotides upstream of the ATG codon of the CP, downstream of the Xbal site, and contains the putative original ribosomal binding site of the coat protein mRNA.
  • E.coli JM109 was transformed with plasmid pAP283-58. 5 ml of LB liquid medium with 20 ⁇ g/ml ampicillin were inoculated with a single colony, and incubated at 37 °C for 16-24 h without shaking.
  • the prepared inoculum was diluted 1 :100 in 100-300 ml of LB medium, containing 20 ⁇ g/ml ampicillin and incubated at 37 °C overnight without shaking.
  • the resulting second inoculum was diluted 1:50 in 2TY medium, containing 0.2 % glucose and phosphate for buffering, and incubated at 37 °C overnight on a shaker. Cells were harvested by centrifugation and frozen at -80°C.
  • Frozen cells were resuspended in lysis buffer at 2 ml/g cells. The mixture was sonicated with 22 kH five times for 15 seconds, with intervals of lmin to cool the solution on ice. The lysate was then centrifuged for 20 minutes at 12 000 ⁇ m, using a F34-6-38 rotor (Ependorf). The centrifugation steps described below were all performed using the same rotor, except otherwise stated. The supernatant was stored at 4° C, while cell debris were washed twice with lysis buffer. After centrifugation, the supematants of the lysate and wash fractions were pooled.
  • Ammonium-sulphate precipitation can be further used to purify AP205 VLP.
  • a concentration of ammonium-sulphate at which AP205 VLP does not precipitate is chosen.
  • the resulting pellet is discarded.
  • an ammonium sulphate concentration at which AP205 VLP quantitatively precipitates is selected, and AP205 VLP is isolated from the pellet of this precipitation step by centrifugation (14 000 ⁇ m, for 20 min). The obtained pellet is solubilised in NET buffer.
  • the capsid protein from the pooled supematants was loaded on a Sepharose
  • the pellet isolated by centrifugation was resolubilized in NET buffer, and purified on a Sepharose 6B column (2.5 X 47 cm), eluted at 3 ml/hour/fraction. The fractions were analysed by SDS-PAGE. Fractions 23-27 were collected, the salt concentration adjusted to 0.5 M, and precipitated with PEG 6000, added from a 40% stock in water and to a final concentration of 13.3%. The pellet isolated by centrifugation was resolubilized in NET buffer, and loaded on the same Sepharose 2B column as above, eluted in the same manner. Fractions 43-53 were collected, and precipitated with ammonium sulphate at a saturation of 60%.
  • the pellet isolated by centrifugation was resolubilized in water, and the obtained protein solution was extensively dialyzed against water. About 10 mg of purified protein per gram of cells could be isolated. Examination of the vims-like particles in Electron microscopy showed that they were identical to the phage particles.
  • the c/el epitope (residues 72 to 88) of HBcAg is located in the tip region on the surface of the Hepatitis B vims capsid (HBcAg).
  • a part of this region (Proline 79 and Alanine 80) was genetically replaced by the peptide Gly-Gly-Lys-Gly-Gly (SEQ ID NO: 33), resulting in the HBcAg-Lys constmct (SEQ ID NO: 26).
  • the introduced Lysine residue contains a reactive amino group in its side chain that can be used for intermolecular chemical crosslinking of HBcAg particles with any antigen containing a free cysteine group.
  • HBcAg-Lys DNA having the amino acid sequence shown in SEQ ID NO:78, was generated by PCRs: The two fragments encoding HBcAg fragments (amino acid residues 1 to 78 and 81 to 149) were amplified separately by PCR. The primers used for these PCRs also introduced a DNA sequence encoding the Gly-Gly-Lys-Gly-Gly peptide (SEQ ID NO: 33). The HBcAg (1 to 78) fragment was amplified from pEco63 using primers EcoRIHBcAg(s) and Lys-HBcAg(as).
  • the HBcAg (81 to 149) fragment was amplified from pEco63 using primers Lys-HBcAg(s) and HBcAg(l-149)Hind(as).
  • Primers Lys-HBcAg(as) and Lys-HBcAg(s) introduced complementary DNA sequences at the ends of the two PCR products allowing fusion of the two PCR products in a subsequent assembly PCR.
  • the assembled fragments were amplified by PCR using primers EcoRIHBcAg(s) and HbcAg(l-149)Hind(as).
  • PCRs 100 pmol of each oligo and 50 ng of the template DNAs were used in the 50 ml reaction mixtures with 2 units of Pwo polymerase, 0.1 mM dNTPs and 2 mM MgSO4.
  • temperature cycling was carried out as follows: 94°C for 2 minutes; 30 cycles of 94°C (1 minute), 50°C (1 minute), 72°C (2 minutes).
  • Lys-HBcAg(as) (5'-CCTAGAGCCACCTTTGCCACCATCTTCTAAATTAG- TACCCACCCAGGTAGC-3') (SEQ ID NO: 59); Lys-HBcAg(s): (5'-GAAGATGGTGGCAAAGGTGGCTCTAGGGACC-
  • EcoRIHBcAg(s) and HBcAg(l-149)Hind(as) were used with 100 ng of the two purified PCR fragments in a 50 ml reaction mixture containing 2 units of Pwo polymerase, 0.1 mM dNTPs and 2 mM MgSO 4 .
  • PCR cycling conditions were: 94°C for 2 minutes; 30 cycles of 94°C (1 minute), 50°C (1 minute), 72°C (2 minutes).
  • the assembled PCR product was analyzed by agarose gel electrophoresis, purified and digested for 19 hours in an appropriate buffer with EcoRI and Hindlll restriction enzymes.
  • the digested DNA fragment was ligated into EcoRI/Hindlll-digested pKK vector to generate pKK-HBcAg-Lys expression vector. Insertion of the PCR product into the vector was analyzed by EcoRI Hindlll restriction analysis and DNA sequencing of the insert.
  • E. coli strains K802 or JM109 were transformed with pKK-HBcAg-Lys.
  • 1 ml of an overnight culture of bacteria was used to innoculate 100 ml of LB medium containing 100 ⁇ g/ml ampicillin. This culture was grown for 4 hours at 37°C until an OD at 600 nm of approximately 0.8 was reached.
  • Induction of the synthesis of HBcAg-Lys was performed by addition of IPTG to a final concentration of 1 mM. After induction, bacteria were further shaken at 37°C for 4 hours. Bacteria were harvested by centrifugation at 5000 x g for 15 minutes. The pellet was frozen at - 80°C.
  • the pellet was thawed and resuspended in bacteria lysis buffer (10 mM Na 2 HPO 4 , pH 7.0, 30 mM NaCl, 0.25% Tween-20, 10 mM EDTA) supplemented with 200 ⁇ g/ml lysozyme and 10 ⁇ l of Benzonase (Merck). Cells were incubated for 30 minutes at room temperature and dismpted by sonication. E. coli cells harboring pKK-HBcAg-Lys expression plasmid or a control plasmid were used for induction of HBcAg-Lys expression with IPTG.
  • HBcAg-Lys protein was analyzed by Western blotting using a monoclonal antibody against HBcAg (YVS1841, purchased from Accurate Chemical and Scientific Co ⁇ ., Westbury, NY, USA), indicating that a significant amount of HBcAg-Lys protein was soluble.
  • lysates from E. coli cells expressing HBcAg-Lys and from control cells were centrifuged at 14,000 x g for 30 minutes.
  • the cleared cell lysate was used for step-gradient centrifugation using a sucrose step gradient consisting of a 4 ml 65% sucrose solution overlaid with 3 ml 15%) sucrose solution followed by 4 ml of bacterial lysate.
  • the sample was centrifuged for 3 hrs with 100,000 x g at 4°C. After centrifugation, 1 ml fractions from the top of the gradient were collected and analyzed by SDS-PAGE followed by Coomassie staining. The HBcAg-Lys protein was detected by Coomassie staining.
  • the HBcAg-Lys protein was enriched at the interface between 15 and 65% sucrose indicating that it had formed a capsid particle. Most of the bacterial proteins remained in the sucrose-free upper layer of the gradient, therefore step-gradient centrifugation of the HBcAg-Lys particles led both to enrichment and to a partial purification of the particles.
  • HBcAg-Lys Expression and purification of HBcAg-Lys in large scale was performed as follows. An overnight culture was prepared by inoculating a single colony in 100 ml LB, 100 ⁇ g/ml Ampicillin and growing the culture overnight at 37°C. 25 ml of the preculture were diluted in 800 ml LB Ampicillin medium the next day, and the culture gorwn to an optical density OD 600 of 0.6-0.8. The culture was then induced with 1 mM IPTG, and left to grow for another 4 hours. The cells were harvested and lysed essentially as described above.
  • HBcAg-Lys was then purified by first precipitating the protein with ammonium sulphate (30%> saturation) from the cleared cell lysate, then loading the resolubilized pellet on a gel filtration column (Sephacryl S-400, Pharmacia). The pooled fractions were precipitated again with ammonium sulphate, the pellet resolubilized and loaded a second time on the same gel filtration column. The fractions were finally pooled and concentrated, and the concentration assessed using a Bradford test (BioRad). EXAMPLE 4
  • Constmction of a HBcAg devoid of free cysteine residues and containing an inserted lysine residue.
  • HBcAg-lys-2cys-Mut A Hepatitis core Antigen (HBcAg), referred to herein as HBcAg-lys-2cys-Mut, devoid of cysteine residues at positions corresponding to 48 and 107 in SEQ ID NO:25 and containing an inserted lysine residue was constmcted using the following methods.
  • the two mutations were introduced by first separately amplifying three fragments of the HBcAg-Lys gene prepared as described above in Example 2 with the following PCR primer combinations. PCR methods and conventional cloning techniques were used to prepare the HBcAg-lys-2cys-Mut gene.
  • Primer 3 48s GSGTCTCCTGAGCATTCCTCACCTCACCATACTGCAC (SEQ ID NO:
  • fragment 4 and fragment 3 were then combined with primers EcoRIHBcAg(s) and HBcAg 149hind-as to produce the full length gene.
  • the full length gene was then digested with the EcoRl (GAATTC) and Hindlll (AAGCTT) enzymes and cloned into the pKK vector (Pharmacia) cut at the same restriction sites. Expression and purification of HBcAg-lys-2cys-Mut were performed as set out in Example 3.
  • Hepatitis core Antigen (HBcAg) 1-185 was modified as described in Example 2.
  • a part of the c/el epitope (residues 72 to 88) region (Proline 79 and Alanine 80) was genetically replaced by the peptide Gly-Gly-Lys-Gly-Gly (SEQ ID NO: 33), resulting in the HBcAg-Lys constmct (SEQ ID NO: 26).
  • the introduced Lysine residue contains a reactive amino group in its side chain that can be used for intermolecular chemical crosslinking of HBcAg particles with any antigen containing a free cysteine group.
  • PCR methods and conventional cloning techniques were used to prepare the HBcAgl -185-Lys gene.
  • the Gly-Gly-Lys-Gly-Gly sequence (SEQ ID NO: 33) was inserted by amplifying two separate fragments of the HBcAg gene from pEco63, as described above in Example 2 and subsequently fusing the two fragments by PCR to assemble the full length gene.
  • the following PCR primer combinations were used: fragment 1 :
  • Primer 1 EcoRIHBcAg(s) (SEQ ID NO: 58) (see Example 2)
  • Primer 2 Lys-HBcAg(as) (SEQ ID NO: 59) (see Example 2) fragment 2:
  • Primer 3 Lys-HBcAg(s) (SEQ ID NO: 60) (see Example 2)
  • Primer 4 HBcAgwfHindlffl
  • Primer 1 EcoRIHBcAg(s) (SEQ ID NO: 58) (see example 2)
  • Primer 2 HBcAgwtHindllll (SEQ ID NO: 67)
  • the assembled full length gene was then digested with the EcoRI (GAATTC) and Hindlll (AAGCTT) enzymes and cloned into the pKK vector (Pharmacia) cut at the same restriction sites.
  • the residues 79 and 80 of HBcAgl-185 were substituted with the epitope C ⁇ H3 of sequence VNLTWSRASG (SEQ ID NO: 68).
  • the C ⁇ H3 sequence stems from the sequence of the third constant domain of the heavy chain of human IgE.
  • the epitope was inserted in the HBcAgl-185 sequence using an assembly PCR method.
  • the HBcAgl-185 gene originating from ATCC clone pEco63 and amplified with primers HBcAg-wt EcoRI fwd and HBcAg-wt Hind III rev was used as template in two separate reactions to amplify two fragments containing sequence elements coding for the C ⁇ H3 sequence.
  • the chimeric VLP was expressed in E. coli and purified as described in Example 2.
  • the elution volume at which the HBcAgl-185- C ⁇ H3 eluted from the gel filtration showed assembly of the fusion proteins to a chimeric VLP.
  • a primer annealing to the 5' end of the Q ⁇ Al gene and a primer annealing to the 3' end of the Al gene and comprising additionally a sequence element coding for the A ⁇ l-6 peptide, of sequence DAEFRH (SEQ ID NO: 75) or DAEFGH (SEQ ID NO: 76), are used in a PCR reaction with pQ ⁇ lO as template.
  • the PCR product is cloned in pQ ⁇ lO (Kozlovska T.M. et al, Gene 137: 133-37 (1993)), and the chimeric VLP expressed and purified as described in Example 1.
  • Complementary primers coding for the sequence of the A ⁇ l-6 peptide of sequence DAEFRH (SEQ ID NO: 75) or DAEFGH (SEQ ID NO: 76), and containing Bspl 191 compatible ends and additional nucleotides enabling in frame insertion, are inserted in the Bspl 191 site of the pFrd8 vector (Pushko, P. et al, Prot. Eng. 6: 883-91 (1993)) by standard molecular biology techniques.
  • the overhangs of the pFrd ⁇ vector are filled in with Klenow after digestion with Bspl 191, and oligonucleotides coding for the sequence of the A ⁇ 1 -6 peptide and additional nucleotides for in frame cloning are ligated in pFrd ⁇ after the Klenow treatment.
  • Clones with the insert in the right orientation are analysed by sequencing. Expression and purification of the chimeric fusion protein in E. coli JM109 or E. coli K802 is performed as described in Pushko, P. et al, Prot. Eng.
  • Two complementary oligonucleotides coding for the A ⁇ l-6 peptide, of sequence DAEFRH (SEQ ID NO: 75) or DAEFGH (SEQ ID NO: 76), with ends compatible with the Nhel site of pOGS ⁇ l l l are synthesized. Additional nucleotides are added to allow for in frame insertion of a sequence coding for the A ⁇ 1 -6 peptide according to the description of EP 677' 111. The amino acids AS and SS flanking the inserted epitope are encoded by the altered Nhel sites resulting from the insertion of the oligonucleotide in the TyA(d) gene of pOGS 8111.
  • POGS8111 is transformed into S. cervisiae strain MC2, for expression of the chimeric Ty VLP as described in EP0677111 and references therein.
  • the chimeric Ty VLP is purified by sucrose gradient ultracentrifugation as described in EP 677' 111.
  • a sequence coding for the A ⁇ 1 -6 peptide having the sequence DAEFRH (SEQ ID NO: 75) or DAEFGH (SEQ ID NO: 76) is substituted to the sequence coding for amino acids 130-136 of the BPV-1 LI gene cloned in the pFastBacl (GIBCO/BRL) vector as described (Chackerian, B. et al, Proc. Natl. Acad. USA 96: 2373-2378 (1999)).
  • the sequence of the construct is verified by nucleotide sequence analysis.
  • Recombinant baculovims is generated using the GIBCO/BRL baculovims system as described by the manufacturer.
  • the chimeric VLPs are purified from baculovims infected Sf9 cells as described by Kimbauer, R. et al., Proc. Natl. Acad. Sci. 89: 12180-84 (1992) and Greenstone, H.L., et al., Proc. Natl. Acad. Sci. 95:1800-05 (1998).
  • DAEFGH SEQ ID NO: 76
  • Examples 7-11 are used for immunization of human transgenic APP mice or C57/BL6 mice as described in
  • Example 13 and 14 The sera obtained from the immunized mice are analysed in a
  • the protective effect of the vaccine is examined by immunizing a large group of human APP transgenic mice as described in Example 14.
  • the A ⁇ l-6 peptide (sequence: NH2-DAEFRHGGC-CONH2) (SEQ ID NO: 77) was chemically synthesized; the initial NH2 group indicates that the peptide has a free N-terminus, and the terminal NH2 group indicates that the peptide has an amidated carboxy-terminus.
  • Q ⁇ VLP was expressed and purified as described in example 1.
  • reaction mixture dialyzed 2 X 2 hours against a 1000-fold volume HBS, pH 8.2, and flash frozen in liquid nitrogen in aliquots for storage at -
  • FIG. 1 shows the SDS-PAGE analysis of the coupling reaction of A ⁇ l-6 peptide and Q ⁇ VLP.
  • the samples were mn under reducing conditions on a 16% Tris-glycine gel, stained with coomassie brilliant blue.
  • Lane 1 is the protein marker, with corresponding molecular weights indicated on the left border of the gel;
  • lane 4 the pellet of the coupling reaction of Q ⁇ VLP protein to the A ⁇ 1 -6 peptide;
  • Coupling products corresponding to the coupling of 1, 2 and 3 peptides per monomer are indicated by arrows in the Figure. More than 1.5 peptides per subunit were coupled on average; nearly no subunits were left uncoupled.
  • Q ⁇ VLP coupled to A ⁇ l-6 peptide (denominated here Qb-Ab-1-6) was injected s.e. in mice (3 mice) at day 0 and 14.
  • a ⁇ l-6 peptide was coupled to Q ⁇ VLP protein as described above.
  • Each mice (C57BL/6) was immunized with 10 ⁇ g of vaccine diluted in PBS to 200 ⁇ l.
  • Mice were retroorbitally bled on day 21, and the titer of the antibodies specific for the A ⁇ l-6 peptide were measured in an ELISA against A ⁇ l-6.
  • the A ⁇ l-6 peptide was coupled to bovine RNAse A using the chemical cross-linker sulfo-SPDP.
  • ELISA plates were coated with coupled RNAse preparations at a concentration of 10 ⁇ g/ml. The plates were blocked and then incubated with serially diluted mouse sera. Bound antibodies were detected with enzymatically labeled anti- mouse IgG antibodies. As a control, preimmune sera of the same mice were also tested. The results are shown in FIG. 2.
  • FIG. 2 shows an ELISA analysis of the IgG antibodies specific for A ⁇ l-6 peptide in sera of mice immunized against the A ⁇ l-6 peptide coupled to Q ⁇ VLP.
  • the results are shown for the three mice immunized (A1-A3), the pre-immune serum is indicated as "pre” in the figure; the result for one pre-immune serum is shown.
  • Comparison of the pre-immune sera with the sera of mice immunized with "Qb-Ab- 1-6" shows that a strong specific antibody response against peptide A ⁇ l-6 could be obtained in the absence of adjuvant.
  • Human A ⁇ 1-40 or A ⁇ 1-42 peptide stock was made in DMSO and diluted in coating buffer before use.
  • ELISA plates were coated with 0.1 ⁇ g /well A ⁇ 1-40 peptide. The plates were blocked and then incubated with serially diluted mouse serum obtained above. Bound antibodies were detected with enzymatically labeled anti-mouse IgG antibody. As a control, sera obtained before vaccination were also included. The semm dilution showing a mean three standard deviations above baseline was calculated and defined as "ELISA titer". No specific antibodies were detected in preimmune sera. The titer obtained for the three mice was of 1 :100000, showing a strong specific immune response against A ⁇ 1-40. Thus, immunization with A ⁇ l-6 coupled to Q ⁇ VLP elicits strong antibody titers cross-reactive with A ⁇ l-40.
  • FIG. 3 shows the result of the ELISA.
  • mice 8 months old female APP23 mice which carry a human APP transgene (Sturchler-Pierrat et al, Proc.Natl. Acad.Sci. USA 94: 13287-13292 (1997)) are used for vaccination.
  • the mice are injected subcutaneously with 25 ⁇ g vaccine diluted in sterile PBS and 14 days later boosted with the same amount of vaccine.
  • Mice are bled from the tail vein before the start of immunization and 7 days after the booster injection.
  • the sera are analyzed for the presence of antibodies specific to a A ⁇ l-6, to A ⁇ l-40 and A ⁇ l-42 by ELISA as described in Example 13.
  • Murine A ⁇ l-6 peptide (sequence: NH2-DAEFGHGGC-CONH2) (SEQ ID NO: 78) is chemically synthesized, and used for coupling to Q ⁇ VLP as described in Example 13.
  • the vaccine is injected in C57BL/6 mice, and the titer of the elicited antibodies against murine A ⁇ l-6, murine A ⁇ l-40 and murine A ⁇ l-42 determined.
  • the immunization and the ELISA determination are performed as described in Example 13.
  • FIG. 4 A and B Sections were stained with the sera of the three mice immunized against human A ⁇ l-6 coupled to Q ⁇ VLP. Each serum stained positively the amyloid plaques from transgenic mice and AD. Results for one of the three sera are shown.
  • Sera elicited against human A ⁇ l-6 clearly stain amyloid plaques of the transgenic human APP23 mouse, as well as amyloid plaques from AD patients. Pre-immune sera were negative. Extracellular amyloid plaques and isolated blood vessels are stained by the antibodies.
  • FIG. 5 B shows a brain section from a 3 months old mouse, a timepoint where amyloid deposits are not yet visible, stained with the polyclonal antibody specific for APP.
  • F1G. 5 D and 5E show a magnification of the CA1 pyramidal layer of the hippocampus from FIG. 5A. and FIG. 5B, respectively.
  • a solution of 120 ⁇ M fr capsid protein in 20 mM Hepes, 150 mM NaCl pH 7.2 is reacted for 30 minutes with a 10 fold molar excess of SMPH (Pierce), diluted from a stock solution in DMSO, at 25 °C on a rocking shaker.
  • the reaction solution is subsequently dialyzed twice for 2 hours against 1 L of 20 mM Hepes, 150 mM NaCl, pH 7.2 at 4 °C.
  • the dialyzed fr reaction mixture is then reacted with a a five-fold molar excess of A ⁇ l-6 peptide (sequence: NH2-DAEFRHGGC-CONH2) (SEQ ID NO: 77) for 2 hours at 16 °C on a rocking shaker. Coupling products are analysed by SDS-PAGE.
  • the reaction solution is subsequently dialyzed twice for 2 hours against 1 L of 20 mM Hepes, 150 mM NaCl, pH 7.2 at 4 °C.
  • the dialyzed HBcAg-Lys-2cys-Mut reaction mixture is then reacted with a five-fold molar excess of A ⁇ l-6 peptide (sequence: NH2-DAEFRHGGC-CONH2) (SEQ ID NO: 77) for 2 hours at 16 °C on a rocking shaker. Coupling products are analysed by SDS-PAGE.
  • the reaction mixture is desalted on a PD-10 column (Amersham-Pharmacia Biotech).
  • the protein-containing fractions eluating from the column are pooled, and the desalted derivatized pili protein is reacted with a five-fold molar excess of A ⁇ l-6 peptide (sequence: NH2- DAEFRHGGC-CONH2) (SEQ ID NO: 77) for 2 hours at 16 °C on a rocking shaker. Coupling products are analysed by SDS-PAGE.
  • a ⁇ l-6 peptide coupled to fr-capsid protein, HBcAg-Lys-2cys-Mut or pili as described above is injected s.e. in mice (3 mice) at day 0 and 14.
  • mice 3 mice
  • mice (C57BL/6) is immunized with 10 ⁇ g of vaccine diluted in PBS to 200 ⁇ l. Mice are retroorbitally bled on day 21, and the titer of the antibodies specific for the A ⁇ l-6 peptide or A ⁇ l-40 or A ⁇ l-42 are measured by ELISA as described in Example 13.
  • Fig. 6 The results of the ELISA are shown in Fig. 6. Plotted in the diagram are the titers of A ⁇ l-40 specific antibodies measured in the sera of the 4 monkeys (1-4) immunized with Q ⁇ hA ⁇ l-6 and the average of the titers of the 4 monkeys. The titers are represented as OD50 titers. OD50 is the dilution of the antibodies at which the signal reaches half of its maximal value. The maximal value (OD max) was obtained from a reference semm originating from a monkey immunised with Q ⁇ hA ⁇ l-27 and recognizing A ⁇ l-40 as well, and measured on the same ELISA plate. Two monkeys (described above) were bled at day 97, 110, 117, 124, 138, 143,
  • Sera were pooled (99 ml) and used for affinity purification of A ⁇ l-6-specif ⁇ c antibodies. These antibodies were used for immunohistochemical staining at a concentration of 1.5 ⁇ g/ml and a biotinylated secondary anti-monkey antibody was used for detection.
  • Paraffine brain sections of 18 months old heterozygous APP23 mouse and an AD patient - Braak Stage 111 - were used for staining. Plaque-specific staininig was observed both in APP23 mouse brain sections and in the AD patient brain sections (Fig. 7).
  • Fig. 7 A and B The result of the histo logical analysis is shown in Fig. 7 A and B.
  • Fig. 7 A Depicted in Fig. 7 A is the staining of human APP transgenic mouse plaques (APP23 strain) with the above described affinity purified antisemm specific for A ⁇ l-6.
  • Fig. 7 B shows the staining of human AD plaques with the same purified antisemm. The purified antisemm was used at a concentration of 1.5 ⁇ g/ml in both cases. Typical plaques are indicated by an arrow on both figures.
  • the peptide murine A ⁇ l-6 (mA ⁇ l-6, sequence: NH2-DAEFGHGGC-CONH2
  • the reaction mixture was then dialyzed twice against a 1000-fold volume of HBS, pH 7.4. at 4°C for two hours; the resulting dialyzed and derivatized AP205 VLP was flash frozen in liquid nitrogen and stored at -20°C overnight.
  • Derivatized AP205 VLP was diluted with one volume of 20 mM HBS, pH 7.4, and reacted 2 hours at 15°C under shaking with 719 ⁇ M mA ⁇ l-6 peptide diluted in the reaction mixture from a 50 mM stock in DMSO.
  • the coupling reaction was dialyzed twice against a 1000-fold volume HBS, pH 7.4, for 2 hours and overnight.
  • the dialyzed reaction mixture was flash frozen in liquid nitrogen in aliquots for storage at -80°C until further use.
  • FIG. 8 shows the SDS-PAGE analysis of the coupling reaction of mA ⁇ l-6 peptide to AP205 VLP.
  • the samples were mn under reducing conditions on a 16% Tris-glycine gel and stained with coomassie brilliant blue.
  • Lane 1 is the protein marker, with corresponding molecular weights indicated on the left border of the gel; lane 2, AP205 VLP protein; lane 3, derivatized AP205 VLP; lane4, the supernatant of the coupling reaction of AP205 VLP to mA ⁇ l-6 peptide; lane 5, the pellet of the coupling reaction of AP205 VLP to mA ⁇ l-6 peptide.
  • AP205 VLP coupled to mA ⁇ l-6 peptide was injected s.e. in mice (3 mice) at day 0 and 14.
  • mA ⁇ l-6 peptide was coupled to AP205 VLP as described above.
  • Each mice (C57BL/6) was immunized with 25 ⁇ g of vaccine diluted in PBS to 200 ⁇ l.
  • Mice were retroorbitally bled on day 21 , and the titer of the antibodies specific for the mA ⁇ l-6 peptide were measured in an ELISA against mA ⁇ l-6.
  • the mA ⁇ l-6 peptide was coupled to bovine RNAse A using the chemical cross-linker sulfo- SPDP.
  • ELISA plates were coated with preparations of RNAse-mA ⁇ l-6 at a concentration of 10 ⁇ g/ml. The plates were blocked and then incubated with serially diluted mouse sera. Bound antibodies were detected with enzymatically labeled anti- mouse IgG antibodies. As a control, preimmune sera of the same mice were also tested. The results are shown in FIG. 9.
  • FIG. 9 shows an ELISA analysis of the IgG antibodies specific for mA ⁇ l-6 peptide in sera of mice immunized with the mA ⁇ l-6 peptide coupled to AP205 VLP.
  • the results are shown for the sera of the three immunized mice collected at day 21 (Al d21 -A3 d21), the pre-immune semm is indicated as "pre imm” in the figure; the result for one pre-immune serum is shown.
  • Comparison of the pre-immune serum with the sera of the mice immunized with mA ⁇ l-6 coupled to AP205 VLP shows that a strong specific antibody response against peptide mA ⁇ l-6, which is a self- antigen, could be obtained in the absence of adjuvant.
  • AP205 VLP is suitable for generating high antibody titers against A ⁇ peptides in the absence of adjuvant.
  • This example demonstrates that immunization with Q ⁇ hA ⁇ l-6 in a mouse model developing Alzheimer's disease-like diffuse (Congo-Red negative) amyloid plaques, resulted in a massive reduction of plaque density in neocortical and subcortical brain areas. Histological occurrence of diffuse amyloid plaques is a prominent feature of AD brain pathology (Selkoe, 1994, Annu. Rev. Neurosci. 17:489-517) and, therefore, the example demonstrates that immunization with Q ⁇ hA ⁇ 1 -6 provides an effective approach for the treatment of Alzheimer' s disease.
  • V717I patent No. WO980-36-4423 were used.
  • This mouse strain is characterized by a large number amyloid plaques in the neocortex, hippocampus, caudate putamen, and thalamus at an age of 18 months. Plaques can be first observed at an age of 9 months. Histologically, the amyloid plaques in APP24 mice are predominantly of a diffuse type, i.e. they are negative in Congo-Red staining. To a lesser degree, also compact amyloid plaques (Congo-Red positive) can be found.
  • Human A ⁇ l-6 peptide coupled to Q ⁇ VLP (Q ⁇ hA ⁇ 1-6) was made as described in Example 13.
  • PBS phosphate-buffered saline
  • mice were subsequently injected 25 ⁇ g of Q ⁇ hA ⁇ 1-6-vaccine, Q ⁇ , or PBS on day 15, 49, 76, 106, 140, 169, 200, 230, 259, and 291. Animals were bled 1-2 days before the first immunization (day 0) and on day 56, 90, 118, 188, 214, 246, and 272 via the tail vein. Blood semm was also collected on day 305, at which time also brains were collected for histopathology (age of the mice at this time point: 19.5 months). The titer of antibodies specific for A ⁇ l-40 were measured by ELISA essentially as described in Example 13. The results of the ELISA are shown in Fig. 10.
  • titers of A ⁇ 1-40 or A ⁇ l-42 specific antibodies measured in the sera of mice immunized with Q ⁇ hA ⁇ 1-6 The titers are represented as OD50% titers. OD50%> is the dilution of the antibodies at which the signal reaches half of its maximal value. The maximal value (OD max) was obtained from a reference antibody recognizing A ⁇ l-40 and Ab42, and measured on the same ELISA plate. All Q ⁇ hA ⁇ l-6 immunized mice developed OD50% titers above 1 :8000 (pre- immune semm titers were below 1 :100) demonstrating a consistent antibody response to Q ⁇ hA ⁇ 1-6 even in old APP24 mice (Fig. 10). Median OD50% titers in the immunized group were in the range of 1 :20'000 to 1 :50'000 throughout the immunization period.
  • brains were fixed by immersion in 4% formaldehyde in 0.1 M PBS at 4°C. After dehydration with ethanol, brains were embedded in paraffin and cut sagitally with a microtome at 4 ⁇ m thickness. Sections were mounted onto super frost slides and dried at 37°C. Sections were washed in PBS and antigenicity enhanced by microwave heating at 90°C for 3 minutes in 0.1 M citric acid buffer.
  • NTH antisera anti A ⁇ l-40, Sturchler-Pierrat et al., 1997, Proc. Natl. Acad. Sci.
  • 94: 13287-13292 were diluted 1 :1000 in PBS with 3% goat serum and incubated over night at 4°C. Following rinsing, sections were incubated for 1 hour with biotinylated anti rabbit IgG secondary antibody (BA1000, Vector Laboratories) diluted 1 :200 in PBS. After rinsing, sections were further processed with the avidin-biotin-peroxidase technique (ABC-Elite Kit PK6100; Vector Laboratories). Finally, sections were reacted with Diaminobenzidine (DAB) metal enhanced substrate (Boehringer, Code 1718096), counterstained with Hemalum, dehydrated, cleared in Xylene and cover slipped.
  • DABC-Elite Kit PK6100 avidin-biotin-peroxidase technique
  • Amyloid plaques were quantified using an MC1D image analyzer (Imaging Research, Brock University, Ontario-Canada, Program Version M5 elite). The microscopic image was digitized by use of a Xillix black and white CCD TV camera and stored with 640x480 pixel resolution at 256 gray levels. The pixel size was calibrated using an object micrometer at 5x magnification (Leica Neoplan Objective). Using a motor driven microscope stage for exact positioning of adjacent object fields the entire neocortex and olfactory nucleus of each section was analysed. For each object field the anatomical area was defined by manual outline.
  • sample area was defined by manual threshold setting (grey level) between immunopositive amyloid plaques and tissue background. Isolated tissue artifacts were excluded by manual outline. Raw data are measured as individual counts (amyloid deposits) and proportional area values (immunopositive amyloid/cortex or olfactory nucleus).
  • PBS administered as 2x100 ⁇ l per mouse
  • mice administered as 2x100 ⁇ l per mouse
  • the titer of antibodies specific for A ⁇ l-40 were determined and expressed as described above and again all immunized mice were found to respond to Q ⁇ hA ⁇ 1- 6 immunization with semm OD50% titers at least above 1 :2000 (not shown). Median OD50% titers were in the range of LIO'OOO to 1 :50'000 throughout the immunization period. Quantification of amyloid deposits was done as described above. Compared to the experiment where immunization was initiated earlier (i.e. at an age of 9.5 months) the reduction of plaque deposit number (-55 %) and area (- 32 %) was less dramatic in the neocortex, but still very pronounced (Fig. 13) and highly significant (p>0.001 vs.
  • FIG. 10 Semm anti A ⁇ 40/42 antibody titers (OD50%) in transgenic mice over-expressing the "Swedish/London" mutant amyloid precursor protein. Mice were immunized with Q ⁇ hA ⁇ 1-6 between 9.5 and 19 months of age. Shown are individual values (black dots) and box plots, where the ends of the boxes define the 25 th and 75 th percentiles, with a line at the median and error bars defining the 10 th and 90 th percentiles (outlyers are shown as dots).
  • FIG 11 Immunhistochemical staining of amyloid plaques in sagittal brain sections.
  • the sagittal brain section of a transgenic mouse over-expressing the "Swedish/London" mutant amyloid precursor protein immunized with Q ⁇ (A) or Q ⁇ hA ⁇ l-6 (B) vaccine is shown in the Figure.
  • Figure 12 Quantification of plaque deposition in transgenic mice over-expressing the "Swedish/London” mutant amyloid precursor protein after immunization between 9.5 and 19 months of age.
  • A Cortical plaque density.
  • B Cortical plaque area.
  • C Plaque density in the caudate putamen.
  • D Plaque area in the caudate putamen.
  • E Plaque density in the hippocampus.
  • F Plaque area in the hippocampus.
  • G Plaque density in the thalamus.
  • H Plaque area in the thalamus. Plaque density is expressed in plaques/mm , plaque area in percent of tissue area covered by amyloid beta. Data are shown as individual values (black dots) and box plot.
  • immunization with Q ⁇ hA ⁇ 1-6 provides an effective approach for the treatment of Alzheimer's disease even when the immunization is initiated in a very advanced stage of amyloid plaque pathology.
  • the amyloid plaque deposition process in the AD mouse model used in this example starts already at an age about 6 months (Sturchler-Pierrat et al., 1997, Proc. Natl. Acad. Sci. 94: 13287-13292).
  • immunization with Q ⁇ hA ⁇ 1-6 was initiated at an age of 18 months, where already a high number of compact plaques had been formed in the cortex.
  • the example also demonstrates the ability of Q ⁇ hA ⁇ 1-6 to induce A ⁇ 40/42 antibodies in very aged animals (no non- responders in 19 immunized mice).
  • Figure 14 Semm anti A ⁇ 40/42 antibody titers (OD50%) in transgenic mice over-expressing the "Swedish” mutant amyloid precursor protein. Mice were immunized with Q ⁇ hA ⁇ 1-6 between 18 and 23 months of age. Shown are individual values (black dots) and box plots, where the ends of the boxes define the 25 th and 75 th percentiles, with a line at the median and error bars defining the 10 th and 90 th percentiles (outlyers are shown as dots).
  • Figure 15 Immunhistochemical staining of amyloid plaques in sagittal brain sections. Arrows point to small sized deposits. Shown in the Figure is a sagittal brain section from a transgenic mouse over-expressing the "Swedish" mutant amyloid precursor protein immunized with PBS (A) or Q ⁇ -A ⁇ l-6 (B).
  • Figure 16 Quantification of plaque deposition in transgenic mice over- expressing the "Swedish" mutant amyloid precursor protein after immunization between 18 and 23 months of age.
  • A Cortical plaque density.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • General Health & Medical Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Engineering & Computer Science (AREA)
  • Immunology (AREA)
  • Microbiology (AREA)
  • Epidemiology (AREA)
  • Mycology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Neurology (AREA)
  • Biomedical Technology (AREA)
  • Neurosurgery (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Organic Chemistry (AREA)
  • Hospice & Palliative Care (AREA)
  • Psychiatry (AREA)
  • Virology (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
PCT/EP2003/007864 2002-07-19 2003-07-18 Vaccine compositions containing amyloid beta1-6 antigen arrays Ceased WO2004016282A1 (en)

Priority Applications (15)

Application Number Priority Date Filing Date Title
DK03787750.3T DK1524994T3 (da) 2002-07-19 2003-07-18 Vaccinesammensætninger indeholdende amyloid beta 1-6-antigen-arrays
NZ537688A NZ537688A (en) 2002-07-19 2003-07-18 Vaccine compositions containing amyloid beta1-6 antigen arrays for treating and/or attenuating Alzheimer's disease
SI200332018T SI1524994T1 (sl) 2002-07-19 2003-07-18 Sestavki cepiv, ki vsebujejo amiloidne beta 1-6 antigenske mreĹľe
EP03787750A EP1524994B1 (en) 2002-07-19 2003-07-18 Vaccine compositions containing amyloid beta1-6 antigen arrays
HK05109064.7A HK1077009B (en) 2002-07-19 2003-07-18 Vaccine compositions containing amyloid beta1-6 antigen arrays
AT03787750T ATE506964T1 (de) 2002-07-19 2003-07-18 Impfstoffzusammensetzungen enthaltende amyloid beta 1-6 antigenarrays
BR0312792-3A BR0312792A (pt) 2002-07-19 2003-07-18 Composições de vacinas contendo séries antigênicas de amilóide beta1-6
MXPA05000819A MXPA05000819A (es) 2002-07-19 2003-07-18 Composiciones de vacunas que contienen arreglos de antigeno amiloide beta 1-6.
JP2004528447A JP4644488B2 (ja) 2002-07-19 2003-07-18 アミロイドベータ1−6抗原アレイを含むワクチン組成物
AU2003250110A AU2003250110C1 (en) 2002-07-19 2003-07-18 Vaccine compositions containing amyloid beta1-6 antigen arrays
CA2492930A CA2492930C (en) 2002-07-19 2003-07-18 Vaccine compositions containing amyloid beta1-6 antigen arrays
CN038197340A CN1674934B (zh) 2002-07-19 2003-07-18 含有淀粉样β1-6抗原阵列的疫苗组合物
DE60336902T DE60336902D1 (de) 2002-07-19 2003-07-18 Impfstoffzusammensetzungen enthaltende amyloid beta 1-6 antigenarrays
IL166227A IL166227A (en) 2002-07-19 2005-01-10 Compositions comprising (a) a virus-like core-particle and (b) at least one abeta1-6 peptide, vaccine compositions comprising said compositions, a process for producing said compositions and use thereof in the preparation of a medicament for immunizing an animal or human
NO20050894A NO337574B1 (no) 2002-07-19 2005-02-18 Vaksinesammensetninger inneholdende amyloide beta-l-6-antigenoppstillinger

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US39663902P 2002-07-19 2002-07-19
US60/396,639 2002-07-19
US47043203P 2003-05-15 2003-05-15
US60/470,432 2003-05-15

Publications (1)

Publication Number Publication Date
WO2004016282A1 true WO2004016282A1 (en) 2004-02-26

Family

ID=31891336

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2003/007864 Ceased WO2004016282A1 (en) 2002-07-19 2003-07-18 Vaccine compositions containing amyloid beta1-6 antigen arrays

Country Status (23)

Country Link
US (4) US7279165B2 (enExample)
EP (2) EP2338510A1 (enExample)
JP (1) JP4644488B2 (enExample)
KR (2) KR101070078B1 (enExample)
CN (2) CN101711865A (enExample)
AT (1) ATE506964T1 (enExample)
AU (1) AU2003250110C1 (enExample)
BR (1) BR0312792A (enExample)
CA (1) CA2492930C (enExample)
CY (1) CY1111751T1 (enExample)
DE (1) DE60336902D1 (enExample)
DK (1) DK1524994T3 (enExample)
EC (1) ECSP055551A (enExample)
IL (1) IL166227A (enExample)
MX (1) MXPA05000819A (enExample)
NO (1) NO337574B1 (enExample)
NZ (1) NZ537688A (enExample)
PL (1) PL217409B1 (enExample)
PT (1) PT1524994E (enExample)
RU (1) RU2450827C2 (enExample)
SI (1) SI1524994T1 (enExample)
WO (1) WO2004016282A1 (enExample)
ZA (1) ZA200500151B (enExample)

Cited By (40)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2006048295A1 (en) * 2004-11-05 2006-05-11 Novartis Ag Composition compri sing vlp and amyloid - beta peptide
WO2006126682A1 (ja) * 2005-05-27 2006-11-30 Juridical Foundation The Chemo-Sero-Therapeutic Research Institute アルツハイマー病の予防・治療用ワクチン
JP2008506666A (ja) * 2004-07-13 2008-03-06 アフィリス・フォルシュングス−ウント・エントヴィックルングス・ゲゼルシャフト・ミット・ベシュレンクテル・ハフツング アルツハイマー病の予防および治療方法
WO2008042024A2 (en) 2006-06-01 2008-04-10 Elan Pharmaceuticals, Inc. Neuroactive fragments of app
JP2008545401A (ja) * 2005-05-26 2008-12-18 サイトス バイオテクノロジー アーゲー 拡張可能な発酵方法
US7517520B2 (en) 2003-03-26 2009-04-14 Cytos Biotechnology Ag Packaging of immunostimulatory oligonucleotides into virus-like particles: method of preparation and use
US7790856B2 (en) 1998-04-07 2010-09-07 Janssen Alzheimer Immunotherapy Humanized antibodies that recognize beta amyloid peptide
US7964192B1 (en) 1997-12-02 2011-06-21 Janssen Alzheimer Immunotherapy Prevention and treatment of amyloidgenic disease
US20110177109A1 (en) * 2009-07-30 2011-07-21 Pfizer Vaccines Llc Antigenic tau peptides and uses thereof
US8003097B2 (en) 2007-04-18 2011-08-23 Janssen Alzheimer Immunotherapy Treatment of cerebral amyloid angiopathy
WO2011106732A1 (en) 2010-02-25 2011-09-01 Wyeth Llc Pet monitoring of ab-directed immunotherapy
WO2011120924A1 (en) 2010-03-29 2011-10-06 Novartis Ag Composition comprising the amyloid beta 1-6 peptide coupled to a virus-like particle and an adjuvant
US8034339B2 (en) 1997-12-02 2011-10-11 Janssen Alzheimer Immunotherapy Prevention and treatment of amyloidogenic disease
US8128928B2 (en) 2002-03-12 2012-03-06 Wyeth Llc Humanized antibodies that recognize beta amyloid peptide
WO2013092720A1 (en) 2011-12-22 2013-06-27 F. Hoffmann-La Roche Ag Full length antibody display system for eukaryotic cells and its use
US8497072B2 (en) 2005-11-30 2013-07-30 Abbott Laboratories Amyloid-beta globulomer antibodies
AU2011253800B2 (en) * 2004-11-05 2013-08-22 Novartis Ag Composition comprising VLP and amyloid-beta peptide
US8613920B2 (en) 2007-07-27 2013-12-24 Janssen Alzheimer Immunotherapy Treatment of amyloidogenic diseases
US8691224B2 (en) 2005-11-30 2014-04-08 Abbvie Inc. Anti-Aβ globulomer 5F7 antibodies
US8784810B2 (en) 2006-04-18 2014-07-22 Janssen Alzheimer Immunotherapy Treatment of amyloidogenic diseases
US8877190B2 (en) 2006-11-30 2014-11-04 Abbvie Inc. Aβ conformer selective anti-Aβ globulomer monoclonal antibodies
US8895004B2 (en) 2007-02-27 2014-11-25 AbbVie Deutschland GmbH & Co. KG Method for the treatment of amyloidoses
US8916165B2 (en) 2004-12-15 2014-12-23 Janssen Alzheimer Immunotherapy Humanized Aβ antibodies for use in improving cognition
US8987419B2 (en) 2010-04-15 2015-03-24 AbbVie Deutschland GmbH & Co. KG Amyloid-beta binding proteins
US9051363B2 (en) 1997-12-02 2015-06-09 Janssen Sciences Ireland Uc Humanized antibodies that recognize beta amyloid peptide
US9062101B2 (en) 2010-08-14 2015-06-23 AbbVie Deutschland GmbH & Co. KG Amyloid-beta binding proteins
US9067981B1 (en) 2008-10-30 2015-06-30 Janssen Sciences Ireland Uc Hybrid amyloid-beta antibodies
US9176150B2 (en) 2003-01-31 2015-11-03 AbbVie Deutschland GmbH & Co. KG Amyloid beta(1-42) oligomers, derivatives thereof and antibodies thereto, methods of preparation thereof and use thereof
EP2952524A1 (en) 2007-10-17 2015-12-09 Janssen Sciences Ireland UC Immunotherapy regimes dependent on apoe status
US9909155B2 (en) 2012-04-18 2018-03-06 Corbion Biotech, Inc. Structuring fats and methods of producing structuring fats
US9969990B2 (en) 2014-07-10 2018-05-15 Corbion Biotech, Inc. Ketoacyl ACP synthase genes and uses thereof
US10006034B2 (en) 2010-05-28 2018-06-26 Corbion Biotech, Inc. Recombinant microalgae including keto-acyl ACP synthase
US10022436B2 (en) 2016-01-11 2018-07-17 Verndari, Inc. Microneedle compositions and methods of using same
US10053715B2 (en) 2013-10-04 2018-08-21 Corbion Biotech, Inc. Tailored oils
US10086056B2 (en) 2015-01-15 2018-10-02 University Of Copenhagen Virus-like particle with efficient epitope display
US10100341B2 (en) 2011-02-02 2018-10-16 Corbion Biotech, Inc. Tailored oils produced from recombinant oleaginous microorganisms
US10933129B2 (en) 2011-07-29 2021-03-02 Selecta Biosciences, Inc. Methods for administering synthetic nanocarriers that generate humoral and cytotoxic T lymphocyte responses
WO2021081353A1 (en) 2019-10-23 2021-04-29 Checkmate Pharmaceuticals, Inc. Synthetic rig-i-like receptor agonists
US11129882B2 (en) 2015-10-30 2021-09-28 University Of Copenhagen Virus like particle with efficient epitope display
US12123003B2 (en) 2018-04-19 2024-10-22 Checkmate Pharmaceuticals, Inc. Synthetic RIG-I-like receptor agonists

Families Citing this family (21)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7094409B2 (en) * 2001-01-19 2006-08-22 Cytos Biotechnology Ag Antigen arrays for treatment of allergic eosinophilic diseases
US7128911B2 (en) 2001-01-19 2006-10-31 Cytos Biotechnology Ag Antigen arrays for treatment of bone disease
US7320793B2 (en) * 2001-01-19 2008-01-22 Cytos Biotechnology Ag Molecular antigen array
ES2335979T3 (es) 2001-09-14 2010-04-07 Cytos Biotechnology Ag Empaquetamiento de cpg inmunoestimuladores en particulas similares a virus: metodo de preparacion y su uso.
US7115266B2 (en) 2001-10-05 2006-10-03 Cytos Biotechnology Ag Angiotensin peptide-carrier conjugates and uses thereof
CN102061288A (zh) * 2002-07-17 2011-05-18 希托斯生物技术股份公司 使用衍生自ap205外壳蛋白的病毒样颗粒的分子抗原阵列
IN2008CN05409A (enExample) 2002-07-18 2015-10-02 Cytos Biotechnology Ag
CA2492930C (en) * 2002-07-19 2013-01-08 Cytos Biotechnology Ag Vaccine compositions containing amyloid beta1-6 antigen arrays
KR20070059207A (ko) * 2004-10-05 2007-06-11 사이토스 바이오테크놀로지 아게 Vlp-항원 컨쥬게이트 및 백신으로서 그의 용도
US20110182948A1 (en) * 2008-05-22 2011-07-28 Beka Solomon Method for treating disease characterized by plaque
AU2009266552B2 (en) * 2008-07-01 2014-01-23 De Staat Der Nederlanden, Vert. Door De Minister Van Vws Vaccine against amyloid folding intermediate
EP3027205A4 (en) 2013-07-28 2017-07-19 Qantu Therapeutics, Inc. Vaccine formulations that induce a th2 immune response
CN107034198B (zh) * 2015-07-15 2021-03-09 长春百克生物科技股份公司 一种嵌合诺如病毒p颗粒及其制备和应用
CN111132692A (zh) * 2017-06-23 2020-05-08 美国菌种保藏中心 包含寨卡病毒抗原的病毒样颗粒
JP7368856B2 (ja) 2017-07-25 2023-10-25 トゥルーバインディング,インコーポレイテッド Tim-3とそのリガンドとの相互作用の遮断によるがん治療
JP7255895B2 (ja) * 2017-08-28 2023-04-11 ボード オブ トラスティーズ オブ ミシガン ステイト ユニバーシティ バクテリオファージおよびその変異体を使用したがんおよび感染を処置する組成物および方法
CN116063505B (zh) 2019-01-30 2024-05-03 真和制药有限公司 抗gal3抗体及其用途
US12281166B2 (en) 2020-05-26 2025-04-22 Truebinding, Inc. Methods of treating inflammatory diseases by blocking Galectin-3
CN115819623A (zh) * 2022-12-12 2023-03-21 长春百克生物科技股份公司 一种重组病毒样颗粒疫苗组合物的制备及应用
KR20250017150A (ko) 2023-07-20 2025-02-04 주식회사 포스백스 파필로마바이러스 바이러스 유사입자 기반 항-아밀로이드 베타 알츠하이머병 백신
WO2025018831A1 (ko) * 2023-07-20 2025-01-23 주식회사 포스백스 파필로마바이러스 바이러스 유사입자 기반 항-아밀로이드 베타 알츠하이머병 백신

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2000032227A2 (en) * 1998-11-30 2000-06-08 Cytos Biotechnology Ag Ordered molecular presentation of antigens, method of preparation and use
WO2001053457A2 (en) * 2000-01-21 2001-07-26 University Of Connecticut Health Center Vaccines against neurodegenerative disorders
WO2002056905A2 (en) * 2001-01-19 2002-07-25 Cytos Biotechnology Ag Molecular antigen array

Family Cites Families (87)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB2055131B (en) 1978-09-29 1982-12-15 Energy Secretary Of State For Electrical power transmission in fluid wells
DE3160926D1 (en) 1980-04-15 1983-10-27 Beecham Group Plc Allergens modified with polysarcosines
US5204096A (en) * 1984-03-07 1993-04-20 New York Blood Center, Inc. Pre-S gene coded peptide hepatitis B immunogens, vaccines, diagnostics, and synthetic lipid vesicle carriers
US4722840A (en) * 1984-09-12 1988-02-02 Chiron Corporation Hybrid particle immunogens
US4959314A (en) * 1984-11-09 1990-09-25 Cetus Corporation Cysteine-depleted muteins of biologically active proteins
US5374426A (en) 1986-09-03 1994-12-20 University Of Saskatchewan Rotavirus nucleocapsid protein VP6 in vaccine compositions
CA1319101C (en) 1986-09-03 1993-06-15 Marta Iris Sabara Rotavirus nucleocapsid protein with or without binding peptides as immunologic carriers for macromolecules
WO1988001873A1 (en) 1986-09-22 1988-03-24 Emory University Vaccine and method of preparation
US5143726A (en) * 1986-12-09 1992-09-01 The Scripps Research Institute T cell epitopes of the hepatitis B virus nucleocapsid protein
US4918166A (en) 1987-04-10 1990-04-17 Oxford Gene Systems Limited Particulate hybrid HIV antigens
US5057540A (en) 1987-05-29 1991-10-15 Cambridge Biotech Corporation Saponin adjuvant
US4912094B1 (en) 1988-06-29 1994-02-15 Ribi Immunochem Research Inc. Modified lipopolysaccharides and process of preparation
JPH0656106B2 (ja) 1988-10-29 1994-07-27 マツダ株式会社 過給機付エンジンの吸気装置
GB8903313D0 (en) 1989-02-14 1989-04-05 Wellcome Found Conjugates
US5703055A (en) 1989-03-21 1997-12-30 Wisconsin Alumni Research Foundation Generation of antibodies through lipid mediated DNA delivery
GB8913737D0 (en) 1989-06-15 1989-08-02 Univ Birmingham A novel anti-allergy treatment
DK0425082T3 (da) 1989-09-04 1995-07-03 Evans Medical Ltd Vacciner
NZ235315A (en) 1989-09-19 1991-09-25 Wellcome Found Chimaeric hepadnavirus core antigen proteins and their construction
ATE356869T1 (de) 1990-01-12 2007-04-15 Amgen Fremont Inc Bildung von xenogenen antikörpern
DE69126304T2 (de) 1990-04-27 1997-09-04 Mcmichael, John, Delanson, N.Y. Verfahren und zusammensetzung zur behandlung von erkrankungen des zns hervorgerufen durch abnormales beta-amyloid-protein
US5178882A (en) 1990-06-22 1993-01-12 The Regents Of The University Of California Viral decoy vaccine
US5334394A (en) 1990-06-22 1994-08-02 The Regents Of The University Of California Human immunodeficiency virus decoy
SE9003978D0 (sv) 1990-12-13 1990-12-13 Henrik Garoff Dna expressionssystem baserade paa ett virus replikon
WO1992011291A1 (en) 1990-12-20 1992-07-09 Smithkline Beecham Biologicals (S.A.) Vaccines based on hepatitis b surface antigen
GB9101550D0 (en) 1991-01-24 1991-03-06 Mastico Robert A Antigen-presenting chimaeric protein
GB9114003D0 (en) * 1991-06-28 1991-08-14 Mastico Robert A Chimaeric protein
ZA934199B (en) 1992-06-18 1994-01-10 Akzo Nv Carrier system against gnrh
FR2695563B1 (fr) 1992-09-11 1994-12-02 Pasteur Institut Microparticules portant des antigènes et leur utilisation pour l'induction de réponses humorales ou cellulaires.
US6004763A (en) * 1992-09-11 1999-12-21 Institut Pasteur Antigen-carrying microparticles and their use in the induction of humoral or cellular responses
GB9227068D0 (en) 1992-12-29 1993-02-24 British Bio Technology Novel proteinaceous particles
DK0678034T3 (da) * 1993-01-11 1999-11-08 Dana Farber Cancer Inst Inc Induktion af cytotoksiske T-lymfocytreaktioner
AU6172194A (en) 1993-02-08 1994-08-29 Paravax, Inc. Defective sindbis virus vectors that express (toxoplasma gondii) p30 antigens
US6015686A (en) 1993-09-15 2000-01-18 Chiron Viagene, Inc. Eukaryotic layered vector initiation systems
US6180771B1 (en) * 1993-12-08 2001-01-30 Immulogic Pharmaceutical Corp. Nucleic acids encoding a house dust mite allergen, Der p III, and uses therefor
AT402898B (de) 1994-08-08 1997-09-25 Int Centre Genetic Eng & Bio Molekulares präsentiersystem
US5935821A (en) * 1995-01-17 1999-08-10 Board Of Trustees Of The University Of Kentucky Polynucleotides related to monoclonal antibody 1A7 and use for the treatment of melanoma and small cell carcinoma
WO1996028624A1 (en) 1995-03-16 1996-09-19 Owens Corning Vacuum insulation panel having blended wool filler and method for manufacturing
CN1185811A (zh) 1995-03-31 1998-06-24 H·沃尔夫 依赖于逆转录病毒样颗粒的抗原呈递系统
US5792462A (en) 1995-05-23 1998-08-11 University Of North Carolina At Chapel Hill Alphavirus RNA replicon systems
US5916616A (en) * 1995-08-11 1999-06-29 Nakano Vinegar Co., Ltd. Process for producing starch noodles by extrusion
JPH09202735A (ja) 1996-01-25 1997-08-05 Nof Corp リポソーム型アレルギー治療薬
ES2190799T5 (es) 1996-03-01 2008-08-16 Novartis Ag Inmunogenos peptidicos para vacunacion y tratamiento contra la alergia.
US5786161A (en) 1996-06-06 1998-07-28 Miltenyi Biotec. Gmbh Isolation and characterization of allergen-binding cells for diagnosis of hypersensitivity
ATE394481T1 (de) 1996-07-24 2008-05-15 Novartis Pharma Gmbh Transgentier-modell für die krankheit von alzheimer
US5770380A (en) 1996-09-13 1998-06-23 University Of Pittsburgh Synthetic antibody mimics--multiple peptide loops attached to a molecular scaffold
GB9621091D0 (en) 1996-10-09 1996-11-27 Fondation Pour Le Perfectionem Attenuated microorganisms strains and their uses
WO1998040100A1 (en) 1997-03-10 1998-09-17 Ottawa Civic Loeb Research Institute USE OF NUCLEIC ACIDS CONTAINING UNMETHYLATED CpG DINUCLEOTIDE AS AN ADJUVANT
US8173127B2 (en) * 1997-04-09 2012-05-08 Intellect Neurosciences, Inc. Specific antibodies to amyloid beta peptide, pharmaceutical compositions and methods of use thereof
ES2255181T3 (es) 1997-08-05 2006-06-16 Vlaams Interuniversitair Instituut Voor Biotechnologie Vzw. Antigeno inmunoprotector contra la gripe y su uso en vacunacion.
US6169175B1 (en) 1997-08-06 2001-01-02 Centers For Disease Control And Prevention Preparation and use of recombinant influenza A virus M2 construct vaccines
US6054312A (en) * 1997-08-29 2000-04-25 Selective Genetics, Inc. Receptor-mediated gene delivery using bacteriophage vectors
TWI239847B (en) 1997-12-02 2005-09-21 Elan Pharm Inc N-terminal fragment of Abeta peptide and an adjuvant for preventing and treating amyloidogenic disease
AU742970C (en) 1997-12-03 2003-03-20 Janssen Alzheimer Immunotherapy Method of suppressing beta-amyloid-related changes in Alzheimer's disease
US6231864B1 (en) 1998-02-12 2001-05-15 Immune Complex Corporation Strategically modified hepatitis B core proteins and their derivatives
US5990085A (en) 1998-05-04 1999-11-23 Michigan State University Inhibin-HBc fusion protein
TWI227241B (en) 1998-06-20 2005-02-01 United Biomedical Inc IgE-CH3 domain antigen peptide, peptide conjugate containing the same, and pharmaceutical composition for treating allergies containing the peptide conjugate
US6927278B1 (en) * 1998-09-01 2005-08-09 Trustees Of The University Of Pennsylvania Peptide scaffolds for transfer of molecules into eukaryotic cells
JP4486257B2 (ja) * 1998-10-21 2010-06-23 アメリカ合衆国 自己抗体の誘導のためのウイルス様粒子
US6380364B1 (en) * 1998-11-23 2002-04-30 Loyola University Of Chicago Chimeric biotin-binding papillomavirus protein
HU229222B1 (en) * 1998-12-04 2013-09-30 Biogen Idec Ma Inc Cambridge Hbv core antigen particles with multiple immunogenic components attached via peptide ligands
CA2363641A1 (en) 1999-02-25 2000-08-31 Smithkline Beecham Biologicals S.A. Epitopes or mimotopes derived from the c-epsilon-3 or c-epsilon-4 domains of ige, antagonists thereof, and their therapeutic uses
EP1173467A4 (en) 1999-04-07 2005-12-28 Univ Jefferson SYNTHETIC PEPTIDES FROM CHEMOKINES
US20020052311A1 (en) * 1999-09-03 2002-05-02 Beka Solomon Methods and compostions for the treatment and/or diagnosis of neurological diseases and disorders
HK1044564B (en) 1999-09-03 2010-05-28 拉莫特大学应用研究和工业开发有限公司 Agents, compositions and methods utilizing the same useful in treating or preventing alzheimer disease
ES2248283T3 (es) 2000-02-21 2006-03-16 Pharmexa A/S Nuevo procedimiento para reducir los niveles de amiloide.
WO2001077158A1 (en) 2000-04-07 2001-10-18 University Of Leeds Innovations Limited Hepatitis b core antigen fusion proteins
CA2407897A1 (en) 2000-05-05 2001-11-15 Cytos Biotechnology Ag Molecular antigen arrays and vaccines
PT1294893E (pt) 2000-06-22 2006-08-31 Ucb Pharma Ltd Modificacao do antigenio nuclear de hepatite b
US20030138769A1 (en) 2000-08-16 2003-07-24 Birkett Ashley J. Immunogenic HBc chimer particles having enhanced stability
US7094409B2 (en) * 2001-01-19 2006-08-22 Cytos Biotechnology Ag Antigen arrays for treatment of allergic eosinophilic diseases
US7128911B2 (en) * 2001-01-19 2006-10-31 Cytos Biotechnology Ag Antigen arrays for treatment of bone disease
WO2003024480A2 (en) 2001-09-14 2003-03-27 Cytos Biotechnology Ag In vivo activation of antigen presenting cells for enhancement of immune responses induced by virus like particles
ES2335979T3 (es) * 2001-09-14 2010-04-07 Cytos Biotechnology Ag Empaquetamiento de cpg inmunoestimuladores en particulas similares a virus: metodo de preparacion y su uso.
US7115266B2 (en) * 2001-10-05 2006-10-03 Cytos Biotechnology Ag Angiotensin peptide-carrier conjugates and uses thereof
US20030219459A1 (en) * 2002-01-18 2003-11-27 Cytos Biotechnology Ag Prion protein carrier-conjugates
CN102061288A (zh) * 2002-07-17 2011-05-18 希托斯生物技术股份公司 使用衍生自ap205外壳蛋白的病毒样颗粒的分子抗原阵列
IN2008CN05409A (enExample) * 2002-07-18 2015-10-02 Cytos Biotechnology Ag
CA2492930C (en) * 2002-07-19 2013-01-08 Cytos Biotechnology Ag Vaccine compositions containing amyloid beta1-6 antigen arrays
CN1665565A (zh) * 2002-07-19 2005-09-07 赛托斯生物技术公司 Ghrelin-载体偶联物
US7537767B2 (en) * 2003-03-26 2009-05-26 Cytis Biotechnology Ag Melan-A- carrier conjugates
CA2517839A1 (en) * 2003-03-26 2004-10-07 Martin F. Bachmann Melan-a peptide analogue-virus-like-particle conjugates
EP1791870A1 (en) * 2004-09-21 2007-06-06 Cytos Biotechnology AG Virus-like particles comprising a fusion protein of the coat protein of ap205 and an antigenic polypeptide
KR20070059207A (ko) * 2004-10-05 2007-06-11 사이토스 바이오테크놀로지 아게 Vlp-항원 컨쥬게이트 및 백신으로서 그의 용도
JP2008517975A (ja) * 2004-10-25 2008-05-29 サイトス バイオテクノロジー アーゲー 胃酸分泌抑制ポリペプチド(gip)抗原アッセイ及びその使用
NZ555590A (en) * 2004-12-13 2009-07-31 Cytos Biotechnology Ag Compositions comprising a VLP and IL-15 protein
NZ561040A (en) * 2005-03-18 2009-04-30 Cytos Biotechnology Ag Cat allergen fusion proteins and use thereof
EP1982729A1 (en) * 2007-04-20 2008-10-22 Cytos Biotechnology AG Vaccination Regimen for B-Cell Vaccines

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2000032227A2 (en) * 1998-11-30 2000-06-08 Cytos Biotechnology Ag Ordered molecular presentation of antigens, method of preparation and use
WO2001053457A2 (en) * 2000-01-21 2001-07-26 University Of Connecticut Health Center Vaccines against neurodegenerative disorders
WO2002056905A2 (en) * 2001-01-19 2002-07-25 Cytos Biotechnology Ag Molecular antigen array

Non-Patent Citations (12)

* Cited by examiner, † Cited by third party
Title
CHAPMAN, P.F., NATURE, vol. 408, 2000, pages 915 - 916
CHEN, G. ET AL., NATURE, vol. 408, 2000, pages 975 - 979
GOLMOHAMMADI, R. ET AL., STRUCTURE, vol. 4, 1996, pages 543 - 554
GOLMOHAMMADI, R. ET AL., STRUCTURE, vol. 4, 1996, pages 543 - 5554
JANUS, C. ET AL., NATURE, vol. 408, 2000, pages 979 - 982
KOZLOVSKA ET AL., INTERVIROLOGY, vol. 39, 1996, pages 9 - 15
KOZLOVSKA, T. M. ET AL., INTERVIROLOGY, vol. 39, 1996, pages 9 - 15
KOZLOVSKA, TM ET AL., GENE, vol. 137, pages 133 - 137
LIM F. ET AL., J. BIOL. CHEM., vol. 271, 1996, pages 31839 - 31845
MORGAN, D. ET AL., NATURE, vol. 408, 2000, pages 982 - 985
PUSHKO P. ET AL., PROTO ENG., vol. 6, 1993, pages 883 - 891
SMILEY B.K. ET AL., GENE, vol. 134, 1993, pages 33 - 40

Cited By (73)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7964192B1 (en) 1997-12-02 2011-06-21 Janssen Alzheimer Immunotherapy Prevention and treatment of amyloidgenic disease
US9051363B2 (en) 1997-12-02 2015-06-09 Janssen Sciences Ireland Uc Humanized antibodies that recognize beta amyloid peptide
US8642044B2 (en) 1997-12-02 2014-02-04 Janssen Alzheimer Immunotherapy Prevention and treatment of amyloidogenic disease
US8535673B2 (en) 1997-12-02 2013-09-17 Janssen Alzheimer Immunotherapy Prevention and treatment of amyloidogenic disease
US8034348B2 (en) 1997-12-02 2011-10-11 Janssen Alzheimer Immunotherapy Prevention and treatment of amyloidogenic disease
US8034339B2 (en) 1997-12-02 2011-10-11 Janssen Alzheimer Immunotherapy Prevention and treatment of amyloidogenic disease
US7790856B2 (en) 1998-04-07 2010-09-07 Janssen Alzheimer Immunotherapy Humanized antibodies that recognize beta amyloid peptide
US8128928B2 (en) 2002-03-12 2012-03-06 Wyeth Llc Humanized antibodies that recognize beta amyloid peptide
US9176150B2 (en) 2003-01-31 2015-11-03 AbbVie Deutschland GmbH & Co. KG Amyloid beta(1-42) oligomers, derivatives thereof and antibodies thereto, methods of preparation thereof and use thereof
US10464976B2 (en) 2003-01-31 2019-11-05 AbbVie Deutschland GmbH & Co. KG Amyloid β(1-42) oligomers, derivatives thereof and antibodies thereto, methods of preparation thereof and use thereof
US7517520B2 (en) 2003-03-26 2009-04-14 Cytos Biotechnology Ag Packaging of immunostimulatory oligonucleotides into virus-like particles: method of preparation and use
JP2008506666A (ja) * 2004-07-13 2008-03-06 アフィリス・フォルシュングス−ウント・エントヴィックルングス・ゲゼルシャフト・ミット・ベシュレンクテル・ハフツング アルツハイマー病の予防および治療方法
RU2415677C2 (ru) * 2004-11-05 2011-04-10 Новартис Аг Композиция, содержащая вирусоподобную частицу (впч) и пептид амилоид-бета
JP2008515954A (ja) * 2004-11-05 2008-05-15 ノバルティス アクチエンゲゼルシャフト VLPおよびアミロイドβペプチドを含む組成物
US8617566B2 (en) 2004-11-05 2013-12-31 Novartis Ag Composition comprising VLP and amyloid beta peptide
JP2011157395A (ja) * 2004-11-05 2011-08-18 Novartis Ag VLPおよびアミロイドβペプチドを含む組成物
US20110086036A1 (en) * 2004-11-05 2011-04-14 Ana Graf Composition comprising vlp and amyloid beta peptide
WO2006048295A1 (en) * 2004-11-05 2006-05-11 Novartis Ag Composition compri sing vlp and amyloid - beta peptide
US7867499B2 (en) 2004-11-05 2011-01-11 Novartis Ag Methods of treating dementia by administering virus-like particles coupled to Aβ
AU2011253800B2 (en) * 2004-11-05 2013-08-22 Novartis Ag Composition comprising VLP and amyloid-beta peptide
EP2286830A3 (en) * 2004-11-05 2011-03-30 Novartis AG Composition comprising vlp and amyloid-beta peptide
AU2010200410B2 (en) * 2004-11-05 2011-10-13 Novartis Ag Composition comprising VLP and amyloid-beta peptide
EP2286830A2 (en) 2004-11-05 2011-02-23 Novartis AG Composition comprising vlp and amyloid-beta peptide
US8460676B2 (en) 2004-11-05 2013-06-11 Novartis Ag Composition comprising VLP and amyloid beta peptide
US8916165B2 (en) 2004-12-15 2014-12-23 Janssen Alzheimer Immunotherapy Humanized Aβ antibodies for use in improving cognition
JP2008545401A (ja) * 2005-05-26 2008-12-18 サイトス バイオテクノロジー アーゲー 拡張可能な発酵方法
WO2006126682A1 (ja) * 2005-05-27 2006-11-30 Juridical Foundation The Chemo-Sero-Therapeutic Research Institute アルツハイマー病の予防・治療用ワクチン
US10208109B2 (en) 2005-11-30 2019-02-19 Abbvie Inc. Monoclonal antibodies against amyloid beta protein and uses thereof
US10538581B2 (en) 2005-11-30 2020-01-21 Abbvie Inc. Anti-Aβ globulomer 4D10 antibodies
US10323084B2 (en) 2005-11-30 2019-06-18 Abbvie Inc. Monoclonal antibodies against amyloid beta protein and uses thereof
US8497072B2 (en) 2005-11-30 2013-07-30 Abbott Laboratories Amyloid-beta globulomer antibodies
US9540432B2 (en) 2005-11-30 2017-01-10 AbbVie Deutschland GmbH & Co. KG Anti-Aβ globulomer 7C6 antibodies
US8691224B2 (en) 2005-11-30 2014-04-08 Abbvie Inc. Anti-Aβ globulomer 5F7 antibodies
US8784810B2 (en) 2006-04-18 2014-07-22 Janssen Alzheimer Immunotherapy Treatment of amyloidogenic diseases
WO2008042024A2 (en) 2006-06-01 2008-04-10 Elan Pharmaceuticals, Inc. Neuroactive fragments of app
US9359430B2 (en) 2006-11-30 2016-06-07 Abbvie Inc. Abeta conformer selective anti-Abeta globulomer monoclonal antibodies
US8877190B2 (en) 2006-11-30 2014-11-04 Abbvie Inc. Aβ conformer selective anti-Aβ globulomer monoclonal antibodies
US9951125B2 (en) 2006-11-30 2018-04-24 Abbvie Inc. Aβ conformer selective anti-Aβ globulomer monoclonal antibodies
US9394360B2 (en) 2006-11-30 2016-07-19 Abbvie Inc. Aβ conformer selective anti-Aβ globulomer monoclonal antibodies
US8895004B2 (en) 2007-02-27 2014-11-25 AbbVie Deutschland GmbH & Co. KG Method for the treatment of amyloidoses
US8003097B2 (en) 2007-04-18 2011-08-23 Janssen Alzheimer Immunotherapy Treatment of cerebral amyloid angiopathy
US8613920B2 (en) 2007-07-27 2013-12-24 Janssen Alzheimer Immunotherapy Treatment of amyloidogenic diseases
EP2952524A1 (en) 2007-10-17 2015-12-09 Janssen Sciences Ireland UC Immunotherapy regimes dependent on apoe status
US9644025B2 (en) 2007-10-17 2017-05-09 Wyeth Llc Immunotherapy regimes dependent on ApoE status
US9067981B1 (en) 2008-10-30 2015-06-30 Janssen Sciences Ireland Uc Hybrid amyloid-beta antibodies
US20110177109A1 (en) * 2009-07-30 2011-07-21 Pfizer Vaccines Llc Antigenic tau peptides and uses thereof
WO2011106732A1 (en) 2010-02-25 2011-09-01 Wyeth Llc Pet monitoring of ab-directed immunotherapy
WO2011120924A1 (en) 2010-03-29 2011-10-06 Novartis Ag Composition comprising the amyloid beta 1-6 peptide coupled to a virus-like particle and an adjuvant
AU2011234656B2 (en) * 2010-03-29 2013-08-01 Novartis Ag Composition comprising the amyloid beta 1-6 peptide coupled to a virus-like particle and an adjuvant
RU2603486C2 (ru) * 2010-03-29 2016-11-27 Новартис Аг КОМПОЗИЦИЯ, ВКЛЮЧАЮЩАЯ АМИЛОИДНЫЙ ПЕПТИД Аβ-1-6, ПРИСОЕДИНЕННЫЙ К ВИРУСОПОДОБНОЙ ЧАСТИЦЕ И АДЪЮВАНТУ
US8987419B2 (en) 2010-04-15 2015-03-24 AbbVie Deutschland GmbH & Co. KG Amyloid-beta binding proteins
US9822171B2 (en) 2010-04-15 2017-11-21 AbbVie Deutschland GmbH & Co. KG Amyloid-beta binding proteins
US10006034B2 (en) 2010-05-28 2018-06-26 Corbion Biotech, Inc. Recombinant microalgae including keto-acyl ACP synthase
US9062101B2 (en) 2010-08-14 2015-06-23 AbbVie Deutschland GmbH & Co. KG Amyloid-beta binding proteins
US10047121B2 (en) 2010-08-14 2018-08-14 AbbVie Deutschland GmbH & Co. KG Amyloid-beta binding proteins
US10100341B2 (en) 2011-02-02 2018-10-16 Corbion Biotech, Inc. Tailored oils produced from recombinant oleaginous microorganisms
US10933129B2 (en) 2011-07-29 2021-03-02 Selecta Biosciences, Inc. Methods for administering synthetic nanocarriers that generate humoral and cytotoxic T lymphocyte responses
WO2013092720A1 (en) 2011-12-22 2013-06-27 F. Hoffmann-La Roche Ag Full length antibody display system for eukaryotic cells and its use
US10287613B2 (en) 2012-04-18 2019-05-14 Corbion Biotech, Inc. Structuring fats and methods of producing structuring fats
US10683522B2 (en) 2012-04-18 2020-06-16 Corbion Biotech, Inc. Structuring fats and methods of producing structuring fats
US9909155B2 (en) 2012-04-18 2018-03-06 Corbion Biotech, Inc. Structuring fats and methods of producing structuring fats
US11401538B2 (en) 2012-04-18 2022-08-02 Corbion Biotech, Inc. Structuring fats and methods of producing structuring fats
US10053715B2 (en) 2013-10-04 2018-08-21 Corbion Biotech, Inc. Tailored oils
US10316299B2 (en) 2014-07-10 2019-06-11 Corbion Biotech, Inc. Ketoacyl ACP synthase genes and uses thereof
US9969990B2 (en) 2014-07-10 2018-05-15 Corbion Biotech, Inc. Ketoacyl ACP synthase genes and uses thereof
US10086056B2 (en) 2015-01-15 2018-10-02 University Of Copenhagen Virus-like particle with efficient epitope display
US11497800B2 (en) 2015-01-15 2022-11-15 University Of Copenhagen Virus-like particle with efficient epitope display
US10526376B2 (en) 2015-01-15 2020-01-07 University Of Copenhagen Virus-like particle with efficient epitope display
US11129882B2 (en) 2015-10-30 2021-09-28 University Of Copenhagen Virus like particle with efficient epitope display
US10363303B2 (en) 2016-01-11 2019-07-30 Verndari, Inc. Microneedle compositions and methods of using same
US10022436B2 (en) 2016-01-11 2018-07-17 Verndari, Inc. Microneedle compositions and methods of using same
US12123003B2 (en) 2018-04-19 2024-10-22 Checkmate Pharmaceuticals, Inc. Synthetic RIG-I-like receptor agonists
WO2021081353A1 (en) 2019-10-23 2021-04-29 Checkmate Pharmaceuticals, Inc. Synthetic rig-i-like receptor agonists

Also Published As

Publication number Publication date
KR101070078B1 (ko) 2011-10-04
US20150374807A1 (en) 2015-12-31
PL374935A1 (en) 2005-11-14
JP4644488B2 (ja) 2011-03-02
ATE506964T1 (de) 2011-05-15
US20090246215A1 (en) 2009-10-01
PT1524994E (pt) 2011-08-01
KR20100125480A (ko) 2010-11-30
US20140294876A1 (en) 2014-10-02
BR0312792A (pt) 2005-05-03
NO337574B1 (no) 2016-05-09
MXPA05000819A (es) 2005-08-29
DK1524994T3 (da) 2011-08-15
US20040141984A1 (en) 2004-07-22
EP1524994B1 (en) 2011-04-27
CN1674934B (zh) 2013-01-02
AU2003250110B2 (en) 2007-11-08
CN101711865A (zh) 2010-05-26
PL217409B1 (pl) 2014-07-31
AU2003250110C1 (en) 2008-05-29
NZ537688A (en) 2007-01-26
RU2005104824A (ru) 2007-12-20
JP2005539025A (ja) 2005-12-22
ECSP055551A (es) 2005-04-18
SI1524994T1 (sl) 2011-08-31
CY1111751T1 (el) 2015-10-07
DE60336902D1 (de) 2011-06-09
US7279165B2 (en) 2007-10-09
CA2492930C (en) 2013-01-08
AU2003250110A1 (en) 2004-03-03
ZA200500151B (en) 2006-07-26
IL166227A (en) 2011-10-31
RU2450827C2 (ru) 2012-05-20
NO20050894L (no) 2005-04-12
CN1674934A (zh) 2005-09-28
EP1524994A1 (en) 2005-04-27
IL166227A0 (en) 2006-01-15
EP2338510A1 (en) 2011-06-29
CA2492930A1 (en) 2004-02-26
KR20050027249A (ko) 2005-03-18
HK1077009A1 (en) 2006-02-03

Similar Documents

Publication Publication Date Title
AU2003250110B2 (en) Vaccine compositions containing amyloid beta1-6 antigen arrays
EP1523372B1 (en) Ghrelin-carrier conjugates
US20090155302A1 (en) Antigen Arrays for Treatment of Allergic Eosinophilic Diseases
AU2002342891B2 (en) Antigen arrays comprising RANKL for treatment of bone disease
US7785873B2 (en) Antigen arrays for treatment of bone disease
AU2002363382A1 (en) Antigen arrays presenting IL-5, IL-3 or eotaxin for treatment of allergic eosinophilic diseases
EP1443960A2 (en) Antigen arrays presenting il-5, il-13 or eotaxin for treatment of allergic eosinophilic diseases
AU2002342891A1 (en) Antigen arrays comprising RANKL for treatment of bone disease
WO2003059386A2 (en) Prion protein carrier-conjugates
AU2003257479B2 (en) Ghrelin-carrier conjugates
HK1156519A (en) Vaccine compositions contanining amyloid beta1-6 antigen arrays
ES2365706T3 (es) Composiciones de vacuna que contienen disposiciones de antígeno beta 1-6 amiloide.
HK1077009B (en) Vaccine compositions containing amyloid beta1-6 antigen arrays
ZA200402015B (en) Antigen arrays comprising rankl for treatment of bone disease.

Legal Events

Date Code Title Description
AK Designated states

Kind code of ref document: A1

Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NI NO NZ OM PG PH PL PT RO RU SC SD SE SG SK SL SY TJ TM TN TR TT TZ UA UG US UZ VC VN YU ZA ZM ZW

AL Designated countries for regional patents

Kind code of ref document: A1

Designated state(s): GH GM KE LS MW MZ SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IT LU MC NL PT RO SE SI SK TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG

121 Ep: the epo has been informed by wipo that ep was designated in this application
WWE Wipo information: entry into national phase

Ref document number: 2003787750

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 3167/CHENP/2004

Country of ref document: IN

WWE Wipo information: entry into national phase

Ref document number: 2003250110

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 2005/00151

Country of ref document: ZA

Ref document number: 200500151

Country of ref document: ZA

WWE Wipo information: entry into national phase

Ref document number: 166227

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: 537688

Country of ref document: NZ

WWE Wipo information: entry into national phase

Ref document number: 2492930

Country of ref document: CA

Ref document number: 1020057000932

Country of ref document: KR

Ref document number: 2004528447

Country of ref document: JP

Ref document number: 374935

Country of ref document: PL

WWE Wipo information: entry into national phase

Ref document number: PA/a/2005/000819

Country of ref document: MX

ENP Entry into the national phase

Ref document number: 2005104824

Country of ref document: RU

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 20038197340

Country of ref document: CN

Ref document number: 1200500211

Country of ref document: VN

WWP Wipo information: published in national office

Ref document number: 1020057000932

Country of ref document: KR

WWP Wipo information: published in national office

Ref document number: 2003787750

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 1-2005-500088

Country of ref document: PH