US20210093666A1 - Cells expressing chimeric antigen receptors and secondary effectors and uses thereof - Google Patents

Cells expressing chimeric antigen receptors and secondary effectors and uses thereof Download PDF

Info

Publication number
US20210093666A1
US20210093666A1 US16/608,362 US201816608362A US2021093666A1 US 20210093666 A1 US20210093666 A1 US 20210093666A1 US 201816608362 A US201816608362 A US 201816608362A US 2021093666 A1 US2021093666 A1 US 2021093666A1
Authority
US
United States
Prior art keywords
tcr
catcr
antigen
domain
cell
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
US16/608,362
Other languages
English (en)
Inventor
Binnaz K. STALEY
Fei Xie
Yiyang Xu
Hong Liu
Cheng Liu
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Eureka Therapeutics Inc
Original Assignee
Eureka Therapeutics Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Eureka Therapeutics Inc filed Critical Eureka Therapeutics Inc
Priority to US16/608,362 priority Critical patent/US20210093666A1/en
Assigned to Eureka Therapeutics, Inc. reassignment Eureka Therapeutics, Inc. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: XIE, FEI, STALEY, Binnaz K., LIU, CHENG, LIU, HONG, XU, Yiyang
Publication of US20210093666A1 publication Critical patent/US20210093666A1/en
Abandoned legal-status Critical Current

Links

Images

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • A61K35/14Blood; Artificial blood
    • A61K35/17Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/11T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/30Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
    • A61K40/31Chimeric antigen receptors [CAR]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/30Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
    • A61K40/32T-cell receptors [TCR]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/421Immunoglobulin superfamily
    • A61K40/4211CD19 or B4
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/4221CD20
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4261Proteoglycans, e.g. glypican, brevican or CSPG4
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4264Cancer antigens from embryonic or fetal origin
    • A61K40/4265Alpha-feto protein
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/7051T-cell receptor (TcR)-CD3 complex
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/70521CD28, CD152
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70578NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2809Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2827Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against B7 molecules, e.g. CD80, CD86
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/283Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against Fc-receptors, e.g. CD16, CD32, CD64
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2833Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against MHC-molecules, e.g. HLA-molecules
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2887Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against CD20
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/303Liver or Pancreas
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0634Cells from the blood or the immune system
    • C12N5/0636T lymphocytes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/46Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
    • A61K2239/48Blood cells, e.g. leukemia or lymphoma
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/522CH1 domain
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/53Hinge
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/54F(ab')2
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/55Fab or Fab'
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/64Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising a combination of variable region and constant region components
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/94Stability, e.g. half-life, pH, temperature or enzyme-resistance
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2318/00Antibody mimetics or scaffolds
    • C07K2318/20Antigen-binding scaffold molecules wherein the scaffold is not an immunoglobulin variable region or antibody mimetics
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/30Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/33Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/40Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation
    • C07K2319/43Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation containing a FLAG-tag
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2510/00Genetically modified cells

Definitions

  • the invention relates to immune cells (such as T cells) comprising a chimeric antibody-T cell receptor (TCR) construct (caTCR) and a secretory secondary effector (SSE) construct.
  • TCR chimeric antibody-T cell receptor
  • SSE secretory secondary effector
  • the caTCR comprises an antigen-binding module that specifically binds to a target antigen and a T cell receptor module (TCRM) capable of recruiting at least one TCR-associated signaling molecule, and the SSE is capable of enhancing an immune response mediated by the caTCR.
  • TCR chimeric antibody-T cell receptor
  • SSE secretory secondary effector
  • T-cell mediated immunity is an adaptive process of developing antigen (Ag)-specific T lymphocytes to eliminate viruses, bacterial, parasitic infections or malignant cells. It can also involve aberrant recognition of self-antigen, leading to autoimmune inflammatory diseases.
  • the Ag specificity of T lymphocytes is based on recognition through the T Cell Receptor (TCR) of unique antigenic peptides presented by Major Histocompatibility Complex (MHC) molecules on Ag-presenting cells (APC) (Broere, et al., Principles of Immunopharmacology, 2011).
  • TCR T Cell Receptor
  • MHC Major Histocompatibility Complex
  • APC Ag-presenting cells
  • the TCR occurs in two forms as either an ⁇ heterodimer or as a ⁇ heterodimer.
  • T cells express either the ⁇ form or the ⁇ 6 form TCR on the cell surface.
  • the four chains, ⁇ / ⁇ / ⁇ / ⁇ , all have a characteristic extracellular structure consisting of a highly polymorphic “immunoglobulin variable region”-like N-terminal domain and an “immunoglobulin constant region”-like second domain. Each of these domains has a characteristic intra-domain disulfide bridge.
  • the constant region is proximal to the cell membrane, followed by a connecting peptide, a transmembrane region and a short cytoplasmic tail.
  • the covalent linkage between the 2 chains of the heterodimeric TCR is formed by the cysteine residue located within the short connecting peptide sequence bridging the extracellular constant domain and the transmembrane region which forms a disulfide bond with the paired TCR chain cysteine residue at the corresponding position (The T cell Receptor Factsbook, 2001).
  • the ⁇ and ⁇ TCRs are associated with the non-polymorphic membrane-bound CD3 proteins to form the functional octameric TCR-CD3 complex, consisting of the TCR heterodimer and three dimeric signaling molecules, CD3 ⁇ / ⁇ , CD3 ⁇ / ⁇ and CD3 ⁇ / ⁇ or ⁇ / ⁇ . Ionizable residues in the transmembrane domain of each subunit form a polar network of interactions that hold the complex together.
  • the TCR N-terminal variable regions recognize the peptide/MHC complex presented on the surface of target cell, whereas the CD3 proteins participate in signal transduction (Call et al., Cell. 111(7):967-79, 2002; The T cell Receptor Factsbook, 2001).
  • ⁇ TCR also called conventional TCR, is expressed on most lymphocytes and consists of the glycosylated polymorphic ⁇ and ⁇ chains. Different ⁇ TCRs can discriminate among different peptides embedded in the surfaces of MHC II (mostly expressed on APC cell surfaces) and MHC I (expressed on all nucleated cells) molecules, whose dimensions and shapes are relatively constant.
  • the ⁇ TCR though structurally similar to the ⁇ TCR, recognizes carbohydrate-, nucleotide-, or phosphor-carrying antigens in a fashion independent of MHC presentation (The T cell Receptor Factsbook, 2001; Girardi et al., J. Invest. Dermatol. 126(1):25-31, 2006; Hayes et al., Immunity. 16(6): 827-38, 2002).
  • T cell therapy occupies a large space in the field of cell-based immunotherapy, with the goal of treating cancer by transferring autologous and ex vivo expanded T cells to patients, and has resulted in some notable antitumor responses (Blattman et al., Science. 305(5681):200-5, 2004).
  • TILs tumor infiltrating lymphocytes
  • TIL therapy A major limitation to the widespread application of TIL therapy is the difficulty in generating human T cells with antitumor potential.
  • exogenous high-affinity TCRs can be introduced into normal autologous T cells of the patients through T cell engineering.
  • the adoptive transfer of these cells into lympho-depleted patients has been shown to mediate cancer regression in cancers such as melanoma, colorectal carcinoma, and synovial sarcoma (Kunert R et al., Front. Immunol. 4:363, 2013).
  • TCR-engineered T cell therapy can target the entire array of potential intracellular tumor-specific proteins, which are processed and delivered to the cell surface through MHC presentation. Furthermore, the TCR is highly sensitive and can be activated by just a few antigenic peptide/MHC molecules, which in turn can trigger a cytolytic T cell response, including cytokine secretion, T cell proliferation and cytolysis of defined target cells. Therefore, compared with antibody or small molecule therapies, TCR-engineered T cells are particularly valuable for their ability to kill target cells with very few copies of target intracellular antigens (Kunert R et al., Front. Immunol. 4:363, 2013).
  • TCR-engineered T cell therapy unlike therapeutic antibodies, which are mostly discovered through hybridoma or display technologies, identification of target-specific TCRs requires the establishment of target peptide/MHC specific TCR clones from patient T cells and screening for the right ⁇ - ⁇ chain combination that has the optimal target antigen-binding affinity.
  • phage/yeast display is employed after cloning of the TCR from patient T cells to further enhance the target binding affinity of the TCR.
  • the whole process requires expertise in many areas and is time-consuming (Kobayashi E et al., Oncoimmunology. 3(1):e27258, 2014).
  • the difficulties in the TCR discovery process have largely impeded the widespread application of TCR-engineered T cell therapy.
  • CAR-T Chimeric Antigen Receptor T cell Therapy
  • the intracellular signaling domain contains an immunoreceptor tyrosine-based activation motif (ITAM), such as those from CD3 ⁇ or FcR ⁇ , and one or more costimulatory signaling domains, such as those from CD28, 4-1BB or OX40 (Barrett D M et al., Annu. Rev. Med. 65:333-47, 2014; Davila M L et al., Oncoimmunology. 1(9):1577-1583, 2012). Binding of target antigens by CARs grafted onto a T cell surface can trigger T cell effector functions independent of TCR-peptide/MHC complex interaction.
  • ITAM immunoreceptor tyrosine-based activation motif
  • T cells equipped with CARs can be redirected to attack a broad variety of cells, including those that do not match the MHC type of the TCRs on the T cells but express the target cell-surface antigens.
  • This approach overcomes the constraints of MHC-restricted TCR recognition and avoids tumor escape through impairments in antigen presentation or MHC molecule expression.
  • Clinical trials have shown clinically significant antitumor activity of CAR-T therapy in neuroblastoma (Louis C U et al., Blood. 118(23):6050-6056, 2011), B-ALL (Maude, S L, et al., New England Journal of Medicine 371:16:1507-1517, 2014), CLL (Brentjens, R J, et al.
  • the present application in one aspect provides immune cells (such as T cells) comprising a chimeric antibody-T cell receptor (TCR) construct (caTCR) and a secretory secondary effector (SSE) construct.
  • TCR chimeric antibody-T cell receptor
  • SSE secretory secondary effector
  • the caTCR comprises an antigen-binding module that specifically binds to a target antigen and a T cell receptor module (TCRM) capable of recruiting at least one TCR-associated signaling molecule, and the SSE is capable of enhancing an immune response mediated by the caTCR.
  • TCR chimeric antibody-T cell receptor
  • SSE secretory secondary effector
  • an immune cell comprising a chimeric antibody-T cell receptor (TCR) construct (caTCR) comprising: i) an antigen binding module that specifically binds to a target antigen; and ii) a T cell receptor module (TCRM) comprising a first TCR domain (TCRD) comprising a first TCR transmembrane domain (TCR-TM) and a second TCRD comprising a second TCR-TM, wherein the TCRM facilitates recruitment of at least one TCR-associated signaling molecule; and b) capable of secreting a secretory secondary effector (SSE) capable of enhancing an immune response mediated by the caTCR.
  • TCR chimeric antibody-T cell receptor
  • caTCR chimeric antibody-T cell receptor
  • nucleic acids encoding a caTCR and an SSE as described herein.
  • one or more nucleic acids encoding: a) a chimeric antibody-T cell receptor (TCR) construct (caTCR) comprising: i) an antigen binding module that specifically binds to a target antigen; and ii) a T cell receptor module (TCRM) comprising a first TCR domain (TCRD) comprising a first TCR transmembrane domain (TCR-TM) and a second TCRD comprising a second TCR-TM, wherein the TCRM facilitates recruitment of at least one TCR-associated signaling molecule; and b) a secretory secondary effector (SSE) capable of enhancing an immune response mediated by the caTCR.
  • TCR chimeric antibody-T cell receptor
  • caTCR chimeric antibody-T cell receptor
  • TCRM T cell receptor module
  • TCRD TCR domain
  • TCR-TM TCR transmembrane domain
  • SSE secretory secondary effector
  • one or more vectors comprising one or more nucleic acids as described herein.
  • composition comprising one or more nucleic acids or one or more vectors as described herein.
  • an immune cell comprising one or more nucleic acids or one or more vectors as described herein.
  • a pharmaceutical composition comprising an immune cell as described herein, and a pharmaceutically acceptable carrier.
  • a method of killing a target cell presenting a target antigen comprising contacting the target cell with an immune cell as described herein.
  • a method of treating a target antigen-associated disease in an individual in need thereof comprising administering to the individual an effective amount of a pharmaceutical composition as described herein.
  • a method of enhancing an immune response of an immune cell comprising a caTCR or transduced with a nucleic acid encoding a caTCR, comprising introducing into said cell one or more nucleic acids or one or more vectors as described herein.
  • FIG. 1 shows a schematic representation of several caTCR molecules having different antigen-binding modules.
  • FIG. 2 shows percent specific lysis from the killing of cancer cell lines HepG2 (AFP + /GPC3 + ) and HepG2-GPC3.ko (AFP + /GPC3 ⁇ ), mediated by T cells transduced with either anti-AFP158/HLA-A*2:01 caTCR alone or anti-AFP158/HLA-A*2:01 caTCR+anti-CD3/anti-GPC3 BsAb at the indicated percent caTCR positivity (5% to 40%).
  • FIG. 3 shows the concentration of cytokines (IL-2, IFN- ⁇ , and TNF- ⁇ ) found in the supernatant after in vitro killing of cancer cell lines HepG2 and HepG2-GPC3.ko, mediated by T cells transduced with either anti-AFP158/HLA-A*2:01 caTCR alone or anti-AFP158/HLA-A*2:01 caTCR+anti-CD3/anti-GPC3 BsAb at the indicated percent caTCR positivity (5% to 40%).
  • cytokines IL-2, IFN- ⁇ , and TNF- ⁇
  • FIG. 4 shows the potentiation of target-specific cancer cell line killing mediated by anti-CD3/anti-GPC3 BsAbs released from activated anti-AFP158/HLA-A*2:01 caTCR+anti-CD3/anti-GPC3 BsAb T cells.
  • the indicated transduced T cells and target cells were incubated together and separated from the indicated target cells and mock T cells by a membrane permeable to the BsAb, but not the T cells.
  • FIGS. 5A-5E show schematic structures of exemplary bispecific caTCR molecules.
  • the present application provides immune cells (such as T cells) comprising a chimeric antibody/T cell receptor construct (referred to herein as a “caTCR”) and a secretory secondary effector (SSE).
  • the caTCR comprises an antigen-binding module that specifically binds to a target antigen and a T cell receptor module (TCRM) capable of recruiting at least one TCR-associated signaling molecule.
  • TCRM T cell receptor module
  • the target antigen of the caTCR can be a protein expressed on the cell surface or a complex comprising a peptide and an MHC protein (referred to herein as a “pMHC complex,” or “pMHC”), such as an MHC-presented disease-associated antigen peptide on the surface of a diseased cell.
  • the SSE is capable of enhancing an immune response mediated by the caTCR, and includes, for example, bispecific immune cell (such as T cell or NK cell) engagers, antagonists of immunosuppressors, agonists of immunostimulators, soluble receptor ligand traps, and stimulatory cytokines.
  • the SSE can enhance an immune response, for example, by blocking an immunosuppressive signal or potentiating an immunostimulatory signal.
  • T cells comprising caTCR and SSE constructs. They exhibited potent cytotoxicity against target-bearing tumor cells, with increased cytokine expression in response to target cell engagement as compared to cells expressing only the caTCR in the absence of the SSE.
  • the present application thus provides immune cells (such as T cells) comprising a caTCR specific for a target antigen and an SSE, wherein the caTCR comprises an antigen-binding module that specifically binds to the target antigen and a T cell receptor module (TCRM) capable of recruiting at least one TCR-associated signaling molecule, and wherein the SSE is capable of enhancing an immune response mediated by the caTCR.
  • TCR T cell receptor module
  • the caTCR can take any of a number of formats with variations in the antigen-binding module and/or TCRM.
  • the caTCR can have an antigen-binding module comprising a moiety selected from the group consisting of a Fab, a Fab′, a (Fab′) 2 , an Fv, and an scFv, and a TCRM comprising one or more sequences derived from an ⁇ / ⁇ or ⁇ / ⁇ TCR, including variants in one or more of the transmembrane domain, connecting peptide, and intracellular domain. See FIG. 1 .
  • the antigen-binding module is multispecific (such as bispecific).
  • the SSE includes, without limitation, a bispecific immune cell (such as T cell or NK cell) engager, an antagonist of an immunosuppressor, an agonist of an immunostimulator, a soluble receptor ligand trap, or a stimulatory cytokine.
  • a bispecific immune cell such as T cell or NK cell
  • an antagonist of an immunosuppressor such as T cell or NK cell
  • an agonist of an immunostimulator such as T cell or NK cell
  • a soluble receptor ligand trap such as a stimulatory cytokine.
  • compositions comprising immune cells comprising i) a caTCR and an SSE, or ii) one or more nucleic acids encoding the caTCR and the SSE.
  • the compositions can be pharmaceutical compositions.
  • kits and articles of manufacture useful for such methods.
  • methods of treating a disease using immune cells comprising a caTCR and an SSE are also provided.
  • antibody or “antibody moiety” includes full-length antibodies and antigen-binding fragments thereof.
  • a full-length antibody comprises two heavy chains and two light chains.
  • the variable regions of the light and heavy chains are responsible for antigen-binding.
  • the variables region in both chains generally contain three highly variable loops called the complementarity determining regions (CDRs) (light chain (LC) CDRs including LC-CDR1, LC-CDR2, and LC-CDR3, heavy chain (HC) CDRs including HC-CDR1, HC-CDR2, and HC-CDR3).
  • CDRs complementarity determining regions
  • CDR boundaries for the antibodies and antigen-binding fragments disclosed herein may be defined or identified by the conventions of Kabat, Chothia, or Al-Lazikani (Al-Lazikani 1997; Chothia 1985; Chothia 1987; Chothia 1989; Kabat 1987; Kabat 1991).
  • the three CDRs of the heavy or light chains are interposed between flanking stretches known as framework regions (FRs), which are more highly conserved than the CDRs and form a scaffold to support the hypervariable loops.
  • FRs framework regions
  • the constant regions of the heavy and light chains are not involved in antigen-binding, but exhibit various effector functions.
  • Antibodies are assigned to classes based on the amino acid sequence of the constant region of their heavy chain.
  • the five major classes or isotypes of antibodies are IgA, IgD, IgE, IgG, and IgM, which are characterized by the presence of ⁇ , ⁇ , ⁇ , ⁇ , and ⁇ heavy chains, respectively.
  • IgG1 ⁇ 1 heavy chain
  • IgG2 ⁇ 2 heavy chain
  • IgG3 ⁇ 3 heavy chain
  • IgG4 ⁇ 4 heavy chain
  • IgA1 ⁇ 1 heavy chain
  • antigen-binding fragment refers to an antibody fragment including, for example, a diabody, a Fab, a Fab′, a F(ab′)2, an Fv fragment, a disulfide stabilized Fv fragment (dsFv), a (dsFv)2, a bispecific dsFv (dsFv-dsFv′), a disulfide stabilized diabody (ds diabody), a single-chain antibody molecule (scFv), an scFv dimer (bivalent diabody), a multispecific antibody formed from a portion of an antibody comprising one or more CDRs, a camelized single domain antibody, a nanobody, a domain antibody, a bivalent domain antibody, or any other antibody fragment that binds to an antigen but does not comprise a complete antibody structure.
  • an antigen-binding fragment is capable of binding to the same antigen to which the parent antibody or a parent antibody fragment (e.g., a parent scFv) binds.
  • an antigen-binding fragment may comprise one or more CDRs from a particular human antibody grafted to a framework region from one or more different human antibodies.
  • a first antibody moiety “competes” for binding to a target antigen with a second antibody moiety when the first antibody moiety inhibits target antigen-binding of the second antibody moiety by at least about 50% (such as at least about any of 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%) in the presence of an equimolar concentration of the first antibody moiety, or vice versa.
  • a high throughput process for “binning” antibodies based upon their cross-competition is described in PCT Publication No. WO 03/48731.
  • the term “specifically binds” or “is specific for” refers to measurable and reproducible interactions, such as binding between a target and an antibody or antibody moiety that is determinative of the presence of the target in the presence of a heterogeneous population of molecules, including biological molecules.
  • an antibody moiety that specifically binds to a target is an antibody moiety that binds the target with greater affinity, avidity, more readily, and/or with greater duration than its bindings to other targets.
  • an antibody moiety that specifically binds to an antigen reacts with one or more antigenic determinants of the antigen (for example a cell surface antigen or a peptide/MHC protein complex) with a binding affinity that is at least about 10 times its binding affinity for other targets.
  • one or more antigenic determinants of the antigen for example a cell surface antigen or a peptide/MHC protein complex
  • T cell receptor refers to a heterodimeric receptor composed of ⁇ or ⁇ chains that pair on the surface of a T cell.
  • Each ⁇ , ⁇ , ⁇ , and ⁇ chain is composed of two Ig-like domains: a variable domain (V) that confers antigen recognition through the complementarity determining regions (CDR), followed by a constant domain (C) that is anchored to cell membrane by a connecting peptide and a transmembrane (TM) region.
  • V variable domain
  • CDR complementarity determining regions
  • C constant domain
  • TM transmembrane
  • the TM region associates with the invariant subunits of the CD3 signaling apparatus.
  • Each of the V domains has three CDRs.
  • CDRs interact with a complex between an antigenic peptide bound to a protein encoded by the major histocompatibility complex (pMHC) (Davis and Bjorkman (1988) Nature, 334, 395-402; Davis et al. (1998) Annu Rev Immunol, 16, 523-544; Murphy (2012), xix, 868 p.).
  • pMHC major histocompatibility complex
  • TCR-associated signaling molecule refers to a molecule having a cytoplasmic immunoreceptor tyrosine-based activation motif (ITAM) that is part of the TCR-CD3 complex.
  • TCR-associated signaling molecules include CD3 ⁇ , CD3 ⁇ , and ⁇ (also known as CD3 ⁇ or CD3 ⁇ ).
  • Activation refers to the state of the cell that has been sufficiently stimulated to induce a detectable increase in downstream effector functions of the CD3 signaling pathway, including, without limitation, cellular proliferation and cytokine production.
  • module when referring to a portion of a protein is meant to include structurally and/or functionally related portions of one or more polypeptides which make up the protein.
  • a transmembrane module of a dimeric receptor may refer to the portions of each polypeptide chain of the receptor that span the membrane.
  • a module may also refer to related portions of a single polypeptide chain.
  • a transmembrane module of a monomeric receptor may refer to portions of the single polypeptide chain of the receptor that span the membrane.
  • a module may also include only a single portion of a polypeptide.
  • isolated construct refers to a construct that (1) is not associated with proteins found in nature, (2) is free of other proteins from the same source, (3) is expressed by a cell from a different species, or, (4) does not occur in nature.
  • isolated nucleic acid as used herein is intended to mean a nucleic acid of genomic, cDNA, or synthetic origin or some combination thereof, which by virtue of its origin the “isolated nucleic acid” (1) is not associated with all or a portion of a polynucleotide in which the “isolated nucleic acid” is found in nature, (2) is operably linked to a polynucleotide which it is not linked to in nature, or (3) does not occur in nature as part of a larger sequence.
  • CDR complementarity determining region
  • CDR complementarity determining region
  • chimeric antibodies refer to antibodies in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit a biological activity of this invention (see U.S. Pat. No. 4,816,567; and Morrison et al., Proc. Natl. Acad. Sci. USA, 81:6851-6855 (1984)).
  • synthetic in reference to an antibody or antibody moiety means that the antibody or antibody moiety has one or more naturally occurring sequences and one or more non-naturally occurring (i.e., synthetic) sequences.
  • “Humanized” forms of non-human (e.g., rodent) antibodies are chimeric antibodies that contain minimal sequence derived from the non-human antibody.
  • humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a hypervariable region (HVR) of the recipient are replaced by residues from a hypervariable region of a non-human species (donor antibody) such as mouse, rat, rabbit or non-human primate having the desired antibody specificity, affinity, and capability.
  • donor antibody such as mouse, rat, rabbit or non-human primate having the desired antibody specificity, affinity, and capability.
  • framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues.
  • humanized antibodies can comprise residues that are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance.
  • the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin and all or substantially all of the FRs are those of a human immunoglobulin sequence.
  • the humanized antibody optionally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
  • Fc immunoglobulin constant region
  • “Homology” refers to the sequence similarity or sequence identity between two polypeptides or between two nucleic acid molecules. When a position in both of the two compared sequences is occupied by the same base or amino acid monomer subunit, e.g., if a position in each of two DNA molecules is occupied by adenine, then the molecules are “homologous” at that position.
  • the “percent of homology” or “percent sequence identity” between two sequences is a function of the number of matching or homologous positions shared by the two sequences divided by the number of positions compared times 100, considering any conservative substitutions as part of the sequence identity.
  • the two sequences are 60% homologous.
  • the DNA sequences ATTGCC and TATGGC share 50% homology.
  • a comparison is made when two sequences are aligned to give maximum homology. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN, Megalign (DNASTAR), or MUSCLE software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full-length of the sequences being compared.
  • % amino acid sequence identity values are generated using the sequence comparison computer program MUSCLE (Edgar, R. C., Nucleic Acids Research 32(5):1792-1797, 2004; Edgar, R. C., BMC Bioinformatics 5(1):113, 2004).
  • C H 1 domain of a human IgG Fc region usually extends from about amino acid 118 to about amino acid 215 (EU numbering system).
  • nucleotide sequence encoding an amino acid sequence includes all nucleotide sequences that are degenerate versions of each other and that encode the same amino acid sequence.
  • the phrase nucleotide sequence that encodes a protein or an RNA may also include introns to the extent that the nucleotide sequence encoding the protein may in some version contain an intron(s).
  • operably linked refers to functional linkage between a regulatory sequence and a heterologous nucleic acid sequence resulting in expression of the latter.
  • a first nucleic acid sequence is operably linked with a second nucleic acid sequence when the first nucleic acid sequence is placed in a functional relationship with the second nucleic acid sequence.
  • a promoter is operably linked to a coding sequence if the promoter affects the transcription or expression of the coding sequence.
  • operably linked DNA sequences are contiguous and, where necessary to join two protein coding regions, in the same reading frame.
  • inducible promoter refers to a promoter whose activity can be regulated by adding or removing one or more specific signals.
  • an inducible promoter may activate transcription of an operably linked nucleic acid under a specific set of conditions, e.g., in the presence of an inducing agent or conditions that activates the promoter and/or relieves repression of the promoter.
  • treatment is an approach for obtaining beneficial or desired results, including clinical results.
  • beneficial or desired clinical results include, but are not limited to, one or more of the following: alleviating one or more symptoms resulting from the disease, diminishing the extent of the disease, stabilizing the disease (e.g., preventing or delaying the worsening of the disease), preventing or delaying the spread (e.g., metastasis) of the disease, preventing or delaying the recurrence of the disease, delay or slowing the progression of the disease, ameliorating the disease state, providing a remission (partial or total) of the disease, decreasing the dose of one or more other medications required to treat the disease, delaying the progression of the disease, increasing or improving the quality of life, increasing weight gain, and/or prolonging survival.
  • treatment is a reduction of pathological consequence of the disease (such as, for example, tumor volume in cancer).
  • the methods of the invention contemplate any one or more of these aspects of treatment
  • recurrence refers to the return of a cancer or disease after clinical assessment of the disappearance of disease. A diagnosis of distant metastasis or local recurrence can be considered a relapse.
  • refractory or “resistant” refers to a cancer or disease that has not responded to treatment.
  • an “effective amount” of a caTCR or composition comprising a caTCR as disclosed herein is an amount sufficient to carry out a specifically stated purpose.
  • An “effective amount” can be determined empirically and by known methods relating to the stated purpose.
  • therapeutically effective amount refers to an amount of a caTCR or composition comprising a caTCR as disclosed herein, effective to “treat” a disease or disorder in an individual.
  • the therapeutically effective amount of a caTCR or composition comprising a caTCR as disclosed herein can reduce the number of cancer cells; reduce the tumor size or weight; inhibit (i.e., slow to some extent and preferably stop) cancer cell infiltration into peripheral organs; inhibit (i.e., slow to some extent and preferably stop) tumor metastasis; inhibit, to some extent, tumor growth; and/or relieve to some extent one or more of the symptoms associated with the cancer.
  • a caTCR or composition comprising a caTCR as disclosed herein can prevent growth and/or kill existing cancer cells, it can be cytostatic and/or cytotoxic.
  • the therapeutically effective amount is a growth inhibitory amount. In some embodiments, the therapeutically effective amount is an amount that improves progression free survival of a patient.
  • the therapeutically effective amount of a caTCR or composition comprising a caTCR as disclosed herein can reduce the number of cells infected by the pathogen; reduce the production or release of pathogen-derived antigens; inhibit (i.e., slow to some extent and preferably stop) spread of the pathogen to uninfected cells; and/or relieve to some extent one or more symptoms associated with the infection.
  • the therapeutically effective amount is an amount that extends the survival of a patient.
  • pharmaceutically acceptable or “pharmacologically compatible” is meant a material that is not biologically or otherwise undesirable, e.g., the material may be incorporated into a pharmaceutical composition administered to a patient without causing any significant undesirable biological effects or interacting in a deleterious manner with any of the other components of the composition in which it is contained.
  • Pharmaceutically acceptable carriers or excipients have preferably met the required standards of toxicological and manufacturing testing and/or are included on the Inactive Ingredient Guide prepared by the U.S. Food and Drug administration.
  • references to “about” a value or parameter herein includes (and describes) variations that are directed to that value or parameter per se. For example, description referring to “about X” includes description of “X”.
  • reference to “not” a value or parameter generally means and describes “other than” a value or parameter.
  • the method is not used to treat cancer of type X means the method is used to treat cancer of types other than X.
  • the present invention provides an immune cell (such as a T cell) presenting on its surface a caTCR and capable of secreting an SSE according to any of the caTCRs and SSEs described herein (such an immune cell is also referred to herein as a “caTCR plus SSE immune cell”).
  • the immune cell comprises nucleic acid encoding the caTCR and SSE, wherein the caTCR is expressed from the nucleic acid and localized to the immune cell surface, and wherein the SSE is expressed or capable of being expressed from the nucleic acid.
  • the immune cell is a T cell.
  • the immune cell is selected from the group consisting of a cytotoxic T cell, a helper T cell, a natural killer T cell, and a suppressor T cell. In some embodiments, the immune cell does not express the TCR subunits from which the TCR-TMs of the caTCR are derived.
  • the immune cell is an ⁇ T cell and the TCR-TMs of the introduced caTCR comprise sequences derived from TCR ⁇ and ⁇ chains, or the T cell is a ⁇ T cell and the TCR-TMs of the introduced caTCR comprise sequences derived from TCR ⁇ and ⁇ chains.
  • the immune cell is modified to block or decrease the expression of one or both of the endogenous TCR subunits of the immune cell.
  • the immune cell is an ⁇ T cell modified to block or decrease the expression of the TCR ⁇ and/or ⁇ chains or the immune cell is a ⁇ T cell modified to block or decrease the expression of the TCR ⁇ and/or ⁇ chains.
  • Modifications of cells to disrupt gene expression include any such techniques known in the art, including for example RNA interference (e.g., siRNA, shRNA, miRNA), gene editing (e.g., CRISPR- or TALEN-based gene knockout), and the like.
  • an immune cell (such as a T cell) comprising nucleic acid encoding a caTCR according to any of the caTCRs described herein and an SSE according to any of the SSEs described herein, wherein the caTCR is expressed from the nucleic acid and localized to the immune cell surface, and wherein the SSE is expressed or capable of being expressed from the nucleic acid.
  • the nucleic acid comprises one or more caTCR nucleic acid sequences encoding the caTCR, and one or more SSE nucleic acid sequences encoding the SSE.
  • some or all of the caTCR and SSE nucleic acid sequences are each contained in different vectors.
  • some or all of the caTCR and SSE nucleic acid sequences are contained in the same vector.
  • Vectors may be selected, for example, from the group consisting of mammalian expression vectors and viral vectors (such as those derived from retroviruses, adenoviruses, adeno-associated viruses, herpes viruses, and lentiviruses).
  • one or more of the vectors is integrated into the host genome of the immune cell.
  • some or all of the caTCR and SSE nucleic acid sequences are under the control of different promoters.
  • some or all of the promoters have the same sequence. In some embodiments, some or all of the promoters have different sequences.
  • some or all of the caTCR and SSE nucleic acid sequences are under the control of a single promoter. In some embodiments, some or all of the promoters are inducible. In some embodiments, the nucleic acid sequences encoding the caTCR are under the control of one or more constitutive promoters. In some embodiments, the nucleic acid sequences encoding the SSE are under the control of one or more inducible promoters. In some embodiments, the inducible promoters are inducible upon activation of the immune cell. In some embodiments, the inducible promoters comprise an NFAT response element. In some embodiments, the immune cell is selected from the group consisting of a cytotoxic T cell, a helper T cell, a natural killer T cell, and a suppressor T cell.
  • an immune cell (such as a T cell) comprising nucleic acid encoding a) a caTCR comprising an antibody moiety that specifically binds to a target antigen and a T cell receptor module (TCRM) comprising a first TCR domain (TCRD) comprising a first TCR transmembrane domain (TCR-TM) and a second TCRD comprising a second TCR-TM, wherein the TCRM facilitates recruitment of at least one TCR-associated signaling molecule, and wherein the antibody moiety is linked to the first and/or second TCRDs; and b) an SSE capable of enhancing an immune response mediated by the caTCR, wherein the nucleic acid comprises one or more caTCR nucleic acid sequences encoding the caTCR and one or more SSE nucleic acid sequences encoding the SSE.
  • TCRM T cell receptor module
  • the one or more caTCR nucleic acid sequences and the one or more SSE nucleic acid sequences are each contained in separate vectors (such as viral vectors, e.g., lentiviral vectors). In some embodiments, some or all of the one or more caTCR nucleic acid sequences and the one or more SSE nucleic acid sequences are contained in the same vector (such as a viral vector). In some embodiments, each of the one or more caTCR nucleic acid sequences and the one or more SSE nucleic acid sequences are, individually, operably linked to a promoter.
  • some or all of the one or more caTCR nucleic acid sequences and the one or more SSE nucleic acid sequences are under the control of a single promoter.
  • the caTCR is a dimer and the one or more caTCR nucleic acids comprise a first caTCR nucleic acid sequence encoding a first caTCR polypeptide chain and a second caTCR nucleic acid sequence encoding a second caTCR polypeptide
  • the SSE is a monomer and the one or more SSE nucleic acids comprise an SSE nucleic acid sequence encoding the SSE, and the first and second caTCR nucleic acids sequences are under the control of a first promoter, and the SSE nucleic acid sequence is under the control of a second promoter.
  • some or all of the promoters have the same sequence. In some embodiments, some or all of the promoters have different sequences. In some embodiments, some or all of the promoters are inducible. In some embodiments, the SSE nucleic acid sequence is operably linked to an inducible promoter. In some embodiments, the inducible promoter comprises one or more elements responsive to immune cell activation. In some embodiments, the inducible promoter is an NFAT-derived promoter. In some embodiments, the NFAT-derived promoter comprises the nucleotide sequence of SEQ ID NO: 74. In some embodiments, some or all of the vectors are viral vectors (such as lentiviral vectors).
  • the antibody moiety of the caTCR is selected from the group consisting of a Fab, a Fab′, a (Fab′)2, an Fv, and a single chain Fv (scFv).
  • the antigen-binding module is multispecific (such as bispecific).
  • the antibody moiety specifically binds a cell surface antigen including, without limitation, CD19, CD20, CD22, CD47, GPC-3, ROR1, ROR2, BCMA, GPRC5D, and FCRL5, including variants or mutants thereof.
  • the antibody moiety specifically binds a peptide/MHC complex, wherein the peptide is derived from a protein including, without limitation, WT-1, AFP, HPV16-E7, NY-ESO-1, PRAME, EBV-LMP2A, HIV-1, KRAS, Histone H3.3, and PSA, including variants or mutants thereof.
  • the SSE is a multispecific antibody (such as a bispecific antibody, e.g., a tandem scFv) targeting an immune cell (such as a T cell or NK cell) and a disease cell (such as a cancer cell).
  • the SSE comprises a first antibody moiety (e.g., a first scFv) targeting CD3 or CD16a, and a second antibody moiety (e.g., a second scFv) targeting GPC3, CD47, MUC16, CD19, CD20, CD22, EpCAM, EGFR, HER2, CEA, PSMA, AFP, PSA, BCMA, FCRL5, NY-ESO, HPV16, or FoxP3, including variants or mutants thereof.
  • a first antibody moiety e.g., a first scFv
  • a second antibody moiety e.g., a second scFv
  • the SSE is a multispecific antibody selected from the group consisting of a tandem scFv, a diabody (Db), a single chain diabody (scDb), a dual-affinity retargeting (DART) antibody, and a dual variable domain (DVD) antibody.
  • the SSE is a tandem scFv comprising a first scFv targeting the immune cell and a second scFv targeting the disease cell.
  • the SSE is an antibody moiety targeting an immune checkpoint molecule.
  • the SSE is an antagonistic antibody moiety targeting PD-1.
  • the SSE is an antagonistic antibody moiety targeting CD47.
  • the SSE is a soluble molecule that specifically binds a ligand of an immunosuppressive receptor. In some embodiments, the SSE is a soluble molecule that specifically binds to and antagonizes an immunosuppressive receptor. In some embodiments, the SSE is a growth factor or stimulatory cytokine.
  • an immune cell comprising nucleic acid encoding a) a dimeric caTCR comprising an antibody moiety that specifically binds to a target antigen and a TCRM capable of recruiting at least one TCR-associated signaling molecule, the dimeric caTCR comprising a first caTCR polypeptide chain comprising a first TCRD comprising a first TCR-TM and a second caTCR polypeptide chain comprising a second TCRD comprising a second TCR-TM, wherein the first and second TCRDs together form the TCRM, and wherein the antibody moiety is linked to one or both of the first and second TCRDs, the nucleic acid comprising a first caTCR nucleic acid sequence encoding the first caTCR polypeptide chain, and a second caTCR nucleic acid sequence encoding the second caTCR polypeptide chain; and b) a monomeric SSE capable of enhancing an immune response mediated by the caTCR, the nucleic acid comprising a
  • the first caTCR nucleic acid sequence is contained in a first vector (such as a viral vector, e.g., a lentiviral vector)
  • the second caTCR nucleic acid sequence is contained in a second vector (such as a viral vector, e.g., a lentiviral vector)
  • the SSE nucleic acid sequence is contained in a third vector (such as a viral vector, e.g., a lentiviral vector).
  • some or all of the first and second caTCR nucleic acid sequences and SSE nucleic acid sequence are contained in the same vector (such as a viral vector, e.g., a lentiviral vector).
  • each of the first and second caTCR nucleic acid sequences and SSE nucleic acid sequence are, individually, operably linked to a promoter.
  • some or all of the first and second caTCR nucleic acid sequences and SSE nucleic acid sequence are under the control of a single promoter.
  • the first and second caTCR nucleic acid sequences are under the control of a first promoter
  • the SSE nucleic acid sequence is under the control of a second promoter.
  • some or all of the promoters have the same sequence.
  • some or all of the promoters have different sequences.
  • some or all of the promoters are inducible.
  • the SSE nucleic acid sequence is operably linked to an inducible promoter.
  • the inducible promoter comprises one or more elements responsive to immune cell activation.
  • the inducible promoter is an NFAT-derived promoter.
  • the NFAT-derived promoter comprises the nucleotide sequence of SEQ ID NO: 74.
  • some or all of the vectors are viral vectors (such as lentiviral vectors).
  • a caTCR plus SSE immune cell (such as a T cell) expressing on its surface a dimeric caTCR according to any of the caTCRs described herein and expressing or capable of expressing a monomeric SSE according to any of the SSEs described herein, wherein the caTCR plus SSE immune cell comprises a) a first caTCR nucleic acid sequence encoding a first caTCR polypeptide chain of the caTCR; b) a second caTCR nucleic acid sequence encoding a second caTCR polypeptide chain of the caTCR; and c) an SSE nucleic acid sequence encoding an SSE polypeptide chain of the SSE, wherein the first and second caTCR polypeptide chains are expressed from the first and second caTCR nucleic acid sequences to form the caTCR, wherein the SSE polypeptide chain is expressed or capable of being expressed from the SSE nucleic acid to form the SSE, and wherein the caTCR local
  • the first caTCR nucleic acid sequence is contained in a first vector (such as a viral vector, e.g., a lentiviral vector)
  • the second caTCR nucleic acid sequence is contained in a second vector (such as a viral vector, e.g., a lentiviral vector)
  • the SSE nucleic acid sequence is contained in a third vector (such as a viral vector, e.g., a lentiviral vector).
  • some or all of the first and second caTCR nucleic acid sequences and SSE nucleic acid sequence are contained in the same vector (such as a viral vector, e.g., a lentiviral vector).
  • each of the first and second caTCR nucleic acid sequences and SSE nucleic acid sequence are, individually, operably linked to a promoter. In some embodiments, some or all of the nucleic acid sequences are under the control of a single promoter. In some embodiments, some or all of the promoters have the same sequence. In some embodiments, some or all of the promoters have different sequences. In some embodiments, some or all of the promoters are inducible. In some embodiments, the nucleic acid sequences encoding the caTCR are under the control of one or more constitutive promoters. In some embodiments, the nucleic acid sequence encoding the SSE is under the control of an inducible promoter.
  • the inducible promoter is inducible upon activation of the immune cell.
  • the inducible promoter is an NFAT-derived promoter.
  • some or all of the vectors are viral vectors (such as lentiviral vectors).
  • the immune cell does not express the TCR subunits from which the TCR-TMs of the caTCR are derived.
  • the immune cell is an ⁇ T cell and the TCR-TMs of the introduced caTCR comprise sequences derived from TCR ⁇ and ⁇ chains, or the immune cell is a ⁇ T cell and the TCR-TMs of the introduced caTCR comprise sequences derived from TCR ⁇ and ⁇ chains.
  • the immune cell is modified to block or decrease the expression of one or both of its endogenous TCR subunits.
  • the immune cell is an ⁇ T cell modified to block or decrease the expression of the TCR ⁇ and/or ⁇ chains, or the immune cell is a ⁇ T cell modified to block or decrease the expression of the TCR ⁇ and/or ⁇ chains.
  • the immune cell is selected from the group consisting of a cytotoxic T cell, a helper T cell, a natural killer T cell, and a suppressor T cell.
  • some or all of the vectors are viral vectors (such as lentiviral vectors) integrated into the host genome of the immune cell.
  • a caTCR plus SSE immune cell (such as a T cell) expressing on its surface a dimeric caTCR according to any of the caTCRs described herein and expressing or capable of expressing a monomeric SSE according to any of the SSEs described herein, wherein the caTCR plus SSE immune cell comprises a) a first vector comprising a first promoter operably linked to a first caTCR nucleic acid sequence encoding a first caTCR polypeptide chain of the caTCR; b) a second vector comprising a second promoter operably linked to a second caTCR nucleic acid sequence encoding a second caTCR polypeptide chain of the caTCR; and c) a third vector comprising a third promoter operably linked to an SSE nucleic acid sequence encoding an SSE polypeptide chain of the SSE, wherein the first and second caTCR polypeptide chains are expressed from the first and second caTCR nucleic acid sequences
  • some or all of the promoters have the same sequence. In some embodiments, some or all of the promoters have different sequences. In some embodiments, some or all of the promoters are inducible. In some embodiments, the nucleic acid sequences encoding the caTCR are under the control of one or more constitutive promoters. In some embodiments, the nucleic acid sequence encoding the SSE is under the control of an inducible promoter. In some embodiments, the inducible promoter is inducible upon activation of the immune cell. In some embodiments, the immune cell does not express the TCR subunits from which the TCR-TMs of the caTCR are derived.
  • the immune cell is an ⁇ T cell and the TCR-TMs of the introduced caTCR comprise sequences derived from TCR ⁇ and ⁇ chains, or the immune cell is a ⁇ T cell and the TCR-TMs of the introduced caTCR comprise sequences derived from TCR ⁇ and ⁇ chains.
  • the immune cell is modified to block or decrease the expression of one or both of its endogenous TCR subunits.
  • the immune cell is an ⁇ T cell modified to block or decrease the expression of the TCR ⁇ and/or ⁇ chains, or the immune cell is a ⁇ T cell modified to block or decrease the expression of the TCR ⁇ and/or ⁇ chains.
  • the immune cell is selected from the group consisting of a cytotoxic T cell, a helper T cell, a natural killer T cell, and a suppressor T cell.
  • the first and second vectors are viral vectors (such as lentiviral vectors) integrated into the host genome of the immune cell.
  • a caTCR plus SSE immune cell (such as a T cell) expressing on its surface a dimeric caTCR according to any of the caTCRs described herein and expressing or capable of expressing a monomeric SSE according to any of the SSEs described herein, wherein the caTCR plus SSE immune cell comprises a) a first vector comprising i) a first promoter operably linked to a first caTCR nucleic acid sequence encoding a first caTCR polypeptide chain of the caTCR and ii) a second promoter operably linked to a second caTCR nucleic acid sequence encoding a second caTCR polypeptide chain of the caTCR; and b) a second vector comprising a third promoter operably linked to an SSE nucleic acid sequence encoding an SSE polypeptide chain of the SSE, wherein the first and second caTCR polypeptide chains are expressed from the first and second caTCR nucleic acid sequences to form
  • some or all of the promoters have the same sequence. In some embodiments, some or all of the promoters have different sequences. In some embodiments, some or all of the promoters are inducible. In some embodiments, the nucleic acid sequences encoding the caTCR are under the control of one or more constitutive promoters. In some embodiments, the nucleic acid sequence encoding the SSE is under the control of an inducible promoter. In some embodiments, the inducible promoter is inducible upon activation of the immune cell. In some embodiments, the immune cell does not express the TCR subunits from which the TCR-TMs of the caTCR are derived.
  • the immune cell is an ⁇ T cell and the TCR-TMs of the introduced caTCR comprise sequences derived from TCR ⁇ and ⁇ chains, or the immune cell is a ⁇ T cell and the TCR-TMs of the introduced caTCR comprise sequences derived from TCR ⁇ and ⁇ chains.
  • the immune cell is modified to block or decrease the expression of one or both of its endogenous TCR subunits.
  • the immune cell is an ⁇ T cell modified to block or decrease the expression of the TCR ⁇ and/or ⁇ chains, or the immune cell is a ⁇ T cell modified to block or decrease the expression of the TCR ⁇ and/or ⁇ chains.
  • the immune cell is selected from the group consisting of a cytotoxic T cell, a helper T cell, a natural killer T cell, and a suppressor T cell.
  • the first and second vectors are viral vectors (such as lentiviral vectors) integrated into the host genome of the immune cell. It is to be appreciated that embodiments where any of the nucleic acid sequences are swapped are also contemplated, such as where the first or second caTCR nucleic acid sequence is swapped with the SSE nucleic acid sequence.
  • a caTCR plus SSE immune cell (such as a T cell) expressing on its surface a dimeric caTCR according to any of the caTCRs described herein and expressing or capable of expressing a monomeric SSE according to any of the SSEs described herein, wherein the caTCR plus SSE immune cell comprises a) a first vector comprising i) a first caTCR nucleic acid sequence encoding a first caTCR polypeptide chain of the caTCR and ii) a second caTCR nucleic acid sequence encoding a second caTCR polypeptide chain of the caTCR, wherein the first and second caTCR nucleic acid sequences are under the control of a first promoter; and b) a second vector comprising a second promoter operably linked to an SSE nucleic acid sequence encoding an SSE polypeptide chain of the SSE, wherein the first and second caTCR polypeptide chains are expressed from the first and second caTCR
  • the first promoter is operably linked to the 5′ end of the first caTCR nucleic acid sequence, and there is nucleic acid linker selected from the group consisting of an internal ribosomal entry site (IRES) and a nucleic acid encoding a self-cleaving 2A peptide (such as P2A, T2A, E2A, or F2A) linking the 3′ end of first caTCR nucleic acid sequence to the 5′ end of the second caTCR nucleic acid sequence, wherein the first caTCR nucleic acid sequence and the second caTCR nucleic acid sequence are transcribed as a single RNA under the control of the promoter.
  • IRS internal ribosomal entry site
  • the first promoter is operably linked to the 5′ end of the second caTCR nucleic acid sequence, and there is nucleic acid linker selected from the group consisting of an internal ribosomal entry site (IRES) and a nucleic acid encoding a self-cleaving 2A peptide (such as P2A, T2A, E2A, or F2A) linking the 3′ end of second caTCR nucleic acid sequence to the 5′ end of the first caTCR nucleic acid sequence, wherein the first caTCR nucleic acid sequence and the second caTCR nucleic acid sequence are transcribed as a single RNA under the control of the promoter.
  • IRS internal ribosomal entry site
  • the first and/or second promoters have the same sequence. In some embodiments, the first and/or second promoters have different sequences. In some embodiments, the first and/or second promoters are inducible. In some embodiments, the nucleic acid sequences encoding the caTCR are under the control of a constitutive promoter. In some embodiments, the nucleic acid sequence encoding the SSE is under the control of an inducible promoter. In some embodiments, the inducible promoter is inducible upon activation of the immune cell. In some embodiments, the immune cell does not express the TCR subunits from which the TCR-TMs of the caTCR are derived.
  • the immune cell is an ⁇ T cell and the TCR-TMs of the introduced caTCR comprise sequences derived from TCR ⁇ and ⁇ chains, or the immune cell is a ⁇ T cell and the TCR-TMs of the introduced caTCR comprise sequences derived from TCR ⁇ and ⁇ chains.
  • the immune cell is modified to block or decrease the expression of one or both of its endogenous TCR subunits.
  • the immune cell is an ⁇ T cell modified to block or decrease the expression of the TCR ⁇ and/or ⁇ chains, or the immune cell is a ⁇ T cell modified to block or decrease the expression of the TCR ⁇ and/or ⁇ chains.
  • the immune cell is selected from the group consisting of a cytotoxic T cell, a helper T cell, a natural killer T cell, and a suppressor T cell.
  • the vector is a viral vector (such as a lentiviral vector) integrated into the host genome of the immune cell. It is to be appreciated that embodiments where any of the nucleic acid sequences are swapped are also contemplated, such as where the first or second caTCR nucleic acid sequence is swapped with the SSE nucleic acid sequence.
  • a caTCR plus SSE immune cell (such as a T cell) expressing on its surface a dimeric caTCR according to any of the caTCRs described herein and expressing or capable of expressing a monomeric SSE according to any of the SSEs described herein, wherein the caTCR plus SSE immune cell comprises a vector comprising a) a first caTCR nucleic acid sequence encoding a first caTCR polypeptide chain of the caTCR; b) a second caTCR nucleic acid sequence encoding a second caTCR polypeptide chain of the caTCR; and c) an SSE nucleic acid sequence encoding an SSE polypeptide chain of the SSE, wherein the first and second caTCR nucleic acid sequences and the SSE nucleic acid sequence are under the control of a single promoter; wherein the first and second caTCR polypeptide chains are expressed from the first and second caTCR nucleic acid sequences to form the caT
  • the promoter is operably linked to one of the nucleic acid sequences, which is linked to the other nucleic acid sequences by nucleic acid linkers selected, individually, from the group consisting of an internal ribosomal entry site (IBES) and a nucleic acid encoding a self-cleaving 2A peptide (such as P2A, T2A, E2A, or F2A), such that the first and second caTCR nucleic acid sequences and the SSE nucleic acid sequence are transcribed as a single RNA under the control of the promoter.
  • the promoter is inducible. In some embodiments, the inducible promoter is inducible upon activation of the immune cell.
  • the immune cell does not express the TCR subunits from which the TCR-TMs of the caTCR are derived.
  • the immune cell is an ⁇ T cell and the TCR-TMs of the introduced caTCR comprise sequences derived from TCR ⁇ and ⁇ chains, or the immune cell is a ⁇ T cell and the TCR-TMs of the introduced caTCR comprise sequences derived from TCR ⁇ and ⁇ chains.
  • the immune cell is modified to block or decrease the expression of one or both of its endogenous TCR subunits.
  • the immune cell is an ⁇ T cell modified to block or decrease the expression of the TCR ⁇ and/or ⁇ chains, or the immune cell is a ⁇ T cell modified to block or decrease the expression of the TCR ⁇ and/or ⁇ chains.
  • the immune cell is selected from the group consisting of a cytotoxic T cell, a helper T cell, a natural killer T cell, and a suppressor T cell.
  • the vector is a viral vector (such as a lentiviral vector) integrated into the host genome of the immune cell.
  • a caTCR plus SSE immune cell (such as a T cell) expressing on its surface a dimeric caTCR according to any of the caTCRs described herein and expressing or capable of expressing a monomeric SSE according to any of the SSEs described herein, wherein the caTCR plus SSE immune cell comprises a vector comprising a) a first caTCR nucleic acid sequence encoding a first caTCR polypeptide chain of the caTCR and a second caTCR nucleic acid sequence encoding a second caTCR polypeptide chain of the caTCR, wherein the first and second caTCR nucleic acid sequences are under the control of a constitutive promoter; and b) an SSE nucleic acid sequence encoding an SSE polypeptide chain of the SSE operably linked to an inducible promoter, wherein the first and second caTCR polypeptide chains are expressed from the first and second caTCR nucleic acid sequences to form the caTCR
  • the constitutive promoter is operably linked to one of the caTCR nucleic acid sequences, which is linked to the other caTCR nucleic acid sequence by a nucleic acid linker selected from the group consisting of an internal ribosomal entry site (IRES) and a nucleic acid encoding a self-cleaving 2A peptide (such as P2A, T2A, E2A, or F2A), such that the first and second caTCR nucleic acid sequences are transcribed as a single RNA under the control of the constitutive promoter.
  • the constitutive promoter is an EF1-alpha promoter, or variant thereof.
  • the EF1-alpha promoter comprises, consists essentially of, or consists of the nucleotide sequence of SEQ ID NO: 75.
  • the inducible promoter is inducible upon activation of the immune cell.
  • the inducible promoter is an NFAT-derived promoter.
  • the NFAT-derived promoter comprises, consists essentially of, or consists of the nucleotide sequence of SEQ ID NO: 74.
  • the immune cell does not express the TCR subunits from which the TCR-TMs of the caTCR are derived.
  • the immune cell is an ⁇ T cell and the TCR-TMs of the introduced caTCR comprise sequences derived from TCR ⁇ and ⁇ chains, or the immune cell is a ⁇ T cell and the TCR-TMs of the introduced caTCR comprise sequences derived from TCR ⁇ and ⁇ chains.
  • the immune cell is modified to block or decrease the expression of one or both of its endogenous TCR subunits.
  • the immune cell is an ⁇ T cell modified to block or decrease the expression of the TCR ⁇ and/or ⁇ chains, or the immune cell is a ⁇ T cell modified to block or decrease the expression of the TCR ⁇ and/or ⁇ chains.
  • the immune cell is selected from the group consisting of a cytotoxic T cell, a helper T cell, a natural killer T cell, and a suppressor T cell.
  • the vector is a viral vector (such as a lentiviral vector) integrated into the host genome of the immune cell.
  • the target antigen-specific chimeric antibody/T cell receptor (caTCR) described herein specifically binds to a target antigen (such as a cell surface antigen or a peptide/MHC complex) and is capable of recruiting at least one TCR-associated signaling molecule (such as CD3 ⁇ , CD3 ⁇ , and/or ⁇ ).
  • a target antigen such as a cell surface antigen or a peptide/MHC complex
  • the caTCR comprises naturally occurring TCR domains.
  • the caTCR comprises at least one non-naturally occurring TCR domain.
  • the caTCR comprises an antigen-binding module that provides the antigen specificity and a T cell receptor module (TCRM) that allows for CD3 recruitment and signaling.
  • the antigen-binding module is not a naturally occurring T cell receptor antigen-binding moiety.
  • the antigen-binding module is linked to the amino terminus of a polypeptide chain in the TCRM.
  • the antigen-binding module is an antibody moiety.
  • the antibody moiety is a Fab, a Fab′, a (Fab′)2, an Fv, or a single chain Fv (scFv).
  • the antibody moiety is monospecific. In some embodiments, the antibody moiety is multi-specific.
  • the TCRM comprises a transmembrane module derived from the transmembrane domains of one or more TCRs (TCR-TMs), such as an ⁇ and/or ⁇ TCR, and optionally further comprises one or both of the connecting peptides or fragments thereof of a TCR and/or one or more TCR intracellular domains or fragments thereof.
  • TCR-TMs TCR-TMs
  • the TCRM comprises two polypeptide chains, each polypeptide chain comprising, from amino terminus to carboxy terminus, a connecting peptide, a transmembrane domain, and optionally a TCR intracellular domain.
  • the TCRM comprises one or more non-naturally occurring TCR domains.
  • the TCRM comprises one or two non-naturally occurring TCR transmembrane domains.
  • a non-naturally occurring TCR domain may be a corresponding domain of a naturally occurring TCR modified by substitution of one or more amino acids, and/or by replacement of a portion of the corresponding domain with a portion of an analogous domain from another TCR.
  • the caTCR may comprise a first polypeptide chain and a second polypeptide chain, wherein the first and second polypeptide chains together form the antigen-binding module and the TCRM.
  • the first and second polypeptide chains are separate polypeptide chains, and the caTCR is a multimer, such as a dimer.
  • the first and second polypeptide chains are covalently linked, such as by a peptide linkage, or by another chemical linkage, such as a disulfide linkage. In some embodiments, the first polypeptide chain and the second polypeptide chain are linked by at least one disulfide bond. In some embodiments, the caTCR further comprises one or more T cell co-stimulatory signaling sequences.
  • the one or more co-stimulatory signaling sequences can be, individually, all or a portion of the intracellular domain of a co-stimulatory molecule including, for example, CD27, CD28, 4-1BB (CD137), OX40, CD30, CD40, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, a ligand that specifically binds with CD83, and the like.
  • the one or more co-stimulatory signaling sequences are between the first TCR-TM and the first TCR intracellular domain and/or between the second TCR-TM and the second TCR intracellular domain.
  • the one or more co-stimulatory signaling sequences are carboxy-terminal to the first TCRD and/or the second TCRD.
  • the caTCR lacks a T cell co-stimulatory signaling sequence.
  • the caTCR further comprises a stabilization module comprising a first stabilization domain and a second stabilization domain, wherein the first and second stabilization domains have a binding affinity for each other that stabilizes the caTCR.
  • the stabilization module is located between the antigen-binding module and the TCRM.
  • the caTCR further comprises a spacer module between any two caTCR modules or domains. In some embodiments, the spacer module comprises one or more peptide linkers connecting two caTCR modules or domains.
  • the caTCRs described herein may have one or more features described in this section. It is intended that any of the features for each component of the caTCR (e.g., antigen-binding module, TCRD, TCR-TM, spacer module, stabilization module, T cell co-stimulation sequences, and various linkers etc.) described herein can be combined with each other, with any of the features of the SSE, and with any of the features of the CSR as if each and every combination is individually described.
  • any of the features for each component of the caTCR e.g., antigen-binding module, TCRD, TCR-TM, spacer module, stabilization module, T cell co-stimulation sequences, and various linkers etc.
  • the antigen-binding module (such as an antibody moiety) specifically binds to a target antigen with a) an affinity that is at least about 10 (including for example at least about any of 10, 20, 30, 40, 50, 75, 100, 200, 300, 400, 500, 750, 1000 or more) times its binding affinity for other molecules; or b) a K d no more than about 1/10 (such as no more than about any of 1/10, 1/20, 1/30, 1/40, 1/50, 1/75, 1/100, 1/200, 1/300, 1/400, 1/500, 1/750, 1/1000 or less) times its K d for binding to other molecules.
  • an affinity that is at least about 10 (including for example at least about any of 10, 20, 30, 40, 50, 75, 100, 200, 300, 400, 500, 750, 1000 or more) times its binding affinity for other molecules
  • a K d no more than about 1/10 such as no more than about any of 1/10, 1/20, 1/30, 1/40, 1/50, 1/75
  • Binding affinity can be determined by methods known in the art, such as ELISA, fluorescence activated cell sorting (FACS) analysis, or radioimmunoprecipitation assay (RIA).
  • K d can be determined by methods known in the art, such as surface plasmon resonance (SPR) assay utilizing, for example, Biacore instruments, or kinetic exclusion assay (KinExA) utilizing, for example, Sapidyne instruments.
  • SPR surface plasmon resonance
  • KinExA kinetic exclusion assay
  • stabilization domains include an Fc region; a hinge region; a C H 3 domain; a C H 4 domain; a C H 1 or C L domain; a leucine zipper domain (e.g., a jun/fos leucine zipper domain, see, e.g., Kostelney et al, J.
  • a yeast GCN4 leucine zipper domain an isoleucine zipper domain; a dimerizing region of a dimerizing cell-surface receptor (e.g., interleukin-8 receptor (IL-8R); or an integrin heterodimer such as LFA-1 or GPIIIb/IIIa); a dimerizing region of a secreted, dimerizing ligand (e.g., nerve growth factor (NGF), neurotrophin-3 (NT-3), interleukin-8 (IL-8), vascular endothelial growth factor (VEGF), or brain-derived neurotrophic factor (BDNF); see, e.g., Arakawa et al, J. Biol. Chem.
  • NNF nerve growth factor
  • NT-3 neurotrophin-3
  • IL-8 interleukin-8
  • VEGF vascular endothelial growth factor
  • BDNF brain-derived neurotrophic factor
  • a coiled coil dimerization domain see, for example, WO2014152878; Fletcher et al, ACS Synth. Biol. 1:240-250, 2012; and Thomas et al., J. Am. Chem. Soc. 135(13):5161-5166, 2013
  • a polypeptide comprising at least one cysteine residue e.g., from about one, two, or three to about ten cysteine residues
  • the TCRM described herein comprises a) a first T cell receptor domain (TCRD) comprising a first TCR transmembrane domain (TCR-TM) and b) a second TCRD comprising a second TCR-TM, wherein the TCRM facilitates recruitment of at least one TCR-associated signaling molecule.
  • TCR-TMs are naturally occurring.
  • at least one of the TCR-TMs is non-naturally occurring.
  • both of the TCR-TMs are non-naturally occurring.
  • the first TCR-TM is derived from one of the transmembrane domains of a T cell receptor (such as an ⁇ TCR or a ⁇ TCR) and the second TCR-TM is derived from the other transmembrane domain of the T cell receptor.
  • the TCRM allows for enhanced recruitment of the at least one TCR-associated signaling molecule as compared to a TCRM comprising the transmembrane domains of the T cell receptor. Recruitment of TCR-associated signaling molecules can be determined by methods known in the art, such as FACS analysis for TCR-CD3 complex surface expression or co-immunoprecipitation of CD3 subunits with the caTCR.
  • the first TCR-TM of a TCRM described herein comprises, consists essentially of, or consists of the transmembrane domain of the TCR ⁇ chain (e.g., GenBank Accession No: CCI73895) or a variant thereof and the second TCR-TM of the TCRM comprises, consists essentially of, or consists of the transmembrane domain of the TCR chain (e.g., GenBank Accession No: CCI73893) or a variant thereof.
  • the first TCR-TM comprises, consists essentially of, or consists of the transmembrane domain of the TCR ⁇ chain (e.g., GenBank Accession No: AAQ57272) or a variant thereof and the second TCR-TM comprises, consists essentially of, or consists of the transmembrane domain of the TCR ⁇ chain (e.g., GenBank Accession No: AGE91788) or a variant thereof.
  • the first and second TCR-TMs of a TCRM described herein comprise, consist essentially of, or consist of the transmembrane domain of a TCR ⁇ chain constant domain (e.g., SEQ ID NO: 1) or a variant thereof and the transmembrane domain of a TCR ⁇ chain constant domain (e.g., SEQ ID NO: 2) or a variant thereof, respectively.
  • a TCR ⁇ chain constant domain e.g., SEQ ID NO: 1
  • SEQ ID NO: 2 the transmembrane domain of a TCR ⁇ chain constant domain
  • the first and second TCR-TMs comprise, consist essentially of, or consist of the transmembrane domain of a TCR ⁇ chain constant domain (e.g., SEQ ID NO: 3) or a variant thereof and the transmembrane domain of a TCR ⁇ chain constant domain (e.g., SEQ ID NO: 4) or a variant thereof, respectively.
  • the first and second TCR-TMs comprise, consist essentially of, or consist of the amino acid sequences of SEQ ID NOs: 5 and 6, or variants thereof, respectively.
  • the first and second TCR-TMs comprise, consist essentially of, or consist of the amino acid sequences of SEQ ID NOs: 7 and 8, or variants thereof, respectively.
  • Variants of the transmembrane domains include, without limitation, transmembrane domains with one or more amino acid substitutions compared to the reference sequence. In some embodiments, a variant transmembrane domain comprises no more than 5 amino acid substitutions compared to the reference sequence. In some embodiments, the first TCRD further comprises a first connecting peptide amino-terminal to the transmembrane domain and/or the second TCRD further comprises a second connecting peptide amino-terminal to the transmembrane domain.
  • the first connecting peptide comprises all or a portion of the connecting peptide of the TCR subunit from which the first TCR-TM is derived, or a variant thereof
  • the second connecting peptide comprises all or a portion of the connecting peptide of the TCR subunit from which the second TCR-TM is derived, or a variant thereof.
  • the first and/or second connecting peptides comprise, consist essentially of, or consist of all or a portion of the connecting peptide of a TCR ⁇ chain constant domain (e.g., SEQ ID NO: 1) or a variant thereof and all or a portion of the connecting peptide of a TCR ⁇ chain constant domain (e.g., SEQ ID NO: 2) or a variant thereof, respectively.
  • the first and/or second connecting peptides comprise, consist essentially of, or consist of all or a portion of the connecting peptide of SEQ ID NO: 27 or 28, or a variant thereof, and all or a portion of the connecting peptide of SEQ ID NO: 29 or 30, or a variant thereof, respectively.
  • the first and/or second connecting peptides comprise, consist essentially of, or consist of all or a portion of the connecting peptide of a TCR ⁇ chain constant domain (e.g., SEQ ID NO: 3) or a variant thereof and all or a portion of the connecting peptide of a TCR ⁇ chain constant domain (e.g., SEQ ID NO: 4) or a variant thereof, respectively.
  • the first and/or second connecting peptides comprise, consist essentially of, or consist of all or a portion of the connecting peptide of SEQ ID NO: 31 or 32, or a variant thereof, and all or a portion of the connecting peptide of SEQ ID NO: 33 or 34, or a variant thereof, respectively.
  • the first TCRD further comprises a first TCR intracellular domain carboxy-terminal to the first TCR-TM and/or the second TCRD further comprises a second TCR intracellular domain carboxy-terminal to the second TCR-TM.
  • the first TCR intracellular domain comprises all or a portion of the intracellular domain of the TCR subunit from which the first TCR-TM is derived, or a variant thereof
  • the second TCR intracellular domain comprises all or a portion of the intracellular domain of the TCR subunit from which the second TCR-TM is derived, or a variant thereof.
  • the second TCR intracellular domains comprise any one of the amino acid sequences of SEQ ID NOs: 17-18, or variants thereof.
  • the first TCRD is a fragment of one chain of a naturally occurring TCR, or a variant thereof, and/or the second TCRD is a fragment of the other chain of the naturally occurring TCR, or a variant thereof. In some embodiments, at least one of the TCRDs is non-naturally occurring. In some embodiments, the first and second TCRDs are linked by a disulfide bond. In some embodiments, the first and second TCRDs are linked by a disulfide bond between a residue in the first connecting peptide and a residue in the second connecting peptide.
  • the TCRM is capable of recruiting at least one TCR-associated signaling molecule selected from the group consisting of CD3 ⁇ , CD3 ⁇ , and ⁇ . In some embodiments, the TCRM is capable of recruiting each of CD3 ⁇ , CD3 ⁇ , and ⁇ to form a caTCR-CD3 complex (i.e., promotes caTCR-CD3 complex formation).
  • Contemplated caTCR constructs include, for example, caTCRs that specifically bind to cell surface antigens, caTCRs that specifically bind to cell surface-presented peptide/MHC complexes, and caTCRs that specifically bind to both cell surface antigens and cell surface-presented peptide/MHC complexes.
  • the antigen-binding module is an antibody moiety selected from the group consisting of a Fab, a Fab′, a (Fab′)2, an Fv, or a single chain Fv (scFv).
  • the antibody moiety is monospecific.
  • the antibody moiety is multi-specific.
  • the antibody moiety is bispecific.
  • the antibody moiety is a tandem scFv, a diabody (Db), a single chain diabody (scDb), a dual-affinity retargeting (DART) antibody, a dual variable domain (DVD) antibody, a chemically cross-linked antibody, a heteromultimeric antibody, or a heteroconjugate antibody.
  • the antibody moiety is a tandem scFv comprising two scFvs linked by a peptide linker. In some embodiments, the antibody moiety is two scFvs that are not directly linked. In some embodiments, the antibody moiety is fully human, semi-synthetic with human antibody framework regions, or humanized.
  • the antigen-binding module comprises a first antigen-binding domain comprising a V H antibody domain and a second antigen-binding domain comprising a V L antibody domain.
  • the V H antibody domain and V L antibody domain CDRs are derived from the same antibody moiety. In some embodiments, some of the V H antibody domain and V L antibody domain CDRs are derived from different antibody moieties. In some embodiments, the V H antibody domain and/or V L antibody domain are human, humanized, chimeric, semi-synthetic, or fully synthetic.
  • the antigen-binding module is an antibody moiety that is semi-synthetic, comprising fully human sequences and one or more synthetic regions.
  • the antigen-binding module is a semi-synthetic antibody moiety, comprising a fully human V L and a semi-synthetic V H comprising fully human FR1, HC-CDR1, FR2, HC-CDR2, FR3, and FR4 regions and a synthetic HC-CDR3.
  • the semi-synthetic V H comprises a fully synthetic HC-CDR3 having a sequence from about 5 to about 25 (such as about any of 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25) amino acids in length.
  • the semi-synthetic V H or the synthetic HC-CDR3 is obtained from a semi-synthetic library (such as a semi-synthetic human library) comprising fully synthetic HC-CDR3 regions having a sequence from about 5 to about 25 (such as about any of 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25) amino acids in length, wherein each amino acid in the sequence is, independently from one another, randomly selected from the standard human amino acids, minus cysteine.
  • the synthetic HC-CDR3 is from about 10 to about 19 (such as about any of 10, 11, 12, 13, 14, 15, 16, 17, 18 or 19) amino acids in length.
  • the antigen-binding module is a semi-synthetic antibody moiety, comprising a semi-synthetic V L and a semi-synthetic V H .
  • the antigen-binding module is a fully-synthetic antibody moiety, comprising fixed human V H /V L framework pairings, but randomized and synthetic sequences for all 6 CDRs of both heavy and light chains.
  • the antigen-binding module in some embodiments is an antibody moiety comprising specific CDR sequences derived from one or more antibody moieties (such as a monoclonal antibody) or certain variants of such sequences comprising one or more amino acid substitutions.
  • the amino acid substitutions in the variant sequences do not substantially reduce the ability of the antigen-binding module to bind the target antigen. Alterations that substantially improve target antigen binding affinity or affect some other property, such as specificity and/or cross-reactivity with related variants of the target antigen, are also contemplated.
  • the stabilization module is derived from an antibody moiety.
  • the stabilization module comprises a first stabilization domain comprising a C H 1 antibody domain or variant thereof and a second stabilization domain comprising a C L antibody domain or variant thereof.
  • the stabilization module comprises a first stabilization domain comprising a C H 3 antibody domain or variant thereof and a second stabilization domain comprising a C H 3 antibody domain or a variant thereof.
  • antibody heavy chain constant domains (e.g., C H 1 or C H 3) contained in the stabilization module are derived from an IgG (e.g., IgG1, IgG2, IgG3, or IgG4), IgA (e.g., IgA1 or IgA2), IgD, IgM, or IgE heavy chain, optionally human.
  • an antibody heavy chain constant domain (e.g., C H 1 or C H 3) contained in the stabilization module is a variant comprising one or more modifications (e.g., amino acid substitutions, insertions, and/or deletions) compared to the sequence from which it is derived.
  • antibody light chain constant domains (C L ) contained in the stabilization module are derived from a kappa or lambda light chain, optionally human.
  • an antibody light chain constant domain (C L ) contained in the stabilization module is a variant comprising one or more modifications (e.g., amino acid substitutions, insertions, and/or deletions) compared to the sequence from which it is derived.
  • the first and/or second stabilization domains comprise one or more modifications that do not substantially alter their binding affinity for each other.
  • the first and/or second stabilization domains comprise one or more modifications that increase their binding affinity for each other and/or introduce a non-naturally occurring disulfide bond.
  • the stabilization module comprises a knob-into-hole modification (see, for example, Carter P. J Immunol Methods. 248:7-15, 2001).
  • the stabilization module comprises antibody constant domain regions (e.g., C H 3 domains) comprising a knob-into-hole modification.
  • the stabilization module comprises antibody constant domain regions (e.g., C H 3 domains) modified by electrostatic steering to enhance their association (see, for example, WO2006106905 and Gunasekaran K, et al. J Biol Chem. 285:19637-46, 2010).
  • the first and second stabilization domains are linked by a disulfide bond.
  • the caTCR comprises an antigen-binding module described herein linked to a TCRM described herein, optionally including a stabilization module.
  • the caTCR comprises the antigen-binding module linked to the N-terminus of one or both of the TCRDs.
  • the caTCR comprises a stabilization module between a TCRM and an antigen-binding module.
  • the caTCR further comprises a spacer module between any two caTCR modules or domains.
  • the spacer module comprises one or more peptide linkers between about 5 to about 70 (such as about any of 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, or 70, including any ranges between these values) amino acids in length.
  • the caTCR further comprises one or more accessory intracellular domains.
  • the one or more accessory intracellular domains are carboxy-terminal to the first and/or second TCRD.
  • the one or more accessory intracellular domains are between the first TCR-TM and the first TCR intracellular domain and/or between the second TCR-TM and the second TCR intracellular domain.
  • the one or more accessory intracellular domains comprise, individually, a TCR co-stimulatory domain.
  • the TCR co-stimulatory domain comprises all or a portion of the intracellular domain of an immune co-stimulatory molecule (such as CD27, CD28, 4-1BB (CD137), OX40, CD30, CD40, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, a ligand that specifically binds with CD83, and the like).
  • an immune co-stimulatory molecule such as CD27, CD28, 4-1BB (CD137), OX40, CD30, CD40, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, a ligand that specifically binds with CD83, and the like.
  • the TCR co-stimulatory domain comprises all or a portion of the amino acid sequence of any one of SEQ ID NO
  • the antigen-binding module specifically binds a cell surface antigen.
  • the cell surface antigen is selected from the group consisting of a protein, a carbohydrate, and a lipid.
  • the cell surface antigen is a disease-associated antigen expressed in a diseased cell.
  • the antigen-binding module specifically binds a complex comprising a peptide and an MEC protein.
  • Peptide/MEC complexes include, for example, a surface-presented complex comprising a peptide derived from a disease-associated antigen expressed in a diseased cell and an MEC protein.
  • the full-length disease-associated antigen is not normally expressed on the surface of the diseased cell (e.g., the disease-associated antigen is an intracellular or secreted protein).
  • the disease is cancer and the disease-associated antigen is a tumor-associated antigen expressed in a cancer cell.
  • the tumor-associated antigen is an oncoprotein.
  • the oncoprotein is the result of a mutation in a proto-oncogene, and the oncoprotein comprises a neoepitope comprising the mutation.
  • the antigen-binding module specifically binds a cell surface tumor-associated antigen (e.g., an oncoprotein comprising a neoepitope).
  • the antigen-binding module specifically binds a complex comprising a peptide derived from a tumor-associated antigen (e.g., an oncoprotein comprising a neoepitope) not normally expressed on the surface of a cancer cell (e.g., an intracellular or secreted tumor-associated antigen) and an MEC protein.
  • the disease is viral infection and the disease-associated antigen is a virus-associated antigen expressed in an infected cell.
  • the antigen-binding module specifically binds a cell surface virus-associated antigen.
  • the antigen-binding module specifically binds a complex comprising a peptide derived from a virus-associated antigen not normally expressed on the surface of a virus-infected cell (e.g., an intracellular or secreted virus-associated antigen) and an MEC protein.
  • the caTCR construct binds the target antigen with a K d between about 0.1 pM to about 500 nM (such as about any of 0.1 pM, 1.0 pM, 10 pM, 50 pM, 100 pM, 500 pM, 1 nM, 10 nM, 50 nM, 100 nM, or 500 nM, including any ranges between these values).
  • the caTCR comprises an antigen-binding module that specifically binds to a cell surface antigen, wherein the cell surface antigen is CD19, CD20, CD22, CD47, GPC-3, ROR1, ROR2, BCMA, GPRC5D, or FCRL5, including variants or mutants thereof.
  • Specific binding to a full antigen, e.g., a cell surface antigen is sometimes referred to as “non-MEC-restricted binding”.
  • the caTCR comprises an antigen-binding module that specifically binds to a complex comprising a peptide and an MEC protein, wherein the peptide is derived from a protein selected from the group consisting of WT-1, AFP, HPV16-E7, NY-ESO-1, PRAME, EBV-LMP2A, HIV-1, KRAS, Histone H3.3, and PSA, including variants or mutants thereof.
  • Specific binding to a complex comprising a peptide and an MEC protein is sometimes referred to as “MEC-restricted binding”.
  • the caTCR comprises an antigen-binding module that specifically binds to a complex comprising a peptide derived from a disease-associated antigen (such as a tumor-associated or virally-encoded antigen) and an MEC class I protein, wherein the MHC class I protein is HLA-A, HLA-F, or HLA-G.
  • the MHC class I protein is HLA-A, HLA-B, or HLA-C.
  • the MHC class I protein is HLA-A.
  • the MEC class I protein is HLA-B.
  • the MHC class I protein is HLA-C.
  • the MEC class I protein is HLA-A01, HLA-A02, HLA-A03, HLA-A09, HLA-A10, HLA-A11, HLA-A19, HLA-A23, HLA-A24, HLA-A25, HLA-A26, HLA-A28, HLA-A29, HLA-A30, HLA-A31, HLA-A32, HLA-A33, HLA-A34, HLA-A36, HLA-A43, HLA-A66, HLA-A68, HLA-A69, HLA-A74, or HLA-A80.
  • the MHC class I protein is HLA-A02.
  • the MEC class I protein is any one of HLA-A*02:01-555, such as HLA-A*02:01, HLA-A*02:02, HLA-A*02:03, HLA-A*02:04, HLA-A*02:05, HLA-A*02:06, HLA-A*02:07, HLA-A*02:08, HLA-A*02:09, HLA-A*02:10, HLA-A*02:11, HLA-A*02:12, HLA-A*02:13, HLA-A*02:14, HLA-A*02:15, HLA-A*02:16, HLA-A*02:17, HLA-A*02:18, HLA-A*02:19, HLA-A*02:20, HLA-A*02:21, HLA-A*02:22, or HLA-A*02:24.
  • the MEC class I protein is HLA-A*02:
  • the caTCR comprises an antigen-binding module that specifically binds to a complex comprising a peptide derived from a disease-associated antigen (such as a tumor-associated or virally-encoded antigen) and an MHC class II protein, wherein the MHC class II protein is HLA-DP, HLA-DQ, or HLA-DR.
  • a disease-associated antigen such as a tumor-associated or virally-encoded antigen
  • MHC class II protein is HLA-DP, HLA-DQ, or HLA-DR.
  • the MEC class II protein is HLA-DP.
  • the MHC class II protein is HLA-DQ.
  • the MHC class II protein is HLA-DR.
  • the caTCR described herein comprises a) an antigen-binding module that specifically binds to a target antigen, and b) a TCRM comprising first and second TCR-TMs derived from the transmembrane domains of a TCR (such as an ⁇ TCR or a ⁇ TCR), wherein the TCRM is capable of recruiting at least one TCR-associated signaling molecule.
  • the antigen-binding module is linked to the amino-terminus of one or more polypeptide chains in the TCRM.
  • the TCRM comprises two polypeptide chains, and the antigen-binding module is linked to the amino-terminus of one or both of the TCRM polypeptide chains.
  • the first and second TCR-TMs are naturally occurring. In some embodiments, at least one of the TCR-TMs is non-naturally occurring. In some embodiments, the first and second TCR-TMs are non-naturally occurring. In some embodiments, the TCRM further comprises at least one connecting peptide or fragment thereof of the TCR amino-terminal to a TCR-TM. In some embodiments, the TCRM further comprises at least one TCR intracellular domain comprising a sequence from an intracellular domain of the TCR carboxy-terminal to a TCR-TM. In some embodiments, the TCRM comprises TCRDs derived from fragments of the TCR chains. In some embodiments, at least one of the TCRDs is non-naturally occurring.
  • the caTCR further comprises at least one accessory intracellular domain comprising a T cell co-stimulatory signaling sequence (such as from CD27, CD28, 4-1BB (CD137), OX40, CD30, or CD40) carboxy-terminal to a TCR-TM.
  • the caTCR lacks a co-stimulatory signaling sequence.
  • the antigen-binding module is an antibody moiety.
  • the antibody moiety comprises a V H antibody domain and a V L antibody domain.
  • the antibody moiety is human, humanized, chimeric, semi-synthetic, or fully synthetic.
  • the caTCR further comprises a stabilization module comprising a first stabilization domain and a second stabilization domain, wherein the first and second stabilization domains have a binding affinity for each other that stabilizes the caTCR.
  • the stabilization module comprises at least one disulfide bond linking the stabilization domains.
  • the first and second stabilization domains comprise antibody domains, such as C H 1 and C L antibody domains, or variants thereof.
  • the TCRM is capable of recruiting at least one TCR-associated signaling molecule selected from the group consisting of CD3 ⁇ , CD3 ⁇ , and ⁇ .
  • the TCRM allows for enhanced recruitment of the at least one TCR-associated signaling molecule as compared to a TCRM comprising the T cell receptor transmembrane domains.
  • the TCRM promotes caTCR-CD3 complex formation.
  • the caTCR is a heteromultimer, such as a heterodimer.
  • the caTCR is a heterodimer comprising a first polypeptide chain comprising the first TCRD and a second polypeptide chain comprising the second TCRD, wherein the antigen-binding module is linked to the first and/or second polypeptide chains.
  • the caTCR described herein specifically binds a target antigen, comprising a) a first TCRD comprising a first TCR-TM derived from one of the transmembrane domains of a TCR and a second TCRD comprising a second TCR-TM derived from the other transmembrane domain of the TCR, wherein the first and second TCRDs form a TCRM that is capable of recruiting at least one TCR-associated signaling molecule; and b) an antigen-binding module that specifically binds to the target antigen, wherein the antigen-binding module is linked to the first and/or second TCRDs.
  • both of the TCR-TMs are naturally occurring.
  • the TCR-TMs are non-naturally occurring.
  • the TCR is an ⁇ TCR and the first and second TCR-TMs are derived from TCR ⁇ and subunit transmembrane domains.
  • the TCR is a ⁇ TCR and the first and second TCR-TMs are derived from TCR ⁇ and ⁇ subunit transmembrane domains.
  • the first TCRD further comprises a first TCR connecting peptide or a fragment thereof and/or the second TCRD further comprises a second TCR connecting peptide or a fragment thereof.
  • the first connecting peptide comprises all or a portion of the connecting peptide of the TCR subunit from which the first TCR-TM is derived, or a variant thereof
  • the second connecting peptide comprises all or a portion of the connecting peptide of the TCR subunit from which the second TCR-TM is derived, or a variant thereof.
  • the first and second connecting peptides are linked by a disulfide bond.
  • the first TCRD further comprises a first TCR intracellular domain and/or the second TCRD further comprises a second TCR intracellular domain.
  • the first TCR intracellular domain comprises a sequence from the intracellular domain of the TCR subunit from which the first TCR-TM is derived and/or the second TCR intracellular domain comprises a sequence from the intracellular domain of the TCR subunit from which the second TCR-TM is derived.
  • the first TCRD is a fragment of the TCR subunit from which the first TCR-TM is derived and/or the second TCRD is a fragment of the TCR subunit from which the second TCR-TM is derived.
  • the caTCR further comprises at least one accessory intracellular domain comprising a T cell co-stimulatory signaling sequence (such as from CD27, CD28, 4-1BB (CD137), OX40, CD30, or CD40).
  • the caTCR further comprises a stabilization module comprising a first stabilization domain and a second stabilization domain, wherein the first and second stabilization domains have a binding affinity for each other that stabilizes the caTCR.
  • the first and second stabilization domains are linked by a disulfide bond.
  • the first and second stabilization domains comprise antibody domains, such as C H 1 and C L antibody domains, or variants thereof.
  • the TCRM is capable of recruiting at least one TCR-associated signaling molecule selected from the group consisting of CD3 ⁇ , CD3 ⁇ , and ⁇ . In some embodiments, the TCRM allows for enhanced recruitment of the at least one TCR-associated signaling molecule as compared to a TCRM comprising the T cell receptor transmembrane domains. In some embodiments, the TCRM promotes caTCR-CD3 complex formation. In some embodiments, there is a spacer module between any two caTCR modules or domains. In some embodiments, the antigen-binding module is an antibody moiety.
  • the antibody moiety is a Fab, a Fab′, a (Fab′)2, an Fv, or a single chain Fv (scFv).
  • the antigen-binding module is multispecific (such as bispecific).
  • the caTCR described herein specifically binds a target antigen, comprising a) a first TCRD comprising a first TCR-TM derived from one of the transmembrane domains of a naturally occurring ⁇ TCR and a second TCRD comprising a second TCR-TM derived from the other transmembrane domain of the naturally occurring ⁇ TCR, wherein the first and second TCRDs form a TCRM that is capable of recruiting at least one TCR-associated signaling molecule; and b) an antigen-binding module that specifically binds to the target antigen, wherein the antigen-binding module is linked to the first and/or second TCRDs.
  • both of the TCR-TMs are naturally occurring. In some embodiments, at least one of the TCR-TMs is non-naturally occurring.
  • the first TCRD further comprises a first TCR connecting peptide or a fragment thereof and/or the second TCRD further comprises a second TCR connecting peptide or a fragment thereof.
  • the first connecting peptide comprises all or a portion of the connecting peptide of the TCR subunit from which the first TCR-TM is derived, or a variant thereof
  • the second connecting peptide comprises all or a portion of the connecting peptide of the TCR subunit from which the second TCR-TM is derived, or a variant thereof.
  • the first and second connecting peptides are linked by a disulfide bond.
  • the first TCRD further comprises a first TCR intracellular domain and/or the second TCRD further comprises a second TCR intracellular domain.
  • the first TCR intracellular domain comprises a sequence from the intracellular domain of the TCR subunit from which the first TCR-TM is derived and/or the second TCR intracellular domain comprises a sequence from the intracellular domain of the TCR subunit from which the second TCR-TM is derived.
  • the first TCRD is a fragment of the TCR subunit from which the first TCR-TM is derived and/or the second TCRD is a fragment of the TCR subunit from which the second TCR-TM is derived.
  • the caTCR further comprises at least one accessory intracellular domain comprising a T cell co-stimulatory signaling sequence (such as from CD27, CD28, 4-1BB (CD137), OX40, CD30, or CD40).
  • the caTCR further comprises a stabilization module comprising a first stabilization domain and a second stabilization domain, wherein the first and second stabilization domains have a binding affinity for each other that stabilizes the caTCR.
  • the first and second stabilization domains are linked by a disulfide bond.
  • the first and second stabilization domains comprise antibody domains, such as C H 1 and C L antibody domains, or variants thereof.
  • the TCRM is capable of recruiting at least one TCR-associated signaling molecule selected from the group consisting of CD3 ⁇ , CD3 ⁇ , and ⁇ .
  • the TCRM allows for enhanced recruitment of the at least one TCR-associated signaling molecule as compared to a TCRM comprising the naturally occurring ⁇ T cell receptor transmembrane domains.
  • the TCRM promotes caTCR-CD3 complex formation.
  • the antigen-binding module is an antibody moiety.
  • the antibody moiety is a Fab, a Fab′, a (Fab′)2, an Fv, or a single chain Fv (scFv).
  • the antigen-binding module is multispecific (such as bispecific).
  • the caTCR described herein specifically binds a target antigen, comprising a) a first TCRD comprising a first TCR-TM derived from one of the transmembrane domains of a naturally occurring ⁇ TCR and a second TCRD comprising a second TCR-TM derived from the other transmembrane domain of the naturally occurring ⁇ TCR, wherein the first and second TCRDs form a TCRM that is capable of recruiting at least one TCR-associated signaling molecule; and b) an antigen-binding module that specifically binds to the target antigen, wherein the antigen-binding module is linked to the first and/or second TCRDs.
  • both of the TCR-TMs are naturally occurring. In some embodiments, at least one of the TCR-TMs is non-naturally occurring.
  • the first TCRD further comprises a first TCR connecting peptide or a fragment thereof and/or the second TCRD further comprises a second TCR connecting peptide or a fragment thereof.
  • the first connecting peptide comprises all or a portion of the connecting peptide of the TCR subunit from which the first TCR-TM is derived, or a variant thereof
  • the second connecting peptide comprises all or a portion of the connecting peptide of the TCR subunit from which the second TCR-TM is derived, or a variant thereof.
  • the first and second connecting peptides are linked by a disulfide bond.
  • the first TCRD further comprises a first TCR intracellular domain and/or the second TCRD further comprises a second TCR intracellular domain.
  • the first TCR intracellular domain comprises a sequence from the intracellular domain of the TCR subunit from which the first TCR-TM is derived and/or the second TCR intracellular domain comprises a sequence from the intracellular domain of the TCR subunit from which the second TCR-TM is derived.
  • the first TCRD is a fragment of the TCR subunit from which the first TCR-TM is derived and/or the second TCRD is a fragment of the TCR subunit from which the second TCR-TM is derived.
  • the caTCR further comprises at least one accessory intracellular domain comprising a T cell co-stimulatory signaling sequence (such as from CD27, CD28, 4-1BB (CD137), OX40, CD30, or CD40).
  • the caTCR further comprises a stabilization module comprising a first stabilization domain and a second stabilization domain, wherein the first and second stabilization domains have a binding affinity for each other that stabilizes the caTCR.
  • the first and second stabilization domains are linked by a disulfide bond.
  • the first and second stabilization domains comprise antibody domains, such as C H 1 and C L antibody domains, or variants thereof.
  • the TCRM is capable of recruiting at least one TCR-associated signaling molecule selected from the group consisting of CD3 ⁇ , CD3 ⁇ , and ⁇ .
  • the TCRM allows for enhanced recruitment of the at least one TCR-associated signaling molecule as compared to a TCRM comprising the naturally occurring ⁇ T cell receptor transmembrane domains.
  • the TCRM promotes caTCR-CD3 complex formation.
  • the antigen-binding module is an antibody moiety.
  • the antibody moiety is a Fab, a Fab′, a (Fab′)2, an Fv, or a single chain Fv (scFv).
  • the antigen-binding module is multispecific (such as bispecific).
  • the caTCR described herein specifically binds a target antigen, comprising a) a first TCRD comprising a first TCR-TM derived from a transmembrane domain contained in one of the amino acid sequences of SEQ ID NO: 1 and SEQ ID NO: 2 and a second TCRD comprising a second TCR-TM derived from a transmembrane domain contained in the other amino acid sequence, wherein the first and second TCRDs form a TCRM that is capable of recruiting at least one TCR-associated signaling molecule; and b) an antigen-binding module that specifically binds to the target antigen, wherein the antigen-binding module is linked to the first and/or second TCRDs.
  • both of the TCR-TMs are naturally occurring. In some embodiments, at least one of the TCR-TMs is non-naturally occurring.
  • the first TCRD further comprises a first TCR connecting peptide or a fragment thereof and/or the second TCRD further comprises a second TCR connecting peptide or a fragment thereof.
  • the first connecting peptide and the second connecting peptide each comprise, independently from one another, the amino acid sequence of a connecting peptide contained in any one of the amino acid sequences of SEQ ID NOs: 1-4, or a variant thereof.
  • the first connecting peptide and the second connecting peptide each comprise, independently from one another, the amino acid sequence of any one of SEQ ID NOs: 9-16, or a variant thereof.
  • the first and second connecting peptides are linked by a disulfide bond.
  • the first TCRD further comprises a first TCR intracellular domain and/or the second TCRD further comprises a second TCR intracellular domain.
  • the first TCR intracellular domain and the second TCR intracellular domain each comprise, independently from one another, the amino acid sequence of an intracellular domain contained in any one of SEQ ID NOs: 1-4, or a variant thereof.
  • the first TCR intracellular domain and the second TCR intracellular domain each comprise, independently from one another, the amino acid sequence of SEQ ID NO: 17 or 18, or a variant thereof.
  • the caTCR further comprises at least one accessory intracellular domain comprising a T cell co-stimulatory signaling sequence (such as from CD27, CD28, 4-1BB (CD137), OX40, CD30, or CD40).
  • the caTCR further comprises a stabilization module comprising a first stabilization domain and a second stabilization domain, wherein the first and second stabilization domains have a binding affinity for each other that stabilizes the caTCR.
  • the first and second stabilization domains are linked by a disulfide bond.
  • the first and second stabilization domains comprise antibody domains, such as C H 1 and C L antibody domains, or variants thereof.
  • the TCRM is capable of recruiting at least one TCR-associated signaling molecule selected from the group consisting of CD3 ⁇ , CD3 ⁇ , and ⁇ .
  • the TCRM allows for enhanced recruitment of the at least one TCR-associated signaling molecule as compared to a TCRM comprising T cell receptor transmembrane domains having the sequences of the transmembrane domains contained in SEQ ID NOs: 1 and 2.
  • the TCRM promotes caTCR-CD3 complex formation.
  • the antigen-binding module is an antibody moiety.
  • the antibody moiety is a Fab, a Fab′, a (Fab′)2, an Fv, or a single chain Fv (scFv).
  • the antigen-binding module is multispecific (such as bispecific).
  • the caTCR described herein specifically binds a target antigen, comprising a) a first TCRD comprising a first TCR-TM derived from a transmembrane domain contained in one of the amino acid sequences of SEQ ID NO: 1 and SEQ ID NO: 2 and a second TCRD comprising a second TCR-TM derived from a transmembrane domain contained in the other amino acid sequence, wherein at least one of the TCR-TMs comprises one or more (such as 2, 3, 4, 5, or more) amino acid substitutions compared to the amino acid sequence from which it is derived, and the first and second TCRDs form a TCRM that is capable of recruiting at least one TCR-associated signaling molecule; and b) an antigen-binding module that specifically binds to the target antigen, wherein the antigen-binding module is linked to the first and/or second TCRDs.
  • each of the TCR-TMs comprises, independently from one another, one or more (such as 2, 3, 4, 5, or more) amino acid substitutions compared to the amino acid sequence from which it is derived.
  • the first TCR-TM and/or the second TCR-TM each comprise, independently from one another, no more than 5 amino acid substitutions compared to the amino acid sequences from which they are derived.
  • at least one of the TCR-TMs comprises a single amino acid substitution compared to the amino acid sequence from which it is derived.
  • each of the TCR-TMs comprises a single amino acid substitution compared to the amino acid sequence from which it is derived.
  • the first TCR-TM further comprises a first TCR connecting peptide or a fragment thereof and/or the second TCRD further comprises a second TCR connecting peptide or a fragment thereof.
  • the first connecting peptide and the second connecting peptide each comprise, independently from one another, the amino acid sequence of a connecting peptide contained in any one of the amino acid sequences of SEQ ID NOs: 1-4, or a variant thereof.
  • the first connecting peptide and the second connecting peptide each comprise, independently from one another, the amino acid sequence of any one of SEQ ID NOs: 9-16, or a variant thereof.
  • the first and second connecting peptides are linked by a disulfide bond.
  • the first TCRD further comprises a first TCR intracellular domain and/or the second TCRD further comprises a second TCR intracellular domain.
  • the first TCR intracellular domain and the second TCR intracellular domain each comprise, independently from one another, the amino acid sequence of an intracellular domain contained in any one of SEQ ID NOs: 1-4, or a variant thereof.
  • the first TCR intracellular domain and the second TCR intracellular domain each comprise, independently from one another, the amino acid sequence of SEQ ID NO: 17 or 18, or a variant thereof.
  • the caTCR further comprises at least one accessory intracellular domain comprising a T cell co-stimulatory signaling sequence (such as from CD27, CD28, 4-1BB (CD137), OX40, CD30, or CD40).
  • the caTCR further comprises a stabilization module comprising a first stabilization domain and a second stabilization domain, wherein the first and second stabilization domains have a binding affinity for each other that stabilizes the caTCR.
  • the first and second stabilization domains are linked by a disulfide bond.
  • the first and second stabilization domains comprise antibody domains, such as C H 1 and C L antibody domains, or variants thereof.
  • the TCRM is capable of recruiting at least one TCR-associated signaling molecule selected from the group consisting of CD3 ⁇ , CD3 ⁇ , and ⁇ .
  • the TCRM allows for enhanced recruitment of the at least one TCR-associated signaling molecule as compared to a TCRM comprising T cell receptor transmembrane domains having the sequences of the transmembrane domains contained in SEQ ID NOs: 1 and 2.
  • the TCRM promotes caTCR-CD3 complex formation.
  • the antigen-binding module is an antibody moiety.
  • the antibody moiety is a Fab, a Fab′, a (Fab′)2, an Fv, or a single chain Fv (scFv).
  • the antigen-binding module is multispecific (such as bispecific).
  • the caTCR described herein specifically binds a target antigen, comprising a) a first TCRD comprising a first TCR-TM derived from a transmembrane domain contained in one of the amino acid sequences of SEQ ID NO: 1 and SEQ ID NO: 2 and a second TCRD comprising a second TCR-TM derived from a transmembrane domain contained in the other amino acid sequence, wherein at least one of the TCR-TMs comprises a chimeric sequence comprising a portion of consecutive amino acids from a transmembrane domain contained in SEQ ID NO: 3 or 4, and the first and second TCRDs form a TCRM that is capable of recruiting at least one TCR-associated signaling molecule; and b) an antigen-binding module that specifically binds to the target antigen, wherein the antigen-binding module is linked to the first and/or second TCRDs.
  • each of the TCR-TMs comprises, independently from one another, a chimeric sequence comprising a portion of consecutive amino acids from a transmembrane domain contained in SEQ ID NO: 3 or 4.
  • the first TCR-TM and/or the second TCR-TM each comprise, independently from one another, a chimeric sequence comprising a portion of no more than about 10 (such as no more than about 9, 8, 7, 6, 5, or fewer) consecutive amino acids from a transmembrane domain contained in SEQ ID NO: 3 or 4.
  • the chimeric sequence in the first or second TCR-TM is from a transmembrane domain contained in SEQ ID NO: 3 and the chimeric sequence in the other TCR-TM is from a transmembrane domain contained in SEQ ID NO: 4.
  • the chimeric sequence in the first TCR-TM is positioned such that it can interact with the chimeric sequence in the second TCR-TM.
  • the first TCRD further comprises a first TCR connecting peptide or a fragment thereof and/or the second TCRD further comprises a second TCR connecting peptide or a fragment thereof.
  • the first connecting peptide and the second connecting peptide each comprise, independently from one another, the amino acid sequence of a connecting peptide contained in any one of the amino acid sequences of SEQ ID NOs: 1-4, or a variant thereof. In some embodiments, the first connecting peptide and the second connecting peptide each comprise, independently from one another, the amino acid sequence of any one of SEQ ID NOs: 9-16, or a variant thereof. In some embodiments, the first and second connecting peptides are linked by a disulfide bond. In some embodiments, the first TCRD further comprises a first TCR intracellular domain and/or the second TCRD further comprises a second TCR intracellular domain.
  • the first TCR intracellular domain and the second TCR intracellular domain each comprise, independently from one another, the amino acid sequence of an intracellular domain contained in any one of SEQ ID NOs: 1-4, or a variant thereof. In some embodiments, the first TCR intracellular domain and the second TCR intracellular domain each comprise, independently from one another, the amino acid sequence of SEQ ID NO: 17 or 18, or a variant thereof. In some embodiments, the caTCR further comprises at least one accessory intracellular domain comprising a T cell co-stimulatory signaling sequence (such as from CD27, CD28, 4-1BB (CD137), OX40, CD30, or CD40).
  • a T cell co-stimulatory signaling sequence such as from CD27, CD28, 4-1BB (CD137), OX40, CD30, or CD40.
  • the caTCR further comprises a stabilization module comprising a first stabilization domain and a second stabilization domain, wherein the first and second stabilization domains have a binding affinity for each other that stabilizes the caTCR.
  • the first and second stabilization domains are linked by a disulfide bond.
  • the first and second stabilization domains comprise antibody domains, such as C H 1 and C L antibody domains, or variants thereof.
  • the TCRM is capable of recruiting at least one TCR-associated signaling molecule selected from the group consisting of CD3 ⁇ , CD3 ⁇ , and ⁇ .
  • the TCRM allows for enhanced recruitment of the at least one TCR-associated signaling molecule as compared to a TCRM comprising T cell receptor transmembrane domains having the sequences of the transmembrane domains contained in SEQ ID NOs: 1 and 2.
  • the TCRM promotes caTCR-CD3 complex formation.
  • the antigen-binding module is an antibody moiety.
  • the antibody moiety is a Fab, a Fab′, a (Fab′)2, an Fv, or a single chain Fv (scFv).
  • the antigen-binding module is multispecific (such as bispecific).
  • the caTCR described herein specifically binds a target antigen, comprising a) a first TCRD comprising a first TCR-TM derived from a transmembrane domain contained in one of the amino acid sequences of SEQ ID NO: 3 and SEQ ID NO: 4 and a second TCRD comprising a second TCR-TM derived from a transmembrane domain contained in the other amino acid sequence, wherein the first and second TCRDs form a TCRM that is capable of recruiting at least one TCR-associated signaling molecule; and b) an antigen-binding module that specifically binds to the target antigen, wherein the antigen-binding module is linked to the first and/or second TCRDs.
  • both of the TCR-TMs are naturally occurring. In some embodiments, at least one of the TCR-TMs is non-naturally occurring.
  • the first TCRD further comprises a first TCR connecting peptide or a fragment thereof and/or the second TCRD further comprises a second TCR connecting peptide or a fragment thereof.
  • the first connecting peptide and the second connecting peptide each comprise, independently from one another, the amino acid sequence of a connecting peptide contained in any one of the amino acid sequences of SEQ ID NOs: 1-4, or a variant thereof.
  • the first connecting peptide and the second connecting peptide each comprise, independently from one another, the amino acid sequence of any one of SEQ ID NOs: 9-16, or a variant thereof.
  • the first and second connecting peptides are linked by a disulfide bond.
  • the first TCRD further comprises a first TCR intracellular domain and/or the second TCRD further comprises a second TCR intracellular domain.
  • the first TCR intracellular domain and the second TCR intracellular domain each comprise, independently from one another, the amino acid sequence of an intracellular domain contained in any one of SEQ ID NOs: 1-4, or a variant thereof.
  • the first TCR intracellular domain and the second TCR intracellular domain each comprise, independently from one another, the amino acid sequence of SEQ ID NO: 17 or 18, or a variant thereof.
  • the caTCR further comprises at least one accessory intracellular domain comprising a T cell co-stimulatory signaling sequence (such as from CD27, CD28, 4-1BB (CD137), OX40, CD30, or CD40).
  • the caTCR further comprises a stabilization module comprising a first stabilization domain and a second stabilization domain, wherein the first and second stabilization domains have a binding affinity for each other that stabilizes the caTCR.
  • the first and second stabilization domains are linked by a disulfide bond.
  • the first and second stabilization domains comprise antibody domains, such as C H 1 and C L antibody domains, or variants thereof.
  • the TCRM is capable of recruiting at least one TCR-associated signaling molecule selected from the group consisting of CD3 ⁇ , CD3 ⁇ , and ⁇ .
  • the TCRM allows for enhanced recruitment of the at least one TCR-associated signaling molecule as compared to a TCRM comprising T cell receptor transmembrane domains having the sequences of the transmembrane domains contained in SEQ ID NOs: 3 and 4.
  • the TCRM promotes caTCR-CD3 complex formation.
  • the antigen-binding module is an antibody moiety.
  • the antibody moiety is a Fab, a Fab′, a (Fab′)2, an Fv, or a single chain Fv (scFv).
  • the antigen-binding module is multispecific (such as bispecific).
  • the caTCR described herein specifically binds a target antigen, comprising a) a first TCRD comprising a first TCR-TM derived from a transmembrane domain contained in one of the amino acid sequences of SEQ ID NO: 3 and SEQ ID NO: 4 and a second TCRD comprising a second TCR-TM derived from a transmembrane domain contained in the other amino acid sequence, wherein at least one of the TCR-TMs comprises one or more (such as 2, 3, 4, 5, or more) amino acid substitutions compared to the amino acid sequence from which it is derived, and the first and second TCRDs form a TCRM that is capable of recruiting at least one TCR-associated signaling molecule; and b) an antigen-binding module that specifically binds to the target antigen, wherein the antigen-binding module is linked to the first and/or second TCRDs.
  • each of the TCR-TMs comprises, independently from one another, one or more (such as 2, 3, 4, 5, or more) amino acid substitutions compared to the amino acid sequence from which it is derived.
  • the first TCR-TM and/or the second TCR-TM each comprise, independently from one another, no more than 5 amino acid substitutions compared to the amino acid sequences from which they are derived.
  • at least one of the TCR-TMs comprises a single amino acid substitution compared to the amino acid sequence from which it is derived.
  • each of the TCR-TMs comprises a single amino acid substitution compared to the amino acid sequence from which it is derived.
  • the first TCR-TM further comprises a first TCR connecting peptide or a fragment thereof and/or the second TCRD further comprises a second TCR connecting peptide or a fragment thereof.
  • the first connecting peptide and the second connecting peptide each comprise, independently from one another, the amino acid sequence of a connecting peptide contained in any one of the amino acid sequences of SEQ ID NOs: 1-4, or a variant thereof.
  • the first connecting peptide and the second connecting peptide each comprise, independently from one another, the amino acid sequence of any one of SEQ ID NOs: 9-16, or a variant thereof.
  • the first and second connecting peptides are linked by a disulfide bond.
  • the first TCRD further comprises a first TCR intracellular domain and/or the second TCRD further comprises a second TCR intracellular domain.
  • the first TCR intracellular domain and the second TCR intracellular domain each comprise, independently from one another, the amino acid sequence of an intracellular domain contained in any one of SEQ ID NOs: 1-4, or a variant thereof.
  • the first TCR intracellular domain and the second TCR intracellular domain each comprise, independently from one another, the amino acid sequence of SEQ ID NO: 17 or 18, or a variant thereof.
  • the caTCR further comprises at least one accessory intracellular domain comprising a T cell co-stimulatory signaling sequence (such as from CD27, CD28, 4-1BB (CD137), OX40, CD30, or CD40).
  • the caTCR further comprises a stabilization module comprising a first stabilization domain and a second stabilization domain, wherein the first and second stabilization domains have a binding affinity for each other that stabilizes the caTCR.
  • the first and second stabilization domains are linked by a disulfide bond.
  • the first and second stabilization domains comprise antibody domains, such as C H I and C L antibody domains, or variants thereof.
  • the TCRM is capable of recruiting at least one TCR-associated signaling molecule selected from the group consisting of CD3 ⁇ , CD3 ⁇ , and ⁇ .
  • the TCRM allows for enhanced recruitment of the at least one TCR-associated signaling molecule as compared to a TCRM comprising T cell receptor transmembrane domains having the sequences of the transmembrane domains contained in SEQ ID NOs: 3 and 4.
  • the TCRM promotes caTCR-CD3 complex formation.
  • the antigen-binding module is an antibody moiety.
  • the antibody moiety is a Fab, a Fab′, a (Fab′)2, an Fv, or a single chain Fv (scFv).
  • the antigen-binding module is multispecific (such as bispecific).
  • the caTCR described herein specifically binds a target antigen, comprising a) a first TCRD comprising a first TCR-TM derived from a transmembrane domain contained in one of the amino acid sequences of SEQ ID NO: 3 and SEQ ID NO: 4 and a second TCRD comprising a second TCR-TM derived from a transmembrane domain contained in the other amino acid sequence, wherein at least one of the TCR-TMs comprises a chimeric sequence comprising a portion of consecutive amino acids from a transmembrane domain contained in SEQ ID NO: 1 or 2, and the first and second TCRDs form a TCRM that is capable of recruiting at least one TCR-associated signaling molecule; and b) an antigen-binding module that specifically binds to the target antigen, wherein the antigen-binding module is linked to the first and/or second TCRDs.
  • each of the TCR-TMs comprises, independently from one another, a chimeric sequence comprising a portion of consecutive amino acids from a transmembrane domain contained in SEQ ID NO: 1 or 2.
  • the first TCR-TM and/or the second TCR-TM each comprise, independently from one another, a chimeric sequence comprising a portion of no more than about 10 (such as no more than about 9, 8, 7, 6, 5, or fewer) consecutive amino acids from a transmembrane domain contained in SEQ ID NO: 1 or 2.
  • the chimeric sequence in the first or second TCR-TM is from a transmembrane domain contained in SEQ ID NO: 1 and the chimeric sequence in the other TCR-TM is from a transmembrane domain contained in SEQ ID NO: 2.
  • the chimeric sequence in the first TCR-TM is positioned such that it can interact with the chimeric sequence in the second TCR-TM.
  • the first TCRD further comprises a first TCR connecting peptide or a fragment thereof and/or the second TCRD further comprises a second TCR connecting peptide or a fragment thereof.
  • the first connecting peptide and the second connecting peptide each comprise, independently from one another, the amino acid sequence of a connecting peptide contained in any one of the amino acid sequences of SEQ ID NOs: 1-4, or a variant thereof. In some embodiments, the first connecting peptide and the second connecting peptide each comprise, independently from one another, the amino acid sequence of any one of SEQ ID NOs: 9-16, or a variant thereof. In some embodiments, the first and second connecting peptides are linked by a disulfide bond. In some embodiments, the first TCRD further comprises a first TCR intracellular domain and/or the second TCRD further comprises a second TCR intracellular domain.
  • the first TCR intracellular domain and the second TCR intracellular domain each comprise, independently from one another, the amino acid sequence of an intracellular domain contained in any one of SEQ ID NOs: 1-4, or a variant thereof. In some embodiments, the first TCR intracellular domain and the second TCR intracellular domain each comprise, independently from one another, the amino acid sequence of SEQ ID NO: 17 or 18, or a variant thereof. In some embodiments, the caTCR further comprises at least one accessory intracellular domain comprising a T cell co-stimulatory signaling sequence (such as from CD27, CD28, 4-1BB (CD137), OX40, CD30, or CD40).
  • a T cell co-stimulatory signaling sequence such as from CD27, CD28, 4-1BB (CD137), OX40, CD30, or CD40.
  • the caTCR further comprises a stabilization module comprising a first stabilization domain and a second stabilization domain, wherein the first and second stabilization domains have a binding affinity for each other that stabilizes the caTCR.
  • the first and second stabilization domains are linked by a disulfide bond.
  • the first and second stabilization domains comprise antibody domains, such as C H 1 and C L antibody domains, or variants thereof.
  • the TCRM is capable of recruiting at least one TCR-associated signaling molecule selected from the group consisting of CD3 ⁇ , CD3 ⁇ , and ⁇ .
  • the TCRM allows for enhanced recruitment of the at least one TCR-associated signaling molecule as compared to a TCRM comprising T cell receptor transmembrane domains having the sequences of the transmembrane domains contained in SEQ ID NOs: 3 and 4.
  • the TCRM promotes caTCR-CD3 complex formation.
  • the antigen-binding module is an antibody moiety.
  • the antibody moiety is a Fab, a Fab′, a (Fab′) 2, an Fv, or a single chain Fv (scFv).
  • the antigen-binding module is multispecific (such as bispecific).
  • the caTCR described herein specifically binds a target antigen, comprising a) a first TCRD comprising a first TCR-TM derived from one of the amino acid sequences of SEQ ID NO: 5 and SEQ ID NO: 6 and a second TCRD comprising a second TCR-TM derived from the other amino acid sequence, wherein the first and second TCRDs form a TCRM that is capable of recruiting at least one TCR-associated signaling molecule; and b) an antigen-binding module that specifically binds to the target antigen, wherein the antigen-binding module is linked to the first and/or second TCRDs.
  • both of the TCR-TMs are naturally occurring.
  • the first TCRD further comprises a first TCR connecting peptide or a fragment thereof and/or the second TCRD further comprises a second TCR connecting peptide or a fragment thereof.
  • the first connecting peptide and the second connecting peptide each comprise, independently from one another, the amino acid sequence of any one of SEQ ID NOs: 9-16, or a variant thereof.
  • the first and second connecting peptides are linked by a disulfide bond.
  • the first TCRD further comprises a first TCR intracellular domain and/or the second TCRD further comprises a second TCR intracellular domain.
  • the first TCR intracellular domain and the second TCR intracellular domain each comprise, independently from one another, the amino acid sequence of SEQ ID NO: 17 or 18, or a variant thereof.
  • the caTCR further comprises at least one accessory intracellular domain comprising a T cell co-stimulatory signaling sequence (such as from CD27, CD28, 4-1BB (CD137), OX40, CD30, or CD40).
  • the caTCR further comprises a stabilization module comprising a first stabilization domain and a second stabilization domain, wherein the first and second stabilization domains have a binding affinity for each other that stabilizes the caTCR.
  • the first and second stabilization domains are linked by a disulfide bond.
  • the first and second stabilization domains comprise antibody domains, such as C H 1 and C L antibody domains, or variants thereof.
  • the TCRM is capable of recruiting at least one TCR-associated signaling molecule selected from the group consisting of CD3 ⁇ , CD3 ⁇ , and ⁇ .
  • the TCRM allows for enhanced recruitment of the at least one TCR-associated signaling molecule as compared to a TCRM comprising T cell receptor transmembrane domains having the sequences of SEQ ID NOs: 5 and 6.
  • the TCRM promotes caTCR-CD3 complex formation.
  • the antigen-binding module is an antibody moiety.
  • the antibody moiety is a Fab, a Fab′, a (Fab′)2, an Fv, or a single chain Fv (scFv).
  • the antigen-binding module is multispecific (such as bispecific).
  • the caTCR described herein specifically binds a target antigen, comprising a) a first TCRD comprising a first TCR-TM derived from one of the amino acid sequences of SEQ ID NO: 5 and SEQ ID NO: 6 and a second TCRD comprising a second TCR-TM derived from the other amino acid sequence, wherein at least one of the TCR-TMs comprises one or more (such as 2, 3, 4, 5, or more) amino acid substitutions compared to the amino acid sequence from which it is derived, and the first and second TCRDs form a TCRM that is capable of recruiting at least one TCR-associated signaling molecule; and b) an antigen-binding module that specifically binds to the target antigen, wherein the antigen-binding module is linked to the first and/or second TCRDs.
  • each of the TCR-TMs comprises, independently from one another, one or more (such as 2, 3, 4, 5, or more) amino acid substitutions compared to the amino acid sequence from which it is derived.
  • the first TCR-TM and/or the second TCR-TM each comprise, independently from one another, no more than 5 amino acid substitutions compared to the amino acid sequences from which they are derived.
  • at least one of the TCR-TMs comprises a single amino acid substitution compared to the amino acid sequence from which it is derived.
  • each of the TCR-TMs comprises a single amino acid substitution compared to the amino acid sequence from which it is derived.
  • the first TCRD further comprises a first TCR connecting peptide or a fragment thereof and/or the second TCRD further comprises a second TCR connecting peptide or a fragment thereof.
  • the first connecting peptide and the second connecting peptide each comprise, independently from one another, the amino acid sequence of any one of SEQ ID NOs: 9-16, or a variant thereof.
  • the first and second connecting peptides are linked by a disulfide bond.
  • the first TCRD further comprises a first TCR intracellular domain and/or the second TCRD further comprises a second TCR intracellular domain.
  • the first TCR intracellular domain and the second TCR intracellular domain each comprise, independently from one another, the amino acid sequence of SEQ ID NO: 17 or 18, or a variant thereof.
  • the caTCR further comprises at least one accessory intracellular domain comprising a T cell co-stimulatory signaling sequence (such as from CD27, CD28, 4-1BB (CD137), OX40, CD30, or CD40).
  • the caTCR further comprises a stabilization module comprising a first stabilization domain and a second stabilization domain, wherein the first and second stabilization domains have a binding affinity for each other that stabilizes the caTCR.
  • the first and second stabilization domains are linked by a disulfide bond.
  • the first and second stabilization domains comprise antibody domains, such as C H 1 and C L antibody domains, or variants thereof.
  • the TCRM is capable of recruiting at least one TCR-associated signaling molecule selected from the group consisting of CD3 ⁇ , CD3 ⁇ , and ⁇ .
  • the TCRM allows for enhanced recruitment of the at least one TCR-associated signaling molecule as compared to a TCRM comprising T cell receptor transmembrane domains having the sequences of SEQ ID NOs: 5 and 6.
  • the TCRM promotes caTCR-CD3 complex formation.
  • the antigen-binding module is an antibody moiety.
  • the antibody moiety is a Fab, a Fab′, a (Fab′)2, an Fv, or a single chain Fv (scFv).
  • the antigen-binding module is multispecific (such as bispecific).
  • the caTCR described herein specifically binds a target antigen, comprising a) a first TCRD comprising a first TCR-TM derived from one of the amino acid sequences of SEQ ID NO: 5 and SEQ ID NO: 6 and a second TCRD comprising a second TCR-TM derived from the other amino acid sequence, wherein at least one of the TCR-TMs comprises a chimeric sequence comprising a portion of consecutive amino acids from SEQ ID NO: 7 or 8, and the first and second TCRDs form a TCRM that is capable of recruiting at least one TCR-associated signaling molecule; and b) an antigen-binding module that specifically binds to the target antigen, wherein the antigen-binding module is linked to the first and/or second TCRDs.
  • each of the TCR-TMs comprises, independently from one another, a chimeric sequence comprising a portion of consecutive amino acids from SEQ ID NO: 7 or 8.
  • the first TCR-TM and/or the second TCR-TM each comprise, independently from one another, a chimeric sequence comprising a portion of no more than about 10 (such as no more than about 9, 8, 7, 6, 5, or fewer) consecutive amino acids from SEQ ID NO: 7 or 8.
  • the chimeric sequence in the first or second TCR-TM is from SEQ ID NO: 7 and the chimeric sequence in the other TCR-TM is from SEQ ID NO: 8.
  • the chimeric sequence in the first TCR-TM is positioned such that it can interact with the chimeric sequence in the second TCR-TM.
  • the first TCRD further comprises a first TCR connecting peptide or a fragment thereof and/or the second TCRD further comprises a second TCR connecting peptide or a fragment thereof.
  • the first connecting peptide and the second connecting peptide each comprise, independently from one another, the amino acid sequence of any one of SEQ ID NOs: 9-16, or a variant thereof.
  • the first and second connecting peptides are linked by a disulfide bond.
  • the first TCRD further comprises a first TCR intracellular domain and/or the second TCRD further comprises a second TCR intracellular domain.
  • the first TCR intracellular domain and the second TCR intracellular domain each comprise, independently from one another, the amino acid sequence of SEQ ID NO: 17 or 18, or a variant thereof.
  • the caTCR further comprises at least one accessory intracellular domain comprising a T cell co-stimulatory signaling sequence (such as from CD27, CD28, 4-1BB (CD137), OX40, CD30, or CD40).
  • the caTCR further comprises a stabilization module comprising a first stabilization domain and a second stabilization domain, wherein the first and second stabilization domains have a binding affinity for each other that stabilizes the caTCR.
  • the first and second stabilization domains are linked by a disulfide bond.
  • the first and second stabilization domains comprise antibody domains, such as C H 1 and C L antibody domains, or variants thereof.
  • the TCRM is capable of recruiting at least one TCR-associated signaling molecule selected from the group consisting of CD3 ⁇ , CD3 ⁇ , and ⁇ .
  • the TCRM allows for enhanced recruitment of the at least one TCR-associated signaling molecule as compared to a TCRM comprising T cell receptor transmembrane domains having the sequences of SEQ ID NOs: 5 and 6.
  • the TCRM promotes caTCR-CD3 complex formation.
  • the antigen-binding module is an antibody moiety.
  • the antibody moiety is a Fab, a Fab′, a (Fab′)2, an Fv, or a single chain Fv (scFv).
  • the antigen-binding module is multispecific (such as bispecific).
  • the caTCR described herein specifically binds a target antigen, comprising a) a first TCRD comprising a first TCR-TM derived from one of the amino acid sequences of SEQ ID NO: 7 and SEQ ID NO: 8 and a second TCRD comprising a second TCR-TM derived from the other amino acid sequence, wherein the first and second TCRDs form a TCRM that is capable of recruiting at least one TCR-associated signaling molecule; and b) an antigen-binding module that specifically binds to the target antigen, wherein the antigen-binding module is linked to the first and/or second TCRDs.
  • both of the TCR-TMs are naturally occurring.
  • the first TCRD further comprises a first TCR connecting peptide or a fragment thereof and/or the second TCRD further comprises a second TCR connecting peptide or a fragment thereof.
  • the first connecting peptide and the second connecting peptide each comprise, independently from one another, the amino acid sequence of any one of SEQ ID NOs: 9-16, or a variant thereof.
  • the first and second connecting peptides are linked by a disulfide bond.
  • the first TCRD further comprises a first TCR intracellular domain and/or the second TCRD further comprises a second TCR intracellular domain.
  • the first TCR intracellular domain and the second TCR intracellular domain each comprise, independently from one another, the amino acid sequence of SEQ ID NO: 17 or 18, or a variant thereof.
  • the caTCR further comprises at least one accessory intracellular domain comprising a T cell co-stimulatory signaling sequence (such as from CD27, CD28, 4-1BB (CD137), OX40, CD30, or CD40).
  • the caTCR further comprises a stabilization module comprising a first stabilization domain and a second stabilization domain, wherein the first and second stabilization domains have a binding affinity for each other that stabilizes the caTCR.
  • the first and second stabilization domains are linked by a disulfide bond.
  • the first and second stabilization domains comprise antibody domains, such as C H 1 and C L antibody domains, or variants thereof.
  • the TCRM is capable of recruiting at least one TCR-associated signaling molecule selected from the group consisting of CD3 ⁇ , CD3 ⁇ , and ⁇ .
  • the TCRM allows for enhanced recruitment of the at least one TCR-associated signaling molecule as compared to a TCRM comprising T cell receptor transmembrane domains having the sequences of SEQ ID NOs: 7 and 8.
  • the TCRM promotes caTCR-CD3 complex formation.
  • the antigen-binding module is an antibody moiety.
  • the antibody moiety is a Fab, a Fab′, a (Fab′)2, an Fv, or a single chain Fv (scFv).
  • the antigen-binding module is multispecific (such as bispecific).
  • the caTCR described herein specifically binds a target antigen, comprising a) a first TCRD comprising a first TCR-TM derived from one of the amino acid sequences of SEQ ID NO: 7 and SEQ ID NO: 8 and a second TCRD comprising a second TCR-TM derived from the other amino acid sequence, wherein at least one of the TCR-TMs comprises one or more (such as 2, 3, 4, 5, or more) amino acid substitutions compared to the amino acid sequence from which it is derived, and the first and second TCRDs form a TCRM that is capable of recruiting at least one TCR-associated signaling molecule; and b) an antigen-binding module that specifically binds to the target antigen, wherein the antigen-binding module is linked to the first and/or second TCRDs.
  • each of the TCR-TMs comprises, independently from one another, one or more (such as 2, 3, 4, 5, or more) amino acid substitutions compared to the amino acid sequence from which it is derived.
  • the first TCR-TM and/or the second TCR-TM each comprise, independently from one another, no more than 5 amino acid substitutions compared to the amino acid sequences from which they are derived.
  • at least one of the TCR-TMs comprises a single amino acid substitution compared to the amino acid sequence from which it is derived.
  • each of the TCR-TMs comprises a single amino acid substitution compared to the amino acid sequence from which it is derived.
  • the first TCRD further comprises a first TCR connecting peptide or a fragment thereof and/or the second TCRD further comprises a second TCR connecting peptide or a fragment thereof.
  • the first connecting peptide and the second connecting peptide each comprise, independently from one another, the amino acid sequence of any one of SEQ ID NOs: 9-16, or a variant thereof.
  • the first and second connecting peptides are linked by a disulfide bond.
  • the first TCRD further comprises a first TCR intracellular domain and/or the second TCRD further comprises a second TCR intracellular domain.
  • the first TCR intracellular domain and the second TCR intracellular domain each comprise, independently from one another, the amino acid sequence of SEQ ID NO: 17 or 18, or a variant thereof.
  • the caTCR further comprises at least one accessory intracellular domain comprising a T cell co-stimulatory signaling sequence (such as from CD27, CD28, 4-1BB (CD137), OX40, CD30, or CD40).
  • the caTCR further comprises a stabilization module comprising a first stabilization domain and a second stabilization domain, wherein the first and second stabilization domains have a binding affinity for each other that stabilizes the caTCR.
  • the first and second stabilization domains are linked by a disulfide bond.
  • the first and second stabilization domains comprise antibody domains, such as C H 1 and C L antibody domains, or variants thereof.
  • the TCRM is capable of recruiting at least one TCR-associated signaling molecule selected from the group consisting of CD3 ⁇ , CD3 ⁇ , and ⁇ .
  • the TCRM allows for enhanced recruitment of the at least one TCR-associated signaling molecule as compared to a TCRM comprising T cell receptor transmembrane domains having the sequences of SEQ ID NOs: 7 and 8.
  • the TCRM promotes caTCR-CD3 complex formation.
  • the antigen-binding module is an antibody moiety.
  • the antibody moiety is a Fab, a Fab′, a (Fab′)2, an Fv, or a single chain Fv (scFv).
  • the antigen-binding module is multispecific (such as bispecific).
  • the caTCR described herein specifically binds a target antigen, comprising a) a first TCRD comprising a first TCR-TM derived from one of the amino acid sequences of SEQ ID NO: 7 and SEQ ID NO: 8 and a second TCRD comprising a second TCR-TM derived from the other amino acid sequence, wherein at least one of the TCR-TMs comprises a chimeric sequence comprising a portion of consecutive amino acids from SEQ ID NO: 5 or 6, and the first and second TCRDs form a TCRM that is capable of recruiting at least one TCR-associated signaling molecule; and b) an antigen-binding module that specifically binds to the target antigen, wherein the antigen-binding module is linked to the first and/or second TCRDs.
  • each of the TCR-TMs comprises, independently from one another, a chimeric sequence comprising a portion of consecutive amino acids from SEQ ID NO: 5 or 6.
  • the first TCR-TM and/or the second TCR-TM each comprise, independently from one another, a chimeric sequence comprising a portion of no more than about 10 (such as no more than about 9, 8, 7, 6, 5, or fewer) consecutive amino acids from SEQ ID NO: 5 or 6.
  • the chimeric sequence in the first or second TCR-TM is from SEQ ID NO: 5 and the chimeric sequence in the other TCR-TM is from SEQ ID NO: 6.
  • the chimeric sequence in the first TCR-TM is positioned such that it can interact with the chimeric sequence in the second TCR-TM.
  • the first TCRD further comprises a first TCR connecting peptide or a fragment thereof and/or the second TCRD further comprises a second TCR connecting peptide or a fragment thereof.
  • the first connecting peptide and the second connecting peptide each comprise, independently from one another, the amino acid sequence of any one of SEQ ID NOs: 9-16, or a variant thereof.
  • the first and second connecting peptides are linked by a disulfide bond.
  • the first TCRD further comprises a first TCR intracellular domain and/or the second TCRD further comprises a second TCR intracellular domain.
  • the first TCR intracellular domain and the second TCR intracellular domain each comprise, independently from one another, the amino acid sequence of SEQ ID NO: 17 or 18, or a variant thereof.
  • the caTCR further comprises at least one accessory intracellular domain comprising a T cell co-stimulatory signaling sequence (such as from CD27, CD28, 4-1BB (CD137), OX40, CD30, or CD40).
  • the caTCR further comprises a stabilization module comprising a first stabilization domain and a second stabilization domain, wherein the first and second stabilization domains have a binding affinity for each other that stabilizes the caTCR.
  • the first and second stabilization domains are linked by a disulfide bond.
  • the first and second stabilization domains comprise antibody domains, such as C H 1 and C L antibody domains, or variants thereof.
  • the TCRM is capable of recruiting at least one TCR-associated signaling molecule selected from the group consisting of CD3 ⁇ , CD3 ⁇ , and ⁇ .
  • the TCRM allows for enhanced recruitment of the at least one TCR-associated signaling molecule as compared to a TCRM comprising T cell receptor transmembrane domains having the sequences of SEQ ID NOs: 7 and 8.
  • the TCRM promotes caTCR-CD3 complex formation.
  • the antigen-binding module is an antibody moiety.
  • the antibody moiety is a Fab, a Fab′, a (Fab′)2, an Fv, or a single chain Fv (scFv).
  • the antigen-binding module is multispecific (such as bispecific).
  • the TCR-TMs of a caTCR are derived from a T cell receptor, wherein at least one of the TCR-TMs is non-naturally occurring.
  • Non-naturally occurring TCR-TMs derived from a T cell receptor include a transmembrane domain from a T cell receptor that has been modified by substitution of one or more amino acids.
  • at least one of the substituted amino acids is substituted with a residue more hydrophobic than the corresponding unsubstituted residue.
  • each of the substituted amino acids is substituted with a residue more hydrophobic than the corresponding unsubstituted residue.
  • At least one of the substituted amino acids is proximal (either in primary sequence or spatially) to an amino acid in the TCRM involved in binding CD3.
  • at least one of the substituted amino acids is separated from an amino acid in the TCRM involved in binding CD3 by no more than 3 (such as 0, 1, 2, or 3) amino acids.
  • at least one of the substituted amino acids is separated from an amino acid in the TCRM involved in binding CD3 by no more than about 15 (such as no more than about any of 14, 12, 10, 8, 6, 4, 2, or 1) angstroms.
  • each of the substituted amino acids is proximal to an amino acid in the TCRM involved in binding CD3.
  • a non-naturally occurring TCR-TM derived from a T cell receptor comprises, consists essentially of, or consists of the transmembrane domain of an ⁇ , ⁇ , ⁇ , or ⁇ TCR subunit modified by substitution of one or more amino acid residues.
  • the transmembrane domain of the TCR subunit is modified by substitution of no more than 5 amino acid residues.
  • the transmembrane domain of the TCR subunit is modified by substitution of a single amino acid residue.
  • at least one of the substituted amino acids is substituted with a residue more hydrophobic than the corresponding unsubstituted residue.
  • each of the substituted amino acids is substituted with a residue more hydrophobic than the corresponding unsubstituted residue. In some embodiments, at least one of the substituted amino acids is proximal to an amino acid in the TCRM involved in binding CD3. In some embodiments, each of the substituted amino acids is proximal to an amino acid in the TCRM involved in binding CD3.
  • a non-naturally occurring TCR-TM derived from a T cell receptor described herein comprises, consists essentially of, or consists of the transmembrane domain of an ⁇ TCR subunit comprising the amino acid sequence of a transmembrane domain contained in SEQ ID NO: 1 (e.g., SEQ ID NO: 5), modified by substitution of one or more amino acid residues.
  • the transmembrane domain of the ⁇ TCR subunit is modified by substitution of no more than 5 amino acid residues in the transmembrane domain contained in SEQ ID NO: 1.
  • the transmembrane domain of the ⁇ TCR subunit is modified by substitution of a single amino acid residue in the transmembrane domain contained in SEQ ID NO: 1.
  • at least one of the substituted amino acids is substituted with a residue more hydrophobic than the corresponding unsubstituted residue.
  • each of the substituted amino acids is substituted with a residue more hydrophobic than the corresponding unsubstituted residue.
  • at least one of the substituted amino acids is proximal to an amino acid in the TCRM involved in binding CD3.
  • each of the substituted amino acids is proximal to an amino acid in the TCRM involved in binding CD3.
  • a non-naturally occurring TCR-TM derived from a T cell receptor described herein comprises, consists essentially of, or consists of the transmembrane domain of an a TCR subunit comprising the amino acid sequence of SEQ ID NO: 5, modified by substitution of one or more amino acid residues.
  • the transmembrane domain of the a TCR subunit is modified by substitution of no more than 5 amino acid residues in SEQ ID NO: 5.
  • the transmembrane domain of the a TCR subunit is modified by substitution of a single amino acid residue in SEQ ID NO: 5.
  • At least one of the substituted amino acids is substituted with a residue more hydrophobic than the corresponding unsubstituted residue. In some embodiments, each of the substituted amino acids is substituted with a residue more hydrophobic than the corresponding unsubstituted residue. In some embodiments, at least one of the substituted amino acids is proximal to an amino acid in the TCRM involved in binding CD3. In some embodiments, each of the substituted amino acids is proximal to an amino acid in the TCRM involved in binding CD3.
  • a non-naturally occurring TCR-TM derived from a T cell receptor described herein comprises, consists essentially of, or consists of the transmembrane domain of a ⁇ TCR subunit comprising the amino acid sequence of a transmembrane domain contained in SEQ ID NO: 2 (e.g., SEQ ID NO: 6), modified by substitution of one or more amino acid residues.
  • the transmembrane domain of the ⁇ TCR subunit is modified by substitution of no more than 5 amino acid residues in the transmembrane domain contained in SEQ ID NO: 2.
  • the transmembrane domain of the ⁇ TCR subunit is modified by substitution of a single amino acid residue in the transmembrane domain contained in SEQ ID NO: 2.
  • at least one of the substituted amino acids is substituted with a residue more hydrophobic than the corresponding unsubstituted residue.
  • each of the substituted amino acids is substituted with a residue more hydrophobic than the corresponding unsubstituted residue.
  • at least one of the substituted amino acids is proximal to an amino acid in the TCRM involved in binding CD3.
  • each of the substituted amino acids is proximal to an amino acid in the TCRM involved in binding CD3.
  • a non-naturally occurring TCR-TM derived from a T cell receptor described herein comprises, consists essentially of, or consists of the transmembrane domain of a ⁇ TCR subunit comprising the amino acid sequence of SEQ ID NO: 6, modified by substitution of one or more amino acid residues.
  • the transmembrane domain of the ⁇ TCR subunit is modified by substitution of no more than 5 amino acid residues in SEQ ID NO: 6.
  • the transmembrane domain of the ⁇ TCR subunit is modified by substitution of a single amino acid residue in SEQ ID NO: 6.
  • At least one of the substituted amino acids is substituted with a residue more hydrophobic than the corresponding unsubstituted residue. In some embodiments, each of the substituted amino acids is substituted with a residue more hydrophobic than the corresponding unsubstituted residue. In some embodiments, at least one of the substituted amino acids is proximal to an amino acid in the TCRM involved in binding CD3. In some embodiments, each of the substituted amino acids is proximal to an amino acid in the TCRM involved in binding CD3.
  • a non-naturally occurring TCR-TM derived from a T cell receptor described herein comprises, consists essentially of, or consists of the transmembrane domain of a ⁇ TCR subunit comprising the amino acid sequence of a transmembrane domain contained in SEQ ID NO: 3 (e.g., SEQ ID NO: 7), modified by substitution of one or more amino acid residues.
  • the transmembrane domain of the ⁇ TCR subunit is modified by substitution of no more than 5 amino acid residues in the transmembrane domain contained in SEQ ID NO: 3.
  • the transmembrane domain of the ⁇ TCR subunit is modified by substitution of a single amino acid residue in the transmembrane domain contained in SEQ ID NO: 3.
  • at least one of the substituted amino acids is substituted with a residue more hydrophobic than the corresponding unsubstituted residue.
  • each of the substituted amino acids is substituted with a residue more hydrophobic than the corresponding unsubstituted residue.
  • at least one of the substituted amino acids is proximal to an amino acid in the TCRM involved in binding CD3.
  • each of the substituted amino acids is proximal to an amino acid in the TCRM involved in binding CD3.
  • the non-naturally occurring TCR-TM comprises the amino acid sequence of the transmembrane domain contained in SEQ ID NO: 3 (e.g., SEQ ID NO: 7), modified by one or more substitutions (such as substitutions with more hydrophobic residues) in amino acids corresponding to the following amino acids in SEQ ID NO: 7: L4, M6, V12, N15, F245, and L25.
  • the non-naturally occurring TCR-TM comprises the amino acid sequence of the transmembrane domain contained in SEQ ID NO: 3 modified by substitutions (such as substitutions with more hydrophobic residues) in amino acids corresponding to V12 and N15 in SEQ ID NO: 7.
  • the non-naturally occurring TCR-TM comprises the amino acid sequence of the transmembrane domain contained in SEQ ID NO: 3 modified by one or more substitutions corresponding to the following substitutions in SEQ ID NO: 7: L4C, M6V, V12F, N15S, F245S, and L25S.
  • the non-naturally occurring TCR-TM comprises the amino acid sequence of the transmembrane domain contained in SEQ ID NO: 3 modified by substitutions corresponding to V12F and N15S substitutions in SEQ ID NO: 7.
  • the non-naturally occurring TCR-TM comprises the amino acid sequence of any one of SEQ ID NOs: 9-13.
  • a non-naturally occurring TCR-TM derived from a T cell receptor described herein comprises, consists essentially of, or consists of the transmembrane domain of a ⁇ TCR subunit comprising the amino acid sequence of SEQ ID NO: 7, modified by substitution of one or more amino acid residues.
  • the transmembrane domain of the ⁇ TCR subunit is modified by substitution of no more than 5 amino acid residues in SEQ ID NO: 7.
  • the transmembrane domain of the ⁇ TCR subunit is modified by substitution of a single amino acid residue in SEQ ID NO: 7.
  • At least one of the substituted amino acids is substituted with a residue more hydrophobic than the corresponding unsubstituted residue. In some embodiments, each of the substituted amino acids is substituted with a residue more hydrophobic than the corresponding unsubstituted residue. In some embodiments, at least one of the substituted amino acids is proximal to an amino acid in the TCRM involved in binding CD3. In some embodiments, each of the substituted amino acids is proximal to an amino acid in the TCRM involved in binding CD3.
  • the non-naturally occurring TCR-TM comprises the amino acid sequence of SEQ ID NO: 7 modified by one or more substitutions (such as substitutions with more hydrophobic residues) in amino acids corresponding to the following amino acids in SEQ ID NO: 7: L4, M6, V12, N15, F245, and L25.
  • the non-naturally occurring TCR-TM comprises the amino acid sequence of SEQ ID NO: 7 modified by substitutions (such as substitutions with more hydrophobic residues) in amino acids corresponding to V12 and N15 in SEQ ID NO: 7.
  • the non-naturally occurring TCR-TM comprises the amino acid sequence of SEQ ID NO: 7 modified by one or more substitutions corresponding to the following substitutions in SEQ ID NO: 7: L4C, M6V, V12F, N15S, F245S, and L25S.
  • the non-naturally occurring TCR-TM comprises the amino acid sequence of SEQ ID NO: 7 modified by substitutions corresponding to V12F and N15S substitutions in SEQ ID NO: 7.
  • the non-naturally occurring TCR-TM comprises the amino acid sequence of any one of SEQ ID NOs: 9-13.
  • a non-naturally occurring TCR-TM derived from a T cell receptor described herein comprises, consists essentially of, or consists of the transmembrane domain of a ⁇ TCR subunit comprising the amino acid sequence of a transmembrane domain contained in SEQ ID NO: 4 (e.g., SEQ ID NO: 8), modified by substitution of one or more amino acid residues.
  • the transmembrane domain of the ⁇ TCR subunit is modified by substitution of no more than 5 amino acid residues in the transmembrane domain contained in SEQ ID NO: 4.
  • the transmembrane domain of the ⁇ TCR subunit is modified by substitution of a single amino acid residue in the transmembrane domain contained in SEQ ID NO: 4.
  • at least one of the substituted amino acids is substituted with a residue more hydrophobic than the corresponding unsubstituted residue.
  • each of the substituted amino acids is substituted with a residue more hydrophobic than the corresponding unsubstituted residue.
  • at least one of the substituted amino acids is proximal to an amino acid in the TCRM involved in binding CD3.
  • each of the substituted amino acids is proximal to an amino acid in the TCRM involved in binding CD3.
  • the non-naturally occurring TCR-TM comprises the amino acid sequence of the transmembrane domain contained in SEQ ID NO: 4 (e.g., SEQ ID NO: 8), modified by one or more substitutions (such as substitutions with more hydrophobic residues) in amino acids corresponding to the following amino acids in SEQ ID NO: 8: Y1, Y2, M3, L5, L8, V12, V13, F15, A16, I18, C19, C20, and C21.
  • the non-naturally occurring TCR-TM comprises the amino acid sequence of the transmembrane domain contained in SEQ ID NO: 4 modified by substitutions (such as substitutions with more hydrophobic residues) in amino acids corresponding to Y2, M3, A16, and I18 in SEQ ID NO: 8. In some embodiments, the non-naturally occurring TCR-TM comprises the amino acid sequence of the transmembrane domain contained in SEQ ID NO: 4 modified by substitutions (such as substitutions with more hydrophobic residues) in amino acids corresponding to L8, V12, and F15 in SEQ ID NO: 8.
  • the non-naturally occurring TCR-TM comprises the amino acid sequence of the transmembrane domain contained in SEQ ID NO: 4 modified by one or more substitutions corresponding to the following substitutions in SEQ ID NO: 8: Y1Q, Y2L, Y2I, M3V, M3I, L5C, L8F, V12F, V13Y, F15S, A16V, A16I, I18V, I18L, C19M, C20M, and C21G.
  • the non-naturally occurring TCR-TM comprises the amino acid sequence of the transmembrane domain contained in SEQ ID NO: 4 modified by substitutions corresponding to Y2L, M3V, A16V, and I18V substitutions in SEQ ID NO: 8. In some embodiments, the non-naturally occurring TCR-TM comprises the amino acid sequence of the transmembrane domain contained in SEQ ID NO: 4 modified by substitutions corresponding to Y2I, M3I, A16I, and I18L substitutions in SEQ ID NO: 8.
  • the non-naturally occurring TCR-TM comprises the amino acid sequence of the transmembrane domain contained in SEQ ID NO: 4 modified by substitutions corresponding to L8F, V12F, and F15S substitutions in SEQ ID NO: 8. In some embodiments, the non-naturally occurring TCR-TM comprises the amino acid sequence of any one of SEQ ID NOs: 14-26.
  • a non-naturally occurring TCR-TM derived from a T cell receptor described herein comprises, consists essentially of, or consists of the transmembrane domain of a ⁇ TCR subunit comprising the amino acid sequence of SEQ ID NO: 8, modified by substitution of one or more amino acid residues.
  • the transmembrane domain of the ⁇ TCR subunit is modified by substitution of no more than 5 amino acid residues in SEQ ID NO: 8.
  • the transmembrane domain of the ⁇ TCR subunit is modified by substitution of a single amino acid residue in SEQ ID NO: 8.
  • At least one of the substituted amino acids is substituted with a residue more hydrophobic than the corresponding unsubstituted residue. In some embodiments, each of the substituted amino acids is substituted with a residue more hydrophobic than the corresponding unsubstituted residue. In some embodiments, at least one of the substituted amino acids is proximal to an amino acid in the TCRM involved in binding CD3. In some embodiments, each of the substituted amino acids is proximal to an amino acid in the TCRM involved in binding CD3.
  • the non-naturally occurring TCR-TM comprises the amino acid sequence of SEQ ID NO: 8 modified by one or more substitutions (such as substitutions with more hydrophobic residues) in amino acids corresponding to the following amino acids in SEQ ID NO: 8: Y1, Y2, M3, L5, L8, V12, V13, F15, A16, I18, C19, C20, and C21.
  • the non-naturally occurring TCR-TM comprises the amino acid sequence of SEQ ID NO: 8 modified by substitutions (such as substitutions with more hydrophobic residues) in amino acids corresponding to Y2, M3, A16, and I18 in SEQ ID NO: 8.
  • the non-naturally occurring TCR-TM comprises the amino acid sequence of SEQ ID NO: 8 modified by substitutions (such as substitutions with more hydrophobic residues) in amino acids corresponding to L8, V12, and F15 in SEQ ID NO: 8.
  • the non-naturally occurring TCR-TM comprises the amino acid sequence of SEQ ID NO: 8 modified by one or more substitutions corresponding to the following substitutions in SEQ ID NO: 8: Y1Q, Y2L, Y2I, M3V, M3I, L5C, L8F, V12F, V13Y, F15S, A16V, A161, I18V, I18L, C19M, C20M, and C21G.
  • the non-naturally occurring TCR-TM comprises the amino acid sequence of SEQ ID NO: 8 modified by substitutions corresponding to Y2L, M3V, A16V, and I18V substitutions in SEQ ID NO: 8. In some embodiments, the non-naturally occurring TCR-TM comprises the amino acid sequence of SEQ ID NO: 8 modified by substitutions corresponding to Y2I, M3I, A161, and I18L substitutions in SEQ ID NO: 8. In some embodiments, the non-naturally occurring TCR-TM comprises the amino acid sequence of SEQ ID NO: 8 modified by substitutions corresponding to L8F, V12F, and F15S substitutions in SEQ ID NO: 8. In some embodiments, the non-naturally occurring TCR-TM comprises the amino acid sequence of any one of SEQ ID NOs: 14-26.
  • the caTCR described herein specifically binds a target antigen, comprising a) a first TCRD comprising a first TCR-TM comprising, consisting essentially of, or consisting of any one of the amino acid sequences of SEQ ID NOs: 7 and 9-13, and a second TCRD comprising a second TCR-TM comprising, consisting essentially of, or consisting of the amino acid sequence of any one of SEQ ID NOs: 8 and 14-26, wherein the first and second TCRDs form a TCRM that is capable of recruiting at least one TCR-associated signaling molecule; and b) an antigen-binding module that specifically binds to the target antigen, wherein the antigen-binding module is linked to the first and/or second TCRDs.
  • the first TCR-TM and second TCR-TM are selected according to any of the caTCRs listed in Table 2.
  • the first TCRD further comprises a first TCR connecting peptide or a fragment thereof and/or the second TCRD further comprises a second TCR connecting peptide or a fragment thereof.
  • the first connecting peptide comprises the amino acid sequence SEQ ID NO: 31 or 32, or a variant thereof
  • the second connecting peptide comprises the amino acid sequence SEQ ID NO: 33 or 34, or a variant thereof.
  • the first and second connecting peptides are linked by a disulfide bond.
  • the first TCRD further comprises a first TCR intracellular domain and/or the second TCRD further comprises a second TCR intracellular domain.
  • the second TCR intracellular domain comprises the amino acid sequence of SEQ ID NO: 36, or a variant thereof.
  • the caTCR further comprises at least one accessory intracellular domain comprising a T cell co-stimulatory signaling sequence (such as from CD27, CD28, 4-1BB (CD137), OX40, CD30, or CD40).
  • the caTCR further comprises a stabilization module comprising a first stabilization domain and a second stabilization domain, wherein the first and second stabilization domains have a binding affinity for each other that stabilizes the caTCR.
  • the first and second stabilization domains are linked by a disulfide bond.
  • the first and second stabilization domains comprise antibody domains, such as C H I and C L antibody domains, or variants thereof.
  • the TCRM is capable of recruiting at least one TCR-associated signaling molecule selected from the group consisting of CD3 ⁇ , CD3 ⁇ , and ⁇ .
  • the TCRM allows for enhanced recruitment of the at least one TCR-associated signaling molecule as compared to a TCRM comprising T cell receptor transmembrane domains having the sequences of SEQ ID NOs: 7 and 8.
  • the TCRM promotes caTCR-CD3 complex formation.
  • the antigen-binding module is an antibody moiety.
  • the antibody moiety is a Fab, a Fab′, a (Fab′)2, an Fv, or a single chain Fv (scFv).
  • the antigen-binding module is multispecific (such as bispecific).
  • the antigen-binding module is an antibody moiety.
  • the antibody moiety is selected from the group consisting of a Fab, a Fab′, a (Fab′)2, an Fv, and a single chain Fv (scFv).
  • the caTCR comprises the first TCRD linked to the first or second antibody moiety chain and the second TCRD linked to the other antibody moiety chain.
  • the antibody moiety specifically binds a cell surface antigen including, without limitation, CD19, CD20, CD22, CD47, GPC-3, ROR1, ROR2, BCMA, GPRC5D, and FCRL5, including variants or mutants thereof.
  • the antibody moiety specifically binds a peptide/MHC complex, wherein the peptide is derived from a protein including, without limitation, WT-1, AFP, HPV16-E7, NY-ESO-1, PRAME, EBV-LMP2A, HIV-1, KRAS, Histone H3.3, and PSA, including variants or mutants thereof.
  • the antigen-binding module is an antibody moiety comprising C H 1 and C L domains.
  • the C H 1 domain is derived from an IgG (e.g., IgG1, IgG2, IgG3, or IgG4) heavy chain, optionally human.
  • the C H 1 domain is a variant comprising one or more modifications (e.g., amino acid substitutions, insertions, and/or deletions) compared to the sequence from which it is derived.
  • the C H 1 domain comprises the amino acid sequence of any one of SEQ ID NOs: 37-47, or a variant thereof.
  • the C H 1 domain comprises the amino acid sequence of SEQ ID NO: 37, or a variant thereof.
  • the C L domain is derived from a kappa or lambda light chain, optionally human.
  • the C L domain is a variant comprising one or more modifications (e.g., amino acid substitutions, insertions, and/or deletions) compared to the sequence from which it is derived.
  • the C L domain comprises the amino acid sequence of SEQ ID NO: 48, or a variant thereof.
  • the C H 1 and/or C L domains comprise one or more modifications that do not substantially alter their binding affinity for each other.
  • the C H 1 and/or C L domains comprise one or more modifications that increase their binding affinity for each other and/or introduce a non-naturally occurring disulfide bond.
  • the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for the target antigen.
  • the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for CD19 (see, e.g., WO2017066136A2).
  • the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for CD19 (e.g., V H domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 56 and/or V L domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 57, or CDRs contained therein).
  • V H domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 56 and/or V L domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 57, or CDRs contained therein.
  • the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for CD20 (e.g., V H domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 58 and/or V L domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 59, or CDRs contained therein).
  • the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for CD22 (see, e.g., U.S. Ser. No. 62/650,955 filed Mar.
  • the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for CD22 (e.g., V H domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 78 and/or V L domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 79, or CDRs contained therein).
  • the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for GPC3 (see, e.g., U.S. Ser. No.
  • the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for GPC3 (e.g., V H domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 60 and/or V L domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 61, or CDRs contained therein).
  • V H domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 60
  • V L domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 61, or CDRs contained therein.
  • the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for ROR1 (see, e.g., WO2016/187220 and WO2016/187216). In some embodiments, the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for ROR2 (see, e.g., WO2016/142768). In some embodiments, the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for BCMA (see, e.g., WO2016/090327 and WO2016/090320).
  • the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for GPRC5D (see, e.g., WO2016/090329 and WO2016/090312). In some embodiments, the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for FCRL5 (see, e.g., WO2016/090337).
  • the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for WT-1 (see, e.g., WO2012/135854, WO2015/070078, and WO2015/070061). In some embodiments, the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for AFP (see, e.g., WO2016/161390). In some embodiments, the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for HPV16-E7 (see, e.g., WO2016/182957).
  • the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for NY-ESO-1 (see, e.g., WO2016/210365). In some embodiments, the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for PRAME (see, e.g., WO2016/191246). In some embodiments, the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for EBV-LMP2A (see, e.g., WO2016/201124).
  • the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for KRAS (see, e.g., WO2016/154047). In some embodiments, the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for PSA (see, e.g., WO2017/015634). In some embodiments, the antibody moiety is a Fab comprising one Fab chain comprising a V H domain and a C H 1 domain, and another Fab chain comprising a V L domain and a C L domain.
  • the C H 1 domain comprises the amino acid sequence of any one of SEQ ID NOs: 37-47 and/or the C L domain comprises the amino acid sequence of SEQ ID NO: 48.
  • the C H 1 domain comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 37 and the C L domain comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 48.
  • the caTCR described herein specifically binds a target antigen, comprising a) a first TCRD comprising a first TCR-TM derived from one of the transmembrane domains of a TCR and a second TCRD comprising a second TCR-TM derived from the other transmembrane domain of the TCR, wherein the first and second TCRDs form a TCRM that is capable of recruiting at least one TCR-associated signaling molecule; and b) an antibody moiety that specifically binds to the target antigen, wherein the antibody moiety is linked to the first and/or second TCRDs.
  • the antibody moiety is selected from the group consisting of a Fab, a Fab′, a (Fab′)2, an Fv, and a single chain Fv (scFv).
  • the antigen-binding module is multispecific (such as bispecific).
  • the antibody moiety specifically binds a cell surface antigen including, without limitation, CD19, CD20, CD22, CD47, GPC-3, ROR1, ROR2, BCMA, GPRC5D, and FCRL5, including variants or mutants thereof.
  • the antibody moiety specifically binds a peptide/MHC complex, wherein the peptide is derived from a protein including, without limitation, WT-1, AFP, HPV16-E7, NY-ESO-1, PRAME, EBV-LMP2A, HIV-1, KRAS, Histone H3.3, and PSA, including variants or mutants thereof.
  • the caTCR further comprises a stabilization module comprising a first stabilization domain and a second stabilization domain, wherein the first and second stabilization domains have a binding affinity for each other that stabilizes the caTCR.
  • the stabilization module is located between the TCRM and the antibody moiety.
  • both of the TCR-TMs are naturally occurring.
  • at least one of the TCR-TMs is non-naturally occurring.
  • the caTCR described herein specifically binds a target antigen, comprising a) a first TCRD comprising a first TCR-TM comprising, consisting essentially of, or consisting of any one of the amino acid sequences of SEQ ID NOs: 7 and 9-13 and a second TCRD comprising a second TCR-TM comprising, consisting essentially of, or consisting of the amino acid sequence of any one of SEQ ID NOs: 8 and 14-26, wherein the first and second TCRDs form a TCRM that is capable of recruiting at least one TCR-associated signaling molecule; and b) an antibody moiety that specifically binds to the target antigen, wherein the antibody moiety is linked to the first and/or second TCRDs.
  • the first TCR-TM and second TCR-TM are selected according to any of the caTCRs listed in Table 2.
  • the antibody moiety is selected from the group consisting of a Fab, a Fab′, a (Fab′)2, an Fv, and a single chain Fv (scFv).
  • the antigen-binding module is multispecific (such as bispecific).
  • the antibody moiety specifically binds a cell surface antigen including, without limitation, CD19, CD20, CD22, CD47, GPC-3, ROR1, ROR2, BCMA, GPRC5D, and FCRL5, including variants or mutants thereof.
  • the antibody moiety specifically binds a peptide/MHC complex, wherein the peptide is derived from a protein including, without limitation, WT-1, AFP, HPV16-E7, NY-ESO-1, PRAME, EBV-LMP2A, HIV-1, KRAS, Histone H3.3, and PSA, including variants or mutants thereof.
  • the first TCRD further comprises a first TCR connecting peptide or a fragment thereof and/or the second TCRD further comprises a second TCR connecting peptide or a fragment thereof.
  • the first connecting peptide comprises the amino acid sequence SEQ ID NO: 31 or 32, or a variant thereof
  • the second connecting peptide comprises the amino acid sequence SEQ ID NO: 33 or 34, or a variant thereof.
  • the first and second connecting peptides are linked by a disulfide bond.
  • the first TCRD further comprises a first TCR intracellular domain and/or the second TCRD further comprises a second TCR intracellular domain.
  • the second TCR intracellular domain comprises the amino acid sequence of SEQ ID NO: 36, or a variant thereof.
  • the caTCR further comprises at least one accessory intracellular domain comprising a T cell co-stimulatory signaling sequence (such as from CD27, CD28, 4-1BB (CD137), OX40, CD30, or CD40).
  • the caTCR further comprises a stabilization module comprising a first stabilization domain and a second stabilization domain, wherein the first and second stabilization domains have a binding affinity for each other that stabilizes the caTCR.
  • the first and second stabilization domains are linked by a disulfide bond.
  • the TCRM is capable of recruiting at least one TCR-associated signaling molecule selected from the group consisting of CD3 ⁇ , CD3 ⁇ , and ⁇ .
  • the TCRM allows for enhanced recruitment of the at least one TCR-associated signaling molecule as compared to a TCRM comprising T cell receptor transmembrane domains having the sequences of SEQ ID NOs: 7 and 8.
  • the TCRM promotes caTCR-CD3 complex formation.
  • both of the TCR-TMs are naturally occurring.
  • at least one of the TCR-TMs is non-naturally occurring.
  • the caTCR described herein specifically binds a target antigen, comprising a) a first TCRD comprising a first TCR-TM and a second TCRD comprising a second TCR-TM, wherein the first and second TCR-TMs comprise, consist essentially of, or consist of the amino acid sequences of SEQ ID NOs: 7 and 8, 9 and 8, 7 and 14, 7 and 15, 7 and 16, 10 and 16, 7 and 17, 7 and 18, 7 and 19, 7 and 20, 7 and 21, 7 and 22, 11 and 23, 12 and 24, 7 and 25, or 13 and 26, respectively, and wherein the first and second TCRDs form a TCRM that is capable of recruiting at least one TCR-associated signaling molecule; and b) an antibody moiety that specifically binds to the target antigen, wherein the antibody moiety is linked to the first and/or second TCRDs.
  • the caTCR described herein specifically binds a target antigen, comprising a) a first TCRD comprising a first TCR-TM comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 7, and a second TCRD comprising a second TCR-TM comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 8, wherein the first and second TCRDs form a TCRM that is capable of recruiting at least one TCR-associated signaling molecule; and b) an antibody moiety that specifically binds to the target antigen, wherein the antibody moiety is linked to the first and/or second TCRDs.
  • the antibody moiety is selected from the group consisting of a Fab, a Fab′, a (Fab′)2, an Fv, and a single chain Fv (scFv).
  • the antigen-binding module is multispecific (such as bispecific).
  • the antibody moiety specifically binds a cell surface antigen including, without limitation, CD19, CD20, CD22, CD47, GPC-3, ROR1, ROR2, BCMA, GPRC5D, and FCRL5, including variants or mutants thereof.
  • the antibody moiety specifically binds a peptide/MHC complex, wherein the peptide is derived from a protein including, without limitation, WT-1, AFP, HPV16-E7, NY-ESO-1, PRAME, EBV-LMP2A, HIV-1, KRAS, Histone H3.3, and PSA, including variants or mutants thereof.
  • the first TCRD further comprises a first TCR connecting peptide or a fragment thereof and/or the second TCRD further comprises a second TCR connecting peptide or a fragment thereof.
  • the first connecting peptide comprises the amino acid sequence SEQ ID NO: 31 or 32, or a variant thereof
  • the second connecting peptide comprises the amino acid sequence SEQ ID NO: 33 or 34, or a variant thereof.
  • the first and second connecting peptides are linked by a disulfide bond.
  • the first TCRD further comprises a first TCR intracellular domain and/or the second TCRD further comprises a second TCR intracellular domain.
  • the second TCR intracellular domain comprises the amino acid sequence of SEQ ID NO: 36, or a variant thereof.
  • the caTCR further comprises at least one accessory intracellular domain comprising a T cell co-stimulatory signaling sequence (such as from CD27, CD28, 4-1BB (CD137), OX40, CD30, or CD40).
  • the caTCR further comprises a stabilization module comprising a first stabilization domain and a second stabilization domain, wherein the first and second stabilization domains have a binding affinity for each other that stabilizes the caTCR.
  • the first and second stabilization domains are linked by a disulfide bond.
  • the TCRM is capable of recruiting at least one TCR-associated signaling molecule selected from the group consisting of CD3 ⁇ , CD3 ⁇ , and ⁇ .
  • the TCRM allows for enhanced recruitment of the at least one TCR-associated signaling molecule as compared to a TCRM comprising T cell receptor transmembrane domains having the sequences of SEQ ID NOs: 7 and 8.
  • the TCRM promotes caTCR-CD3 complex formation.
  • the caTCR described herein specifically binds a target antigen, comprising a) a first polypeptide chain comprising a first antigen-binding domain comprising a first Fab chain linked to a first TCRD comprising a first TCR-TM derived from one of the transmembrane domains of a TCR; and b) a second polypeptide chain comprising a second antigen-binding domain comprising a second Fab chain linked to a second TCRD comprising a second TCR-TM derived from the other transmembrane domain of the TCR, wherein the first and second TCRDs form a TCRM that is capable of recruiting at least one TCR-associated signaling molecule, and wherein the first and second Fab chains form a Fab-like antigen-binding module that specifically binds the target antigen.
  • the caTCR comprises a) a first polypeptide chain comprising a first Fab chain comprising V H and C H 1 antibody domains linked to the first TCRD and b) a second Fab chain comprising V L and C L antibody domains linked to the second TCRD.
  • the caTCR comprises a) a first Fab chain comprising V L and C L antibody domains linked to the first TCRD and b) a second Fab chain comprising V H and C H 1 antibody domains linked to the second TCRD.
  • the C H 1 and/or C L domains comprise one or more modifications that increase the binding affinity of the Fab chains for each other.
  • the C H 1 and C L domains are swapped, such that one of the Fab chains comprises V H and C L antibody domains and the other Fab chain comprises V L and C H 1 antibody domains.
  • the Fab-like antigen-binding module specifically binds a cell surface antigen including, without limitation, CD19, CD20, CD22, CD47, GPC-3, ROR1, ROR2, BCMA, GPRC5D, and FCRL5, including variants or mutants thereof.
  • the Fab-like antigen-binding module specifically binds a peptide/MHC complex, wherein the peptide is derived from a protein including, without limitation, WT-1, AFP, HPV16-E7, NY-ESO-1, PRAME, EBV-LMP2A, HIV-1, KRAS, Histone H3.3, and PSA, including variants or mutants thereof.
  • the caTCR further comprises a stabilization module comprising a first stabilization domain and a second stabilization domain, wherein the first and second stabilization domains have a binding affinity for each other that stabilizes the caTCR.
  • the first or second stabilization domain is located between first TCRD and its linked Fab chain and the other stabilization domain is located between the second TCRD and its linked Fab chain.
  • both of the TCR-TMs are naturally occurring. In some embodiments, at least one of the TCR-TMs is non-naturally occurring.
  • the caTCR described herein specifically binds a target antigen, comprising a) a first polypeptide chain comprising a first antigen-binding domain comprising a first Fab chain linked to a first TCRD comprising a first TCR-TM comprising, consisting essentially of, or consisting of any one of the amino acid sequences of SEQ ID NOs: 7 and 9-13; and b) a second polypeptide chain comprising a second antigen-binding domain comprising a second Fab chain linked to a second TCRD comprising a second TCR-TM comprising, consisting essentially of, or consisting of the amino acid sequence of any one of SEQ ID NOs: 8 and 14-26, wherein the first and second TCRDs form a TCRM that is capable of recruiting at least one TCR-associated signaling molecule, and wherein the first and second Fab chains form a Fab-like antigen-binding module that specifically binds the target antigen.
  • the first TCR-TM and second TCR-TM are selected according to any of the caTCRs listed in Table 2.
  • a) the first Fab chain comprises V H and C H 1 antibody domains and the second Fab chain comprises V L and C L antibody domains; or b) the first Fab chain comprises V L and C L antibody domains and the second Fab chain comprises V H and C H 1 antibody domains.
  • the C H 1 domain comprises the amino acid sequence of any one of SEQ ID NOs: 37-47 and/or the C L domain comprises the amino acid sequence of SEQ ID NO: 48.
  • the C H 1 domain comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 37 and the C L domain comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 48.
  • the Fab-like antigen-binding module specifically binds a cell surface antigen including, without limitation, CD19, CD20, CD22, CD47, GPC-3, ROR1, ROR2, BCMA, GPRC5D, and FCRL5, including variants or mutants thereof.
  • the Fab-like antigen-binding module specifically binds a peptide/MEC complex, wherein the peptide is derived from a protein including, without limitation, WT-1, AFP, HPV16-E7, NY-ESO-1, PRAME, EBV-LMP2A, HIV-1, KRAS, Histone H3.3, and PSA, including variants or mutants thereof.
  • the first TCRD further comprises a first TCR connecting peptide or a fragment thereof and/or the second TCRD further comprises a second TCR connecting peptide or a fragment thereof.
  • the first connecting peptide comprises the amino acid sequence SEQ ID NO: 31 or 32, or a variant thereof
  • the second connecting peptide comprises the amino acid sequence SEQ ID NO: 33 or 34, or a variant thereof.
  • the first and second connecting peptides are linked by a disulfide bond.
  • the first TCRD further comprises a first TCR intracellular domain and/or the second TCRD further comprises a second TCR intracellular domain.
  • the second TCR intracellular domain comprises the amino acid sequence of SEQ ID NO: 36, or a variant thereof.
  • the caTCR further comprises at least one accessory intracellular domain comprising a T cell co-stimulatory signaling sequence (such as from CD27, CD28, 4-1BB (CD137), OX40, CD30, or CD40).
  • the caTCR further comprises a stabilization module comprising a first stabilization domain and a second stabilization domain, wherein the first and second stabilization domains have a binding affinity for each other that stabilizes the caTCR.
  • the first and second stabilization domains are linked by a disulfide bond.
  • the TCRM is capable of recruiting at least one TCR-associated signaling molecule selected from the group consisting of CD3 ⁇ , CD3 ⁇ , and ⁇ .
  • the TCRM allows for enhanced recruitment of the at least one TCR-associated signaling molecule as compared to a TCRM comprising T cell receptor transmembrane domains having the sequences of SEQ ID NOs: 7 and 8.
  • the TCRM promotes caTCR-CD3 complex formation.
  • both of the TCR-TMs are naturally occurring.
  • at least one of the TCR-TMs is non-naturally occurring.
  • the caTCR described herein specifically binds a target antigen, comprising a) a first polypeptide chain comprising a first antigen-binding domain comprising a first Fab chain linked to a first TCRD comprising a first TCR-TM and a second polypeptide chain comprising a second antigen-binding domain comprising a second Fab chain linked to a second TCRD comprising a second TCR-TM, wherein the first and second TCR-TMs comprise, consist essentially of, or consist of the amino acid sequences of SEQ ID NOs: 7 and 8, 9 and 8, 7 and 14, 7 and 15, 7 and 16, 10 and 16, 7 and 17, 7 and 18, 7 and 19, 7 and 20, 7 and 21, 7 and 22, 11 and 23, 12 and 24, 7 and 25, or 13 and 26, respectively, wherein the first and second TCRDs form a TCRM that is capable of recruiting at least one TCR-associated signaling molecule, and wherein the first and second Fab chains form a Fab-like antigen-binding module
  • the first Fab chain comprises V H and C H 1 antibody domains and the second Fab chain comprises V L and C L antibody domains; or b) the first Fab chain comprises V L and C L antibody domains and the second Fab chain comprises V H and C H 1 antibody domains.
  • the C H 1 domain comprises the amino acid sequence of any one of SEQ ID NOs: 37-47 and/or the C L domain comprises the amino acid sequence of SEQ ID NO: 48.
  • the C H 1 domain comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 37 and the C L domain comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 48.
  • the Fab-like antigen-binding module specifically binds a cell surface antigen including, without limitation, CD19, CD20, CD22, CD47, GPC-3, ROR1, ROR2, BCMA, GPRC5D, and FCRL5, including variants or mutants thereof.
  • the Fab-like antigen-binding module specifically binds a peptide/MHC complex, wherein the peptide is derived from a protein including, without limitation, WT-1, AFP, HPV16-E7, NY-ESO-1, PRAME, EBV-LMP2A, HIV-1, KRAS, Histone H3.3, and PSA, including variants or mutants thereof.
  • the first TCRD further comprises a first TCR connecting peptide or a fragment thereof and/or the second TCRD further comprises a second TCR connecting peptide or a fragment thereof.
  • the first connecting peptide comprises the amino acid sequence SEQ ID NO: 31 or 32, or a variant thereof
  • the second connecting peptide comprises the amino acid sequence SEQ ID NO: 33 or 34, or a variant thereof.
  • the first and second connecting peptides are linked by a disulfide bond.
  • the first TCRD further comprises a first TCR intracellular domain and/or the second TCRD further comprises a second TCR intracellular domain.
  • the second TCR intracellular domain comprises the amino acid sequence of SEQ ID NO: 36, or a variant thereof.
  • the caTCR further comprises at least one accessory intracellular domain comprising a T cell co-stimulatory signaling sequence (such as from CD27, CD28, 4-1BB (CD137), OX40, CD30, or CD40).
  • the caTCR further comprises a stabilization module comprising a first stabilization domain and a second stabilization domain, wherein the first and second stabilization domains have a binding affinity for each other that stabilizes the caTCR.
  • the first and second stabilization domains are linked by a disulfide bond.
  • the TCRM is capable of recruiting at least one TCR-associated signaling molecule selected from the group consisting of CD3 ⁇ , CD3 ⁇ , and ⁇ . In some embodiments, the TCRM allows for enhanced recruitment of the at least one TCR-associated signaling molecule as compared to a TCRM comprising T cell receptor transmembrane domains having the sequences of SEQ ID NOs: 7 and 8. In some embodiments, the TCRM promotes caTCR-CD3 complex formation. In some embodiments, there is a spacer module between any two caTCR modules or domains.
  • the caTCR described herein specifically binds a target antigen, comprising a) a first TCRD comprising a first TCR-TM derived from one of the transmembrane domains of a TCR and a second TCRD comprising a second TCR-TM derived from the other transmembrane domain of the TCR, wherein the first and second TCRDs form a TCRM that is capable of recruiting at least one TCR-associated signaling molecule; and b) a Fab′ that specifically binds to the target antigen, wherein the Fab′ comprises a first Fab′ chain comprising V H , C H 1, and partial hinge antibody domains and a second Fab′ chain comprising V L and C L antibody domains, and wherein the first Fab′ chain is linked to the first or second TCRD and the second Fab′ chain is linked to the other TCRD.
  • the C H 1 and/or C L domains comprise one or more modifications that increase the binding affinity of the Fab′ chains for each other.
  • the C H 1 and C L domains are swapped, such that the first Fab′ chain comprises V H , C L , and partial hinge antibody domains and the second Fab′ chain comprises V L and C H 1 domains.
  • the Fab′ specifically binds a cell surface antigen including, without limitation, CD19, CD20, CD22, CD47, GPC-3, ROR1, ROR2, BCMA, GPRC5D, and FCRL5, including variants or mutants thereof.
  • the Fab′ specifically binds a peptide/MHC complex, wherein the peptide is derived from a protein including, without limitation, WT-1, AFP, HPV16-E7, NY-ESO-1, PRAME, EBV-LMP2A, HIV-1, KRAS, Histone H3.3, and PSA, including variants or mutants thereof.
  • the caTCR further comprises a stabilization module comprising a first stabilization domain and a second stabilization domain, wherein the first and second stabilization domains have a binding affinity for each other that stabilizes the caTCR.
  • the first or second stabilization domain is located between first TCRD and its linked Fab′ chain and the other stabilization domain is located between the second TCRD and its linked Fab′ chain.
  • both of the TCR-TMs are naturally occurring.
  • at least one of the TCR-TMs is non-naturally occurring.
  • the caTCR described herein specifically binds a target antigen, comprising a) a first TCRD comprising a first TCR-TM derived from one of the transmembrane domains of a TCR and a second TCRD comprising a second TCR-TM derived from the other transmembrane domain of the TCR, wherein the first and second TCRDs form a TCRM that is capable of recruiting at least one TCR-associated signaling molecule; and b) a (Fab′)2 that specifically binds to the target antigen, wherein the (Fab′)2 comprises first and second (Fab′)2 chains comprising V H , C H 1, and partial hinge antibody domains and third and fourth (Fab′)2 chains comprising V L and C L antibody domains, and wherein the first (Fab′)2 chain is linked to the first or second TCRD and the second (Fab′)2 chain is linked to the other TCRD.
  • a target antigen comprising a) a first TCRD compris
  • the C H 1 and/or C L domains comprise one or more modifications that increase the binding affinity of the (Fab′)2 chains for each other.
  • the C H 1 and C L domains are swapped, such that the first and second (Fab′)2 chains comprise V H , C L , and partial hinge antibody domains and the third and fourth (Fab′)2 chains comprise V L and C H 1 domains.
  • the (Fab′)2 specifically binds a cell surface antigen including, without limitation, CD19, CD20, CD22, CD47, GPC-3, ROR1, ROR2, BCMA, GPRC5D, and FCRL5, including variants or mutants thereof.
  • the (Fab′)2 specifically binds a peptide/MHC complex, wherein the peptide is derived from a protein including, without limitation, WT-1, AFP, HPV16-E7, NY-ESO-1, PRAME, EBV-LMP2A, HIV-1, KRAS, Histone H3.3, and PSA, including variants or mutants thereof.
  • the caTCR further comprises a stabilization module comprising a first stabilization domain and a second stabilization domain, wherein the first and second stabilization domains have a binding affinity for each other that stabilizes the caTCR.
  • the first or second stabilization domain is located between first TCRD and its linked (Fab′)2 chain and the other stabilization domain is located between the second TCRD and its linked (Fab′)2 chain.
  • both of the TCR-TMs are naturally occurring.
  • at least one of the TCR-TMs is non-naturally occurring.
  • the caTCR described herein specifically binds a target antigen, comprising a) a first TCRD comprising a first TCR-TM derived from one of the transmembrane domains of a TCR and a second TCRD comprising a second TCR-TM derived from the other transmembrane domain of the TCR, wherein the first and second TCRDs form a TCRM that is capable of recruiting at least one TCR-associated signaling molecule; and b) an Fv that specifically binds to the target antigen, wherein the Fv comprises a first Fv chain comprising a V H antibody domain and a second Fv chain comprising a V L antibody domain, and wherein the first Fv chain is linked to the first or second TCRD and the second Fv chain is linked to the other TCRD.
  • the Fv specifically binds a cell surface antigen including, without limitation, CD19, CD20, CD22, CD47, GPC-3, ROR1, ROR2, BCMA, GPRC5D, and FCRL5, including variants or mutants thereof.
  • the Fv specifically binds a peptide/MHC complex, wherein the peptide is derived from a protein including, without limitation, WT-1, AFP, HPV16-E7, NY-ESO-1, PRAME, EBV-LMP2A, HIV-1, KRAS, Histone H3.3, and PSA, including variants or mutants thereof.
  • the caTCR further comprises a stabilization module comprising a first stabilization domain and a second stabilization domain, wherein the first and second stabilization domains have a binding affinity for each other that stabilizes the caTCR.
  • the first or second stabilization domain is located between first TCRD and its linked Fv chain and the other stabilization domain is located between the second TCRD and its linked Fv chain.
  • both of the TCR-TMs are naturally occurring. In some embodiments, at least one of the TCR-TMs is non-naturally occurring.
  • the caTCR described herein specifically binds a target antigen, comprising a) a first TCRD comprising a first TCR-TM derived from one of the transmembrane domains of a TCR and a second TCRD comprising a second TCR-TM derived from the other transmembrane domain of the TCR, wherein the first and second TCRDs form a TCRM that is capable of recruiting at least one TCR-associated signaling molecule; and b) a first scFv that specifically binds to the target antigen, wherein the first scFv comprises V H and V L antibody domains, and wherein the first scFv is linked to the first or second TCRD.
  • the caTCR further comprises a second antigen-binding module linked to the first scFv or to the TCRD that is not linked to the first scFv.
  • the second antigen-binding module specifically binds to the target antigen.
  • the second antigen-binding module specifically binds to an antigen other than the target antigen.
  • the second antigen-binding module is a second scFv.
  • the scFv specifically binds a cell surface antigen including, without limitation, CD19, CD20, CD22, CD47, GPC-3, ROR1, ROR2, BCMA, GPRC5D, and FCRL5, including variants or mutants thereof.
  • the scFv specifically binds a peptide/MHC complex, wherein the peptide is derived from a protein including, without limitation, WT-1, AFP, HPV16-E7, NY-ESO-1, PRAME, EBV-LMP2A, HIV-1, KRAS, Histone H3.3, and PSA, including variants or mutants thereof.
  • the caTCR further comprises a stabilization module comprising a first stabilization domain and a second stabilization domain, wherein the first and second stabilization domains have a binding affinity for each other that stabilizes the caTCR.
  • the first or second stabilization domain is located between first scFv and its linked TCRD and the other stabilization domain is linked to the second TCRD.
  • both of the TCR-TMs are naturally occurring. In some embodiments, at least one of the TCR-TMs is non-naturally occurring.
  • the caTCR described herein specifically binds a target antigen, comprising a) a first TCRD comprising a first TCR-TM derived from one of the transmembrane domains of a TCR and a second TCRD comprising a second TCR-TM derived from the other transmembrane domain of the TCR, wherein the first and second TCRDs form a TCRM that is capable of recruiting at least one TCR-associated signaling molecule; and b) a first scFv that specifically binds to the target antigen and a second scFv, wherein the first and second scFvs comprise V H and V L antibody domains, and wherein the first scFv is linked to the first or second TCRD and the second scFv is linked to the other TCRD.
  • the second TCRD specifically binds to the target antigen.
  • the second scFv comprises, consists essentially of, or consists of the amino acid sequence of the first scFv.
  • the second scFv specifically binds to an antigen other than the target antigen.
  • the first and/or second scFvs specifically bind, individually, a cell surface antigen including, without limitation, CD19, CD20, CD22, CD47, GPC-3, ROR1, ROR2, BCMA, GPRC5D, and FCRL5, including variants or mutants thereof.
  • the first and/or second scFvs specifically bind, individually, a peptide/MHC complex, wherein the peptide is derived from a protein including, without limitation, WT-1, AFP, HPV16-E7, NY-ESO-1, PRAME, EBV-LMP2A, HIV-1, KRAS, Histone H3.3, and PSA, including variants or mutants thereof.
  • the caTCR further comprises a stabilization module comprising a first stabilization domain and a second stabilization domain, wherein the first and second stabilization domains have a binding affinity for each other that stabilizes the caTCR.
  • the first or second stabilization domain is located between first scFv and its linked TCRD and the other stabilization domain is located between the second scFv and its linked TCRD.
  • both of the TCR-TMs are naturally occurring. In some embodiments, at least one of the TCR-TMs is non-naturally occurring.
  • the caTCR is a multispecific caTCR that specifically binds to two or more (e.g., 2, 3, 4, or more) different target antigens or epitopes. In some embodiments, the multispecific caTCR specifically binds to two or more (e.g., 2, 3, 4, or more) different target antigens. In some embodiments, the multispecific caTCR specifically binds to two or more (e.g., 2, 3, 4, or more) different epitopes on the same target antigen. In some embodiments, the multispecific caTCR comprises an antigen-binding module for each antigen or epitope. In some embodiments, the multispecific caTCR comprises more than two antigen-binding module for at least one antigen or epitope.
  • the multispecific caTCR comprises a multispecific antigen-binding module comprising two or more (e.g., 2, 3, 4, or more) antigen-binding domains each specifically binding to an antigen or epitope.
  • the multispecific caTCR is bispecific. In some embodiments, the multispecific caTCR is trispecific.
  • Multi-specific molecules are molecules that have binding specificities for at least two different antigens or epitopes (e.g., bispecific antibodies have binding specificities for two antigens or epitopes). Multi-specific caTCRs with more than two valencies and/or specificities are also contemplated. Bispecific antibodies have been described, e.g., see, Brinkmann U. and Kontermann R. E. (2017) MABS, 9(2), 182-212. Trispecific antibodies can be prepared. See, Tutt et al. J. Immunol. 147: 60 (1991). It is to be appreciated that one of skill in the art could select appropriate features of individual multi-specific molecules known in the art to form a multi-specific caTCR.
  • the caTCR (also referred herein as “multispecific caTCR”) comprises: a) a multispecific (e.g., bispecific) antigen-binding module comprising a first antigen-binding domain that specifically binds to a first target antigen and a second antigen-binding domain that specifically binds to a second target antigen; and b) a TCRM comprising a first TCRD (TCRD1) comprising a first TCR-TM and a second TCRD (TCRD2) comprising a second TCR-TM; wherein the TCRM facilitates recruitment of at least one TCR-associated signaling molecule.
  • TCRD1 TCRD
  • TCRD2 second TCRD
  • the first TCRD further comprises a first TCR connecting peptide or a fragment thereof and/or the second TCRD further comprises a second TCR connecting peptide or a fragment thereof.
  • the first connecting peptide comprises all or a portion of the connecting peptide of the TCR subunit from which the first TCR-TM is derived, or a variant thereof
  • the second connecting peptide comprises all or a portion of the connecting peptide of the TCR subunit from which the second TCR-TM is derived, or a variant thereof.
  • the first and second connecting peptides are linked by a disulfide bond.
  • the first TCRD further comprises a first TCR intracellular domain and/or the second TCRD further comprises a second TCR intracellular domain.
  • the first TCR intracellular domain comprises a sequence from the intracellular domain of the TCR subunit from which the first TCR-TM is derived and/or the second TCR intracellular domain comprises a sequence from the intracellular domain of the TCR subunit from which the second TCR-TM is derived.
  • the first TCRD is a fragment of the TCR subunit from which the first TCR-TM is derived and/or the second TCRD is a fragment of the TCR subunit from which the second TCR-TM is derived.
  • the caTCR further comprises at least one accessory intracellular domain comprising a T cell co-stimulatory signaling sequence (such as from CD27, CD28, 4-1BB (CD137), OX40, CD30, or CD40).
  • the caTCR further comprises a stabilization module comprising a first stabilization domain and a second stabilization domain, wherein the first and second stabilization domains have a binding affinity for each other that stabilizes the caTCR.
  • the first and second stabilization domains are linked by a disulfide bond.
  • the first and second stabilization domains comprise an antibody moiety, such as C H 1 and C L antibody domains, or variants thereof.
  • the TCRM is capable of recruiting at least one TCR-associated signaling molecule selected from the group consisting of CD3 ⁇ , CD3 ⁇ , and ⁇ . In some embodiments, the TCRM allows for enhanced recruitment of the at least one TCR-associated signaling molecule as compared to a TCRM comprising the naturally occurring ⁇ T cell receptor transmembrane domains. In some embodiments, the TCRM promotes caTCR-CD3 complex formation. In some embodiments, there is a spacer module between any two caTCR modules or domains. In some embodiments, both the first TCR-TM and the second TCR-TM are naturally occurring. In some embodiments, at least one of the TCR-TMs is non-naturally occurring.
  • the first TCR-TM comprises up to 5 amino acid substitutions (e.g., a single amino acid substitution) compared to the transmembrane domain from which it is derived and/or the second TCR-TM comprises up to 5 amino acid substitutions (e.g., a single amino acid substitution) compared to the transmembrane domain from which it is derived.
  • a substituted amino acid in the first TCR-TM is proximal to a substituted amino acid in the second TCR-TM.
  • one or more substituted amino acids are proximal to an amino acid in the first or second TCR-TM involved in binding to CD3.
  • one or more (e.g., each) substituted amino acids are more hydrophobic than their corresponding unsubstituted amino acid.
  • the first TCR-TM comprises the amino acid sequence of any one of SEQ ID NOs: 7 and 9-13
  • the second TCR-TM comprises the amino acid sequence of any one of SEQ ID NOs: 8 and 14-26.
  • bispecific caTCRs Exemplary structures of bispecific caTCRs are shown in FIGS. 5A-5E , in which the target antigens are CD19 and CD22, but a skilled person in the art would readily appreciate that bispecific caTCRs targeting other target antigens or epitopes may be prepared using the same structural formats.
  • dual-variable domains derived from DVD IgGs (see, DiGiammarino et al., mAbs 3(5): 487-494) can be used as a bispecific antigen-binding module in the caTCR ( FIG. 5A ).
  • DVD dual-variable domains
  • Various linkers for fusion of the outer variable domain and inner variable domain have been developed and optimized for DVD-Igs, which may be useful in constructing bispecific caTCRs having a DVD module.
  • the variable domain stacking approach in DVD modules may affect the folding and target binding affinity of the inner variable domain.
  • the linkers between the two variable domains and the order of the two variable domains may affect the efficacy of the caTCR.
  • the caTCR comprises: a) a multispecific (e.g., bispecific) antigen-binding module comprising a Fv that specifically binds to a first target antigen and a Fab that specifically binds to a second target antigen; and b) a TCRM comprising a first TCRD (TCRD1) comprising a first TCR-TM and a second TCRD (TCRD2) comprising a second TCR-TM; wherein the TCRM facilitates recruitment of at least one TCR-associated signaling molecule.
  • a multispecific (e.g., bispecific) antigen-binding module comprising a Fv that specifically binds to a first target antigen and a Fab that specifically binds to a second target antigen
  • a TCRM comprising a first TCRD (TCRD1) comprising a first TCR-TM and a second TCRD (TCRD2) comprising a second TCR-TM; wherein the TCRM facilitates recruitment of at least
  • the caTCR comprises: (i) a first polypeptide chain comprising from the N-terminus to the C-terminus: V H 1-L1-V H 2-C H 1-TCRD1; and a second polypeptide chain comprising from the N-terminus to the C-terminus: V L 1-L2-V L 2-C L -TCRD2; (ii) a first polypeptide chain comprising from the N-terminus to the C-terminus: V H 1-L 1-V L 2-C L -TCRD1; and a second polypeptide chain comprising from the N-terminus to the C-terminus: V L 1-L2-V H 2-C H 1-TCRD2; (iii) a first polypeptide chain comprising from the N-terminus to the C-terminus: V L 1-L1-V H 2-C H 1-TCRD1; and a second polypeptide chain comprising from the N-terminus to the C-terminus: V H 1-L2-V L 2-C L -TCRD2; or (
  • L1 and/or L2 are about 5 to about 50 (e.g., about 5-10, about 10-15, or about 15-30) amino acids long. In some embodiments, L1 and L2 have the same length. In some embodiment, L1 and L2 have the same amino acid sequence. In some embodiments, L1 and L2 have different lengths. In some embodiments, L1 and L2 have different amino acid sequences.
  • An exemplary bispecific caTCR is shown in FIG. 5A .
  • CODV Cross-over dual variable domains derived from CODV-IgGs
  • CODV can be used as a bispecific antigen-binding module in the caTCR ( FIG. 5B ).
  • CODV allows relatively unobstructed antigen-binding sites for each Fv.
  • Various linkers for fusion of the heavy chain and light chain variable regions have been developed and optimized for CODV-Igs, which may be useful in constructing bispecific caTCRs having a CODV module.
  • proper folding of the CODV module can be challenging, and long linkers used in the CODV module can be a potential source of immunogenicity and susceptible to proteolytic cleavage.
  • the caTCR comprises: a) a multispecific (e.g., bispecific) antigen-binding module comprising a first Fv that specifically binds to a first target antigen and a second Fv that specifically binds to a second target antigen; and b) a TCRM comprising a first TCRD (TCRD1) comprising a first TCR-TM and a second TCRD (TCRD2) comprising a second TCR-TM; wherein the TCRM facilitates recruitment of at least one TCR-associated signaling molecule.
  • the caTCR further comprises a C H 1 and a C L .
  • the caTCR comprises: (i) a first polypeptide chain comprising from the N-terminus to the C-terminus: V H 1-L1-V H 2-C H 1-TCRD1, and a second polypeptide chain comprising from the N-terminus to the C-terminus: V L 2-L2-V L 1-C L -TCRD2; or (ii) a first polypeptide chain comprising from the N-terminus to the C-terminus: V L 1-L1-V L 2-C L -TCRD1, and a second polypeptide chain comprising from the N-terminus to the C-terminus: V H 2-L2-V H 1-C H 1-TCRD2, wherein V H 1 and V L 1 form a first antigen-binding domain that specifically binds to a first target antigen, and V H 2 and V L 2 form a second antigen-binding domain that specifically binds to a second target antigen, wherein TCRD1 and TCRD2 form a TCRM that facilitates recruitment of
  • L1 and/or L2 are about 5 to about 50 (e.g., about 5-20, about 15-30, or about 30-50) amino acids long. In some embodiments, L1 and L2 have the same length. In some embodiment, L1 and L2 have the same amino acid sequence. In some embodiments, L1 and L2 have different lengths. In some embodiments, L1 and L2 have different amino acid sequences.
  • An exemplary bispecific caTCR is shown in FIG. 5B .
  • Bispecific antigen-binding modules derived from scFv-fusion proteins may be used in a bispecific caTCR ( FIG. 5C ).
  • Expression of bispecific antibodies having a similar fusion format has demonstrated proper folding and stability of this format.
  • Various linkers for fusion of the scFvs to the constant domains have been developed and optimized for these bispecific antibodies, which may be useful in constructing bispecific caTCRs having a similar scFv fusion domain.
  • steric hindrance between the scFvs may compromise binding of the scFvs to their target antigens.
  • the caTCR comprises: a) a multispecific (e.g., bispecific) antigen-binding module comprising a first scFv that specifically binds to a first target antigen and a second scFv that specifically binds to a second target antigen; and b) a TCRM comprising a first TCRD (TCRD1) comprising a first TCR-TM and a second TCRD (TCRD2) comprising a second TCR-TM; wherein the TCRM facilitates recruitment of at least one TCR-associated signaling molecule.
  • the caTCR further comprises a C H 1 and a C L .
  • the caTCR comprises: (i) a first polypeptide chain comprising from the N-terminus to the C-terminus: scFv1-L1-C H 1-TCRD1, and a second polypeptide chain comprising from the N-terminus to the C-terminus: scFv2-L2-C L -TCRD2; or (ii) a first polypeptide chain comprising from the N-terminus to the C-terminus: scFv2-L1-C H 1-TCRD1, and a second polypeptide chain comprising from the N-terminus to the C-terminus: scFv1-L2-C L -TCRD2; wherein scFv1 specifically binds to a first target antigen and scFv2 specifically binds to a second target antigen, wherein TCRD1 and TCRD2 form a TCRM that facilitates recruitment of at least one TCR-associated signaling molecule, and wherein L1 and L2 are
  • L1 and/or L2 are about 5 to about 50 (e.g., about 5-10, about 10-15, or about 15-30) amino acids long. In some embodiments, L1 and L2 have the same length. In some embodiment, L1 and L2 have the same amino acid sequence. In some embodiments, L1 and L2 have different lengths. In some embodiments, L1 and L2 have different amino acid sequences.
  • An exemplary bispecific caTCR is shown in FIG. 5C .
  • Bispecific antigen-binding modules derived from an IgG-scFv bispecific antibody or a Fab-scFv-Fc bispecific antibody may be used in a bispecific caTCR.
  • an scFv is attached to either the V H or V L of a Fab, which allows greater flexibility of the scFv and thus greater access of the Fab to its target antigen.
  • the scFv-Fab module may have stability issues.
  • a Fab is fused to a first TCRD and an scFv is fused to a second TCRD.
  • the caTCR comprises: a) a multispecific (e.g., bispecific) antigen-binding module comprising a scFv that specifically binds to a first target antigen and a Fab that specifically binds to a second target antigen; and b) a TCRM comprising a first TCRD (TCRD1) comprising a first TCR-TM and a second TCRD (TCRD2) comprising a second TCR-TM; wherein the TCRM facilitates recruitment of at least one TCR-associated signaling molecule.
  • a multispecific (e.g., bispecific) antigen-binding module comprising a scFv that specifically binds to a first target antigen and a Fab that specifically binds to a second target antigen
  • TCRM comprising a first TCRD (TCRD1) comprising a first TCR-TM and a second TCRD (TCRD2) comprising a second TCR-TM;
  • the caTCR comprises: (i) a first polypeptide chain comprising from the N-terminus to the C-terminus: scFv-L1-V H -C H 1-TCRD1, and a second polypeptide chain comprising from the N-terminus to the C-terminus: V L -C L -TCRD2; or (ii) a first polypeptide chain comprising from the N-terminus to the C-terminus: V H -C H 1-TCRD1, and a second polypeptide chain comprising from the N-terminus to the C-terminus: scFv-L2-V L -C L -TCRD2; wherein the scFv specifically binds to a first target antigen, and the V H and V L form a second antigen-binding domain that specifically binds to a second target antigen, wherein TCRD1 and TCRD2 form a TCRM that facilitates recruitment of at least one TCR-associated signaling molecule, and
  • the caTCR comprises: (i) a first polypeptide chain comprising from the N-terminus to the C-terminus: V L -C L -L1-TCRD1, a second polypeptide chain comprising from the N-terminus to the C-terminus: V H -C H 1, and a third polypeptide chain comprising from the N-terminus to the C-terminus: scFv-L2-TCRD2; (ii) a first polypeptide chain comprising from the N-terminus to the C-terminus: V H -C H 1-L1-TCRD1, a second polypeptide chain comprising from the N-terminus to the C-terminus: V L -C L , and a third polypeptide chain comprising from the N-terminus to the C-terminus: scFv-L2-TCRD2; (iii) a first polypeptide chain comprising from the N-terminus to the C-terminus: scFv-L1-TCRD1;
  • L1 and/or L2 are about 5 to about 50 (e.g., about 5-10, about 10-15, or about 15-30) amino acids long.
  • An exemplary bispecific caTCR is shown in FIG. 5E .
  • the length of the peptide linker between the scFv and the TCRD and the length of the peptide linker between the Fab and the TCRD can be optimized as they may affect the accessibility of the scFv and the Fab to their target antigens.
  • the multispecific antigen-binding module of the multispecific caTCR may specifically bind to any suitable combination of target antigens or epitopes.
  • the multispecific antigen-binding module specifically binds to at least one cell surface antigen.
  • the at least one cell surface antigen is selected from the group consisting of CD19, CD20, CD22, CD47, GPC-3, ROR1, ROR2, BCMA, GPRC5D, and FCRL5, including variants or mutants thereof.
  • the multispecific antigen-binding module specifically binds to at least one peptide/MHC complex.
  • the at least one peptide/MHC complex comprises a peptide derived from a protein selected from the group consisting of WT-1, AFP, HPV16-E7, NY-ESO-1, PRAME, EBV-LMP2A, HIV-1, KRAS, Histone H3.3, and PSA, including variants or mutants thereof.
  • the multispecific antigen-binding module specifically binds to a first cell surface antigen and a second cell surface antigen. In some embodiments, the multispecific antigen-binding module specifically binds to CD19 and CD22. In some embodiments, the multispecific antigen-binding module specifically binds to CD19 and CD20.
  • the multispecific antigen-binding module specifically binds to a first peptide/MHC complex and a second peptide/MHC complex. In some embodiments, the multispecific antigen-binding module specifically binds a cell surface antigen and a peptide/MHC complex.
  • the secretory secondary effector (SSE) described herein enhances the immune response mediated by a caTCR plus SSE immune cell in which it is functionally expressed and secreted from.
  • the SSE is capable of redirecting other immune cells (such as bystander T cells or NK cells) to target disease cells (such as target cancer cells).
  • the SSE is a multispecific antibody (such as a bispecific antibody) targeting an immune cell (such as a T cell or NK cell) and a disease cell (such as a cancer cell).
  • the SSE protects the caTCR plus SSE immune cell from an immunosuppressive environment, such as an immunosuppressive tumor environment.
  • the SSE provides autocrine activation of stimulatory receptors on the caTCR plus SSE immune cell.
  • the SSE is an exogenous growth factor or stimulatory cytokine.
  • the expression of the SSE in the caTCR plus SSE immune cell is inducible.
  • the expression of the SSE in the caTCR plus SSE immune cell is inducible upon signaling through the caTCR.
  • the SSE is a multispecific antibody (such as a bispecific antibody) targeting a T cell and a disease cell.
  • the SSE comprises an antibody moiety that specifically binds to a surface antigen of a T cell.
  • the T cell surface antigen is CD3.
  • the SSE comprises an antibody moiety that specifically binds to a disease-associated antigen (such as a cancer-associated antigen).
  • the disease-associated antigen is a surface antigen of a disease cell (such as a cancer cell).
  • the disease-associated antigen is glypican-3 (GPC3), CD47, mucin-16 (MUC16), CD19, CD20, CD22, EpCAM, EGFR, HER2, CEA, PSMA, AFP, PSA, BCMA, FCRL5, NY-ESO, HPV16, or FoxP3, including variants or mutants thereof.
  • the SSE is a multispecific antibody selected from the group consisting of a tandem scFv, a diabody (Db), a single chain diabody (scDb), a dual-affinity retargeting (DART) antibody, and a dual variable domain (DVD) antibody.
  • the SSE is a bispecific antibody.
  • the SSE is a tandem scFv comprising a first scFv targeting the T cell surface antigen and a second scFv targeting the disease-associated antigen.
  • the SSE is a tandem scFv comprising a first scFv targeting CD3 and a second scFv targeting a disease-associated antigen.
  • the disease-associated antigen is GPC3, CD47, MUC16, CD19, CD20, CD22, EpCAM, EGFR, HER2, CEA, PSMA, AFP, PSA, BCMA, FCRL5, NY-ESO, HPV16, or FoxP3, including variants or mutants thereof.
  • the SSE is a tandem scFv comprising a first scFv targeting CD3 and a second scFv targeting GPC3.
  • the first scFv targeting CD3 comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 69.
  • the second scFv comprises a V H domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 60 and a V L domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 61.
  • the second scFv comprises the V H and V L domains connected by a peptide linker comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 66.
  • the V H domain is amino-terminal to the V L domain.
  • the V L domain is amino-terminal to the V H domain.
  • the second scFv comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 67.
  • the SSE comprises the first and second scFvs connected by a peptide linker comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 70.
  • the first scFv is amino-terminal to the second scFv.
  • the second scFv is amino-terminal to the first scFv.
  • the SSE comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 71.
  • the SSE is a tandem scFv comprising a first scFv targeting CD3 and a second scFv targeting CD47.
  • the first scFv targeting CD3 comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 69.
  • the second scFv comprises a V H domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 62 and a V L domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 63.
  • the second scFv comprises the V H and V L domains connected by a peptide linker comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 66.
  • the V H domain is amino-terminal to the V L domain.
  • the V L domain is amino-terminal to the V H domain.
  • the second scFv comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 68.
  • the SSE comprises the first and second scFvs connected by a peptide linker comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 70.
  • the first scFv is amino-terminal to the second scFv.
  • the second scFv is amino-terminal to the first scFv.
  • the SSE is a tandem scFv comprising a first scFv targeting CD3 and a second scFv targeting MUC16.
  • the first scFv targeting CD3 comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 69.
  • the second scFv comprises the CDRs or variable domains (V H and/or V L domains) of an antibody moiety specific for MUC16 (see, e.g., US200405795, US2008311134, US2013171152, and WO16/149368).
  • the second scFv comprises V H and V L domains connected by a peptide linker comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 66.
  • the V H domain is amino-terminal to the V L domain.
  • the V L domain is amino-terminal to the V H domain.
  • the SSE comprises the first and second scFvs connected by a peptide linker.
  • the peptide linker comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 70.
  • the first scFv is amino-terminal to the second scFv.
  • the second scFv is amino-terminal to the first scFv.
  • the SSE is a multispecific antibody (such as a bispecific antibody) targeting an NK cell and a disease-associated antigen (such as a cancer-associated antigen).
  • the SSE comprises an antibody moiety that specifically binds to a surface antigen of an NK cell.
  • the NK cell surface antigen is CD16a.
  • the SSE comprises an antibody moiety that specifically binds to a disease-associated antigen (such as a cancer-associated antigen).
  • the disease-associated antigen is a surface antigen of a disease cell (such as a cancer cell).
  • the disease-associated antigen is GPC3, CD47, MUC16, CD19, CD20, CD22, EpCAM, EGFR, HER2, CEA, PSMA, AFP, PSA, BCMA, FCRL5, NY-ESO, HPV16, or FoxP3, including variants or mutants thereof.
  • the SSE is a multispecific antibody selected from the group consisting of a tandem scFv, a diabody (Db), a single chain diabody (scDb), a dual-affinity retargeting (DART) antibody, and a dual variable domain (DVD) antibody.
  • the SSE is a bispecific antibody.
  • the SSE is a tandem scFv comprising a first scFv targeting the NK cell surface antigen and a second scFv targeting the disease-associated antigen.
  • the SSE is a tandem scFv comprising a first scFv targeting CD16a and a second scFv targeting a disease-associated antigen.
  • the disease-associated antigen is GPC3, CD47, MUC16, CD19, CD20, CD22, EpCAM, EGFR, HER2, CEA, PSMA, AFP, PSA, BCMA, FCRL5, NY-ESO, HPV16, or FoxP3, including variants or mutants thereof.
  • the SSE is a tandem scFv comprising a first scFv targeting CD16a and a second scFv targeting GPC3.
  • the first scFv comprises the CDRs or variable domains (V H and/or V L domains) of an antibody moiety specific for CD16a (e.g., V H domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 64 and/or V L domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 65, or CDRs contained therein).
  • the second scFv comprises a V H domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 60 and a V L domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 61.
  • the second scFv comprises the V H and V L domains connected by a peptide linker comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 66.
  • the V H domain is amino-terminal to the V L domain.
  • the V L domain is amino-terminal to the V H domain.
  • the second scFv comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 67.
  • the SSE comprises the first and second scFvs connected by a peptide linker comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 70.
  • the first scFv is amino-terminal to the second scFv.
  • the second scFv is amino-terminal to the first scFv.
  • the SSE is a tandem scFv comprising a first scFv targeting CD16a and a second scFv targeting CD47.
  • the first scFv comprises the CDRs or variable domains (V H and/or V L domains) of an antibody moiety specific for CD16a (e.g., V H domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 64 and/or V L domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 65, or CDRs contained therein).
  • the second scFv comprises a V H domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 62 and a V L domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 63.
  • the second scFv comprises the V H and V L domains connected by a peptide linker comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 66.
  • the V H domain is amino-terminal to the V L domain.
  • the V L domain is amino-terminal to the V H domain.
  • the second scFv comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 68.
  • the SSE comprises the first and second scFvs connected by a peptide linker comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 70.
  • the first scFv is amino-terminal to the second scFv.
  • the second scFv is amino-terminal to the first scFv.
  • the SSE is a tandem scFv comprising a first scFv targeting CD16a and a second scFv targeting MUC16.
  • the first scFv comprises the CDRs or variable domains (V H and/or V L domains) of an antibody moiety specific for CD16a (e.g., V H domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 64 and/or V L domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 65, or CDRs contained therein).
  • the second scFv comprises the CDRs or variable domains (V H and/or V L domains) of an antibody moiety specific for MUC16 (see, e.g., US200405795, US2008311134, US2013171152, and WO16/149368).
  • the second scFv comprises V H and V L domains connected by a peptide linker comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 66.
  • the V H domain is amino-terminal to the V L domain.
  • the V L domain is amino-terminal to the V H domain.
  • the SSE comprises the first and second scFvs connected by a peptide linker.
  • the peptide linker comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 70.
  • the first scFv is amino-terminal to the second scFv.
  • the second scFv is amino-terminal to the first scFv.
  • the SSEs described herein comprises an antibody moiety that specifically binds to a disease-associated antigen, wherein the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for the disease-associated antigen.
  • the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for CD19 (see, e.g., WO2017066136A2).
  • the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for CD19 (e.g., V H domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 56 and/or V L domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 57, or CDRs contained therein).
  • V H domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 56 and/or V L domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 57, or CDRs contained therein.
  • the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for CD20 (e.g., V H domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 58 and/or V L domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 59, or CDRs contained therein).
  • the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for CD22 (see, e.g., U.S. Ser. No. 62/650,955 filed Mar.
  • the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for CD22 (e.g., V H domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 78 and/or V L domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 79, or CDRs contained therein).
  • the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for GPC3 (see, e.g., U.S. Ser. No.
  • the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for GPC3 (e.g., V H domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 60 and/or V L domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 61, or CDRs contained therein).
  • V H domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 60
  • V L domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 61, or CDRs contained therein.
  • the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for ROR1 (see, e.g., WO2016/187220 and WO2016/187216). In some embodiments, the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for ROR2 (see, e.g., WO2016/142768). In some embodiments, the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for BCMA (see, e.g., WO2016/090327 and WO2016/090320).
  • the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for GPRC5D (see, e.g., WO2016/090329 and WO2016/090312). In some embodiments, the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for FCRL5 (see, e.g., WO2016/090337).
  • the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for WT-1 (see, e.g., WO2012/135854, WO2015/070078, and WO2015/070061). In some embodiments, the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for AFP (see, e.g., WO2016/161390). In some embodiments, the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for HPV16-E7 (see, e.g., WO2016/182957).
  • the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for NY-ESO-1 (see, e.g., WO2016/210365). In some embodiments, the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for PRAME (see, e.g., WO2016/191246). In some embodiments, the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for EBV-LMP2A (see, e.g., WO2016/201124).
  • the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for KRAS (see, e.g., WO2016/154047). In some embodiments, the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for PSA (see, e.g., WO2017/015634). In some embodiments, the antibody moiety is an scFv.
  • the SSE is a tandem scFv comprising a) a first scFv that specifically binds to a surface antigen of a T cell (such as CD3) or an NK cell (such as CD16a) and b) the antibody moiety, wherein the antibody moiety is a second scFv.
  • the SSE comprises the first and second scFvs connected by a peptide linker.
  • the peptide linker comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 70.
  • the first scFv is amino-terminal to the second scFv.
  • the second scFv is amino-terminal to the first scFv.
  • the SSE is a multispecific antibody (such as a bispecific antibody) targeting one or more soluble immunosuppressive agents. Such an SSE can act as a trap to sequester the soluble immunosuppressive agents from their targets, thereby reducing their immunosuppressive effects.
  • the SSE comprises one or more antibody moieties that specifically bind to one or more soluble immunosuppressive agents.
  • the immunosuppressive agents are immunosuppressive cytokines.
  • the immunosuppressive cytokines include TGF- ⁇ family members (such as TGF- ⁇ 1 to 4), IL-4, and IL-10, including variants or mutants thereof.
  • the SSE is a multispecific antibody selected from the group consisting of a tandem scFv, a diabody (Db), a single chain diabody (scDb), a dual-affinity retargeting (DART) antibody, and a dual variable domain (DVD) antibody.
  • the SSE is a bispecific antibody.
  • the SSE is a tandem scFv comprising a first scFv targeting a first immunosuppressive cytokine (such as TGF ⁇ ) and a second scFv targeting a second immunosuppressive cytokine (such as IL-4).
  • the SSE is an antibody moiety targeting an immune checkpoint molecule. In some embodiments, the SSE is an antagonist of an inhibitory immune checkpoint molecule. In some embodiments, the inhibitory immune checkpoint molecule is selected from the group consisting of PD-1, PD-L1, CTLA-4, HVEM, BTLA, KIR, LAG-3, TIM-3, and A2aR. In some embodiments, the SSE is an agonist of a stimulatory immune checkpoint molecule. In some embodiments, the stimulatory immune checkpoint molecule is selected from the group consisting of CD28, ICOS, 4-1BB, OX40, CD27, and CD40.
  • the antibody moiety is a full-length antibody, a Fab, a Fab′, a (Fab′)2, an Fv, or a single chain Fv (scFv). In some embodiments, the antibody moiety is an scFv.
  • the SSE is an antagonistic antibody moiety targeting PD-1.
  • the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antagonistic antibody moiety specific for PD-1 (see, e.g., WO2016/210129).
  • the antagonistic antibody moiety is a full-length antibody, a Fab, a Fab′, a (Fab′)2, an Fv, or a single chain Fv (scFv).
  • the antagonistic antibody moiety is an scFv.
  • the SSE is an antagonistic antibody moiety targeting CD47.
  • the antagonistic antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antagonistic antibody moiety specific for CD47 (e.g., V H domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 62 and/or V L domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 63, or CDRs contained therein).
  • the antagonistic antibody moiety is a full-length antibody, a Fab, a Fab′, a (Fab′)2, an Fv, or a single chain Fv (scFv).
  • the antagonistic antibody moiety is an scFv.
  • the antagonistic antibody moiety comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 68.
  • the SSE comprises an antibody moiety that binds to a target antigen with a) an affinity that is at least about 10 (including for example at least about any of 10, 20, 30, 40, 50, 75, 100, 200, 300, 400, 500, 750, 1000 or more) times its binding affinity for other molecules; or b) a K d no more than about 1/10 (such as no more than about any of 1/10, 1/20, 1/30, 1/40, 1/50, 1/75, 1/100, 1/200, 1/300, 1/400, 1/500, 1/750, 1/1000 or less) times its K d for binding to other molecules.
  • an affinity that is at least about 10 (including for example at least about any of 10, 20, 30, 40, 50, 75, 100, 200, 300, 400, 500, 750, 1000 or more) times its binding affinity for other molecules; or b) a K d no more than about 1/10 (such as no more than about any of 1/10, 1/20, 1/30, 1/40, 1/50, 1/75, 1/
  • Binding affinity can be determined by methods known in the art, such as ELISA, fluorescence activated cell sorting (FACS) analysis, or radioimmunoprecipitation assay (RIA).
  • K d can be determined by methods known in the art, such as surface plasmon resonance (SPR) assay utilizing, for example, Biacore instruments, or kinetic exclusion assay (KinExA) utilizing, for example, Sapidyne instruments.
  • SPR surface plasmon resonance
  • KinExA kinetic exclusion assay
  • the SSE is a soluble molecule that specifically binds a ligand of an immunosuppressive receptor.
  • the SSE comprises a ligand-binding domain derived from the extracellular domain of the immunosuppressive receptor.
  • the ligand-binding domain is a portion of the extracellular domain of the receptor.
  • the immunosuppressive receptor is selected from the group consisting of FasR, TNFR1, TNFR2, SIRP ⁇ , PD-1, CD28, CTLA-4, ICOS, BTLA, KIR, LAG-3, 4-1BB, OX40, CD27, CD40, and TIM-3.
  • the SSE is a soluble molecule that specifically binds to and antagonizes an immunosuppressive receptor.
  • the SSE comprises a receptor-binding domain derived from the extracellular domain of a ligand for the immunosuppressive receptor.
  • the receptor-binding domain is a portion of the extracellular domain of the ligand.
  • the ligand is selected from the group consisting of FasL, PD-L1, PD-L2, CD47, CD80, CD86, ICOSL, HVEM, 4-1BBL, OX40L, CD70, CD40L, and GAL9.
  • the SSE is an exogenous stimulatory cytokine.
  • An exogenous cytokine described herein is a cytokine expressed from an exogenous gene.
  • the exogenous stimulatory cytokine is an IL-12 family member.
  • the IL-12 family member is IL-12, IL-23, IL-27, or IL-35.
  • the exogenous stimulatory cytokine is IL-2, IL-15, IL-18, or IL-21.
  • the exogenous stimulatory cytokine is capable of providing autocrine activation of receptors for the cytokine on the caTCR plus SSE immune cell.
  • the expression of the SSE in the caTCR plus SSE immune cell is inducible.
  • the caTCR plus SSE immune cell comprises a nucleic acid sequence encoding the SSE is operably linked to an inducible promoter, including any of the inducible promoters described herein.
  • the expression of the SSE in the caTCR plus SSE immune cell is inducible upon signaling through the caTCR.
  • the caTCR plus SSE immune cell comprises a nucleic acid sequence encoding the SSE is operably linked to a promoter or regulatory element responsive to signaling through the caTCR.
  • the nucleic acid sequence encoding the SSE is operably linked to a nuclear-factor of the activated T-cell (NFAT)-derived promoter.
  • the NFAT-derived promoter is an NFAT-derived minimal promoter (see for example Durand, D. et. al., Molec. Cell. Biol. 8, 1715-1724 (1988); Clipstone, N A, Crabtree, G R. Nature. 1992 357(6380): 695-7; Chmielewski, M., et al. Cancer research 71.17 (2011): 5697-5706; and Zhang, L., et al. Molecular therapy 19.4 (2011): 751-759).
  • the NFAT-derived promoter comprises the nucleotide sequence of SEQ ID NO: 74.
  • the nucleic acid sequence encoding the SSE is operably linked to an IL-2 promoter.
  • the caTCR plus SSE immune cell (such as a T cell) described herein comprises a chimeric co-stimulatory receptor (CSR) comprising: i) a ligand-binding module that is capable of binding or interacting with a target ligand; ii) a transmembrane module; and iii) a co-stimulatory immune cell signaling module that is capable of providing a co-stimulatory signal to the immune cell, wherein the ligand-binding module and the co-stimulatory immune cell signaling module are not derived from the same molecule, and wherein the CSR lacks a functional primary immune cell signaling domain.
  • CSR chimeric co-stimulatory receptor
  • Such an immune cell is also referred herein as a “caTCR plus SSE and CSR immune cell.”
  • the ligand-specific chimeric co-stimulatory receptor (CSR) described herein specifically binds to a target ligand (such as a cell surface antigen or a peptide/MHC complex) and is capable of stimulating an immune cell on the surface of which it is functionally expressed upon target ligand binding.
  • the CSR comprises a ligand-binding module that provides the ligand-binding specificity, a transmembrane module, and a co-stimulatory immune cell signaling module that allows for stimulating the immune cell.
  • the CSR lacks a functional primary immune cell signaling sequence. In some embodiments, the CSR lacks any primary immune cell signaling sequence.
  • the CSR comprises a single polypeptide chain comprising the ligand-binding module, transmembrane module, and co-stimulatory signaling module.
  • the CSR comprises a first polypeptide chain and a second polypeptide chain, wherein the first and second polypeptide chains together form the ligand-binding module, transmembrane module, and co-stimulatory signaling module.
  • the first and second polypeptide chains are separate polypeptide chains, and the CSR is a multimer, such as a dimer.
  • the first and second polypeptide chains are covalently linked, such as by a peptide linkage, or by another chemical linkage, such as a disulfide linkage.
  • the first polypeptide chain and the second polypeptide chain are linked by at least one disulfide bond.
  • the expression of the CSR in the caTCR plus SSE and CSR immune cell is inducible. In some embodiments, the expression of the caTCR plus SSE and CSR immune cell is inducible upon signaling through the caTCR.
  • co-stimulatory immune cell signaling domains for use in the CSRs of the invention include the cytoplasmic sequences of co-receptors of the T cell receptor (TCR), which can act in concert with a caTCR to initiate signal transduction following caTCR engagement, as well as any derivative or variant of these sequences and any synthetic sequence that has the same functional capability.
  • TCR T cell receptor
  • T cell activation is mediated by two distinct classes of intracellular signaling sequence: those that initiate antigen-dependent primary activation through the TCR (referred to herein as “primary T cell signaling sequences”) and those that act in an antigen-independent manner to provide a secondary or co-stimulatory signal (referred to herein as “co-stimulatory T cell signaling sequences”).
  • primary T cell signaling sequences those that initiate antigen-dependent primary activation through the TCR
  • co-stimulatory T cell signaling sequences those that act in an antigen-independent manner to provide a secondary or co-stimulatory signal
  • Primary immune cell signaling sequences that act in a stimulatory manner may contain signaling motifs which are known as immunoreceptor tyrosine-based activation motifs or ITAMs.
  • ITAM-containing primary immune cell signaling sequences include those derived from TCR ⁇ , FcR ⁇ , FcR ⁇ , CD3 ⁇ , CD3 ⁇ , CD3 ⁇ , CD5, CD22, CD79a, CD79b, and CD66d.
  • a “functional” primary immune cell signaling sequence is a sequence that is capable of transducing an immune cell activation signal when operably coupled to an appropriate receptor.
  • “Non-functional” primary immune cell signaling sequences, which may comprises fragments or variants of primary immune cell signaling sequences, are unable to transduce an immune cell activation signal.
  • the CSRs described herein lack a functional primary immune cell signaling sequence, such as a functional signaling sequence comprising an ITAM. In some embodiments, the CSRs lack any primary immune cell signaling sequence.
  • the co-stimulatory immune cell signaling sequence can be a portion of the intracellular domain of a co-stimulatory molecule including, for example, CD27, CD28, 4-1BB (CD137), OX40, CD27, CD40, PD-1, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, a ligand that specifically binds with CD83, and the like.
  • a co-stimulatory molecule including, for example, CD27, CD28, 4-1BB (CD137), OX40, CD27, CD40, PD-1, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, a ligand that specifically binds with CD83, and the like.
  • the target ligand is a cell surface antigen. In some embodiments, the target ligand is a peptide/MHC complex. In some embodiments, the target ligand is the same as the target antigen of a caTCR expressed in the same immune cell. In some embodiments, the target ligand is different than the target antigen of a caTCR expressed in the same immune cell. In some embodiments, the target ligand is a molecule presented on the surface of a cell presenting the target antigen. For example, in some embodiments, the target antigen of the caTCR is a cancer-associated antigen presented on a cancer cell, and the target ligand is a ubiquitous molecule expressed on the surface of the cancer cell, such as an integrin.
  • the target ligand is a disease-associated ligand. In some embodiments, the target ligand is a cancer-associated ligand. In some embodiments, the cancer-associated ligand is, for example, CD19, CD20, CD22, CD47, IL4, GPC-3, ROR1, ROR2, BCMA, GPRC5D, or FCRL5. In some embodiments, the cancer-associated ligand is a peptide/MHC complex comprising a peptide derived from a protein including WT-1, AFP, HPV16-E7, NY-ESO-1, PRAME, EBV-LMP2A, and PSA. In some embodiments, the target ligand is a virus-associated ligand.
  • the target ligand is an immune checkpoint molecule.
  • the immune checkpoint molecule includes PD-L1, PD-L2, CD80, CD86, ICOSL, B7-H3, B7-H4, HVEM, 4-1BBL, OX40L, CD70, CD40, and GALS.
  • the target ligand is an apoptotic molecule.
  • the apoptotic molecule includes FasL, FasR, TNFR1, and TNFR2.
  • the ligand-binding module is an antibody moiety.
  • the antibody moiety is a Fab, a Fab′, a (Fab′)2, an Fv, or a single chain Fv (scFv).
  • the antibody moiety specifically binds a cell surface antigen including, without limitation, CD19, CD20, CD22, CD47, GPC-3, ROR1, ROR2, BCMA, GPRC5D, and FCRL5.
  • the antibody moiety specifically binds a peptide/MHC complex, wherein the peptide is derived from a protein including, without limitation, WT-1, AFP, HPV16-E7, NY-ESO-1, PRAME, EBV-LMP2A, and PSA.
  • the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for CD19 (see, e.g., WO2017066136A2).
  • the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for CD19 (e.g., V H domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 56 and/or V L domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 57, or CDRs contained therein).
  • V H domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 56 and/or V L domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 57, or CDRs contained therein.
  • the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for CD20 (e.g., V H domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 58 and/or V L domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 59, or CDRs contained therein).
  • the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for CD22 (see, e.g., U.S. Ser. No. 62/650,955 filed Mar.
  • the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for CD22 (e.g., V H domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 78 and/or V L domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 79, or CDRs contained therein).
  • the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for GPC3 (see, e.g., U.S. Ser. No.
  • the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for GPC3 (e.g., V H domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 60 and/or V L domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 61, or CDRs contained therein).
  • V H domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 60
  • V L domain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 61, or CDRs contained therein.
  • the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for ROR1 (see, e.g., WO2016/187220 and WO2016/187216). In some embodiments, the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for ROR2 (see, e.g., WO2016/142768). In some embodiments, the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for BCMA (see, e.g., WO2016/090327 and WO2016/090320).
  • the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for GPRC5D (see, e.g., WO2016/090329 and WO2016/090312). In some embodiments, the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for FCRL5 (see, e.g., WO2016/090337).
  • the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for WT-1 (see, e.g., WO2012/135854, WO2015/070078, and WO2015/070061). In some embodiments, the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for AFP (see, e.g., WO2016/161390). In some embodiments, the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for HPV16-E7 (see, e.g., WO2016/182957).
  • the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for NY-ESO-1 (see, e.g., WO2016/210365). In some embodiments, the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for PRAME (see, e.g., WO2016/191246). In some embodiments, the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for EBV-LMP2A (see, e.g., WO2016/201124).
  • the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for KRAS (see, e.g., WO2016/154047). In some embodiments, the antibody moiety comprises the CDRs or variables domains (V H and/or V L domains) of an antibody moiety specific for PSA (see, e.g., WO2017/015634).
  • the ligand-binding module is (or is derived from) all or a portion of the extracellular domain of a receptor for the target ligand.
  • the receptor includes, for example, FasR, TNFR1, TNFR2, PD-1, CD28, CTLA-4, ICOS, BTLA, KIR, LAG-3, 4-1BB, OX40, CD27, and TIM-3.
  • the transmembrane module comprises one or more transmembrane domains derived from, for example, CD28, CD3E, CD3, CD45, CD4, CDS, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, or CD154.
  • the co-stimulatory signaling module comprises, consists essentially of, or consists of all or a portion of the intracellular domain of an immune cell co-stimulatory molecule including, for example, CD27, CD28, 4-1BB (CD137), OX40, CD30, CD40, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, a ligand that specifically binds with CD83, and the like.
  • the co-stimulatory signaling molecule comprises a fragment of CD28 comprising the amino acid sequence of SEQ ID NO: 49 or 80.
  • the co-stimulatory signaling molecule comprises a fragment of 4-1BB comprising the amino acid sequence of SEQ ID NO: 50 or 81. In some embodiments, the co-stimulatory signaling molecule comprises a fragment of OX40 comprising the amino acid sequence of SEQ ID NO: 51 or 82. In some embodiments, the co-stimulatory signaling molecule comprises a fragment of CD27 comprising the amino acid sequence of SEQ ID NO: 84 or 85. In some embodiments, the co-stimulatory signaling molecule comprises a fragment of CD30 comprising the amino acid sequence of SEQ ID NO: 86 or 87. In some embodiments, the co-stimulatory signaling molecule comprises a fragment of CD8 comprising the amino acid sequence of SEQ ID NO: 83.
  • the CSR further comprises a spacer module between any of the ligand-binding module, the transmembrane module, and the co-stimulatory signaling module.
  • the spacer module comprises one or more peptide linkers connecting two CSR modules.
  • the spacer module comprises one or more peptide linkers between about 5 to about 70 (such as about any of 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, or 70, including any ranges between these values) amino acids in length.
  • the ligand-binding module (such as an antibody moiety) specifically binds to a target antigen with a) an affinity that is at least about 10 (including for example at least about any of 10, 20, 30, 40, 50, 75, 100, 200, 300, 400, 500, 750, 1000 or more) times its binding affinity for other molecules; or b) a K d no more than about 1/10 (such as no more than about any of 1/10, 1/20, 1/30, 1/40, 1/50, 1/75, 1/100, 1/200, 1/300, 1/400, 1/500, 1/750, 1/1000 or less) times its K d for binding to other molecules.
  • an affinity that is at least about 10 (including for example at least about any of 10, 20, 30, 40, 50, 75, 100, 200, 300, 400, 500, 750, 1000 or more) times its binding affinity for other molecules; or b) a K d no more than about 1/10 (such as no more than about any of 1/10, 1/20, 1/30, 1/40, 1/
  • Binding affinity can be determined by methods known in the art, such as ELISA, fluorescence activated cell sorting (FACS) analysis, or radioimmunoprecipitation assay (RIA).
  • K d can be determined by methods known in the art, such as surface plasmon resonance (SPR) assay utilizing, for example, Biacore instruments, or kinetic exclusion assay (KinExA) utilizing, for example, Sapidyne instruments.
  • SPR surface plasmon resonance
  • KinExA kinetic exclusion assay
  • the CSR described herein specifically binds to a target ligand (such as a cell surface antigen or a peptide/MHC complex), comprising a) a target ligand-binding domain (LBD); b) a transmembrane domain; and c) and a co-stimulatory signaling domain, wherein the CSR is capable of stimulating an immune cell on the surface of which it is functionally expressed upon target ligand binding.
  • the target ligand is a cell surface antigen.
  • the target ligand is a peptide/MHC complex.
  • the target ligand is the same as the target antigen of a caTCR expressed in the same immune cell.
  • the target ligand is different from the target antigen of a caTCR expressed in the same immune cell.
  • the target ligand is a disease-associated ligand.
  • the target ligand is a cancer-associated ligand.
  • the cancer-associated ligand is, for example, CD19, CD20, CD22, CD47, IL4, GPC-3, ROR1, ROR2, BCMA, GPRC5D, or FCRL5.
  • the cancer-associated ligand is a peptide/MHC complex comprising a peptide derived from a protein including WT-1, AFP, HPV16-E7, NY-ESO-1, PRAME, EBV-LMP2A, and PSA.
  • the target ligand is a virus-associated ligand.
  • the target ligand is an immune checkpoint molecule.
  • the immune checkpoint molecule includes PD-L1, PD-L2, CD80, CD86, ICOSL, B7-H3, B7-H4, HVEM, 4-1BBL, OX40L, CD70, CD40, and GALS.
  • the target ligand is an apoptotic molecule.
  • the apoptotic molecule includes FasL, FasR, TNFR1, and TNFR2.
  • the ligand-binding domain is an antibody moiety.
  • the antibody moiety is a Fab, a Fab′, a (Fab′)2, an Fv, or a single chain Fv (scFv).
  • the ligand-binding domain is (or is derived from) all or a portion of the extracellular domain of a receptor for the target ligand.
  • the receptor includes, for example, FasR, TNFR1, TNFR2, PD-1, CD28, CTLA-4, ICOS, BTLA, KIR, LAG-3, 4-1BB, OX40, CD27, and TIM-3.
  • the transmembrane domain comprises a transmembrane domain derived from a transmembrane protein including, for example, CD28, CD3 ⁇ , CD3 ⁇ , CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, or CD154.
  • the CSR comprises a fragment of a transmembrane protein (fTMP), wherein the fTMP comprises the CSR transmembrane domain.
  • the co-stimulatory signaling domain comprises, consists essentially of, or consists of all or a portion of the intracellular domain of an immune cell co-stimulatory molecule including, for example, CD27, CD28, 4-1BB (CD137), OX40, CD30, CD40, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, a ligand that specifically binds with CD83, and the like.
  • an immune cell co-stimulatory molecule including, for example, CD27, CD28, 4-1BB (CD137), OX40, CD30, CD40, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, a ligand that specifically binds with CD83, and
  • the CSR comprises a fragment of an immune cell co-stimulatory molecule (fCSM), wherein the fCSM comprises the CSR transmembrane domain and CSR co-stimulatory signaling domain.
  • the CSR further comprises a spacer domain between any of the ligand-binding domain, the transmembrane domain, and the co-stimulatory signaling domain.
  • the spacer domain comprises a peptide linker connecting two CSR domains.
  • the CSR described herein specifically binds to a target ligand, comprising a) a target ligand-binding domain; b) a transmembrane domain; and c) and a co-stimulatory signaling domain, wherein the target ligand is a cell surface antigen, and wherein the CSR is capable of stimulating an immune cell on the surface of which it is functionally expressed upon target ligand binding.
  • the target ligand is the same as the target antigen of a caTCR expressed in the same immune cell.
  • the target ligand is different from the target antigen of a caTCR expressed in the same immune cell.
  • the target ligand is a disease-associated ligand. In some embodiments, the target ligand is a cancer-associated ligand. In some embodiments, the cancer-associated ligand is, for example, CD19, CD20, CD22, CD47, IL4, GPC-3, ROR1, ROR2, BCMA, GPRC5D, or FCRL5. In some embodiments, the target ligand is a virus-associated ligand. In some embodiments, the target ligand is an immune checkpoint molecule.
  • the immune checkpoint molecule includes PD-L1, PD-L2, CD80, CD86, ICOSL, B7-H3, B7-H4, HVEM, 4-1BBL, OX40L, CD70, CD40, and GALS.
  • the target ligand is an apoptotic molecule.
  • the apoptotic molecule includes FasL, FasR, TNFR1, and TNFR2.
  • the ligand-binding domain is an antibody moiety.
  • the antibody moiety is a Fab, a Fab′, a (Fab′)2, an Fv, or a single chain Fv (scFv).
  • the ligand-binding domain is (or is derived from) all or a portion of the extracellular domain of a receptor for the target ligand.
  • the receptor includes, for example, FasR, TNFR1, TNFR2, PD-1, CD28, CTLA-4, ICOS, BTLA, KIR, LAG-3, 4-1BB, OX40, CD27, and TIM-3.
  • the transmembrane domain comprises a transmembrane domain derived from a transmembrane protein including, for example, CD28, CD3 ⁇ , CD3 ⁇ , CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, or CD154.
  • the CSR comprises a fragment of a transmembrane protein (fTMP), wherein the fTMP comprises the CSR transmembrane domain.
  • the co-stimulatory signaling domain comprises, consists essentially of, or consists of all or a portion of the intracellular domain of an immune cell co-stimulatory molecule including, for example, CD27, CD28, 4-1BB (CD137), OX40, CD30, CD40, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, a ligand that specifically binds with CD83, and the like.
  • the CSR comprises a fragment of an immune cell co-stimulatory molecule (fCSM), wherein the fCSM comprises the CSR transmembrane domain and CSR co-stimulatory signaling domain.
  • the CSR further comprises a spacer domain between any of the ligand-binding domain, the transmembrane domain, and the co-stimulatory signaling domain.
  • the spacer domain comprises a peptide linker connecting two CSR domains.
  • the CSR described herein specifically binds to a target ligand, comprising a) a target ligand-binding domain; b) a transmembrane domain; and c) and a co-stimulatory signaling domain, wherein the target ligand is a peptide/MHC complex, and wherein the CSR is capable of stimulating an immune cell on the surface of which it is functionally expressed upon target ligand binding.
  • the target ligand is the same as the target antigen of a caTCR expressed in the same immune cell. In some embodiments, the target ligand is different from the target antigen of a caTCR expressed in the same immune cell.
  • the target ligand is a disease-associated ligand. In some embodiments, the target ligand is a cancer-associated ligand. In some embodiments, the cancer-associated ligand is a peptide/MHC complex comprising a peptide derived from a protein including WT-1, AFP, HPV16-E7, NY-ESO-1, PRAME, EBV-LMP2A, and PSA. In some embodiments, the target ligand is a virus-associated ligand. In some embodiments, the ligand-binding domain is an antibody moiety.
  • the antibody moiety is a Fab, a Fab′, a (Fab′)2, an Fv, or a single chain Fv (scFv).
  • the transmembrane domain comprises a transmembrane domain derived from a transmembrane protein including, for example, CD28, CD3c, CD3, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, or CD154.
  • the CSR comprises a fragment of a transmembrane protein (fTMP), wherein the fTMP comprises the CSR transmembrane domain.
  • the co-stimulatory signaling domain comprises, consists essentially of, or consists of all or a portion of the intracellular domain of an immune cell co-stimulatory molecule including, for example, CD27, CD28, 4-1BB (CD137), OX40, CD30, CD40, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, a ligand that specifically binds with CD83, and the like.
  • the CSR comprises a fragment of an immune cell co-stimulatory molecule (fCSM), wherein the fCSM comprises the CSR transmembrane domain and CSR co-stimulatory signaling domain.
  • the CSR further comprises a spacer domain between any of the ligand-binding domain, the transmembrane domain, and the co-stimulatory signaling domain.
  • the spacer domain comprises a peptide linker connecting two CSR domains.
  • the CSR described herein specifically binds to a target ligand (such as a cell surface antigen or a peptide/MHC complex), comprising a) a target ligand-binding domain; b) a transmembrane domain; and c) and a co-stimulatory signaling domain, wherein the ligand-binding domain is an antibody moiety, and wherein the CSR is capable of stimulating an immune cell on the surface of which it is functionally expressed upon target ligand binding.
  • the target ligand is a cell surface antigen.
  • the target ligand is a peptide/MHC complex.
  • the target ligand is the same as the target antigen of a caTCR expressed in the same immune cell. In some embodiments, the target ligand is different from the target antigen of a caTCR expressed in the same immune cell. In some embodiments, the target ligand is a disease-associated ligand. In some embodiments, the target ligand is a cancer-associated ligand. In some embodiments, the cancer-associated ligand is, for example, CD19, CD20, CD22, CD47, IL4, GPC-3, ROR1, ROR2, BCMA, GPRC5D, or FCRL5.
  • the cancer-associated ligand is a peptide/MHC complex comprising a peptide derived from a protein including WT-1, AFP, HPV16-E7, NY-ESO-1, PRAME, EBV-LMP2A, and PSA.
  • the target ligand is a virus-associated ligand.
  • the target ligand is an immune checkpoint molecule.
  • the immune checkpoint molecule includes PD-L1, PD-L2, CD80, CD86, ICOSL, B7-H3, B7-H4, HVEM, 4-1BBL, OX40L, CD70, CD40, and GALS.
  • the target ligand is an apoptotic molecule.
  • the apoptotic molecule includes FasL, FasR, TNFR1, and TNFR2.
  • the antibody moiety is a Fab, a Fab′, a (Fab′)2, an Fv, or a single chain Fv (scFv).
  • the transmembrane domain comprises a transmembrane domain derived from a transmembrane protein including, for example, CD28, CD3 ⁇ , CD3 ⁇ , CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, or CD154.
  • the CSR comprises a fragment of a transmembrane protein (fTMP), wherein the fTMP comprises the CSR transmembrane domain.
  • the co-stimulatory signaling domain comprises, consists essentially of, or consists of all or a portion of the intracellular domain of an immune cell co-stimulatory molecule including, for example, CD27, CD28, 4-1BB (CD137), OX40, CD30, CD40, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, a ligand that specifically binds with CD83, and the like.
  • an immune cell co-stimulatory molecule including, for example, CD27, CD28, 4-1BB (CD137), OX40, CD30, CD40, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, a ligand that specifically binds with CD83, and
  • the CSR comprises a fragment of an immune cell co-stimulatory molecule (fCSM), wherein the fCSM comprises the CSR transmembrane domain and CSR co-stimulatory signaling domain.
  • the CSR further comprises a spacer domain between any of the ligand-binding domain, the transmembrane domain, and the co-stimulatory signaling domain.
  • the spacer domain comprises a peptide linker connecting two CSR domains.
  • the CSR comprises an fCSM of CD28. In some embodiments, the CSR comprises: a) a target ligand-binding domain; and b) a fragment of CD28 comprising the amino acid sequence of SEQ ID NO: 80. In some embodiments, the CSR comprises: a target ligand-binding domain and a CSR domain comprising the amino acid sequence of SEQ ID NO: 88.
  • the CSR described herein specifically binds to a target ligand (such as a cell surface antigen or a peptide/MEC complex), comprising a) a target ligand-binding domain; b) a transmembrane domain; and c) and a co-stimulatory signaling domain, wherein the ligand-binding domain is (or is derived from) all or a portion of the extracellular domain of a receptor for the target ligand, and wherein the CSR is capable of stimulating an immune cell on the surface of which it is functionally expressed upon target ligand binding.
  • the target ligand is a cell surface antigen.
  • the target ligand is the same as the target antigen of a caTCR expressed in the same immune cell. In some embodiments, the target ligand is different from the target antigen of a caTCR expressed in the same immune cell. In some embodiments, the target ligand is a disease-associated ligand. In some embodiments, the target ligand is a cancer-associated ligand. In some embodiments, the cancer-associated ligand is, for example, CD19, CD20, CD22, CD47, IL4, GPC-3, ROR1, ROR2, BCMA, GPRC5D, or FCRL5. In some embodiments, the target ligand is an immune checkpoint molecule.
  • the immune checkpoint molecule includes PD-L1, PD-L2, CD80, CD86, ICOSL, B7-H3, B7-H4, HVEM, 4-1BBL, OX40L, CD70, CD40, and GALS.
  • the target ligand is an apoptotic molecule.
  • the apoptotic molecule includes FasL, FasR, TNFR1, and TNFR2.
  • the target ligand receptor includes, for example, FasR, TNFR1, TNFR2, PD-1, CD28, CTLA-4, ICOS, BTLA, KIR, LAG-3, 4-1BB, OX40, CD27, and TIM-3.
  • the transmembrane domain comprises a transmembrane domain derived from, for example, CD28, CD3 ⁇ , CD3 ⁇ , CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, or CD154.
  • the co-stimulatory signaling domain comprises, consists essentially of, or consists of all or a portion of the intracellular domain of an immune cell co-stimulatory molecule including, for example, CD27, CD28, 4-1BB (CD137), OX40, CD30, CD40, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, a ligand that specifically binds with CD83, and the like.
  • the CSR further comprises a spacer domain between any of the ligand-binding domain, the transmembrane domain, and the co-stimulatory signaling domain.
  • the spacer domain comprises a peptide linker connecting two CSR domains.
  • the CSR described herein specifically binds to CD19, comprising a) an scFv comprising a V H domain having the amino acid sequence of SEQ ID NO: 76 and a V L domain having the amino acid sequence of SEQ ID NO: 77; and b) a fragment of CD28 comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 49 or 80.
  • the fragment of CD28 comprises the amino acid sequence of SEQ ID NO: 80.
  • the CSR comprises, from amino terminus to carboxy terminus, the scFv, a peptide linker, and the fragment of CD28.
  • the CSR comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 89.
  • the CSR described herein specifically binds to GPC3, comprising a) an scFv comprising a V H domain having the amino acid sequence of SEQ ID NO: 60 and a V L domain having the amino acid sequence of SEQ ID NO: 61; and b) a fragment of CD28 comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 49 or 80.
  • the scFv comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 67.
  • the fragment of CD28 comprises the amino acid sequence of SEQ ID NO: 80.
  • the CSR comprises, from amino terminus to carboxy terminus, the scFv, a peptide linker, and the fragment of CD28. In some embodiments, the CSR comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 90.
  • the expression of the CSR in the caTCR plus SSE and CSR immune cell is inducible.
  • the caTCR plus SSE and CSR immune cell comprises a nucleic acid sequence encoding the CSR operably linked to an inducible promoter, including any of the inducible promoters described herein.
  • the expression of the CSR in the caTCR plus SSE and CSR immune cell is inducible upon signaling through the caTCR.
  • the caTCR plus SSE and CSR immune cell comprises a nucleic acid sequence encoding the CSR operably linked to a promoter or regulatory element responsive to signaling through the caTCR.
  • the nucleic acid sequence encoding the CSR is operably linked to a nuclear-factor of the activated T-cell (NFAT)-derived promoter.
  • the NFAT-derived promoter is an NFAT-derived minimal promoter (see for example Durand, D. et. al., Molec. Cell. Biol. 8, 1715-1724 (1988); Clipstone, N A, Crabtree, G R. Nature. 1992 357(6380): 695-7; Chmielewski, M., et al. Cancer research 71.17 (2011): 5697-5706; and Zhang, L., et al. Molecular therapy 19.4 (2011): 751-759).
  • the NFAT-derived promoter comprises the nucleotide sequence of SEQ ID NO: 74.
  • the nucleic acid sequence encoding the CSR is operably linked to an IL-2 promoter.
  • Nucleic acid molecules encoding the caTCRs, SSEs and/or CSRs described herein are also contemplated.
  • a nucleic acid (or a set of nucleic acids) encoding the caTCR, SSE and/or CSR there is provided a nucleic acid (or a set of nucleic acids) encoding the caTCR, SSE and/or CSR.
  • the present invention also provides vectors in which a nucleic acid of the present invention is inserted.
  • a caTCR and/or SSE and/or CSR described herein by a nucleic acid encoding the caTCR and/or SSE and/or CSR can be achieved by inserting the nucleic acid into an appropriate expression vector, such that the nucleic acid is operably linked to 5′ and 3′ regulatory elements, including for example a promoter (e.g., a lymphocyte-specific promoter) and a 3′ untranslated region (UTR).
  • the vectors can be suitable for replication and integration in eukaryotic host cells.
  • Typical cloning and expression vectors contain transcription and translation terminators, initiation sequences, and promoters useful for regulation of the expression of the desired nucleic acid sequence.
  • the nucleic acids of the present invention may also be used for nucleic acid immunization and gene therapy, using standard gene delivery protocols. Methods for gene delivery are known in the art. See, e.g., U.S. Pat. Nos. 5,399,346, 5,580,859, 5,589,466, incorporated by reference herein in their entireties.
  • the invention provides a gene therapy vector.
  • the nucleic acid can be cloned into a number of types of vectors.
  • the nucleic acid can be cloned into a vector including, but not limited to, a plasmid, a phagemid, a phage derivative, an animal virus, and a cosmid.
  • Vectors of particular interest include expression vectors, replication vectors, probe generation vectors, and sequencing vectors.
  • the expression vector may be provided to a cell in the form of a viral vector.
  • Viral vector technology is well known in the art and is described, for example, in Sambrook et al. (2001, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York), and in other virology and molecular biology manuals.
  • Viruses which are useful as vectors include, but are not limited to, retroviruses, adenoviruses, adeno-associated viruses, herpes viruses, and lentiviruses.
  • a suitable vector contains an origin of replication functional in at least one organism, a promoter sequence, convenient restriction endonuclease sites, and one or more selectable markers (see, e.g., WO 01/96584; WO 01/29058; and U.S. Pat. No. 6,326,193).
  • retroviruses provide a convenient platform for gene delivery systems.
  • a selected gene can be inserted into a vector and packaged in retroviral particles using techniques known in the art.
  • the recombinant virus can then be isolated and delivered to cells of the subject either in vivo or ex vivo.
  • retroviral systems are known in the art.
  • adenovirus vectors are used.
  • a number of adenovirus vectors are known in the art.
  • lentivirus vectors are used.
  • Vectors derived from retroviruses such as the lentivirus are suitable tools to achieve long-term gene transfer since they allow long-term, stable integration of a transgene and its propagation in daughter cells.
  • Lentiviral vectors have the added advantage over vectors derived from onco-retroviruses such as murine leukemia viruses in that they can transduce non-proliferating cells, such as hepatocytes. They also have the added advantage of low immunogenicity.
  • promoter elements e.g., enhancers
  • promoters regulate the frequency of transcriptional initiation.
  • these are located in the region 30-110 bp upstream of the start site, although a number of promoters have recently been shown to contain functional elements downstream of the start site as well.
  • the spacing between promoter elements frequently is flexible, so that promoter function is preserved when elements are inverted or moved relative to one another.
  • tk thymidine kinase
  • the spacing between promoter elements can be increased to 50 bp apart before activity begins to decline.
  • a suitable promoter is the immediate early cytomegalovirus (CMV) promoter sequence.
  • CMV immediate early cytomegalovirus
  • This promoter sequence is a strong constitutive promoter sequence capable of driving high levels of expression of any polynucleotide sequence operatively linked thereto.
  • Another example of a suitable promoter is Elongation Growth Factor-la (EF-1a).
  • constitutive promoter sequences may also be used, including, but not limited to the simian virus 40 (SV40) early promoter, mouse mammary tumor virus (MMTV), human immunodeficiency virus (HIV) long terminal repeat (LTR) promoter, MoMuLV promoter, an avian leukemia virus promoter, an Epstein-Barr virus immediate early promoter, a Rous sarcoma virus promoter, as well as human gene promoters such as, but not limited to, the actin promoter, the myosin promoter, the hemoglobin promoter, and the creatine kinase promoter.
  • SV40 simian virus 40
  • MMTV mouse mammary tumor virus
  • HSV human immunodeficiency virus
  • LTR long terminal repeat
  • MoMuLV promoter MoMuLV promoter
  • an avian leukemia virus promoter an Epstein-Barr virus immediate early promoter
  • Rous sarcoma virus promoter as well as human gene promoters such as
  • inducible promoters are also contemplated as part of the invention.
  • the use of an inducible promoter provides a molecular switch capable of turning on expression of the polynucleotide sequence which it is operatively linked when such expression is desired, or turning off the expression when expression is not desired.
  • Exemplary inducible promoter systems for use in eukaryotic cells include, but are not limited to, hormone-regulated elements (e.g., see Mader, S. and White, J. H. (1993) Proc. Natl. Acad. Sci. USA 90:5603-5607), synthetic ligand-regulated elements (see, e.g., Spencer, D. M.
  • An exemplary inducible promoter system for use in the present invention is the Tet system. Such systems are based on the Tet system described by Gossen et al. (1993).
  • a polynucleotide of interest is under the control of a promoter that comprises one or more Tet operator (TetO) sites.
  • TetO Tet operator
  • TetR Tet repressor
  • the inducing agent causes release of TetR from TetO, thereby allowing transcription to take place.
  • Doxycycline is a member of the tetracycline family of antibiotics having the chemical name of 1-dimethylamino-2,4a,5,7,12-pentahydroxy-11-methyl-4,6-dioxo-1,4a,11,11a,12,12a-hexahydrotetracene-3-carboxamide.
  • a TetR is codon-optimized for expression in mammalian cells, e.g., murine or human cells.
  • Most amino acids are encoded by more than one codon due to the degeneracy of the genetic code, allowing for substantial variations in the nucleotide sequence of a given nucleic acid without any alteration in the amino acid sequence encoded by the nucleic acid.
  • many organisms display differences in codon usage, also known as “codon bias” (i.e., bias for use of a particular codon(s) for a given amino acid). Codon bias often correlates with the presence of a predominant species of tRNA for a particular codon, which in turn increases efficiency of mRNA translation.
  • a coding sequence derived from a particular organism e.g., a prokaryote
  • Tet-Off transcription is inactive in the presence of Tc or Dox.
  • a tetracycline-controlled transactivator protein which is composed of TetR fused to the strong transactivating domain of VP16 from Herpes simplex virus, regulates expression of a target nucleic acid that is under transcriptional control of a tetracycline-responsive promoter element (TRE).
  • the TRE is made up of TetO sequence concatamers fused to a promoter (commonly the minimal promoter sequence derived from the human cytomegalovirus (hCMV) immediate-early promoter).
  • hCMV human cytomegalovirus
  • rtTA is a reverse tetracycline-controlled transactivator, rtTA.
  • rtTA is a fusion protein comprised of the TetR repressor and the VP16 transactivation domain.
  • a four amino acid change in the TetR DNA binding moiety alters rtTA's binding characteristics such that it can only recognize the tetO sequences in the TRE of the target transgene in the presence of Dox.
  • transcription of the TRE-regulated target gene is stimulated by rtTA only in the presence of Dox.
  • lac repressor system Another inducible promoter system is the lac repressor system from E. coli .
  • the lac repressor system functions by regulating transcription of a polynucleotide of interest operably linked to a promoter comprising the lac operator (lacO).
  • lacO lac operator
  • lacR lac repressor
  • lacR lacR
  • lacR lacR
  • Expression of the polynucleotide of interest is induced by a suitable inducing agent, e.g., isopropyl-3-D-thiogalactopyranoside (IPTG).
  • IPTG isopropyl-3-D-thiogalactopyranoside
  • NFAT nuclear-factor of the activated T-cell
  • the NFAT family of transcription factors are important regulators of T cell activation.
  • NFAT response elements are found, for example, in the IL-2 promoter (see for example Durand, D. et. al., Molec. Cell. Biol. 8, 1715-1724 (1988); Clipstone, N A, Crabtree, G R. Nature. 1992 357(6380): 695-7; Chmielewski, M., et al. Cancer research 71.17 (2011): 5697-5706; and Zhang, L., et al. Molecular therapy 19.4 (2011): 751-759).
  • an inducible promoter described herein comprises one or more (such as 2, 3, 4, 5, 6, or more) NFAT response elements. In some embodiments, the inducible promoter comprises 6 NFAT response elements, for example, comprising the nucleotide sequence of SEQ ID NO: 72. In some embodiments, an inducible promoter described herein comprises one or more (such as 2, 3, 4, 5, 6, or more) NFAT response elements linked to a minimal promoter, such as a minimal TA promoter. In some embodiments, the minimal TA promoter comprises the nucleotide sequence of SEQ ID NO: 73. In some embodiments, the inducible promoter comprises the nucleotide sequence of SEQ ID NO: 74.
  • the expression vector to be introduced into a cell can also contain either a selectable marker gene or a reporter gene or both to facilitate identification and selection of expressing cells from the population of cells sought to be transfected or infected through viral vectors.
  • the selectable marker may be carried on a separate piece of DNA and used in a co-transfection procedure. Both selectable markers and reporter genes may be flanked with appropriate regulatory sequences to enable expression in the host cells.
  • Useful selectable markers include, for example, antibiotic-resistance genes, such as neo and the like.
  • Reporter genes are used for identifying potentially transfected cells and for evaluating the functionality of regulatory sequences.
  • a reporter gene is a gene that is not present in or expressed by the recipient organism or tissue and that encodes a polypeptide whose expression is manifested by some easily detectable property, e.g., enzymatic activity. Expression of the reporter gene is assayed at a suitable time after the DNA has been introduced into the recipient cells.
  • Suitable reporter genes may include genes encoding luciferase, ⁇ -galactosidase, chloramphenicol acetyl transferase, secreted alkaline phosphatase, or the green fluorescent protein gene (e.g., Ui-Tel et al., 2000 FEBS Letters 479: 79-82).
  • Suitable expression systems are well known and may be prepared using known techniques or obtained commercially.
  • the construct with the minimal 5′ flanking region showing the highest level of expression of reporter gene is identified as the promoter.
  • Such promoter regions may be linked to a reporter gene and used to evaluate agents for the ability to modulate promoter-driven transcription.
  • nucleic acid encoding a caTCR and/or an SSE and/or a CSR according to any of the caTCRs, SSEs and CSRs described herein.
  • the nucleic acid comprises one or more nucleic acid sequences encoding all of the polypeptide chains of the caTCR.
  • the nucleic acid comprises one or more nucleic acid sequences encoding all of the polypeptide chains of the SSE.
  • the nucleic acid comprises one or more nucleic acid sequences encoding all of the polypeptide chains of the caTCR and the SSE.
  • each of the one or more nucleic acid sequences are contained in separate vectors.
  • nucleic acid sequences are contained in the same vector. In some embodiments, all of the nucleic acid sequences are contained in the same vector.
  • Vectors may be selected, for example, from the group consisting of mammalian expression vectors and viral vectors (such as those derived from retroviruses, adenoviruses, adeno-associated viruses, herpes viruses, and lentiviruses).
  • the caTCR is a dimer comprising a first caTCR polypeptide chain and a second caTCR polypeptide chain and the SSE is a monomer comprising a single SSE polypeptide chain
  • the nucleic acid encoding the caTCR comprises a first nucleic acid sequence encoding the first caTCR polypeptide chain, a second nucleic acid encoding the second caTCR chain, and a third nucleic acid sequence encoding the SSE polypeptide chain.
  • the first nucleic acid sequence is contained in a first vector
  • the second nucleic acid sequence is contained in a second vector
  • the third nucleic acid sequence is contained in a third vector.
  • the first and second nucleic acid sequences are contained in a first vector, and the third nucleic acid sequence is contained in a second vector. In some embodiments, the first and third nucleic acid sequences are contained in a first vector, and the second nucleic acid sequence is contained in a second vector. In some embodiments, the second and third nucleic acid sequences are contained in a first vector, and the first nucleic acid sequence is contained in a second vector. In some embodiments, the first, second, and third nucleic acid sequences are contained in the same vector.
  • the first nucleic acid sequence is under the control of a first promoter
  • the second nucleic acid sequence is under the control of a second promoter
  • the third nucleic acid sequence is under the control of a third promoter.
  • some or all of the first, second, and third promoters have the same sequence.
  • some or all of the first, second, and third promoters have different sequences.
  • some or all of the first, second, and third nucleic acid sequences are expressed as a single transcript under the control of a single promoter in a multicistronic vector. See for example Kim, J H, et al., PLoS One 6(4):e18556, 2011.
  • one or more of the promoters are inducible.
  • the third nucleic acid sequence encoding the SSE polypeptide chain is operably linked to an inducible promoter.
  • the inducible promoter comprises one or more elements responsive to immune cell activation, such as NFAT response elements.
  • one or more of the nucleic acid sequences encoding the caTCR are under the control of a constitutive promoter. In some embodiments, one or more of the nucleic acid sequences encoding the caTCR are operably linked to an EF1-alpha promoter. In some embodiments, the EF1-alpha promoter comprises the nucleotide sequence of SEQ ID NO: 75. In some embodiments, one or more of the nucleic acid sequences encoding the SSE are under the control of an inducible promoter. In some embodiments, the inducible promoter comprises one or more elements responsive to immune cell activation.
  • one or more of the nucleic acid sequences encoding the SSE are operably linked to an NFAT-derived promoter.
  • the NFAT-derived promoter comprises the nucleotide sequence of SEQ ID NO: 74.
  • some or all of the first, second, and third nucleic acid sequences have similar (such as substantially or about the same) expression levels in a host cell (such as a T cell).
  • some of the nucleic acid sequences encoding the caTCR and/or SSE and/or CSR have expression levels in a host cell (such as a T cell) that differ by at least about two (such as at least about any of 2, 3, 4, 5, or more) times. Expression can be determined at the mRNA or protein level. The level of mRNA expression can be determined by measuring the amount of mRNA transcribed from the nucleic acid using various well-known methods, including Northern blotting, quantitative RT-PCR, microarray analysis and the like.
  • the level of protein expression can be measured by known methods including immunocytochemical staining, enzyme-linked immunosorbent assay (ELISA), western blot analysis, luminescent assays, mass spectrometry, high performance liquid chromatography, high-pressure liquid chromatography-tandem mass spectrometry, and the like.
  • ELISA enzyme-linked immunosorbent assay
  • western blot analysis luminescent assays
  • mass spectrometry high performance liquid chromatography
  • high-pressure liquid chromatography-tandem mass spectrometry and the like.
  • nucleic acid encoding the caTCR and/or SSE and/or CSR comprises five or more nucleic acid sequences (e.g., where the caTCR and SSE each comprises 2 or more distinct polypeptide chains).
  • nucleic acid encoding a) a dimeric caTCR comprising a first caTCR polypeptide chain and a second caTCR polypeptide chain according to any of the caTCRs described herein, the nucleic acid comprising i) a first caTCR nucleic acid sequence encoding the first caTCR polypeptide chain, and ii) a second caTCR nucleic acid sequence encoding the second caTCR polypeptide chain; and b) a monomeric SSE comprising a single SSE polypeptide chain according to any of the SSEs described herein, the nucleic acid further comprising an SSE nucleic acid sequence encoding the SSE polypeptide chain.
  • the first caTCR nucleic acid sequence is contained in a first vector (such as a viral vector, e.g., a lentiviral vector)
  • the second caTCR nucleic acid sequence is contained in a second vector (such as a viral vector, e.g., a lentiviral vector)
  • the SSE nucleic acid sequence is contained in a third vector (such as a viral vector, e.g., a lentiviral vector).
  • some or all of the first and second caTCR nucleic acid sequences and SSE nucleic acid sequence are contained in the same vector (such as a viral vector, e.g., a lentiviral vector).
  • each of the first and second caTCR nucleic acid sequences and SSE nucleic acid sequence are, individually, operably linked to a promoter. In some embodiments, some or all of the promoters have the same sequence. In some embodiments, some or all of the promoters have different sequences. In some embodiments, some or all of the first and second caTCR nucleic acid sequences and the SSE nucleic acid sequence are under the control of a single promoter. In some embodiments, some or all of the promoters are inducible. In some embodiments, the SSE nucleic acid sequence is operably linked to an inducible promoter. In some embodiments, the inducible promoter comprises one or more elements responsive to immune cell activation. In some embodiments, the SSE nucleic acid sequence is operably linked to an NFAT-derived promoter. In some embodiments, some or all of the vectors are viral vectors (such as lentiviral vectors).
  • a first vector such as a viral vector, e.g., a lentiviral vector
  • a first vector comprising nucleic acid encoding a dimeric caTCR comprising a first caTCR polypeptide chain and a second caTCR polypeptide chain according to any of the caTCRs described herein comprising i) a first promoter operably linked to a first caTCR nucleic acid sequence encoding the first caTCR polypeptide chain; and ii) a second promoter operably linked to a second caTCR nucleic acid sequence encoding the second caTCR polypeptide chain; and b) a second vector (such as a viral vector, e.g., a lentiviral vector) comprising nucleic acid encoding a monomeric SSE comprising an SSE polypeptide chain according to any of the SSEs described herein comprising a third promoter operably linked to an SSE nucleic acid sequence encoding the SSE poly
  • a second vector
  • the promoters have the same sequence. In some embodiments, some or all of the promoters have different sequences. In some embodiments, some or all of the promoters are inducible. In some embodiments, the third promoter is an inducible promoter. In some embodiments, the inducible promoter comprises one or more elements responsive to immune cell activation. In some embodiments, the third promoter is an NFAT-derived promoter. In some embodiments, the first and/or second vectors are viral vectors (such as lentiviral vectors).
  • a first vector such as a viral vector, e.g., a lentiviral vector
  • a second vector comprising nucleic acid encoding a monomeric SSE comprising an SSE polypeptide chain according to any of the SSEs described herein comprising a second promoter operably linked to an SSE nucleic acid
  • the first promoter is operably linked to the 5′ end of the first caTCR nucleic acid sequence, and there is nucleic acid linker selected from the group consisting of an internal ribosomal entry site (IRES) and a nucleic acid encoding a self-cleaving 2A peptide (such as P2A, T2A, E2A, or F2A) linking the 3′ end of first caTCR nucleic acid sequence to the 5′ end of the second caTCR nucleic acid sequence, wherein the first caTCR nucleic acid sequence and the second caTCR nucleic acid sequence are transcribed as a single RNA under the control of the first promoter.
  • IRS internal ribosomal entry site
  • the first promoter is operably linked to the 5′ end of the second caTCR nucleic acid sequence, and there is nucleic acid linker selected from the group consisting of an internal ribosomal entry site (IRES) and a nucleic acid encoding a self-cleaving 2A peptide (such as P2A, T2A, E2A, or F2A) linking the 3′ end of second caTCR nucleic acid sequence to the 5′ end of the first caTCR nucleic acid sequence, wherein the first caTCR nucleic acid sequence and the second caTCR nucleic acid sequence are transcribed as a single RNA under the control of the first promoter.
  • IRS internal ribosomal entry site
  • the first and/or second promoters are inducible.
  • the second promoter is an inducible promoter.
  • the inducible promoter comprises one or more elements responsive to immune cell activation.
  • the second promoter is an NFAT-derived promoter.
  • the NFAT-derived promoter comprises the nucleotide sequence of SEQ ID NO: 74.
  • the first and/or second vectors are viral vectors (such as lentiviral vectors). It is to be appreciated that embodiments where any of the nucleic acid sequences are swapped are also contemplated, such as where the first or second caTCR nucleic acid sequence is swapped with the SSE nucleic acid sequence.
  • a vector such as a viral vector, e.g., a lentiviral vector
  • a vector comprising a) nucleic acid encoding a dimeric caTCR comprising a first caTCR polypeptide chain and a second caTCR polypeptide chain according to any of the caTCRs described herein comprising i) a first caTCR nucleic acid sequence encoding the first caTCR polypeptide chain; and ii) a second caTCR nucleic acid sequence encoding the second caTCR polypeptide chain; and b) nucleic acid encoding a monomeric SSE comprising an SSE polypeptide chain according to any of the SSEs described herein comprising an SSE nucleic acid sequence encoding the SSE polypeptide chain, wherein the first and second caTCR nucleic acid sequences are under the control of a first promoter, and wherein the SSE nucleic acid sequence is under the control of a second promoter.
  • the first promoter is operably linked to one of the caTCR nucleic acid sequences, which is linked to the other caTCR nucleic acid sequence by a nucleic acid linker selected from the group consisting of an internal ribosomal entry site (IRES) and a nucleic acid encoding a self-cleaving 2A peptide (such as P2A, T2A, E2A, or F2A), such that the first and second caTCR nucleic acid sequences are transcribed as a single RNA under the control of the first promoter.
  • the first and/or second promoters are inducible.
  • the second promoter is an inducible promoter.
  • the inducible promoter comprises one or more elements responsive to immune cell activation.
  • the second promoter is an NFAT-derived promoter.
  • the NFAT-derived promoter comprises the nucleotide sequence of SEQ ID NO: 74.
  • the vector is a viral vector (such as a lentiviral vector).
  • a vector such as a viral vector, e.g., a lentiviral vector
  • a vector comprising a) nucleic acid encoding a dimeric caTCR comprising a first caTCR polypeptide chain and a second caTCR polypeptide chain according to any of the caTCRs described herein comprising i) a first caTCR nucleic acid sequence encoding the first caTCR polypeptide chain; and ii) a second caTCR nucleic acid sequence encoding the second caTCR polypeptide chain; and b) nucleic acid encoding a monomeric SSE comprising an SSE polypeptide chain according to any of the SSEs described herein comprising an SSE nucleic acid sequence encoding the SSE polypeptide chain, wherein the first and second caTCR nucleic acid sequences and the SSE nucleic acid sequence are under the control of a single promoter.
  • the promoter is operably linked to one of the nucleic acid sequences, which is linked to the other nucleic acid sequences by nucleic acid linkers selected, individually, from the group consisting of an internal ribosomal entry site (IRES) and a nucleic acid encoding a self-cleaving 2A peptide (such as P2A, T2A, E2A, or F2A), such that the first and second caTCR nucleic acid sequences and the SSE nucleic acid sequence are transcribed as a single RNA under the control of the promoter.
  • the promoter is inducible.
  • the inducible promoter comprises one or more elements responsive to immune cell activation.
  • the vector is a viral vector (such as a lentiviral vector).
  • a vector such as a viral vector, e.g., a lentiviral vector
  • a vector comprising a) nucleic acid encoding a dimeric caTCR comprising a first caTCR polypeptide chain and a second caTCR polypeptide chain according to any of the caTCRs described herein comprising i) a first caTCR nucleic acid sequence encoding the first caTCR polypeptide chain; and ii) a second caTCR nucleic acid sequence encoding the second caTCR polypeptide chain, wherein the first and second caTCR nucleic acid sequences are under the control of a constitutive promoter; and b) nucleic acid encoding a tandem scFv bispecific SSE comprising an SSE polypeptide chain according to any of the tandem scFv bispecific SSEs described herein comprising an inducible promoter operably linked to an SSE nucleic acid sequence encoding the SSE polypeptide chain.
  • the constitutive promoter is operably linked to one of the caTCR nucleic acid sequences, which is linked to the other caTCR nucleic acid sequence by a nucleic acid linker selected from the group consisting of an internal ribosomal entry site (IRES) and a nucleic acid encoding a self-cleaving 2A peptide (such as P2A, T2A, E2A, or F2A), such that the first caTCR nucleic acid sequence and the second caTCR nucleic acid sequence are transcribed as a single RNA under the control of the constitutive promoter.
  • the constitutive promoter is an EF1-alpha promoter, or variant thereof.
  • the EF1-alpha promoter comprises, consists essentially of, or consists of the nucleotide sequence of SEQ ID NO: 75.
  • the inducible promoter comprises one or more elements responsive to immune cell activation.
  • the inducible promoter is an NFAT-derived promoter.
  • the NFAT-derived promoter comprises, consists essentially of, or consists of the nucleotide sequence of SEQ ID NO: 74.
  • the first and/or second vectors are viral vectors (such as lentiviral vectors).
  • the caTCR targets an MHC-restricted AFP peptide presented on the surface of a cell
  • the SSE targets CD3 and GPC3.
  • nucleic acid encoding a) a dimeric caTCR comprising an antibody moiety that specifically binds to a target antigen and a TCRM capable of recruiting at least one TCR-associated signaling molecule, the dimeric caTCR comprising a first caTCR polypeptide chain comprising a first TCRD comprising a first TCR-TM and a second caTCR polypeptide chain comprising a second TCRD comprising a second TCR-TM, wherein the first and second TCRDs together form the TCRM, and wherein the antibody moiety is linked to one or both of the first and second TCRDs, the nucleic acid comprising a first caTCR nucleic acid sequence encoding the first caTCR polypeptide chain, and a second caTCR nucleic acid sequence encoding the second caTCR polypeptide chain; and b) a monomeric SSE capable of enhancing an immune response mediated by the caTCR, the nucleic acid further comprising
  • the first caTCR nucleic acid sequence is contained in a first vector (such as a viral vector, e.g., a lentiviral vector)
  • the second caTCR nucleic acid sequence is contained in a second vector (such as a viral vector, e.g., a lentiviral vector)
  • the SSE nucleic acid sequence is contained in a third vector (such as a viral vector, e.g., a lentiviral vector).
  • some or all of the first and second caTCR nucleic acid sequences and SSE nucleic acid sequence are contained in the same vector (such as a viral vector, e.g., a lentiviral vector).
  • each of the first and second caTCR nucleic acid sequences and SSE nucleic acid sequence are, individually, operably linked to a promoter.
  • some or all of the first and second caTCR nucleic acid sequences and SSE nucleic acid sequence are under the control of a single promoter.
  • the first and second caTCR nucleic acid sequences are under the control of a first promoter
  • the SSE nucleic acid sequence is under the control of a second promoter.
  • some or all of the promoters have the same sequence.
  • some or all of the promoters have different sequences.
  • some or all of the promoters are inducible.
  • the SSE nucleic acid sequence is operably linked to an inducible promoter.
  • the inducible promoter comprises one or more elements responsive to immune cell activation.
  • the inducible promoter is an NFAT-derived promoter.
  • the NFAT-derived promoter comprises the nucleotide sequence of SEQ ID NO: 74.
  • some or all of the vectors are viral vectors (such as lentiviral vectors).
  • the antibody moiety of the caTCR is selected from the group consisting of a Fab, a Fab′, a (Fab′)2, an Fv, and a single chain Fv (scFv).
  • the antigen-binding module is multispecific (such as bispecific).
  • the antibody moiety specifically binds a cell surface antigen including, without limitation, CD19, CD20, CD22, CD47, GPC-3, ROR1, ROR2, BCMA, GPRC5D, and FCRL5, including variants or mutants thereof.
  • the antibody moiety specifically binds a peptide/MHC complex, wherein the peptide is derived from a protein including, without limitation, WT-1, AFP, HPV16-E7, NY-ESO-1, PRAME, EBV-LMP2A, HIV-1, KRAS, Histone H3.3, and PSA, including variants or mutants thereof.
  • the SSE is a multispecific antibody (such as a bispecific antibody, e.g., a tandem scFv) targeting an immune cell (such as a T cell or NK cell) and a disease cell (such as a cancer cell).
  • a multispecific antibody such as a bispecific antibody, e.g., a tandem scFv
  • an immune cell such as a T cell or NK cell
  • a disease cell such as a cancer cell
  • the SSE comprises a first antibody moiety (e.g., a first scFv) targeting CD3 or CD16a, and a second antibody moiety (e.g., a second scFv) targeting GPC3, CD47, MUC16, CD19, CD20, CD22, EpCAM, EGFR, HER2, CEA, PSMA, AFP, PSA, BCMA, FCRL5, NY-ESO, HPV16, or FoxP3, including variants or mutants thereof.
  • a first antibody moiety e.g., a first scFv
  • a second antibody moiety e.g., a second scFv
  • the SSE is a multispecific antibody selected from the group consisting of a tandem scFv, a diabody (Db), a single chain diabody (scDb), a dual-affinity retargeting (DART) antibody, and a dual variable domain (DVD) antibody.
  • the SSE is a tandem scFv comprising a first scFv targeting the immune cell and a second scFv targeting the disease cell.
  • the SSE is an antibody moiety targeting an immune checkpoint molecule.
  • the SSE is an antagonistic antibody moiety targeting PD-1.
  • the SSE is a soluble molecule that specifically binds a ligand of an immunosuppressive receptor. In some embodiments, the SSE is a soluble molecule that specifically binds to and antagonizes an immunosuppressive receptor. In some embodiments, the SSE is a growth factor or stimulatory cytokine.
  • the vector can be readily introduced into a host cell, e.g., mammalian, bacterial, yeast, or insect cell by any method in the art.
  • the expression vector can be transferred into a host cell by physical, chemical, or biological means.
  • Physical methods for introducing a polynucleotide into a host cell include calcium phosphate precipitation, lipofection, particle bombardment, microinjection, electroporation, and the like. Methods for producing cells comprising vectors and/or exogenous nucleic acids are well-known in the art. See, for example, Sambrook et al. (2001, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York). In some embodiments, the introduction of a polynucleotide into a host cell is carried out by calcium phosphate transfection.
  • Biological methods for introducing a polynucleotide of interest into a host cell include the use of DNA and RNA vectors.
  • Viral vectors, and especially retroviral vectors have become the most widely used method for inserting genes into mammalian, e.g., human, cells.
  • Other viral vectors can be derived from lentivirus, poxviruses, herpes simplex virus 1, adenoviruses and adeno-associated viruses, and the like. See, for example, U.S. Pat. Nos. 5,350,674 and 5,585,362.
  • Chemical means for introducing a polynucleotide into a host cell include colloidal dispersion systems, such as macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes.
  • colloidal dispersion systems such as macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes.
  • An exemplary colloidal system for use as a delivery vehicle in vitro and in vivo is a liposome (e.g., an artificial membrane vesicle).
  • an exemplary delivery vehicle is a liposome.
  • lipid formulations is contemplated for the introduction of the nucleic acids into a host cell (in vitro, ex vivo or in vivo).
  • the nucleic acid may be associated with a lipid.
  • the nucleic acid associated with a lipid may be encapsulated in the aqueous interior of a liposome, interspersed within the lipid bilayer of a liposome, attached to a liposome via a linking molecule that is associated with both the liposome and the oligonucleotide, entrapped in a liposome, complexed with a liposome, dispersed in a solution containing a lipid, mixed with a lipid, combined with a lipid, contained as a suspension in a lipid, contained or complexed with a micelle, or otherwise associated with a lipid.
  • Lipid, lipid/DNA or lipid/expression vector associated compositions are not limited to any particular structure in solution.
  • Lipids are fatty substances which may be naturally occurring or synthetic lipids.
  • lipids include the fatty droplets that naturally occur in the cytoplasm as well as the class of compounds which contain long-chain aliphatic hydrocarbons and their derivatives, such as fatty acids, alcohols, amines, amino alcohols, and aldehydes.
  • assays include, for example, “molecular biological” assays well known to those of skill in the art, such as Southern and Northern blotting, RT-PCR and PCR; “biochemical” assays, such as detecting the presence or absence of a particular peptide, e.g., by immunological means (ELISAs and Western blots) or by assays described herein to identify agents falling within the scope of the invention.
  • molecular biological assays well known to those of skill in the art, such as Southern and Northern blotting, RT-PCR and PCR
  • biochemical assays such as detecting the presence or absence of a particular peptide, e.g., by immunological means (ELISAs and Western blots) or by assays described herein to identify agents falling within the scope of the invention.
  • the antibody moiety (e.g., Fab, Fab′, (Fab′)2, Fv, or scFv) comprises sequences derived from a monoclonal antibody.
  • the antibody moiety comprises V H and V L domains, or variants thereof, from the monoclonal antibody.
  • the antibody moiety further comprises C H 1 and C L domains, or variants thereof, from the monoclonal antibody.
  • Monoclonal antibodies can be prepared, e.g., using hybridoma methods, such as those described by Kohler and Milstein, Nature, 256:495 (1975) and Sergeeva et al., Blood, 117(16):4262-4272.
  • a hamster, mouse, or other appropriate host animal is typically immunized with an immunizing agent to elicit lymphocytes that produce or are capable of producing antibodies that will specifically bind to the immunizing agent.
  • the lymphocytes can be immunized in vitro.
  • the immunizing agent can include a polypeptide or a fusion protein of the protein of interest, or a complex comprising at least two molecules, such as a complex comprising a peptide and an MHC protein.
  • PBLs peripheral blood lymphocytes
  • spleen cells or lymph node cells are used if non-human mammalian sources are desired.
  • the lymphocytes are then fused with an immortalized cell line using a suitable fusing agent, such as polyethylene glycol, to form a hybridoma cell.
  • a suitable fusing agent such as polyethylene glycol
  • Immortalized cell lines are usually transformed mammalian cells, particularly myeloma cells of rodent, bovine, and human origin. Usually, rat or mouse myeloma cell lines are employed.
  • the hybridoma cells can be cultured in a suitable culture medium that preferably contains one or more substances that inhibit the growth or survival of the unfused, immortalized cells.
  • the culture medium for the hybridomas typically will include hypoxanthine, aminopterin, and thymidine (“HAT medium”), which prevents the growth of HGPRT-deficient cells.
  • HGPRT hypoxanthine guanine phosphoribosyl transferase
  • the immortalized cell lines fuse efficiently, support stable high-level expression of antibody by the selected antibody-producing cells, and are sensitive to a medium such as HAT medium.
  • the immortalized cell lines are murine myeloma lines, which can be obtained, for instance, from the Salk Institute Cell Distribution Center, San Diego, Calif. and the American Type Culture Collection, Manassas, Va. Human myeloma and mouse-human heteromyeloma cell lines also have been described for the production of human monoclonal antibodies. Kozbor, J. Immunol., 133:3001 (1984); Brodeur et al. Monoclonal Antibody Production Techniques and Applications (Marcel Dekker, Inc.: New York, 1987) pp. 51-63.
  • the culture medium in which the hybridoma cells are cultured can then be assayed for the presence of monoclonal antibodies directed against the polypeptide.
  • the binding specificity of monoclonal antibodies produced by the hybridoma cells can be determined by immunoprecipitation or by an in vitro binding assay, such as radioimmunoassay (RIA) or enzyme-linked immunoabsorbent assay (ELISA). Such techniques and assays are known in the art.
  • the binding affinity of the monoclonal antibody can, for example, be determined by the Scatchard analysis of Munson and Pollard, Anal. Biochem., 107:220 (1980).
  • the clones can be sub-cloned by limiting dilution procedures and grown by standard methods. Goding, supra. Suitable culture media for this purpose include, for example, Dulbecco's Modified Eagle's Medium and RPMI-1640 medium. Alternatively, the hybridoma cells can be grown in vivo as ascites in a mammal.
  • the monoclonal antibodies secreted by the sub-clones can be isolated or purified from the culture medium or ascites fluid by conventional immunoglobulin purification procedures such as, for example, protein A-Sepharose, hydroxylapatite chromatography, gel electrophoresis, dialysis, or affinity chromatography.
  • the antibody moiety comprises sequences from a clone selected from an antibody moiety library (such as a phage library presenting scFv or Fab fragments).
  • the clone may be identified by screening combinatorial libraries for antibody fragments with the desired activity or activities. For example, a variety of methods are known in the art for generating phage display libraries and screening such libraries for antibodies possessing the desired binding characteristics.
  • repertoires of V H and V L genes are separately cloned by polymerase chain reaction (PCR) and recombined randomly in phage libraries, which can then be screened for antigen-binding phage as described in Winter et al., Ann. Rev. Immunol., 12: 433-455 (1994).
  • Phage typically display antibody fragments, either as single-chain Fv (scFv) fragments or as Fab fragments.
  • naive repertoire can be cloned (e.g., from human) to provide a single source of antibodies to a wide range of non-self and also self-antigens without any immunization as described by Griffiths et al., EMBO J, 12: 725-734 (1993).
  • naive libraries can also be made synthetically by cloning unrearranged V-gene segments from stem cells, and using PCR primers containing random sequence to encode the highly variable CDR3 regions and to accomplish rearrangement in vitro, as described by Hoogenboom and Winter, J. Mol. Biol., 227: 381-388 (1992).
  • Patent publications describing human antibody phage libraries include, for example: U.S. Pat. No. 5,750,373, and US Patent Publication Nos. 2005/0079574, 2005/0119455, 2005/0266000, 2007/0117126, 2007/0160598, 2007/0237764, 2007/0292936, and 2009/0002360.
  • the antibody moiety can be prepared using phage display to screen libraries for antibodies specific to the target antigen (such as a peptide/MHC class I/11 complex or a cell surface antigen).
  • the library can be a human scFv phage display library having a diversity of at least one ⁇ 10 9 (such as at least about any of 1 ⁇ 10 9 , 2.5 ⁇ 10 9 , 5 ⁇ 10 9 , 7.5 ⁇ 10 9 , 1 ⁇ 10 10 , 2.5 ⁇ 10 10 , 5 ⁇ 10 10 , 7.5 ⁇ 10 10 , or 1 ⁇ 10 11 ) unique human antibody fragments.
  • the library is a na ⁇ ve human library constructed from DNA extracted from human PMBCs and spleens from healthy donors, encompassing all human heavy and light chain subfamilies.
  • the library is a na ⁇ ve human library constructed from DNA extracted from PBMCs isolated from patients with various diseases, such as patients with autoimmune diseases, cancer patients, and patients with infectious diseases.
  • the library is a semi-synthetic human library, wherein heavy chain CDR3 is completely randomized, with all amino acids (with the exception of cysteine) equally likely to be present at any given position (see, e.g., Hoet, R. M. et al., Nat. Biotechnol.
  • the heavy chain CDR3 of the semi-synthetic human library has a length from about 5 to about 24 (such as about any of 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, or 24) amino acids.
  • the library is a fully-synthetic phage display library.
  • the library is a non-human phage display library.
  • Phage clones that bind to the target antigen with high affinity can be selected by iterative binding of phage to the target antigen, which is bound to a solid support (such as, for example, beads for solution panning or mammalian cells for cell panning), followed by removal of non-bound phage and by elution of specifically bound phage.
  • a solid support such as, for example, beads for solution panning or mammalian cells for cell panning
  • the target antigen can be biotinylated for immobilization to a solid support.
  • the biotinylated target antigen is mixed with the phage library and a solid support, such as streptavidin-conjugated Dynabeads M-280, and then target antigen-phage-bead complexes are isolated.
  • the bound phage clones are then eluted and used to infect an appropriate host cell, such as E. coli XL1-Blue, for expression and purification.
  • T2 cells a TAP-deficient, HLA-A*02:01 + lymphoblast cell line
  • AFP peptide a TAP-deficient, HLA-A*02:01 + lymphoblast cell line
  • the panning can be performed for multiple (such as about any of 2, 3, 4, 5, 6 or more) rounds with either solution panning, cell panning, or a combination of both, to enrich for phage clones binding specifically to the target antigen.
  • Enriched phage clones can be tested for specific binding to the target antigen by any methods known in the art, including for example ELISA and FACS.
  • the caTCR, SSE and CSR antibody moieties can be human or humanized.
  • Humanized forms of non-human (e.g., murine) antibody moieties are chimeric immunoglobulins, immunoglobulin chains, or fragments thereof (such as Fv, Fab, Fab′, F(ab′) 2 , scFv, or other antigen-binding subsequences of antibodies) that typically contain minimal sequence derived from non-human immunoglobulin.
  • Humanized antibody moieties include human immunoglobulins, immunoglobulin chains, or fragments thereof (recipient antibody) in which residues from a CDR of the recipient are replaced by residues from a CDR of a non-human species (donor antibody) such as mouse, rat, or rabbit having the desired specificity, affinity, and capacity.
  • donor antibody such as mouse, rat, or rabbit having the desired specificity, affinity, and capacity.
  • Fv framework residues of the human immunoglobulin are replaced by corresponding non-human residues.
  • Humanized antibody moieties can also comprise residues that are found neither in the recipient antibody moiety nor in the imported CDR or framework sequences.
  • the humanized antibody moiety can comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin, and all or substantially all of the FR regions are those of a human immunoglobulin consensus sequence.
  • CDR regions correspond to those of a non-human immunoglobulin
  • FR regions are those of a human immunoglobulin consensus sequence.
  • a humanized antibody moiety has one or more amino acid residues introduced into it from a source that is non-human. These non-human amino acid residues are often referred to as “import” residues, which are typically taken from an “import” variable domain.
  • humanization can be essentially performed following the method of Winter and co-workers (Jones et al., Nature, 321: 522-525 (1986); Riechmann et al., Nature, 332: 323-327 (1988); Verhoeyen et al., Science, 239: 1534-1536 (1988)), by substituting rodent CDRs or CDR sequences for the corresponding sequences of a human antibody moiety.
  • humanized antibody moieties are antibody moieties (U.S. Pat. No. 4,816,567), wherein substantially less than an intact human variable domain has been substituted by the corresponding sequence from a non-human species.
  • humanized antibody moieties are typically human antibody moieties in which some CDR residues and possibly some FR residues are substituted by residues from analogous sites in rodent antibodies.
  • human antibody moieties can be generated.
  • transgenic animals e.g., mice
  • JH antibody heavy-chain joining region
  • human antibodies can be made by introducing human immunoglobulin loci into transgenic animals, e.g., mice in which the endogenous immunoglobulin genes have been partially or completely inactivated.
  • Human antibodies may also be generated by in vitro activated B cells (see U.S. Pat. Nos. 5,567,610 and 5,229,275) or by using various techniques known in the art, including phage display libraries. Hoogenboom and Winter, J. Mol. Biol., 227:381 (1991); Marks et al., J. Mol. Biol., 222:581 (1991). The techniques of Cole et al. and Boerner et al. are also available for the preparation of human monoclonal antibodies. Cole et al., Monoclonal Antibodies and Cancer Therapy , Alan R. Liss, p. 77 (1985) and Boerner et al., J. Immunol., 147(1): 86-95 (1991).
  • amino acid sequence variants of the antigen-binding modules provided herein are contemplated. For example, it may be desirable to improve the binding affinity and/or other biological properties of the antigen-binding module.
  • Amino acid sequence variants of an antigen-binding module may be prepared by introducing appropriate modifications into the nucleotide sequence encoding the antigen-binding module, or by peptide synthesis. Such modifications include, for example, deletions from, and/or insertions into and/or substitutions of residues within the amino acid sequences of the antigen-binding module. Any combination of deletion, insertion, and substitution can be made to arrive at the final construct, provided that the final construct possesses the desired characteristics, e.g., antigen-binding.
  • antigen-binding module variants having one or more amino acid substitutions are provided.
  • Sites of interest for substitutional mutagenesis include the HVRs and FRs of antibody moieties.
  • Amino acid substitutions may be introduced into an antigen-binding module of interest and the products screened for a desired activity, e.g., retained/improved antigen binding or decreased immunogenicity.
  • Amino acids may be grouped into different classes according to common side-chain properties:
  • Non-conservative substitutions will entail exchanging a member of one of these classes for another class.
  • An exemplary substitutional variant is an affinity matured antibody moiety, which may be conveniently generated, e.g., using phage display-based affinity maturation techniques. Briefly, one or more CDR residues are mutated and the variant antibody moieties displayed on phage and screened for a particular biological activity (e.g., binding affinity). Alterations (e.g., substitutions) may be made in HVRs, e.g., to improve antibody moiety affinity. Such alterations may be made in HVR “hotspots,” i.e., residues encoded by codons that undergo mutation at high frequency during the somatic maturation process (see, e.g., Chowdhury, Methods Mol. Biol.
  • variable genes chosen for maturation are introduced into the variable genes chosen for maturation by any of a variety of methods (e.g., error-prone PCR, chain shuffling, or oligonucleotide-directed mutagenesis).
  • a secondary library is then created. The library is then screened to identify any antibody moiety variants with the desired affinity.
  • Another method to introduce diversity involves HVR-directed approaches, in which several HVR residues (e.g., 4-6 residues at a time) are randomized. HVR residues involved in antigen binding may be specifically identified, e.g., using alanine scanning mutagenesis or modeling. CDR-H3 and CDR-L3 in particular are often targeted.
  • substitutions, insertions, or deletions may occur within one or more HVRs so long as such alterations do not substantially reduce the ability of the antibody moiety to bind antigen.
  • conservative alterations e.g., conservative substitutions as provided herein
  • Such alterations may be outside of HVR “hotspots” or SDRs.
  • each HVR either is unaltered, or contains no more than one, two or three amino acid substitutions.
  • a useful method for identification of residues or regions of an antigen-binding module that may be targeted for mutagenesis is called “alanine scanning mutagenesis” as described by Cunningham and Wells (1989) Science, 244:1081-1085.
  • a residue or group of target residues e.g., charged residues such as arg, asp, his, lys, and glu
  • a neutral or negatively charged amino acid e.g., alanine or polyalanine
  • a crystal structure of an antigen-antigen-binding module complex can be determined to identify contact points between the antigen-binding module and antigen. Such contact residues and neighboring residues may be targeted or eliminated as candidates for substitution. Variants may be screened to determine whether they contain the desired properties.
  • Amino acid sequence insertions include amino- and/or carboxyl-terminal fusions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues.
  • terminal insertions include an antigen-binding module with an N-terminal methionyl residue.
  • Other insertional variants of the antigen-binding module include the fusion to the N- or C-terminus of the antigen-binding module to an enzyme (e.g., for ADEPT) or a polypeptide which increases the serum half-life of the antigen-binding module.
  • a caTCR according to any of the caTCRs described herein and/or an SSE according to any of the SSEs described herein and/or a CSR according to any of the CSRs described herein may be further modified to contain additional nonproteinaceous moieties that are known in the art and readily available.
  • the moieties suitable for derivatization of the caTCR and/or SSE and/or CSR include but are not limited to water soluble polymers.
  • Non-limiting examples of water soluble polymers include, but are not limited to, polyethylene glycol (PEG), copolymers of ethylene glycol/propylene glycol, carboxymethylcellulose, dextran, polyvinyl alcohol, polyvinyl pyrrolidone, poly-1,3-dioxolane, poly-1,3,6-trioxane, ethylene/maleic anhydride copolymer, polyaminoacids (either homopolymers or random copolymers), and dextran or poly(n-vinyl pyrrolidone)polyethylene glycol, propropylene glycol homopolymers, prolypropylene oxide/ethylene oxide co-polymers, polyoxyethylated polyols (e.g., glycerol), polyvinyl alcohol, and mixtures thereof.
  • PEG polyethylene glycol
  • copolymers of ethylene glycol/propylene glycol carboxymethylcellulose
  • dextran polyvinyl alcohol
  • Polyethylene glycol propionaldehyde may have advantages in manufacturing due to its stability in water.
  • the polymer may be of any molecular weight, and may be branched or unbranched.
  • the number of polymers attached to the caTCR and/or SSE and/or CSR may vary, and if more than one polymer are attached, they can be the same or different molecules. In general, the number and/or type of polymers used for derivatization can be determined based on considerations including, but not limited to, the particular properties or functions of the caTCR and/or SSE and/or CSR to be improved, whether the caTCR and/or SSE and/or CSR derivative will be used in a therapy under defined conditions, etc.
  • conjugates of a caTCR and/or SSE and/or CSR and nonproteinaceous moiety that may be selectively heated by exposure to radiation are provided.
  • the nonproteinaceous moiety is a carbon nanotube (Kam et al., Proc. Natl. Acad. Sci. USA 102: 11600-11605 (2005)).
  • the radiation may be of any wavelength, and includes, but is not limited to, wavelengths that do not harm ordinary cells, but which heat the nonproteinaceous moiety to a temperature at which cells proximal to the caTCR- and/or SSE- and/or CSR-nonproteinaceous moiety are killed.
  • the present invention in one aspect provides immune cells (such as lymphocytes, for example T cells) expressing a caTCR and an SSE according to any of the embodiments described herein.
  • immune cells such as lymphocytes, for example T cells
  • SSE exemplary methods of preparing immune cells (such as T cells) expressing a caTCR and an SSE (caTCR plus SSE immune cells, such as caTCR plus SSE T cells) are provided herein.
  • a caTCR plus SSE immune cell (such as a caTCR plus SSE T cell) can be generated by introducing one or more nucleic acids (including for example a lentiviral vector) encoding a caTCR (such as any of the caTCRs described herein) that specifically binds to a target antigen (such as a disease-associated antigen) and an SSE (such as any of the SSEs described herein).
  • a target antigen such as a disease-associated antigen
  • SSE such as any of the SSEs described herein.
  • the caTCR plus SSE immune cells (such as caTCR plus SSE T cells) of the invention are able to replicate in vivo, resulting in long-term persistence that can lead to sustained control of a disease associated with expression of the target antigen (such as cancer or viral infection).
  • the invention relates to administering a genetically modified T cell expressing a caTCR that specifically binds to a target antigen according to any of the caTCRs described herein and an SSE capable of enhancing an immune response mediated by the caTCR according to any of the SSEs described herein for the treatment of a patient having or at risk of developing a disease and/or disorder associated with expression of the target antigen (also referred to herein as a “target antigen-positive” or “TA-positive” disease or disorder), including, for example, cancer or viral infection, using lymphocyte infusion.
  • autologous lymphocyte infusion is used in the treatment.
  • Autologous PBMCs are collected from a patient in need of treatment and T cells are activated and expanded using the methods described herein and known in the art and then infused back into the patient.
  • a T cell expressing a caTCR that specifically binds to a target antigen according to any of the caTCRs described herein and expressing or capable of expressing an SSE that is capable of being secreted from the T cell also referred to herein as an “caTCR plus SSE T cell”.
  • the caTCR plus SSE T cells of the invention can undergo robust in vivo T cell expansion and can establish target antigen-specific memory cells that persist at high levels for an extended amount of time in blood and bone marrow.
  • the caTCR plus SSE T cells of the invention infused into a patient can eliminate target antigen-presenting cells, such as target antigen-presenting cancer or virally-infected cells, in vivo in patients having a target antigen-associated disease.
  • the caTCR plus SSE T cells of the invention infused into a patient can eliminate target antigen-presenting cells, such as target antigen-presenting cancer or virally-infected cells, in vivo in patients having a target antigen-associated disease that is refractory to at least one conventional treatment.
  • T cells Prior to expansion and genetic modification of the T cells, a source of T cells is obtained from a subject.
  • T cells can be obtained from a number of sources, including peripheral blood mononuclear cells, bone marrow, lymph node tissue, cord blood, thymus tissue, tissue from a site of infection, ascites, pleural effusion, spleen tissue, and tumors.
  • any number of T cell lines available in the art may be used.
  • T cells can be obtained from a unit of blood collected from a subject using any number of techniques known to the skilled artisan, such as FICOLLTM separation.
  • cells from the circulating blood of an individual are obtained by apheresis.
  • the apheresis product typically contains lymphocytes, including T cells, monocytes, granulocytes, B cells, other nucleated white blood cells, red blood cells, and platelets.
  • the cells collected by apheresis may be washed to remove the plasma fraction and to place the cells in an appropriate buffer or media for subsequent processing steps.
  • the cells are washed with phosphate buffered saline (PBS).
  • PBS phosphate buffered saline
  • the wash solution lacks calcium and may lack magnesium or may lack many if not all divalent cations.
  • a washing step may be accomplished by methods known to those in the art, such as by using a semi-automated “flow-through” centrifuge (for example, the Cobe 2991 cell processor, the Baxter CytoMate, or the Haemonetics Cell Saver 5) according to the manufacturer's instructions.
  • a semi-automated “flow-through” centrifuge for example, the Cobe 2991 cell processor, the Baxter CytoMate, or the Haemonetics Cell Saver 5
  • the cells may be resuspended in a variety of biocompatible buffers, such as Ca 2+ -free, Mg 2+ -free PBS, PlasmaLyte A, or other saline solutions with or without buffer.
  • the undesirable components of the apheresis sample may be removed and the cells directly resuspended in culture media.
  • T cells are isolated from peripheral blood lymphocytes by lysing the red blood cells and depleting the monocytes, for example, by centrifugation through a PERCOLLTM gradient or by counterflow centrifugal elutriation.
  • a specific subpopulation of T cells such as CD3 + , CD28 + , CD4 + , CD8 + , CD45RA + , and CD45RO + T cells, can be further isolated by positive or negative selection techniques.
  • T cells are isolated by incubation with anti-CD3/anti-CD28 (i.e., 3 ⁇ 28)-conjugated beads, such as DYNABEADS® M-450 CD3/CD28 T, for a time period sufficient for positive selection of the desired T cells.
  • the time period is about 30 minutes. In some embodiments, the time period ranges from 30 minutes to 36 hours or longer (including all ranges between these values). In some embodiments, the time period is at least one, 2, 3, 4, 5, or 6 hours. In some embodiments, the time period is 10 to 24 hours. In some embodiments, the incubation time period is 24 hours.
  • TIL tumor infiltrating lymphocytes
  • subpopulations of T cells can be preferentially selected for or against at culture initiation or at other desired time points.
  • multiple rounds of selection can also be used in the context of this invention. In some embodiments, it may be desirable to perform the selection procedure and use the “unselected” cells in the activation and expansion process. “Unselected” cells can also be subjected to further rounds of selection.
  • Enrichment of a T cell population by negative selection can be accomplished with a combination of antibodies directed to surface markers unique to the negatively selected cells.
  • One method is cell sorting and/or selection via negative magnetic immunoadherence or flow cytometry that uses a cocktail of monoclonal antibodies directed to cell surface markers present on the cells negatively selected.
  • a monoclonal antibody cocktail typically includes antibodies to CD 14, CD20, CD11 b, CD 16, HLA-DR, and CD8.
  • T regulatory cells are depleted by anti-CD25 conjugated beads or other similar methods of selection.
  • the concentration of cells and surface can be varied. In some embodiments, it may be desirable to significantly decrease the volume in which beads and cells are mixed together (i.e., increase the concentration of cells), to ensure maximum contact of cells and beads. For example, in some embodiments, a concentration of about 2 billion cells/ml is used. In some embodiments, a concentration of about 1 billion cells/ml is used. In some embodiments, greater than about 100 million cells/ml is used. In some embodiments, a concentration of cells of about any of 10, 15, 20, 25, 30, 35, 40, 45, or 50 million cells/ml is used.
  • a concentration of cells of about any of 75, 80, 85, 90, 95, or 100 million cells/ml is used. In some embodiments, a concentration of about 125 or about 150 million cells/ml is used.
  • Using high concentrations can result in increased cell yield, cell activation, and cell expansion. Further, use of high cell concentrations allows more efficient capture of cells that may weakly express target antigens of interest, such as CD28-negative T cells, or from samples where there are many tumor cells present (i.e., leukemic blood, tumor tissue, etc.). Such populations of cells may have therapeutic value and would be desirable to obtain. For example, using high concentration of cells allows more efficient selection of CD8 + T cells that normally have weaker CD28 expression.
  • T cells are obtained from a patient directly following treatment.
  • the quality of T cells obtained may be optimal or improved for their ability to expand ex vivo.
  • these cells may be in a preferred state for enhanced engraftment and in vivo expansion.
  • mobilization for example, mobilization with GM-CSF
  • conditioning regimens can be used to create a condition in a subject wherein repopulation, recirculation, regeneration, and/or expansion of particular cell types is favored, especially during a defined window of time following therapy.
  • Illustrative cell types include T cells, B cells, dendritic cells, and other cells of the immune system.
  • the T cells can be activated and expanded generally using methods as described, for example, in U.S. Pat. Nos. 6,352,694; 6,534,055; 6,905,680; 6,692,964; 5,858,358; 6,887,466; 6,905,681; 7,144,575; 7,067,318; 7,172,869; 7,232,566; 7,175,843; 5,883,223; 6,905,874; 6,797,514; 6,867,041; and U.S. Patent Application Publication No. 20060121005.
  • the T cells of the invention are expanded by contact with a surface having attached thereto an agent that stimulates a CD3/TCR complex associated signal and a ligand that stimulates a costimulatory molecule on the surface of the T cells.
  • T cell populations may be stimulated, such as by contact with an anti-CD3 antibody, or antigen-binding fragment thereof, or an anti-CD2 antibody immobilized on a surface, or by contact with a protein kinase C activator (e.g., bryostatin) in conjunction with a calcium ionophore.
  • a ligand that binds the accessory molecule is used for co-stimulation of an accessory molecule on the surface of the T cells.
  • a population of T cells can be contacted with an anti-CD3 antibody and an anti-CD28 antibody, under conditions appropriate for stimulating proliferation of the T cells.
  • an anti-CD3 antibody and an anti-CD28 antibody can be used as can other methods commonly known in the art (Berg et al., Transplant Proc. 30(8):3975-3977, 1998; Haanen et al., J. Exp. Med. 190(9):13191328, 1999; Garland et al., J. Immunol. Meth. 227(1-2):53-63, 1999).
  • the caTCR plus SSE immune cells (such as caTCR plus SSE T cells) of the invention are generated by transducing immune cells (such as T cells prepared by the methods described herein) with one or more viral vectors encoding a caTCR as described herein and an SSE as described herein.
  • Viral vector delivery systems include DNA and RNA viruses, which have either episomal or integrated genomes after delivery to the immune cell.
  • the caTCR plus SSE immune cell comprises the one or more vectors integrated into the caTCR plus SSE immune cell genome.
  • the one or more viral vectors are lentiviral vectors.
  • the caTCR plus SSE immune cell is a caTCR plus SSE T cell comprising the lentiviral vectors integrated into its genome.
  • the caTCR plus SSE immune cell is a T cell modified to block or decrease the expression of one or both of its endogenous TCR chains.
  • the caTCR plus SSE immune cell is an ⁇ T cell modified to block or decrease the expression of the TCR ⁇ and/or ⁇ chains, or the caTCR plus SSE immune cell is a ⁇ T cell modified to block or decrease the expression of the TCR ⁇ and/or ⁇ chains.
  • Modifications of cells to disrupt gene expression include any such techniques known in the art, including for example RNA interference (e.g., siRNA, shRNA, miRNA), gene editing (e.g., CRISPR- or TALEN-based gene knockout), and the like.
  • caTCR plus SSE T cells with reduced expression of one or both of the endogenous TCR chains of the T cell are generated using the CRISPR/Cas system.
  • CRISPR/Cas system of gene editing see for example Jian W & Marraffini L A, Annu. Rev. Microbiol. 69, 2015; Hsu P D et al., Cell, 157(6):1262-1278, 2014; and O'Connell M R et al., Nature Volume: 516:Pages:263-266, 2014.
  • caTCR plus SSE T cells with reduced expression of one or both of the endogenous TCR chains of the T cell are generated using TALEN-based genome editing.
  • a method of enriching a heterogeneous cell population for a caTCR plus SSE immune cell according to any of the caTCR plus SSE immune cells described herein.
  • caTCR plus SSE immune cells that specifically bind to a target antigen can be enriched for by positive selection techniques.
  • caTCR plus SSE immune cells (such as caTCR plus SSE T cells) are enriched for by incubation with target antigen-conjugated beads for a time period sufficient for positive selection of the desired caTCR plus SSE immune cells.
  • the time period is about 30 minutes. In some embodiments, the time period ranges from 30 minutes to 36 hours or longer (including all ranges between these values). In some embodiments, the time period is at least one, 2, 3, 4, 5, or 6 hours. In some embodiments, the time period is 10 to 24 hours.
  • the incubation time period is 24 hours.
  • use of longer incubation times such as 24 hours, can increase cell yield. Longer incubation times may be used to isolate caTCR plus SSE immune cells in any situation where there are few caTCR plus SSE immune cells as compared to other cell types. The skilled artisan would recognize that multiple rounds of selection can also be used in the context of this invention.
  • the concentration of cells and surface can be varied. In some embodiments, it may be desirable to significantly decrease the volume in which beads and cells are mixed together (i.e., increase the concentration of cells), to ensure maximum contact of cells and beads. For example, in some embodiments, a concentration of about 2 billion cells/ml is used. In some embodiments, a concentration of about 1 billion cells/ml is used. In some embodiments, greater than about 100 million cells/ml is used. In some embodiments, a concentration of cells of about any of 10, 15, 20, 25, 30, 35, 40, 45, or 50 million cells/ml is used.
  • a concentration of cells of about any of 75, 80, 85, 90, 95, or 100 million cells/ml is used. In some embodiments, a concentration of about 125 or about 150 million cells/ml is used. Using high concentrations can result in increased cell yield, cell activation, and cell expansion. Further, use of high cell concentrations allows more efficient capture of caTCR plus SSE immune cells that may weakly express the caTCR.
  • enrichment results in minimal or substantially no exhaustion of the caTCR plus SSE immune cells.
  • enrichment results in fewer than about 50% (such as fewer than about any of 45, 40, 35, 30, 25, 20, 15, 10, or 5%) of the caTCR plus SSE immune cells becoming exhausted.
  • Effector cell exhaustion can be determined by any means known in the art, including any means described herein.
  • enrichment results in minimal or substantially no terminal differentiation of the caTCR plus SSE immune cells.
  • enrichment results in fewer than about 50% (such as fewer than about any of 45, 40, 35, 30, 25, 20, 15, 10, or 5%) of the caTCR plus SSE immune cells becoming terminally differentiated.
  • Effector cell differentiation can be determined by any means known in the art, including any means described herein.
  • enrichment results in minimal or substantially no internalization of caTCRs on the caTCR plus SSE immune cells. For example, in some embodiments, enrichment results in less than about 50% (such as less than about any of 45, 40, 35, 30, 25, 20, 15, 10, or 5%) of caTCRs on the caTCR plus SSE immune cells becoming internalized. Internalization of caTCRs on caTCR plus SSE immune cells can be determined by any means known in the art, including any means described herein.
  • enrichment results in increased proliferation of the caTCR plus SSE immune cells.
  • enrichment results in an increase of at least about 10% (such as at least about any of 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 1000% or more) in the number of caTCR plus SSE immune cells following enrichment.
  • a method of enriching a heterogeneous cell population for caTCR plus SSE immune cells expressing a caTCR that specifically binds to a target antigen and expressing or capable of expressing an SSE comprising: a) contacting the heterogeneous cell population with a first molecule comprising the target antigen or one or more epitopes contained therein to form complexes comprising the caTCR plus SSE immune cell bound to the first molecule; and b) separating the complexes from the heterogeneous cell population, thereby generating a cell population enriched for the caTCR plus SSE immune cells.
  • the first molecule is immobilized to a solid support.
  • the solid support is particulate (such as beads). In some embodiments, the solid support is a surface (such as the bottom of a well). In some embodiments, the first molecule is labelled with a tag. In some embodiments, the tag is a fluorescent molecule, an affinity tag, or a magnetic tag. In some embodiments, the method further comprises eluting the caTCR plus SSE immune cells from the first molecule and recovering the eluate.
  • a caTCR library for example cells expressing a library of nucleic acids encoding a plurality of caTCRs, may be exposed to a capture molecule comprising the target antigen or one or more epitopes contained therein, followed by isolation of affinity members of the library that specifically bind the capture molecule.
  • the capture molecule is immobilized on a solid support.
  • the support may be the surfaces of beads, microtitre plates, immunotubes, or any material known in the art useful for such purposes.
  • the interaction takes place in solution with a tagged capture molecule (e.g. biotinylated capture molecule).
  • the procedure involves one or more washing steps to remove unspecific and non-reactive library members (panning).
  • to purify complexes in solution they are collected by either immobilization or by centrifugation.
  • affinity members are captured on a soluble biotinylated capture molecule, followed by immobilization of the affinity complex (affinity member and capture molecule) on streptavidin beads.
  • the solid support is a bead.
  • the beads include, for example, magnetic beads (e.g. from Bangs Laboratories, Polysciences inc., Dynal Biotech, Miltenyi Biotech or Quantum Magnetic), nonmagnetic beads (e.g.
  • the affinity members are purified by positive selection. In some embodiments, the affinity members are purified by negative selection to remove unwanted library members. In some embodiments, the affinity members are purified by both positive and negative selection steps.
  • nucleic acid sequences encoding the caTCRs to be expressed in the library are incorporated into expression vectors appropriate for the type of expression system to be used.
  • Appropriate expression vectors for use in display in cells, such as CD3+ cells, are well known and described in the art.
  • the expression vector is a viral vector, such as a lentiviral vector.
  • nucleic acid library comprising sequences encoding a plurality of caTCRs according to any one of the embodiments described herein.
  • the nucleic acid library comprises viral vectors encoding the plurality of caTCRs.
  • the viral vectors are lentiviral vectors.
  • a method of screening a nucleic acid library according to any of the embodiments described herein for sequences encoding caTCRs specific for a target antigen comprising: a) introducing the nucleic acid library into a plurality of cells, such that the caTCRs are expressed on the surface of the plurality of cells; b) incubating the plurality of cells with a capture molecule comprising the target antigen or one or more epitopes contained therein; c) collecting cells bound to the capture molecule; and d) isolating sequences encoding the caTCRs from cells collected in step c), thereby identifying caTCRs specific for the target antigen.
  • the method further comprises one or more wash steps.
  • the one or more wash steps are carried out between steps b) and c).
  • the plurality of cells is a plurality of CD3+ cells.
  • the capture molecule is immobilized on a solid support.
  • the solid support is a bead.
  • collecting cells bound to the capture molecule comprises eluting cells from the capture ligand bound to the solid support and collecting the eluate.
  • the capture molecule is labelled with a tag.
  • the tag is a fluorescent molecule, an affinity tag, or a magnetic tag.
  • collecting cells bound to the capture molecule comprises isolating complexes comprising the cells and the labelled ligand. In some embodiments, the cells are dissociated from the complexes.
  • MHC class I proteins are one of two primary classes of major histocompatibility complex (MHC) molecules (the other being MHC class II) and are found on nearly every nucleated cell of the body. Their function is to display fragments of proteins from within the cell to T cells; healthy cells will be ignored, while cells containing foreign or mutated proteins will be attacked by the immune system. Because MHC class I proteins present peptides derived from cytosolic proteins, the pathway of WIC class I presentation is often called the cytosolic or endogenous pathway. Class I MHC molecules bind peptides generated mainly from degradation of cytosolic proteins by the proteasome. The MHC I:peptide complex is then inserted into the plasma membrane of the cell.
  • MHC major histocompatibility complex
  • class I MHC cytotoxic T cells
  • CTLs cytotoxic T cells
  • class I MHC can also present peptides generated from exogenous proteins, in a process known as cross-presentation.
  • MHC class I proteins consist of two polypeptide chains, ⁇ and ⁇ 2-microglobulin ( ⁇ 2M). The two chains are linked noncovalently via interaction of ⁇ 2M and the ⁇ 3 domain. Only the ⁇ chain is polymorphic and encoded by a HLA gene, while the ⁇ 2M subunit is not polymorphic and encoded by the ⁇ -2 microglobulin gene.
  • the ⁇ 3 domain is plasma membrane-spanning and interacts with the CD8 co-receptor of T-cells.
  • the ⁇ 3-CD8 interaction holds the MHC I molecule in place while the T cell receptor (TCR) on the surface of the cytotoxic T cell binds its ⁇ 1- ⁇ 2 heterodimer ligand, and checks the coupled peptide for antigenicity.
  • TCR T cell receptor
  • the ⁇ 1 and ⁇ 2 domains fold to make up a groove for peptides to bind.
  • MHC class I proteins bind peptides that are 8-10 amino acid in length.
  • MHC class II molecules are a family of molecules normally found only on antigen-presenting cells such as dendritic cells, mononuclear phagocytes, some endothelial cells, thymic epithelial cells, and B cells.
  • the antigens presented by class II peptides are derived from extracellular proteins (not cytosolic as in class I); hence, the MHC class II-dependent pathway of antigen presentation is called the endocytic or exogenous pathway.
  • Loading of an MHC class II molecule occurs by phagocytosis; extracellular proteins are endocytosed, digested in lysosomes, and the resulting epitopic peptide fragments are loaded onto MHC class II molecules prior to their migration to the cell surface.
  • class II molecules are also heterodimers, but in this case consist of two homogenous peptides, an ⁇ and ⁇ chain.
  • the subdesignation ⁇ 1, ⁇ 2, etc. refers to separate domains within the HLA gene; each domain is usually encoded by a different exon within the gene, and some genes have further domains that encode leader sequences, transmembrane sequences, etc. Because the antigen-binding groove of MHC class II molecules is open at both ends while the corresponding groove on class I molecules is closed at each end, the antigens presented by MHC class II molecules are longer, generally between 15 and 24 amino acid residues long.
  • the human leukocyte antigen (HLA) genes are the human versions of the MHC genes.
  • the three major MHC class I proteins in humans are HLA-A, HLA-B, and HLA-C, while the 3 minor ones are HLA-E, HLA-F, and HLA-G.
  • the three major MHC class II proteins involved in antigen presentation in humans are HLA-DP, HLDA-DQ, and HLA-DR, while the other MHC class II proteins, HLA-DM and HLA-DO, are involved in the internal processing and loading of antigens.
  • HLA-A is ranked among the genes in humans with the fastest-evolving coding sequence. As of December 2013, there were 2432 known HLA-A alleles coding for 1740 active proteins and 117 null proteins.
  • the HLA-A gene is located on the short arm of chromosome 6 and encodes the larger, a-chain, constituent of HLA-A. Variation of HLA-A a-chain is key to HLA function. This variation promotes genetic diversity in the population. Since each HLA has a different affinity for peptides of certain structures, greater variety of HLAs means greater variety of antigens to be ‘presented’ on the cell surface, enhancing the likelihood that a subset of the population will be resistant to any given foreign invader. This decreases the likelihood that a single pathogen has the capability to wipe out the entire human population. Each individual can express up to two types of HLA-A, one from each of their parents.
  • All alleles receive at least a four digit classification, e.g., HLA-A*02:12.
  • the A signifies which HLA gene the allele belongs to.
  • the next pair of digits indicates this assignment.
  • HLA-A*02:02, HLA-A*02:04, and HLA-A*02:324 are all members of the A2 serotype (designated by the *02 prefix). This group is the primary factor responsible for HLA compatibility. All numbers after this cannot be determined by serotyping and are designated through gene sequencing.
  • the second set of digits indicates what HLA protein is produced.
  • HLA-A02 proteins are assigned in order of discovery and as of December 2013 there are 456 different HLA-A02 proteins known (assigned names HLA-A*02:01 to HLA-A*02:456).
  • the shortest possible HLA name includes both of these details.
  • the Fab-like antigen-binding module specifically binds to a complex comprising a peptide derived from a disease-associated antigen (such as a tumor-associated or virally-encoded antigen) and an MHC class I protein, wherein the MHC class I protein is HLA-A, HLA-E, HLA-F, or HLA-G.
  • the MHC class I protein is HLA-A, HLA-B, or HLA-C.
  • the MHC class I protein is HLA-A.
  • the MHC class I protein is HLA-B.
  • the MEC class I protein is HLA-C.
  • the MEC class I protein is HLA-A01, HLA-A02, HLA-A03, HLA-A09, HLA-A10, HLA-A11, HLA-A19, HLA-A23, HLA-A24, HLA-A25, HLA-A26, HLA-A28, HLA-A29, HLA-A30, HLA-A31, HLA-A32, HLA-A33, HLA-A34, HLA-A36, HLA-A43, HLA-A66, HLA-A68, HLA-A69, HLA-A74, or HLA-A80.
  • the MHC class I protein is HLA-A02.
  • the MHC class I protein is any one of HLA-A*02:01-555, such as HLA-A*02:01, HLA-A*02:02, HLA-A*02:03, HLA-A*02:04, HLA-A*02:05, HLA-A*02:06, HLA-A*02:07, HLA-A*02:08, HLA-A*02:09, HLA-A*02:10, HLA-A*02:11, HLA-A*02:12, HLA-A*02:13, HLA-A*02:14, HLA-A*02:15, HLA-A*02:16, HLA-A*02:17, HLA-A*02:18, HLA-A*02:19, HLA-A*02:20, HLA-A*02:21, HLA-A*02:22, or HLA-A*02:24.
  • the MEC class I protein is HLA-A*02:
  • the Fab-like antigen-binding module specifically binds to a complex comprising a peptide derived from a disease-associated antigen (such as a tumor-associated or virally-encoded antigen) and an MEC class II protein, wherein the MEC class II protein is HLA-DP, HLA-DQ, or HLA-DR.
  • a disease-associated antigen such as a tumor-associated or virally-encoded antigen
  • MEC class II protein is HLA-DP.
  • HLA-DQ HLA-DR.
  • Peptides suitable for use in generating Fab-like antigen-binding modules can be determined, for example, based on the presence of HLA (such as HLA-A*02:01) binding motifs and cleavage sites for proteasomes and immune-proteasomes using computer prediction models known to those of skill in the art.
  • HLA such as HLA-A*02:01
  • models include, but are not limited to, ProPred1 (described in more detail in Singh and Raghava, ProPred: prediction of HLA - DR binding sites. BIOINFORMATICS 17(12):1236-1237, 2001), and SYFPEITHI (see Schuler et al. SYFPEITHI, Database for Searching and T - Cell Epitope Prediction. in Immunoinformatics Methods in Molecular Biology , vol 409(1): 75-93, 2007).
  • peptide synthesis may be done in accordance with protocols well known to those of skill in the art. Because of their relatively small size, the peptides of the invention may be directly synthesized in solution or on a solid support in accordance with conventional peptide synthesis techniques. Various automatic synthesizers are commercially available and can be used in accordance with known protocols. The synthesis of peptides in solution phase has become a well-established procedure for large-scale production of synthetic peptides and as such is a suitable alternative method for preparing the peptides of the invention (See for example, Solid Phase Peptide Synthesis by John Morrow Stewart and Martin et al. Application of Almez - mediated Amidation Reactions to Solution Phase Peptide Synthesis , Tetrahedron Letters Vol. 39, pages 1517-1520, 1998).
  • caTCR plus SSE immune cell compositions comprising an immune cell (such as a T cell) presenting on its surface a caTCR according to any of the caTCRs described herein and expressing or capable of expressing an SSE according to any of the SSEs described herein.
  • the caTCR plus SSE immune cell composition is a pharmaceutical composition.
  • the composition may comprise a homogenous cell population comprising caTCR plus SSE immune cells of the same cell type and expressing the same caTCR and SSE, or a heterogeneous cell population comprising a plurality of caTCR plus SSE immune cell populations comprising caTCR plus SSE immune cells of different cell types, expressing different caTCRs, and/or expressing different SSEs.
  • the composition may further comprise cells that are not caTCR plus SSE immune cells.
  • a caTCR plus SSE immune cell composition comprising a homogeneous cell population of caTCR plus SSE immune cells (such as caTCR plus SSE T cells) of the same cell type and expressing the same caTCR and SSE.
  • the caTCR plus SSE immune cell is a T cell.
  • the caTCR plus SSE immune cell is selected from the group consisting of a cytotoxic T cell, a helper T cell, a natural killer T cell, and a suppressor T cell.
  • the caTCR plus SSE immune cell composition is a pharmaceutical composition.
  • a caTCR plus SSE immune cell composition comprising a heterogeneous cell population comprising a plurality of caTCR plus SSE immune cell populations comprising caTCR plus SSE immune cells of different cell types, expressing different caTCRs, and/or expressing different SSEs.
  • the caTCR plus SSE immune cells are T cells.
  • each population of caTCR plus SSE immune cells is, independently from one another, of a cell type selected from the group consisting of cytotoxic T cells, helper T cells, natural killer T cells, and suppressor T cells.
  • all of the caTCR plus SSE immune cells in the composition are of the same cell type (e.g., all of the caTCR plus SSE immune cells are cytotoxic T cells).
  • at least one population of caTCR plus SSE immune cells is of a different cell type than the others (e.g., one population of caTCR plus SSE immune cells consists of cytotoxic T cells and the other populations of caTCR plus SSE immune cells consist of natural killer T cells).
  • each population of caTCR plus SSE immune cells expresses the same caTCR.
  • at least one population of caTCR plus SSE immune cells expresses a different caTCR than the others.
  • each population of caTCR plus SSE immune cells expresses a different caTCR than the others. In some embodiments, each population of caTCR plus SSE immune cells expresses a caTCR that specifically binds to the same target antigen. In some embodiments, at least one population of caTCR plus SSE immune cells expresses a caTCR that specifically binds to a different target antigen than the others (e.g., one population of caTCR plus SSE immune cells specifically binds to a pMHC complex and the other populations of caTCR plus SSE immune cells specifically bind to a cell surface receptor).
  • each population of caTCR plus SSE immune cells expresses a caTCR that specifically binds to a different target antigen
  • each population of caTCR plus SSE immune cells expresses a caTCR that specifically binds to a target antigen associated with the same disease or disorder (e.g., each of the target antigens are associated with a cancer, such as breast cancer).
  • each population of caTCR plus SSE immune cells expresses the same SSE.
  • at least one population of caTCR plus SSE immune cells expresses a different SSE than the others.
  • each population of caTCR plus SSE immune cells expresses a different SSE than the others.
  • each population of caTCR plus SSE immune cells expresses an SSE that specifically binds to the same target. In some embodiments, at least one population of caTCR plus SSE immune cells expresses an SSE that specifically binds to a different target than the others (e.g., one population of caTCR plus SSE immune cells specifically binds to a pMHC complex and the other populations of caTCR plus SSE immune cells specifically bind to a cell surface receptor).
  • each population of caTCR plus SSE immune cells expresses an SSE that specifically binds to a different target
  • each population of caTCR plus SSE immune cells expresses an SSE that specifically binds to a target associated with the same disease or disorder (e.g., each of the targets are associated with a cancer, such as breast cancer).
  • the caTCR plus SSE immune cell composition is a pharmaceutical composition.
  • a caTCR plus SSE immune cell composition comprising a plurality of caTCR plus SSE immune cell populations according to any of the embodiments described herein, wherein all of the caTCR plus SSE immune cells in the composition are of the same cell type (e.g., all of the caTCR plus SSE immune cells are cytotoxic T cells), and wherein each population of caTCR plus SSE immune cells expresses a different caTCR than the others.
  • the caTCR plus SSE immune cells are T cells.
  • the caTCR plus SSE immune cells are selected from the group consisting of cytotoxic T cells, helper T cells, natural killer T cells, and suppressor T cells.
  • each population of caTCR plus SSE immune cells expresses a caTCR that specifically binds to the same target antigen.
  • at least one population of caTCR plus SSE immune cells expresses a caTCR that specifically binds to a different target antigen than the others (e.g., one population of caTCR plus SSE immune cells specifically binds to a pMHC complex and the other populations of caTCR plus SSE immune cells specifically bind to a cell surface receptor).
  • each population of caTCR plus SSE immune cells expresses a caTCR that specifically binds to a different target antigen
  • each population of caTCR plus SSE immune cells expresses a caTCR that specifically binds to a target antigen associated with the same disease or disorder (e.g., each of the target antigens are associated with a cancer, such as breast cancer).
  • the caTCR plus SSE immune cell composition is a pharmaceutical composition.
  • a caTCR plus SSE immune cell composition comprising a plurality of caTCR plus SSE immune cell populations according to any of the embodiments described herein, wherein all of the caTCR plus SSE immune cells in the composition are of the same cell type (e.g., all of the caTCR plus SSE immune cells are cytotoxic T cells), and wherein each population of caTCR plus SSE immune cells expresses a different SSE than the others.
  • the caTCR plus SSE immune cells are T cells.
  • the caTCR plus SSE immune cells are selected from the group consisting of cytotoxic T cells, helper T cells, natural killer T cells, and suppressor T cells.
  • each population of caTCR plus SSE immune cells expresses an SSE that specifically binds to the same target. In some embodiments, at least one population of caTCR plus SSE immune cells expresses an SSE that specifically binds to a different target than the others (e.g., one population of caTCR plus SSE immune cells specifically binds to a pMHC complex and the other populations of caTCR plus SSE immune cells specifically bind to a cell surface receptor).
  • each population of caTCR plus SSE immune cells expresses an SSE that specifically binds to a different target
  • each population of caTCR plus SSE immune cells expresses an SSE that specifically binds to a target associated with the same disease or disorder (e.g., each of the targets are associated with a cancer, such as breast cancer).
  • the caTCR plus SSE immune cell composition is a pharmaceutical composition.
  • a composition comprising a plurality of caTCR plus SSE immune cell populations according to any of the embodiments described herein, wherein at least one population of caTCR plus SSE immune cells is of a different cell type than the others. In some embodiments, all of the populations of caTCR plus SSE immune cells are of different cell types. In some embodiments, the caTCR plus SSE immune cells are T cells. In some embodiments, each population of caTCR plus SSE immune cells is, independently from one another, of a cell type selected from the group consisting of cytotoxic T cells, helper T cells, natural killer T cells, and suppressor T cells. In some embodiments, each population of caTCR plus SSE immune cells expresses the same caTCR.
  • At least one population of caTCR plus SSE immune cells expresses a different caTCR than the others. In some embodiments, each population of caTCR plus SSE immune cells expresses a different caTCR than the others. In some embodiments, each population of caTCR plus SSE immune cells expresses a caTCR that specifically binds to the same target antigen. In some embodiments, at least one population of caTCR plus SSE immune cells expresses a caTCR that specifically binds to a different target antigen than the others (e.g., one population of caTCR plus SSE immune cells specifically binds to a pMHC complex and the other populations of caTCR plus SSE immune cells specifically bind to a cell surface receptor).
  • each population of caTCR plus SSE immune cells expresses a caTCR that specifically binds to a different target antigen
  • each population of caTCR plus SSE immune cells expresses a caTCR that specifically binds to a target antigen associated with the same disease or disorder (e.g., each of the target antigens are associated with a cancer, such as breast cancer).
  • each population of caTCR plus SSE immune cells expresses the same SSE.
  • at least one population of caTCR plus SSE immune cells expresses a different SSE than the others.
  • each population of caTCR plus SSE immune cells expresses a different SSE than the others.
  • each population of caTCR plus SSE immune cells expresses an SSE that specifically binds to the same target. In some embodiments, at least one population of caTCR plus SSE immune cells expresses an SSE that specifically binds to a different target than the others (e.g., one population of caTCR plus SSE immune cells specifically binds to a pMHC complex and the other populations of caTCR plus SSE immune cells specifically bind to a cell surface receptor).
  • each population of caTCR plus SSE immune cells expresses an SSE that specifically binds to a different target
  • each population of caTCR plus SSE immune cells expresses an SSE that specifically binds to a target associated with the same disease or disorder (e.g., each of the targets are associated with a cancer, such as breast cancer).
  • the caTCR plus SSE immune cell composition is a pharmaceutical composition.
  • cryopreserved/cryopreserving can be used interchangeably. Freezing includes freeze drying.
  • cryoprotective agents include dimethyl sulfoxide (DMSO) (Lovelock and Bishop, 1959, Nature 183:1394-1395; Ashwood-Smith, 1961, Nature 190:1204-1205), glycerol, polyvinylpyrrolidine (Rinfret, 1960, Ann. N.Y. Acad. Sci.
  • DMSO can be used. Addition of plasma (e.g., to a concentration of 20-25%) can augment the protective effects of DMSO. After addition of DMSO, cells can be kept at 0° C. until freezing, because DMSO concentrations of 1% can be toxic at temperatures above 4° C.
  • DMSO-treated cells can be pre-cooled on ice and transferred to a tray containing chilled methanol which is placed, in turn, in a mechanical refrigerator (e.g., Harris or Revco) at ⁇ 80° C.
  • a mechanical refrigerator e.g., Harris or Revco
  • Thermocouple measurements of the methanol bath and the samples indicate a cooling rate of 1° to 3° C./minute can be preferred.
  • the specimens can have reached a temperature of ⁇ 80° C. and can be placed directly into liquid nitrogen ( ⁇ 196° C.).
  • samples can be cryogenically stored in liquid nitrogen ( ⁇ 196° C.) or vapor ( ⁇ 1° C.). Such storage is facilitated by the availability of highly efficient liquid nitrogen refrigerators.
  • frozen cells can be thawed for use in accordance with methods known to those of ordinary skill in the art.
  • Frozen cells are preferably thawed quickly and chilled immediately upon thawing.
  • the vial containing the frozen cells can be immersed up to its neck in a warm water bath; gentle rotation will ensure mixing of the cell suspension as it thaws and increase heat transfer from the warm water to the internal ice mass. As soon as the ice has completely melted, the vial can be immediately placed on ice.
  • methods can be used to prevent cellular clumping during thawing.
  • Exemplary methods include: the addition before and/or after freezing of DNase (Spitzer et al., 1980, Cancer 45:3075-3085), low molecular weight dextran and citrate, hydroxyethyl starch (Stiff et al., 1983, Cryobiology 20:17-24), etc.
  • DNase Spitzer et al., 1980, Cancer 45:3075-3085
  • low molecular weight dextran and citrate low molecular weight dextran and citrate
  • hydroxyethyl starch Stiff et al., 1983, Cryobiology 20:17-24
  • DMSO has no serious toxicity.
  • Exemplary carriers and modes of administration of cells are described at pages 14-15 of U.S. Patent Publication No. 2010/0183564. Additional pharmaceutical carriers are described in Remington: The Science and Practice of Pharmacy, 21 st Edition, David B. Troy, ed., Lippicott Williams & Wilkins (2005).
  • cells can be harvested from a culture medium, and washed and concentrated into a carrier in a therapeutically-effective amount.
  • exemplary carriers include saline, buffered saline, physiological saline, water, Hanks' solution, Ringer's solution, Nonnosol-R (Abbott Labs), Plasma-Lyte A® (Baxter Laboratories, Inc., Morton Grove, Ill.), glycerol, ethanol, and combinations thereof.
  • carriers can be supplemented with human serum albumin (HSA) or other human serum components or fetal bovine serum.
  • HAS human serum albumin
  • a carrier for infusion includes buffered saline with 5% HAS or dextrose.
  • Additional isotonic agents include polyhydric sugar alcohols including trihydric or higher sugar alcohols, such as glycerin, erythritol, arabitol, xylitol, sorbitol, or mannitol.
  • Carriers can include buffering agents, such as citrate buffers, succinate buffers, tartrate buffers, fumarate buffers, gluconate buffers, oxalate buffers, lactate buffers, acetate buffers, phosphate buffers, histidine buffers, and/or trimethylamine salts.
  • buffering agents such as citrate buffers, succinate buffers, tartrate buffers, fumarate buffers, gluconate buffers, oxalate buffers, lactate buffers, acetate buffers, phosphate buffers, histidine buffers, and/or trimethylamine salts.
  • Stabilizers refer to a broad category of excipients which can range in function from a bulking agent to an additive which helps to prevent cell adherence to container walls.
  • Typical stabilizers can include polyhydric sugar alcohols; amino acids, such as arginine, lysine, glycine, glutamine, asparagine, histidine, alanine, ornithine, L-leucine, 2-phenylalanine, glutamic acid, and threonine; organic sugars or sugar alcohols, such as lactose, trehalose, stachyose, mannitol, sorbitol, xylitol, ribitol, myoinisitol, galactitol, glycerol, and cyclitols, such as inositol; PEG; amino acid polymers; sulfur-containing reducing agents, such as urea, glutathione, thioctic acid, sodium thioglycolate,
  • compositions can include a local anesthetic such as lidocaine to ease pain at a site of injection.
  • a local anesthetic such as lidocaine to ease pain at a site of injection.
  • Exemplary preservatives include phenol, benzyl alcohol, meta-cresol, methyl paraben, propyl paraben, octadecyldimethylbenzyl ammonium chloride, benzalkonium halides, hexamethonium chloride, alkyl parabens such as methyl or propyl paraben, catechol, resorcinol, cyclohexanol, and 3-pentanol.
  • Therapeutically effective amounts of cells within compositions can be greater than 10 2 cells, greater than 10 3 cells, greater than 10 4 cells, greater than 10 5 cells, greater than 10 6 cells, greater than 10 7 cells, greater than 10 8 cells, greater than 10 9 cells, greater than 10 10 cells, or greater than 10 11 cells.
  • cells are generally in a volume of a liter or less, 500 ml or less, 250 ml or less or 100 ml or less.
  • density of administered cells is typically greater than 10 4 cells/ml, 10 7 cells/ml or 10 8 cells/ml.
  • nucleic acid compositions such as pharmaceutical compositions, also referred to herein as formulations
  • the nucleic acid composition is a pharmaceutical composition.
  • the nucleic acid composition further comprises any of an isotonizing agent, an excipient, a diluent, a thickener, a stabilizer, a buffer, and/or a preservative; and/or an aqueous vehicle, such as purified water, an aqueous sugar solution, a buffer solution, physiological saline, an aqueous polymer solution, or RNase free water.
  • the amounts of such additives and aqueous vehicles to be added can be suitably selected according to the form of use of the nucleic acid composition.
  • compositions and formulations disclosed herein can be prepared for administration by, for example, injection, infusion, perfusion, or lavage.
  • the compositions and formulations can further be formulated for bone marrow, intravenous, intradermal, intraarterial, intranodal, intralymphatic, intraperitoneal, intralesional, intraprostatic, intravaginal, intrarectal, topical, intrathecal, intratumoral, intramuscular, intravesicular, and/or subcutaneous injection.
  • the formulations to be used for in vivo administration must be sterile. This is readily accomplished by, e.g., filtration through sterile filtration membranes.
  • the caTCRs and SSEs of the invention can be administered to individuals (e.g., mammals such as humans) to treat a disease and/or disorder associated with target antigen (TA) expression (also referred to herein as a “target-antigen positive” or “TA-positive” disease or disorder), including, for example, cancer and infectious disease (such as viral infection).
  • TA target antigen
  • the present application thus in some embodiments provides a method for treating a target antigen-positive disease (such as cancer or viral infection) in an individual comprising administering to the individual an effective amount of a composition (such as a pharmaceutical composition) comprising a caTCR according to any one of the caTCRs described herein and an SSE according to any of the SSEs described herein.
  • the composition further comprises a cell (such as an immune cell) expressing the caTCR and expressing or capable of expressing the SSE (such as a cell presenting on its surface the caTCR and capable of secreting the SSE).
  • the cancer is selected, for example, from the group consisting of adrenocortical carcinoma, bladder cancer, breast cancer, cervical cancer, cholangiocarcinoma, colorectal cancers, esophageal cancer, glioblastoma, glioma, hepatocellular carcinoma, head and neck cancer, kidney cancer, lung cancer, melanoma, mesothelioma, multiple myeloma, pancreatic cancer, pheochromocytoma, plasmacytoma, neuroblastoma, ovarian cancer, prostate cancer, sarcoma, stomach cancer, uterine cancer and thyroid cancer.
  • the viral infection is caused by a virus selected, for example, from the group consisting of Cytomegalovirus (CMV), Epstein-Barr Virus (EBV), Hepatitis B Virus (HBV), Kaposi's Sarcoma associated herpesvirus (KSHV), Human papillomavirus (HPV), Molluscum contagiosum virus (MCV), Human T cell leukemia virus 1 (HTLV-1), HIV (Human immunodeficiency virus), and Hepatitis C Virus (HCV).
  • CMV Cytomegalovirus
  • EBV Epstein-Barr Virus
  • HBV Hepatitis B Virus
  • KSHV Kaposi's Sarcoma associated herpesvirus
  • HPV Human papillomavirus
  • MMV Molluscum contagiosum virus
  • HTLV-1 Human T cell leukemia virus 1
  • HIV Human immunodeficiency virus
  • HCV Hepatitis C Virus
  • a method of treating a target antigen-associated disease comprising administering to the individual an effective amount of a composition comprising immune cells (such as T cells) a) presenting on their surface a caTCR comprising i) a first TCRD comprising a first TCR-TM derived from one of the transmembrane domains of a naturally occurring TCR and a second TCRD comprising a second TCR-TM derived from the other transmembrane domain of the naturally occurring TCR, wherein the first and second TCRDs form a TCRM that is capable of recruiting at least one TCR-associated signaling molecule, and ii) an antigen-binding module that specifically binds to the target antigen, wherein the antigen-binding module is linked to the first and/or second TCRDs; and b) expressing or capable of expressing a secretory secondary effector (SSE) capable of enhancing
  • SSE secretory secondary effector
  • the TCR-TMs is non-naturally occurring.
  • the naturally occurring TCR is an ⁇ TCR and the first and second TCR-TMs are derived from TCR ⁇ and ⁇ subunit transmembrane domains.
  • the naturally occurring TCR is a ⁇ TCR and the first and second TCR-TMs are derived from TCR ⁇ and ⁇ subunit transmembrane domains.
  • the first TCRD further comprises a first TCR connecting peptide or a fragment thereof and/or the second TCRD further comprises a second TCR connecting peptide or a fragment thereof.
  • the first connecting peptide comprises all or a portion of the connecting peptide of the TCR subunit from which the first TCR-TM is derived, or a variant thereof
  • the second connecting peptide comprises all or a portion of the connecting peptide of the TCR subunit from which the second TCR-TM is derived, or a variant thereof.
  • the first and second connecting peptides are linked by a disulfide bond.
  • the first TCRD further comprises a first TCR intracellular domain and/or the second TCRD further comprises a second TCR intracellular domain.
  • the first TCR intracellular domain comprises a sequence from the intracellular domain of the TCR subunit from which the first TCR-TM is derived and/or the second TCR intracellular domain comprises a sequence from the intracellular domain of the TCR subunit from which the second TCR-TM is derived.
  • the first TCRD is a fragment of the TCR subunit from which the first TCR-TM is derived and/or the second TCRD is a fragment of the TCR subunit from which the second TCR-TM is derived.
  • the caTCR further comprises at least one accessory intracellular domain comprising a T cell costimulatory signaling sequence (such as from CD27, CD28, 4-1BB (CD137), OX40, CD30, or CD40).
  • the caTCR further comprises a stabilization module comprising a first stabilization domain and a second stabilization domain, wherein the first and second stabilization domains have a binding affinity that stabilizes the caTCR.
  • the first and second stabilization domains are linked by a disulfide bond.
  • the first and second stabilization domains comprise an antibody moiety, such as C H 1 and C L antibody domains, or variants thereof.
  • the TCRM is capable of recruiting at least one TCR-associated signaling molecule selected from the group consisting of CD3 ⁇ , CD3 ⁇ , and ⁇ . In some embodiments, the TCRM allows for enhanced recruitment of the at least one TCR-associated signaling molecule as compared to a TCRM comprising the naturally occurring T cell receptor transmembrane domains. In some embodiments, the TCRM promotes caTCR-CD3 complex formation. In some embodiments, there is a spacer module between any two caTCR modules or domains. In some embodiments, the antigen-binding module is an antibody moiety.
  • the antibody moiety is a Fab, a Fab′, a (Fab′)2, an Fv, or a single chain Fv (scFv).
  • the antigen-binding module is multispecific (such as bispecific).
  • the target antigen is a cell surface antigen.
  • the cell surface antigen is selected from the group consisting of a protein, a carbohydrate, and a lipid.
  • the cell surface antigen is a disease-associated antigen, such as a tumor-associated or virally-encoded antigen.
  • the cell surface antigen is CD19, ROR1, ROR2, BCMA, GPRC5D, or FCRL5.
  • the target antigen is a surface-presented peptide/MEC complex.
  • the peptide/MHC complex comprises a peptide derived from a disease-associated antigen (such as a tumor-associated or virally-encoded antigen) and an MEC protein.
  • the peptide/MEC complex comprises a peptide and an MEC protein, wherein the peptide is derived from a protein selected from the group consisting of WT-1, AFP, HPV16-E7, NY-ESO-1, PRAME, EBV-LMP2A, HIV-1, KRAS, Histone H3.3, and PSA, including variants or mutants thereof.
  • the MEC protein is an MEC class I protein. In some embodiments, the MEC class I protein is HLA-A. In some embodiments, the HLA-A is HLA-A02. In some embodiments, the HLA-A02 is HLA-A*02:01.
  • the SSE is an antibody moiety that targets an immune cell surface antigen and a disease-associated antigen. In some embodiments, the immune cell surface antigen is CD3 or CD16a.
  • the disease-associated antigen is GPC3, CD47, MUC16, CD19, CD20, CD22, EpCAM, EGFR, HER2, CEA, PSMA, AFP, PSA, BCMA, FCRL5, NY-ESO, HPV16, or FoxP3, including variants or mutants thereof.
  • the SSE is a multispecific antibody moiety selected from the group consisting of a tandem scFv, a diabody (Db), a single chain diabody (scDb), a dual-affinity retargeting (DART) antibody, and a dual variable domain (DVD) antibody.
  • the SSE is a tandem scFv comprising a first scFv targeting the immune cell surface antigen and a second scFv targeting the disease-associated antigen.
  • the SSE is an antibody moiety targeting an immune checkpoint molecule.
  • the SSE is an antagonist of an inhibitory immune checkpoint molecule.
  • the inhibitory immune checkpoint molecule is selected from the group consisting of PD-1, PD-L1, CTLA-4, HVEM, BTLA, KIR, LAG-3, TIM-3, and A2aR.
  • the SSE is an agonist of a stimulatory immune checkpoint molecule.
  • the stimulatory immune checkpoint molecule is selected from the group consisting of CD28, ICOS, 4-1BB, OX40, CD27, and CD40.
  • the SSE is a full-length antibody, a Fab, a Fab′, a (Fab′)2, an Fv, or a single chain Fv (scFv).
  • the SSE is an scFv.
  • the SSE is a soluble molecule that specifically binds a ligand of an immunosuppressive receptor.
  • the SSE comprises a ligand-binding domain derived from the extracellular domain of the immunosuppressive receptor.
  • the ligand-binding domain is a portion of the extracellular domain of the receptor.
  • the immunosuppressive receptor is selected from the group consisting of FasR, TNFR1, TNFR2, SIRP ⁇ , PD-1, CD28, CTLA-4, ICOS, BTLA, KIR, LAG-3, 4-1BB, OX40, CD27, CD40, and TIM-3.
  • the SSE is a soluble molecule that specifically binds to and antagonizes an immunosuppressive receptor.
  • the SSE comprises a receptor-binding domain derived from the extracellular domain of a ligand for the immunosuppressive receptor.
  • the receptor-binding domain is a portion of the extracellular domain of the ligand.
  • the ligand is selected from the group consisting of FasL, PD-L1, PD-L2, CD47, CD80, CD86, ICOSL, HVEM, 4-1BBL, OX40L, CD70, CD40L, and GALS.
  • the SSE is a stimulatory cytokine.
  • the stimulatory cytokine is an IL-12 family member.
  • the IL-12 family member is IL-12, IL-23, IL-27, or IL-35.
  • the stimulatory cytokine is IL-2, IL-15, IL-18, or IL-21. In some embodiments, the stimulatory cytokine is capable of providing autocrine activation of receptors for the cytokine on the caTCR plus SSE immune cell. In some embodiments, the expression of the SSE in the caTCR plus SSE immune cell is inducible. In some embodiments, the immune cell is a ⁇ T cell. In some embodiments, the immune cell is a ⁇ T cell modified to block or decrease the expression of the TCR ⁇ and/or ⁇ chains. In some embodiments, the immune cell is an ⁇ T cell.
  • the immune cell is an ⁇ T cell modified to block or decrease the expression of the TCR ⁇ and/or ⁇ chains.
  • the immune cell is selected from the group consisting of a cytotoxic T cell, a helper T cell, a natural killer T cell, and a suppressor T cell.
  • a method of treating a target antigen-associated disease comprising administering to the individual an effective amount of a composition comprising immune cells (such as T cells) a) presenting on their surface a caTCR that specifically binds the target antigen comprising i) a first TCRD comprising a first TCR-TM derived from one of the transmembrane domains of a naturally occurring ⁇ TCR and a second TCRD comprising a second TCR-TM derived from the other transmembrane domain of the naturally occurring ⁇ TCR, wherein the first and second TCRDs form a TCRM that is capable of recruiting at least one TCR-associated signaling molecule, and ii) an antigen-binding module that specifically binds to the target antigen, wherein the antigen-binding module is linked to the first and/or second TCRDs; and b) expressing or capable of expressing a secretory secondary
  • the SSE is an antibody moiety (such as a bispecific antibody, e.g., a tandem scFv) that targets an immune cell surface antigen and a disease-associated antigen.
  • the SSE is an antibody moiety (such as an scFv) that antagonizes an inhibitory immune checkpoint molecule or agonizes a stimulatory immune checkpoint molecule.
  • the SSE is a soluble molecule that antagonizes the interaction between an immunosuppressive receptor and its ligand, such as a soluble molecule comprising a binding domain derived from a) the extracellular domain of the immunosuppressive receptor, or b) the ligand of the immunosuppressive receptor.
  • the SSE is a stimulatory cytokine.
  • the immune cell is a ⁇ T cell.
  • the immune cell is an ⁇ T cell modified to block or decrease the expression of the TCR ⁇ and/or ⁇ chains.
  • the immune cell is selected from the group consisting of a cytotoxic T cell, a helper T cell, a natural killer T cell, and a suppressor T cell.
  • a method of treating a target antigen-associated disease comprising administering to the individual an effective amount of a composition comprising immune cells (such as T cells) a) presenting on their surface a caTCR that specifically binds the target antigen comprising i) a first TCRD comprising a first TCR-TM derived from one of the transmembrane domains of a naturally occurring ⁇ TCR and a second TCRD comprising a second TCR-TM derived from the other transmembrane domain of the naturally occurring ⁇ TCR, wherein the first and second TCRDs form a TCRM that is capable of recruiting at least one TCR-associated signaling molecule, and ii) an antigen-binding module that specifically binds to the target antigen, wherein the antigen-binding module is linked to the first and/or second TCRDs; and b) expressing or capable of expressing a secretory secondary
  • the SSE is an antibody moiety (such as a bispecific antibody, e.g., a tandem scFv) that targets an immune cell surface antigen and a disease-associated antigen.
  • the SSE is an antibody moiety (such as an scFv) that antagonizes an inhibitory immune checkpoint molecule or agonizes a stimulatory immune checkpoint molecule.
  • the SSE is a soluble molecule that antagonizes the interaction between an immunosuppressive receptor and its ligand, such as a soluble molecule comprising a binding domain derived from a) the extracellular domain of the immunosuppressive receptor, or b) the ligand of the immunosuppressive receptor.
  • the SSE is a stimulatory cytokine.
  • the immune cell is a ⁇ T cell modified to block or decrease the expression of the TCR ⁇ and/or ⁇ chains.
  • the immune cell is an ⁇ T cell.
  • the immune cell is selected from the group consisting of a cytotoxic T cell, a helper T cell, a natural killer T cell, and a suppressor T cell.
  • a method of treating a target antigen-associated disease comprising administering to the individual an effective amount of a composition comprising immune cells (such as T cells) a) presenting on their surface a caTCR that specifically binds the target antigen comprising i) a first TCRD comprising a first TCR-TM derived from the amino acid sequence of SEQ ID NO: 5 and a second TCRD comprising a second TCR-TM derived from the amino acid sequence of SEQ ID NO: 6, wherein the first and second TCRDs form a TCRM that is capable of recruiting at least one TCR-associated signaling molecule; and ii) an antigen-binding module that specifically binds to the target antigen, wherein the antigen-binding module is linked to the first and/or second TCRDs; and b) expressing or capable of expressing a secretory secondary effector (SSE) capable of enhancing an immune response
  • SSE secretory secondary effector
  • At least one of the TCR-TMs comprises one or more (such as 2, 3, 4, 5, or more) amino acid substitutions compared to the amino acid sequence from which it is derived.
  • each of the TCR-TMs comprises, independently from one another, one or more (such as 2, 3, 4, 5, or more) amino acid substitutions compared to the amino acid sequence from which it is derived.
  • the first TCR-TM and/or the second TCR-TM each comprise, independently from one another, no more than 5 amino acid substitutions compared to the amino acid sequences from which they are derived.
  • at least one of the TCR-TMs comprises a single amino acid substitution compared to the amino acid sequence from which it is derived.
  • each of the TCR-TMs comprises a single amino acid substitution compared to the amino acid sequence from which it is derived.
  • at least one of the substituted amino acids in the first TCR-TM is positioned such that in the caTCR it can interact with at least one of the substituted amino acids in the second TCR-TM.
  • the SSE is an antibody moiety (such as a bispecific antibody, e.g., a tandem scFv) that targets an immune cell surface antigen and a disease-associated antigen.
  • the SSE is an antibody moiety (such as an scFv) that antagonizes an inhibitory immune checkpoint molecule or agonizes a stimulatory immune checkpoint molecule.
  • the SSE is a soluble molecule that antagonizes the interaction between an immunosuppressive receptor and its ligand, such as a soluble molecule comprising a binding domain derived from a) the extracellular domain of the immunosuppressive receptor, or b) the ligand of the immunosuppressive receptor.
  • the SSE is a stimulatory cytokine.
  • the immune cell is a ⁇ T cell.
  • the immune cell is an ⁇ T cell modified to block or decrease the expression of the TCR ⁇ and/or ⁇ chains.
  • the immune cell is selected from the group consisting of a cytotoxic T cell, a helper T cell, a natural killer T cell, and a suppressor T cell.
  • a method of treating a target antigen-associated disease comprising administering to the individual an effective amount of a composition comprising immune cells (such as T cells) a) presenting on their surface a caTCR that specifically binds the target antigen comprising i) a first TCRD comprising a first TCR-TM derived from the amino acid sequence of SEQ ID NO: 7 and a second TCRD comprising a second TCR-TM derived from the amino acid sequence of SEQ ID NO: 8, wherein the first and second TCRDs form a TCRM that is capable of recruiting at least one TCR-associated signaling molecule; and ii) an antigen-binding module that specifically binds to the target antigen, wherein the antigen-binding module is linked to the first and/or second TCRDs; and b) expressing or capable of expressing a secretory secondary effector (SSE) capable of enhancing an immune response
  • SSE secretory secondary effector
  • At least one of the TCR-TMs comprises one or more (such as 2, 3, 4, 5, or more) amino acid substitutions compared to the amino acid sequence from which it is derived.
  • each of the TCR-TMs comprises, independently from one another, one or more (such as 2, 3, 4, 5, or more) amino acid substitutions compared to the amino acid sequence from which it is derived.
  • the first TCR-TM and/or the second TCR-TM each comprise, independently from one another, no more than 5 amino acid substitutions compared to the amino acid sequences from which they are derived.
  • at least one of the TCR-TMs comprises a single amino acid substitution compared to the amino acid sequence from which it is derived.
  • each of the TCR-TMs comprises a single amino acid substitution compared to the amino acid sequence from which it is derived.
  • at least one of the substituted amino acids in the first TCR-TM is positioned such that in the caTCR it can interact with at least one of the substituted amino acids in the second TCR-TM.
  • the first TCR-TM and second TCR-TM are selected according to any of the caTCRs listed in Table 2.
  • the SSE is an antibody moiety (such as a bispecific antibody, e.g., a tandem scFv) that targets an immune cell surface antigen and a disease-associated antigen.
  • the SSE is an antibody moiety (such as an scFv) that antagonizes an inhibitory immune checkpoint molecule or agonizes a stimulatory immune checkpoint molecule.
  • the SSE is a soluble molecule that antagonizes the interaction between an immunosuppressive receptor and its ligand, such as a soluble molecule comprising a binding domain derived from a) the extracellular domain of the immunosuppressive receptor, or b) the ligand of the immunosuppressive receptor.
  • the SSE is a stimulatory cytokine.
  • the immune cell is a ⁇ T cell modified to block or decrease the expression of the TCR ⁇ and/or ⁇ chains.
  • the immune cell is an ⁇ T cell.
  • the immune cell is selected from the group consisting of a cytotoxic T cell, a helper T cell, a natural killer T cell, and a suppressor T cell.
  • a method of treating an AFP-associated disease comprising administering to the individual an effective amount of a composition comprising immune cells (such as T cells) a) presenting on their surface a caTCR that specifically binds an AFP peptide/HLA-02*01 complex comprising i) a first caTCR polypeptide chain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 54 and a second caTCR polypeptide chain comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 55; and b) a secretory secondary effector (SSE) that is a bispecific tandem scFv targeting GPC3 and CD3 comprising the amino acid sequence of SEQ ID NO: 71.
  • a composition comprising immune cells (such as T cells)
  • a) presenting on their surface a caTCR that specifically binds an AFP peptide/HLA-02*01 complex comprising i) a first caTCR polypeptid
  • the immune cell is a ⁇ T cell modified to block or decrease the expression of the TCR ⁇ and/or ⁇ chains. In some embodiments, the immune cell is an ⁇ T cell. In some embodiments, the immune cell is selected from the group consisting of a cytotoxic T cell, a helper T cell, a natural killer T cell, and a suppressor T cell.
  • compositions comprising a plurality of immune cells expressing different caTCRs and/or expressing or capable of expressing different SSEs.
  • the composition is a heterogeneous caTCR plus SSE immune cell composition as described herein.
  • the individual is a mammal (e.g., human, non-human primate, rat, mouse, cow, horse, pig, sheep, goat, dog, cat, etc.). In some embodiments, the individual is a human. In some embodiments, the individual is a clinical patient, a clinical trial volunteer, an experimental animal, etc. In some embodiments, the individual is younger than about 60 years old (including for example younger than about any of 50, 40, 30, 25, 20, 15, or 10 years old). In some embodiments, the individual is older than about 60 years old (including for example older than about any of 70, 80, 90, or 100 years old). In some embodiments, the individual is diagnosed with or environmentally or genetically prone to one or more of the diseases or disorders described herein (such as cancer or viral infection). In some embodiments, the individual has one or more risk factors associated with one or more diseases or disorders described herein.
  • the individual has one or more risk factors associated with one or more diseases or disorders described herein.
  • the caTCR plus SSE immune cell compositions of the invention are administered in combination with a second, third, or fourth agent (including, e.g., an antineoplastic agent, a growth inhibitory agent, a cytotoxic agent, or a chemotherapeutic agent) to treat diseases or disorders involving target antigen expression.
  • a second, third, or fourth agent including, e.g., an antineoplastic agent, a growth inhibitory agent, a cytotoxic agent, or a chemotherapeutic agent
  • the caTCR plus SSE immune cell composition is administered in combination with a cytokine (such as IL-2).
  • a cytokine such as IL-2
  • the caTCR plus SSE immune cell composition is administered in combination with an agent that increases the expression of MHC proteins and/or enhances the surface presentation of peptides by MHC proteins.
  • the agent includes, for example, IFN receptor agonists, Hsp90 inhibitors, enhancers of p53 expression, and chemotherapeutic agents.
  • the agent is an IFN receptor agonist including, for example, IFN ⁇ , IFN ⁇ , and IFN ⁇ .
  • the agent is an Hsp90 inhibitor including, for example, tanespimycin (17-AAG), alvespimycin (17-DMAG), retaspimycin (IPI-504), IPI-493, CNF2024/BIIB021, WC-3100, Debio 0932 (CUDC-305), PU-H71, Ganetespib (STA-9090), NVP-AUY922 (VER-52269), HSP990, KW-2478, AT13387, SNX-5422, DS-2248, and XL888.
  • the agent is an enhancer of p53 expression including, for example, 5-fluorouracil and nutlin-3.
  • the agent is a chemotherapeutic agent including, for example, topotecan, etoposide, cisplatin, paclitaxel, and vinblastine.
  • a method of treating a target antigen-positive disease in an individual in need thereof comprising administering to the individual a caTCR plus SSE immune cell composition according to any of the embodiments described herein in combination with a cytokine (such as IL-2).
  • a cytokine such as IL-2
  • the caTCR plus SSE immune cell composition and the cytokine are administered simultaneously.
  • the caTCR plus SSE immune cell composition and the cytokine are administered sequentially.
  • a method of treating a target antigen-positive disease in an individual in need thereof, wherein the cells expressing the target antigen do not normally present, or present at relatively low levels, a complex comprising the target antigen and an MHC class I protein on their surface comprising administering to the individual a caTCR plus SSE immune cell compositions according to any of the embodiments described herein in combination with an agent that increases the expression of MHC class I proteins and/or enhances the surface presentation of target antigens by MHC class I proteins.
  • the agent includes, for example, IFN receptor agonists, Hsp90 inhibitors, enhancers of p53 expression, and chemotherapeutic agents.
  • the agent is an IFN receptor agonist including, for example, IFN ⁇ , IFN ⁇ , and IFN ⁇ .
  • the agent is an Hsp90 inhibitor including, for example, tanespimycin (17-AAG), alvespimycin (17-DMAG), retaspimycin (IPI-504), IPI-493, CNF2024/BIIB021, WC-3100, Debio 0932 (CUDC-305), PU-H71, Ganetespib (STA-9090), NVP-AUY922 (VER-52269), HSP990, KW-2478, AT13387, SNX-5422, DS-2248, and XL888.
  • the agent is an enhancer of p53 expression including, for example, 5-fluorouracil and nutlin-3.
  • the agent is a chemotherapeutic agent including, for example, topotecan, etoposide, cisplatin, paclitaxel, and vinblastine.
  • the caTCR plus SSE immune cell composition and the agent are administered simultaneously. In some embodiments, the caTCR plus SSE immune cell composition and the agent are administered sequentially.
  • a method of treating a target antigen-associated disease comprising administering to the individual an effective amount of a composition comprising nucleic acid encoding a caTCR and an SSE according to any of the embodiments described herein.
  • a target antigen-associated disease such as cancer or viral infection
  • Methods for gene delivery are known in the art. See, e.g., U.S. Pat. Nos. 5,399,346, 5,580,859, 5,589,466, incorporated by reference herein in their entireties.
  • Cancer treatments can be evaluated, for example, by tumor regression, tumor weight or size shrinkage, time to progression, duration of survival, progression free survival, overall response rate, duration of response, quality of life, protein expression and/or activity.
  • Approaches to determining efficacy of the therapy can be employed, including for example, measurement of response through radiological imaging.
  • the efficacy of treatment is measured as the percentage tumor growth inhibition (% TGI), calculated using the equation 100 ⁇ (T/C ⁇ 100), where T is the mean relative tumor volume of the treated tumor, and C is the mean relative tumor volume of a non-treated tumor.
  • % TGI is about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, or more than 95%.
  • Viral infection treatments can be evaluated, for example, by viral load, duration of survival, quality of life, protein expression and/or activity.
  • the caTCR plus SSE immune cells in some embodiments can be useful for treating cancers associated with a target antigen.
  • Cancers that may be treated using any of the methods described herein include tumors that are not vascularized, or not yet substantially vascularized, as well as vascularized tumors.
  • the cancers may comprise non-solid tumors (such as hematological tumors, for example, leukemias and lymphomas) or may comprise solid tumors.
  • Types of cancers to be treated with the caTCR plus SSE immune cells of the invention include, but are not limited to, carcinoma, blastoma, and sarcoma, and certain leukemia or lymphoid malignancies, benign and malignant tumors, and malignancies e.g., sarcomas, carcinomas, and melanomas.
  • carcinoma blastoma
  • sarcoma certain leukemia or lymphoid malignancies
  • benign and malignant tumors e.g., sarcomas, carcinomas, and melanomas.
  • malignancies e.g., sarcomas, carcinomas, and melanomas.
  • adult tumors/cancers and pediatric tumors/cancers are also included.
  • Hematologic cancers are cancers of the blood or bone marrow.
  • hematological (or hematogenous) cancers include leukemias, including acute leukemias (such as acute lymphocytic leukemia, acute myelocytic leukemia, acute myelogenous leukemia and myeloblastic, promyelocytic, myelomonocytic, monocytic and erythroleukemia), chronic leukemias (such as chronic myelocytic (granulocytic) leukemia, chronic myelogenous leukemia, and chronic lymphocytic leukemia), polycythemia vera, lymphoma, Hodgkin's disease, non-Hodgkin's lymphoma (indolent and high grade forms), multiple myeloma, plasmacytoma, Waldenstrom's macroglobulinemia, heavy chain disease, myelodysplastic syndrome, hairy cell leukemia and myelodysplasia.
  • Solid tumors are abnormal masses of tissue that usually do not contain cysts or liquid areas. Solid tumors can be benign or malignant. Different types of solid tumors are named for the type of cells that form them (such as sarcomas, carcinomas, and lymphomas). Examples of solid tumors, such as sarcomas and carcinomas, include adrenocortical carcinoma, cholangiocarcinoma, fibrosarcoma, myxosarcoma, liposarcoma, chondrosarcoma, osteosarcoma, and other sarcomas, synovioma, mesothelioma, Ewing's tumor, leiomyosarcoma, rhabdomyosarcoma, colon carcinoma, stomach cancer, lymphoid malignancy, pancreatic cancer, breast cancer, lung cancers, ovarian cancer, prostate cancer, hepatocellular carcinoma, squamous cell carcinoma, basal cell carcinoma, adenocarcinoma, sweat gland carcinoma,
  • Cancer treatments can be evaluated, for example, by tumor regression, tumor weight or size shrinkage, time to progression, duration of survival, progression free survival, overall response rate, duration of response, quality of life, protein expression and/or activity.
  • Approaches to determining efficacy of the therapy can be employed, including for example, measurement of response through radiological imaging.
  • the caTCR plus SSE immune cells in other embodiments can be useful for treating infectious diseases by targeting pathogen-associated (such as virally-encoded) antigens.
  • pathogen-associated antigens such as virally-encoded
  • the infection to be prevented or treated may be caused by a virus, bacteria, protozoa, or parasite.
  • the target antigen may be a pathogenic protein, polypeptide or peptide that is responsible for a disease caused by the pathogen, or is capable of inducing an immunological response in a host infected by the pathogen.
  • Pathogenic antigens which can be targeted by caTCR plus SSE immune cells include, but are not limited to, antigens derived from Acinetobacter baumannii, Anaplasma genus, Anaplasma phagocytophilum, Ancylostoma braziliense, Ancylostoma duodenale, Arcanobacterium haemolyticum, Ascaris lumbricoides, Aspergillus genus, Astroviridae, Babesia genus, Bacillus anthracis, Bacillus cereus, Bartonella henselae , BK virus, Blastocystis hominis, Blastomyces dermatitidis, Bordetella pertussis, Borrelia burgdorferi, Borrelia genus, Borrelia spp, Brucella genus, Brugia malayi, Bunyaviridae family, Burkholderia cepacia and other Burkholderia species, Burkholderia
  • the caTCR plus SSE immune cells are used for treating oncogenic infectious diseases, such as infection by oncogenic viruses.
  • Oncogenic viruses include, but are not limited to, CMV, EBV, HBV, KSHV, HPV, MCV, HTLV-1, HIV-1, and HCV.
  • the target antigen of the caTCR can be a viral oncoprotein including, but not limited to, Tax, E7, E6/E7, E6, HBx, EBNA proteins (e.g., EBNA3 A, EBNA3 C, and EBNA 2), v-cyclin, LANA1, LANA2, LMP-1, k-bZIP, RTA, KSHV K8, and fragments thereof. See Ahuja, Richa, et al., Curr. Sci., 2014.
  • an article of manufacture containing materials useful for the treatment of a target antigen-positive disease such as cancer (for example adrenocortical carcinoma, bladder cancer, breast cancer, cervical cancer, cholangiocarcinoma, colorectal cancers, esophageal cancer, glioblastoma, glioma, hepatocellular carcinoma, head and neck cancer, kidney cancer, lung cancer, melanoma, mesothelioma, multiple myeloma, pancreatic cancer, pheochromocytoma, plasmacytoma, neuroblastoma, ovarian cancer, prostate cancer, sarcoma, stomach cancer, uterine cancer or thyroid cancer) or viral infection (for example infection by CMV, EBV, HBV, KSHV, HPV, MCV, HTLV-1, HIV-1, or HCV).
  • cancer for example adrenocortical carcinoma, bladder cancer, breast cancer, cervical cancer, cholangiocarcinoma, colorectal cancers,
  • the article of manufacture can comprise a container and a label or package insert on or associated with the container.
  • Suitable containers include, for example, bottles, vials, syringes, etc.
  • the containers may be formed from a variety of materials such as glass or plastic.
  • the container holds a composition which is effective for treating a disease or disorder described herein, and may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle).
  • At least one active agent in the composition is an immune cell presenting on its surface a caTCR and expressing or capable of expressing an SSE of the invention.
  • the label or package insert indicates that the composition is used for treating the particular condition.
  • the label or package insert will further comprise instructions for administering the caTCR plus SSE immune cell composition to the patient.
  • Articles of manufacture and kits comprising combinatorial therapies described herein are also contemplated.
  • Package insert refers to instructions customarily included in commercial packages of therapeutic products that contain information about the indications, usage, dosage, administration, contraindications and/or warnings concerning the use of such therapeutic products.
  • the package insert indicates that the composition is used for treating a target antigen-positive cancer (such as adrenocortical carcinoma, bladder cancer, breast cancer, cervical cancer, cholangiocarcinoma, colorectal cancers, esophageal cancer, glioblastoma, glioma, hepatocellular carcinoma, head and neck cancer, kidney cancer, lung cancer, melanoma, mesothelioma, multiple myeloma, pancreatic cancer, pheochromocytoma, plasmacytoma, neuroblastoma, ovarian cancer, prostate cancer, sarcoma, stomach cancer, uterine cancer or thyroid cancer).
  • the package insert indicates that the composition is used for treating a target antigen-positive viral infection (for example infection by CMV
  • the article of manufacture may further comprise a second container comprising a pharmaceutically acceptable buffer, such as bacteriostatic water for injection (BWFI), phosphate-buffered saline, Ringer's solution and dextrose solution. It may further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, and syringes.
  • BWFI bacteriostatic water for injection
  • phosphate-buffered saline such as bacteriostatic water for injection (BWFI), phosphate-buffered saline, Ringer's solution and dextrose solution.
  • BWFI bacteriostatic water for injection
  • phosphate-buffered saline such as phosphate-buffered saline, Ringer's solution and dextrose solution.
  • dextrose solution such as bacteriostatic water for injection (BWFI), phosphate-buffered saline, Ringer's solution and dext
  • Kits are also provided that are useful for various purposes, e.g., for treatment of a target antigen-positive disease or disorder described herein, optionally in combination with the articles of manufacture.
  • Kits of the invention include one or more containers comprising a caTCR plus SSE immune cell composition (or unit dosage form and/or article of manufacture), and in some embodiments, further comprise another agent (such as the agents described herein) and/or instructions for use in accordance with any of the methods described herein.
  • the kit may further comprise a description of selection of individuals suitable for treatment.
  • Instructions supplied in the kits of the invention are typically written instructions on a label or package insert (e.g., a paper sheet included in the kit), but machine-readable instructions (e.g., instructions carried on a magnetic or optical storage disk) are also acceptable.
  • the kit comprises a composition comprising an immune cell presenting on its surface a caTCR and expressing or capable of expressing an SSE.
  • the kit comprises a) a composition comprising an immune cell presenting on its surface a caTCR and expressing or capable of expressing an SSE, and b) an effective amount of at least one other agent, wherein the other agent increases the expression of MEC proteins and/or enhances the surface presentation of peptides by MEC proteins (e.g., IFN ⁇ , IFN ⁇ , IFN ⁇ , or Hsp90 inhibitor).
  • the kit comprises a) a composition comprising an immune cell presenting on its surface a caTCR and expressing or capable of expressing an SSE, and b) instructions for administering the caTCR plus SSE immune cell composition to an individual for treatment of a target antigen-positive disease (such as cancer or viral infection).
  • a target antigen-positive disease such as cancer or viral infection.
  • the kit comprises a) a composition comprising an immune cell presenting on its surface a caTCR and expressing or capable of expressing an SSE, b) an effective amount of at least one other agent, wherein the other agent increases the expression of MEC proteins and/or enhances the surface presentation of peptides by MEC proteins (e.g., IFN ⁇ , IFN ⁇ , IFN ⁇ , or Hsp90 inhibitor), and c) instructions for administering the caTCR plus SSE immune cell composition and the other agent(s) to an individual for treatment of a target antigen-positive disease (such as cancer or viral infection).
  • the caTCR plus SSE immune cell composition and the other agent(s) can be present in separate containers or in a single container.
  • the kit may comprise one distinct composition or two or more compositions wherein one composition comprises the caTCR plus SSE immune cell and another composition comprises the other agent.
  • the kit comprises a nucleic acid (or set of nucleic acids) encoding a caTCR and an SSE. In some embodiments, the kit comprises a) a nucleic acid (or set of nucleic acids) encoding a caTCR and an SSE, and b) a host cell (such as an immune cell) for expressing the nucleic acid (or set of nucleic acids).
  • the kit comprises a) a nucleic acid (or set of nucleic acids) encoding a caTCR and an SSE, and b) instructions for i) expressing the caTCR and SSE in a host cell (such as an immune cell, e.g., a T cell), ii) preparing a composition comprising the host cell expressing the caTCR and SSE, and iii) administering the composition comprising the host cell expressing the caTCR and SSE to an individual for the treatment of a target antigen-positive disease (such as cancer or viral infection).
  • a target antigen-positive disease such as cancer or viral infection.
  • the host cell is derived from the individual.
  • the kit comprises a) a nucleic acid (or set of nucleic acids) encoding a caTCR and an SSE, b) a host cell (such as an immune cell) for expressing the nucleic acid (or set of nucleic acids), and c) instructions for i) expressing the caTCR and SSE in the host cell, ii) preparing a composition comprising the host cell expressing the caTCR and SSE, and iii) administering the composition comprising the host cell expressing the caTCR and SSE to an individual for the treatment of a target antigen-positive disease (such as cancer or viral infection).
  • a target antigen-positive disease such as cancer or viral infection
  • kits of the invention are in suitable packaging.
  • suitable packaging includes, but is not limited to, vials, bottles, jars, flexible packaging (e.g., sealed Mylar or plastic bags), and the like. Kits may optionally provide additional components such as buffers and interpretative information.
  • the present application thus also provides articles of manufacture, which include vials (such as sealed vials), bottles, jars, flexible packaging, and the like.
  • kits may be provided that contain sufficient dosages of a caTCR plus SSE immune cell composition as disclosed herein to provide effective treatment of an individual for an extended period, such as any of a week, 8 days, 9 days, 10 days, 11 days, 12 days, 13 days, 2 weeks, 3 weeks, 4 weeks, 6 weeks, 8 weeks, 3 months, 4 months, 5 months, 7 months, 8 months, 9 months, or more. Kits may also include multiple unit doses of the caTCR plus SSE immune cells, and pharmaceutical compositions and instructions for use and packaged in quantities sufficient for storage and use in pharmacies, for example, hospital pharmacies and compounding pharmacies.
  • an immune cell in one embodiments, there is provided an immune cell
  • a) comprising a chimeric antibody-T cell receptor (TCR) construct (caTCR) comprising: i) an antigen binding module that specifically binds to a target antigen; and ii) a T cell receptor module (TCRM) comprising a first TCR domain (TCRD) comprising a first TCR transmembrane domain (TCR-TM) and a second TCRD comprising a second TCR-TM, wherein the TCRM facilitates recruitment of at least one TCR-associated signaling molecule; and b) capable of secreting a secretory secondary effector (SSE) capable of enhancing an immune response mediated by the caTCR.
  • TCR chimeric antibody-T cell receptor
  • caTCR chimeric antibody-T cell receptor
  • ROR receptor tyrosine kinase-like orphan receptor
  • BCMA B-cell maturation antigen
  • G Protein-Coupled Receptor Class C Group 5 Member D GPRC5D
  • Glypican 3 Glypican 3
  • FCRL5 Fc Receptor Like 5
  • MEC major histocompatibility complex
  • WT-1 Wilms Tumor 1
  • AFP Alpha-fetoprotein
  • HPV16-E7 Human Papilloma Virus Type 16-E7
  • PRAME Preferentially Expressed Antigen In Melanoma
  • EBV-LMP2A Epstein-Barr virus latent membrane protein 2A
  • KRAS GTPase KRas
  • Histone H3.3 Histone H3.3
  • TCRM allows for enhanced recruitment of the at least one TCR-associated signaling molecule as compared to a TCRM comprising the first naturally occurring T cell receptor transmembrane domains.
  • the antigen-binding module is an antibody moiety selected from the group consisting of a Fab, a Fab′, a (Fab′)2, an Fv, and a single chain Fv (scFv).
  • the immune cell of embodiment 14, wherein the caTCR comprises two or more antigen-binding modules.
  • the antigen binding module comprises at least one scFv linked to at least one of the TCRDs.
  • the antigen binding module comprises a V H domain linked to one of the TCRDs and a V L domain linked to the other TCRD.
  • V H domain is fused to one of the TCRDs and the V L domain is fused to the other TCRD, optionally via a peptide linker.
  • V H domain is covalently conjugated to one of the TCRDs and the V L domain is covalently conjugated to the other TCRD.
  • the caTCR further comprises a stabilization module comprising a first stabilization domain and a second stabilization domain, wherein the first and second stabilization domains have a binding affinity that stabilizes the caTCR.
  • the immune cell of embodiment 24, wherein the stabilization module is selected from the group consisting of a C H 1-C L module, a C H 2-C H 2 module, a C H 3-C H 3 module, and a C H 4-C H 4 module.
  • Kd equilibrium dissociation constant
  • TCR-associated signaling molecule is selected from the group consisting of CD3 ⁇ , CD3 ⁇ , and
  • the immune cell of embodiment 32 wherein the multispecific antibody moiety is selected from the group consisting of a tandem scFv, a diabody (Db), a single chain diabody (scDb), a dual-affinity retargeting (DART) antibody, and a dual variable domain (DVD) antibody.
  • the multispecific antibody moiety is selected from the group consisting of a tandem scFv, a diabody (Db), a single chain diabody (scDb), a dual-affinity retargeting (DART) antibody, and a dual variable domain (DVD) antibody.
  • the immune cell of embodiment 33 wherein the antibody moiety is a bispecific antibody moiety comprising a first antibody moiety that targets an immune cell surface antigen and a second antibody moiety that targets a disease-associated antigen.
  • the immune cell of embodiment 34, wherein the immune cell surface antigen is CD3 or CD16a.
  • the immune cell of embodiment 34 or 35, wherein the disease-associated antigen is the same as the target antigen of the caTCR.
  • the disease-associated antigen is GPC3, CD47, MUC16, CD19, CD20, CD22, EpCAM, EGFR, HER2, CEA, PSMA, AFP, PSA, BCMA, FCRL5, NY-ESO, HPV16, or FoxP3.
  • the immune cell of embodiment 31, wherein the antibody moiety is a full-length antibody, a Fab, a Fab′, a (Fab′)2, an Fv, or a single chain Fv (scFv).
  • the immune cell of embodiment 40 wherein the antibody moiety is an antagonist of an inhibitory immune checkpoint molecule.
  • the immune cell of embodiment 41 wherein the inhibitory immune checkpoint molecule is selected from the group consisting of PD-1, PD-L1, CTLA-4, HVEM, BTLA, KIR, LAG-3, TIM-3, and A2aR.
  • the immune cell of embodiment 40 wherein the antibody moiety is an agonist of a stimulatory immune checkpoint molecule.
  • the immune cell of embodiment 43 wherein the stimulatory immune checkpoint molecule is selected from the group consisting of CD28, ICOS, 4-1BB, OX40, CD27, and CD40.
  • the immune cell of embodiment 38 wherein the target antigen of the caTCR is an MEC class I complex comprising an AFP peptide, and the disease-associated antigen is GPC3.
  • the antigen-binding module of the caTCR comprises a variable heavy (V H ) domain comprising the amino acid sequence of SEQ ID NO: 52 and a variable light (V L ) domain comprising the amino acid sequence of SEQ ID NO: 53, or variants thereof that do not substantially alter the binding of the antigen-binding molecule to AFP
  • the first antibody moiety of the SSE comprises a V H domain comprising the amino acid sequence of SEQ ID NO: 70 and a V L domain comprising the amino acid SEQUENCE of SEQ ID NO: 71, or variants thereof that do not substantially alter the binding of the first antibody moiety to CD3
  • the second antibody moiety of the SSE comprises a V H domain comprising the amino acid sequence of SEQ ID NO: 64 and a V L domain comprising the amino acid SEQUENCE of SEQ ID NO: 65, or variants thereof that do not substantially alter the binding of the second antibody moiety to GPC3.
  • the immune cell of embodiment 49 wherein the receptor is selected from the group consisting of FasR, TNFR1, TNFR2, SIRP ⁇ , PD-1, CD28, CTLA-4, ICOS, BTLA, KIR, LAG-3, 4-1BB, OX40, CD27, CD40, and TIM-3.
  • the receptor is selected from the group consisting of FasR, TNFR1, TNFR2, SIRP ⁇ , PD-1, CD28, CTLA-4, ICOS, BTLA, KIR, LAG-3, 4-1BB, OX40, CD27, CD40, and TIM-3.
  • the immune cell of embodiment 51 wherein the ligand is selected from the group consisting of FasL, PD-L1, PD-L2, CD47, CD80, CD86, ICOSL, HVEM, 4-1BBL, OX40L, CD70, CD40L, and GAL9.
  • the ligand is selected from the group consisting of FasL, PD-L1, PD-L2, CD47, CD80, CD86, ICOSL, HVEM, 4-1BBL, OX40L, CD70, CD40L, and GAL9.
  • the immune cell of embodiment 53 wherein the exogenous cytokine is an IL-12 family member.
  • the immune cell of embodiment 54 wherein the exogenous cytokine is IL-12, IL-23, IL-27, or IL-35.
  • the immune cell of embodiment 53 wherein the exogenous cytokine is IL-2, IL-15, IL-18, or IL-21.
  • the immune cell of embodiment 57 wherein the expression of the SSE is inducible upon activation of the immune cell.
  • nucleic acids encoding the caTCR and SSE of any one of embodiments 1-59.
  • a chimeric antibody-T cell receptor (TCR) construct comprising: i) an antigen binding module that specifically binds to a target antigen; and ii) a T cell receptor module (TCRM) comprising a first TCR domain (TCRD) comprising a first TCR transmembrane domain (TCR-TM) and a second TCRD comprising a second TCR-TM, wherein the TCRM facilitates recruitment of at least one TCR-associated signaling molecule; and b) a secretory secondary effector (SSE) capable of enhancing an immune response mediated by the caTCR.
  • TCR chimeric antibody-T cell receptor construct
  • the one or more nucleic acids of any one of embodiments 60-63, comprising a nucleotide sequence encoding the SSE is operably linked to an inducible promoter.
  • the one or more nucleic acids of embodiment 64 wherein the inducible promoter is inducible upon activation of the immune cell.
  • NFAT activated T-cell
  • one or more vectors comprising the one or more nucleic acids of any one of embodiments 60-66.
  • the one or more vectors of embodiment 67 wherein at least one of the vectors comprises a nucleic acid sequence encoding the caTCR and at least one other vector comprises a nucleic acid sequence encoding the SSE.
  • the one or more vectors of embodiment 67 comprising a single vector comprising the one or more nucleic acids.
  • composition comprising the one or more nucleic acids of any one of embodiments 60-66 or the one or more vectors of any one of embodiments 67-69.
  • an immune cell comprising the one or more nucleic acids of any one of embodiments 60-66 or the one or more vectors of any one of embodiments 67-69.
  • the immune cell of embodiment 71 wherein the immune cell further comprises a caTCR expressed from the one or more nucleic acids of any one of embodiments 60-66 or the one or more vectors of any one of embodiments 67-69.
  • the immune cell of embodiment 71 or 72 wherein the immune cell further comprises an SSE expressed from the one or more nucleic acids of any one of embodiments 60-66 or the one or more vectors of any one of embodiments 67-69.
  • the caTCR is a heterodimer comprising a first polypeptide chain comprising the first TCRD and a second polypeptide chain comprising the second TCRD, and wherein the antigen-binding module comprises one or two polypeptide chains linked to the amino-terminus of one or both of the TCRDs
  • the SSE comprises a single polypeptide chain
  • the immune cell comprising: i) a first nucleic acid sequence encoding the first polypeptide chain of the caTCR; ii) a second nucleic acid sequence encoding the second polypeptide chain of the caTCR; and iii) a third nucleic acid sequence encoding the SSE.
  • the immune cell of embodiment 75 comprising:
  • the immune cell of embodiment 75 comprising:
  • a) a first vector comprising: i) the first nucleic acid sequence encoding the first polypeptide chain of the caTCR under the control of a first promoter; and ii) the second nucleic acid sequence encoding the second polypeptide chain of the caTCR under the control of a second promoter; and b) a second vector comprising the third nucleic acid sequence encoding the SSE under the control of a third promoter.
  • the immune cell of embodiment 75 comprising a vector comprising:
  • the immune cell of embodiment 75 comprising:
  • the immune cell of embodiment 75 comprising a vector comprising:
  • the immune cell of embodiment 80 or 84 wherein the inducible promoter is inducible upon activation of the immune cell.
  • the immune cell of embodiment 75 comprising a vector comprising:
  • the first nucleic acid sequence encoding the first polypeptide chain of the caTCR a) the first nucleic acid sequence encoding the first polypeptide chain of the caTCR; b) the second nucleic acid sequence encoding the second polypeptide chain of the caTCR; and c) the third nucleic acid sequence encoding the SSE, wherein the first, second, and third nucleic acid sequences are under the control of a single promoter.
  • a pharmaceutical composition comprising the immune cell of any one of embodiments 1-59 and 71-88, and a pharmaceutically acceptable carrier.
  • a method of killing a target cell presenting a target antigen comprising contacting the target cell with the immune cell of any one of embodiments 1-59 and 71-88.
  • a method of treating a target antigen-associated disease in an individual in need thereof comprising administering to the individual an effective amount of the pharmaceutical composition of embodiment 89.
  • the cancer is selected from the group consisting of adrenocortical carcinoma, bladder cancer, breast cancer, cervical cancer, cholangiocarcinoma, colorectal cancers, esophageal cancer, glioblastoma, glioma, hepatocellular carcinoma, head and neck cancer, kidney cancer, leukemia, lung cancer, lymphoma, melanoma, mesothelioma, multiple myeloma, pancreatic cancer, pheochromocytoma, plasmacytoma, neuroblastoma, ovarian cancer, prostate cancer, sarcoma, stomach cancer, uterine cancer and thyroid cancer.
  • CMV Cytomegalovirus
  • EBV Epstein-Barr Virus
  • HBV Hepatitis B Virus
  • KSHV Kaposi's Sarcoma associated herpesvirus
  • HPV Human papillomavirus
  • MMV Molluscum contagiosum virus
  • HTLV-1 Human T cell leukemia virus 1
  • HAV Human immunodeficiency virus
  • HCV Hepatitis C Virus
  • a method of enhancing an immune response of an immune cell comprising a caTCR or transduced with a nucleic acid encoding a caTCR, comprising introducing into said cell the one or more nucleic acids of any one of embodiments 60-66 or the one or more vectors of any one of embodiments 67-69.
  • HepG2 ATCC HB-8065; HLA-A2+, AFP + , GPC3 +
  • SK-HEP-1 ATCC HTB-52; HLA-A2+, AFP ⁇ , GPC3 ⁇
  • HepG2 GPC3 knockout (HepG2-GPC3.ko) line was generated using CRISPR technology to knockout GPC3.
  • Another control cell line, SK-HEP1-AFP/GPC3 (AFP + , GPC3 + ) was generated by transducing SK-HEP-1 cell line with a minigene cassette expressing AFP and GPC3. All cell lines were cultured in RPMI 1640 or DMEM supplemented with 10% FBS and 2 mM glutamine at 37° C./5% CO 2 .
  • Flow cytometry data were collected using BD FACSCanto II and analyzed using FlowJo software package.
  • Lentiviruses encoding human AFP158/HLA-A*02:01-specific caTCR alone or AFP158/HLA-A*02:01-specific caTCR+anti-GPC3/anti-CD3 BsAb were produced, for example, by transfection of 293T cells with vectors encoding the constructs.
  • Primary human T-cells were used for transduction after one-day stimulation with CD3/CD28 beads (Dynabeads®, Invitrogen) in the presence of interleukin-2 (IL-2) at 100 U/ml.
  • Concentrated lentiviruses were applied to T-cells in Retronectin- (Takara) coated 6-well plates for 96 hours. Transduction efficiencies were assessed by flow cytometry.
  • Cell lines were transduced with either a vector encoding both subunits of the caTCR construct alone or a vector encoding the caTCR and the BsAb.
  • CD3 + T cells were prepared from PBMC-enriched whole blood using EasySep Human T Cell Isolation Kit (StemCell Technologies) which negatively depletes CD14, CD16, CD19, CD20, CD36, CD56, CD66b, CD123, glycophorin A expressing cells.
  • Human T cells were activated and expanded with, for example, CD3/CD28 Dynabeads (Invitrogen) according to manufacturer's protocol.
  • Activated T cells (ATC) were cultured and maintained in RPMI1640 medium with 10% FBS plus 100 U/ml IL-2, and used at day 7-14.
  • Activated T cells (immune cells) and target cells were co-cultured at various effector-to-target ratios (e.g., 2.5:1 or 5:1) for 16 hours and assayed for cytotoxicities.
  • FIG. 1 Various chimeric antibody-T cell receptor (caTCRs) designs are contemplated, and six different examples are shown in FIG. 1 (caTCR-1, caTCR-2, caTCR-3, caTCR-4, caTCR-5, and caTCR-6).
  • various antibody moieties Fab, Fab′, (Fab′)2, Fv, or scFv
  • Fab, Fab′, (Fab′)2, Fv, or scFv are fused to the amino terminus of T cell receptor ⁇ / ⁇ chains or ⁇ / ⁇ chains lacking variable and constant domains and including all or part of their connecting peptide (region after the constant domain), their transmembrane domain, or a variant thereof, and any intracellular domain to form caTCR heterodimers which can be expressed on the surface of T cells.
  • the V ⁇ /V ⁇ or V ⁇ /V ⁇ domains form the antigen-binding domain of the TCR.
  • Our designs replace the V ⁇ -C ⁇ /V ⁇ -C ⁇ or V ⁇ -C ⁇ /V ⁇ -C ⁇ regions with various antibody moieties, and introduce at least one variant TCR transmembrane domain, thus conferring an antibody's binding specificity to the construct, and resulting in an enhanced ability of the construct to recruit accessory molecules in a TCR complex, such as CD3 ⁇ , CD3 ⁇ and CD3 ⁇ , as compared to TCRs or related constructs with only naturally occurring TCR transmembrane domains.
  • the caTCR constructs were named as follows: caTCR-[design #]-[variant location][#].
  • Design #1 corresponds to caTCR with a Fab antibody moiety
  • design #2 corresponds to caTCR with a Fab′ antibody moiety
  • design #3 corresponds to caTCR with a (Fab′)2 antibody moiety
  • design #4 corresponds to caTCR with an Fv antibody moiety
  • design #5 corresponds to caTCR with a single scFv antibody moiety
  • design #6 corresponds to caTCR with two scFv antibody moieties (see FIG. 1 ).
  • No variant location and #0 corresponds to a construct with naturally occurring TCR domains, and #>1 corresponds to caTCR with specific variants in the variant location (e.g., caTCR-1-TM1 corresponds to one transmembrane domain variant, caTCR-1-EC1 corresponds to one extracellular domain variant; see Table 2).
  • variable domain and the first constant domain (IgV H -IgC H 1) of an antibody heavy chain replaces the amino terminal portion of the TCR ⁇ chain up to a position bordering or within the connecting peptide in the extracellular domain of the TCR ⁇ chain after the V ⁇ -C ⁇ region, optionally wherein the transmembrane domain of the TCR ⁇ chain is modified, such as by substitution of one or more amino acids.
  • variable domain and the constant domain (IgV L -IgC L ) of the corresponding antibody light chain replaces the amino terminal portion of the TCR ⁇ chain up to a position bordering or within the connecting peptide in the extracellular domain of the TCR ⁇ chain after the V ⁇ -C ⁇ region, optionally wherein the transmembrane domain of the TCR ⁇ chain is modified, such as by substitution of one or more amino acids.
  • one chain includes the IgV H domain of an anti-AFP158/HLA-A*02:01 antibody (SEQ ID NO: 52) fused to an IgC H 1 domain (any one of SEQ ID NOs: 37-47) fused to a carboxy-terminal portion of the TCR chain including the transmembrane domain and all or part of the connecting peptide of the TCR chain, and the other chain includes the IgV L domain of the anti-AFP158/HLA-A*02:01 antibody (SEQ ID NO: 53) fused to an IgC L domain (SEQ ID NO: 48) fused to a carboxy-terminal portion of the TCR ⁇ chain including the transmembrane domain and all or part of the connecting peptide of the TCR ⁇ chain, wherein at least one of the TCR domains (such as a TCR transmembrane domain) is a non-naturally occurring variant comprising one or more amino acid substitutions.
  • the TCR domains such as a TCR transmembrane domain
  • the carboxy terminal portion of the TCR chain includes a connecting peptide having the amino acid sequence of SEQ ID NO: 31 or 32. In some embodiments, the carboxy terminal portion of the TCR chain includes a transmembrane domain having the amino acid sequence of any one of SEQ ID NOs: 7, and 9-13. In some embodiments, the carboxy terminal portion of the TCR ⁇ chain includes a connecting peptide having the amino acid sequence of SEQ ID NO: 33 or 34. In some embodiments, the carboxy terminal portion of the TCR ⁇ chain includes a transmembrane domain having the amino acid sequence of any one of SEQ ID NOs: 8, and 14-26.
  • the variable domain, the first constant domain, and the hinge (IgV H -IgC H 1-hinge) of an antibody heavy chain replaces the amino terminal portion of the TCR chain up to a position bordering or within the connecting peptide in the extracellular domain of the TCR chain after the V ⁇ -C ⁇ region, optionally wherein the transmembrane domain of the TCR chain is modified, such as by substitution of one or more amino acids.
  • variable domain and the constant domain of the corresponding antibody light chain fused to a linker replaces the amino terminal portion of the TCR ⁇ chain up to a position bordering or within the connecting peptide in the extracellular domain of the TCR ⁇ chain after the V ⁇ -C ⁇ region, optionally wherein the transmembrane domain of the TCR ⁇ chain is modified, such as by substitution of one or more amino acids.
  • variable domain, the first constant domain, and the hinge (IgV H -IgC H 1-hinge) of an antibody heavy chain replaces the amino terminal portion of the TCR chain up to a position bordering or within the connecting peptide in the extracellular domain of the TCR chain after the V ⁇ -C ⁇ region, optionally wherein the transmembrane domain of the TCR chain is modified, such as by substitution of one or more amino acids.
  • variable domain, the first constant domain, and the hinge (IgV H -IgC H 1-hinge) of the antibody heavy chain replaces the amino terminal portion of the TCR ⁇ chain up to a position bordering or within the connecting peptide in the extracellular domain of the TCR ⁇ chain after the V ⁇ -C ⁇ region, optionally wherein the transmembrane domain of the TCR ⁇ chain is modified, such as by substitution of one or more amino acids.
  • the variable domain and the constant domain of the corresponding antibody light chain (IgV L -IgC L ) are associated with the IgV H -IgC H 1 domains.
  • variable domain (IgV H ) of an antibody heavy chain replaces the amino terminal portion of the TCR chain up to a position bordering or within the connecting peptide in the extracellular domain of the TCR chain after the V ⁇ -C ⁇ region, optionally wherein the transmembrane domain of the TCR chain is modified, such as by substitution of one or more amino acids.
  • variable domain (IgV L ) of the corresponding antibody light chain replaces the amino terminal portion of the TCR ⁇ chain up to a position bordering or within the connecting peptide in the extracellular domain of the TCR ⁇ chain after the V ⁇ -C ⁇ region, optionally wherein the transmembrane domain of the TCR ⁇ chain is modified, such as by substitution of one or more amino acids.
  • variable domain of an antibody heavy chain fused to the variable domain of the corresponding antibody light chain replaces the amino terminal portion of the TCR chain up to a position bordering or within the connecting peptide in the extracellular domain of the TCR chain after the V ⁇ -C ⁇ region, optionally wherein the transmembrane domain of the TCR chain is modified, such as by substitution of one or more amino acids.
  • the amino terminal portion of the TCR ⁇ chain up to a position bordering or within the connecting peptide in the extracellular domain of the TCR ⁇ chain after the V ⁇ -C ⁇ region is deleted, optionally wherein the transmembrane domain of the TCR ⁇ chain is modified, such as by substitution of one or more amino acids.
  • variable domain of an antibody heavy chain fused to the variable domain of the corresponding antibody light chain replaces the amino terminal portion of the TCR chain up to a position bordering or within the connecting peptide in the extracellular domain of the TCR chain after the V ⁇ -C ⁇ region, optionally wherein the transmembrane domain of the TCR chain is modified, such as by substitution of one or more amino acids.
  • variable domain of an antibody heavy chain fused to the variable domain of the corresponding antibody light chain replaces the amino terminal portion of the TCR ⁇ chain up to a position bordering or within the connecting peptide in the extracellular domain of the TCR ⁇ chain after the V ⁇ -C ⁇ region, optionally wherein the transmembrane domain of the TCR ⁇ chain is modified, such as by substitution of one or more amino acids.
  • Anti-AFP caTCR SEQ ID NOs: 54 and 55
  • anti-AFP caTCR+anti-GPC3/anti-CD3 BsAb SEQ ID NO: 71
  • the anti-AFP caTCR was under the control of the EF1-alpha promoter (SEQ ID NO: 75)
  • the anti-GPC3/anti-CD3 BsAb was under the control of an NFAT-derived promoter (SEQ ID NO: 74) comprising 6 NFAT response elements (SEQ ID NO: 72) and a minimal TA promoter (SEQ ID NO: 73).
  • T-cells were matched at the indicated receptor positive percentages by mixing with mock T-cells. Two cell lines were used: HEPG2 (AFP+/GPC3+) and HEPG2 GPC3.ko (AFP+/GPC3 ⁇ ) at an effector-to-target ratio of 2.5:1. Specific T-cell lysis was measured after 16 hr incubation using the Cytox 96 Non-radioactive Cytotoxicity Assay (Promega).
  • Sequence Listing SEQ ID NO Description Sequence 1 TCR ⁇ constant domain PNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDF KSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNL SVIGFRILLLKVAGFNLLMTLRLWSS 2 TCR ⁇ constant domain EDLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVST DPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKP VTQIVSAEAWGRADCGFTSVSYQQGVLSATILYEILLGKATLYAVLVSALVLMAMVKR KDF 3 TCR ⁇ constant domain SQPHTKPSVFVMKNGTNVACLVKEFYPKDIRINLVSSKKITEFDPAIVISPSGKYNAV KLGKYEDSNSV

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Epidemiology (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Cell Biology (AREA)
  • Zoology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Engineering & Computer Science (AREA)
  • Toxicology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Hematology (AREA)
  • Wood Science & Technology (AREA)
  • Microbiology (AREA)
  • Developmental Biology & Embryology (AREA)
  • Virology (AREA)
  • General Engineering & Computer Science (AREA)
  • Oncology (AREA)
  • Mycology (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
US16/608,362 2017-04-26 2018-04-24 Cells expressing chimeric antigen receptors and secondary effectors and uses thereof Abandoned US20210093666A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US16/608,362 US20210093666A1 (en) 2017-04-26 2018-04-24 Cells expressing chimeric antigen receptors and secondary effectors and uses thereof

Applications Claiming Priority (5)

Application Number Priority Date Filing Date Title
US201762490580P 2017-04-26 2017-04-26
US201762490576P 2017-04-26 2017-04-26
US201762490578P 2017-04-26 2017-04-26
PCT/US2018/029220 WO2018200585A1 (en) 2017-04-26 2018-04-24 Cells expressing chimeric antigen receptors and secondary effectors and uses thereof
US16/608,362 US20210093666A1 (en) 2017-04-26 2018-04-24 Cells expressing chimeric antigen receptors and secondary effectors and uses thereof

Publications (1)

Publication Number Publication Date
US20210093666A1 true US20210093666A1 (en) 2021-04-01

Family

ID=63918704

Family Applications (5)

Application Number Title Priority Date Filing Date
US16/608,362 Abandoned US20210093666A1 (en) 2017-04-26 2018-04-24 Cells expressing chimeric antigen receptors and secondary effectors and uses thereof
US16/608,336 Active 2039-07-12 US11613573B2 (en) 2017-04-26 2018-04-24 Chimeric antibody/T-cell receptor constructs and uses thereof
US16/608,366 Active 2040-07-03 US11965021B2 (en) 2017-04-26 2018-04-24 Cells expressing chimeric activating receptors and chimeric stimulating receptors and uses thereof
US16/660,515 Active US10822413B2 (en) 2017-04-26 2019-10-22 Cells expressing chimeric activating receptors and chimeric stimulating receptors and uses thereof
US18/593,621 Pending US20240317855A1 (en) 2017-04-26 2024-03-01 Cells expressing chimeric activating receptors and chimeric stimulating receptors and uses thereof

Family Applications After (4)

Application Number Title Priority Date Filing Date
US16/608,336 Active 2039-07-12 US11613573B2 (en) 2017-04-26 2018-04-24 Chimeric antibody/T-cell receptor constructs and uses thereof
US16/608,366 Active 2040-07-03 US11965021B2 (en) 2017-04-26 2018-04-24 Cells expressing chimeric activating receptors and chimeric stimulating receptors and uses thereof
US16/660,515 Active US10822413B2 (en) 2017-04-26 2019-10-22 Cells expressing chimeric activating receptors and chimeric stimulating receptors and uses thereof
US18/593,621 Pending US20240317855A1 (en) 2017-04-26 2024-03-01 Cells expressing chimeric activating receptors and chimeric stimulating receptors and uses thereof

Country Status (13)

Country Link
US (5) US20210093666A1 (https=)
EP (2) EP3615567A4 (https=)
JP (4) JP7538601B2 (https=)
KR (3) KR102729668B1 (https=)
CN (2) CN110741016A (https=)
AU (3) AU2018258045B2 (https=)
CA (2) CA3059755A1 (https=)
IL (4) IL270136B2 (https=)
MX (1) MX2024007576A (https=)
PH (1) PH12019502411A1 (https=)
SG (5) SG10201913655UA (https=)
TW (4) TWI874297B (https=)
WO (3) WO2018200583A1 (https=)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11613573B2 (en) * 2017-04-26 2023-03-28 Eureka Therapeutics, Inc. Chimeric antibody/T-cell receptor constructs and uses thereof

Families Citing this family (53)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
PL3298033T5 (pl) 2015-05-18 2023-10-30 TCR2 Therapeutics Inc. Kompozycje i zastosowania medyczne do reprogramowania TCR z zastosowaniem białek fuzyjnych
CA3032498A1 (en) 2016-08-02 2018-02-08 TCR2 Therapeutics Inc. Compositions and methods for tcr reprogramming using fusion proteins
WO2018067993A1 (en) 2016-10-07 2018-04-12 TCR2 Therapeutics Inc. Compositions and methods for t-cell receptors reprogramming using fusion proteins
JP7291396B2 (ja) 2016-11-22 2023-06-15 ティーシーアール2 セラピューティクス インク. 融合タンパク質を用いたtcrの再プログラミングのための組成物及び方法
EP3774919A4 (en) * 2018-03-30 2021-12-29 Eureka Therapeutics, Inc. Constructs targeting cd22 and uses thereof
US11993661B2 (en) 2018-06-18 2024-05-28 Eureka Therapeutics, Inc. Constructs targeting prostate-specific membrane antigen (PSMA) and uses thereof
BR112021001338A2 (pt) * 2018-07-26 2021-05-04 TCR2 Therapeutics Inc. composições e métodos para reprogramação de tcr usando proteínas de fusão específicas para o alvo
EP3670530A1 (en) * 2018-12-18 2020-06-24 Max-Delbrück-Centrum für Molekulare Medizin in der Helmholtz-Gemeinschaft Cd22-specific t cell receptors and adoptive t cell therapy for treatment of b cell malignancies
CN111100199B (zh) * 2018-12-29 2021-02-12 北京百普赛斯生物科技股份有限公司 一种荧光素标记的蛋白四聚体及其制备方法与应用
US20230192805A1 (en) * 2019-01-14 2023-06-22 Nanjing Legend Biotech Co., Ltd. Chimeric receptor polypeptides and uses thereof
WO2020156405A1 (en) * 2019-01-28 2020-08-06 Wuxi Biologics (Shanghai) Co. Ltd. Novel bispecific cd3/cd20 polypeptide complexes
CN113490689B (zh) * 2019-02-01 2024-06-04 恺兴生命科技(上海)有限公司 Tcr融合蛋白及表达tcr融合蛋白的细胞
BR112022001368A2 (pt) 2019-07-26 2022-05-24 Janssen Biotech Inc Proteínas que compreendem domínios de ligação ao antígeno de peptidase 2 relacionada à calicreína e seus usos
US12595311B2 (en) 2020-03-02 2026-04-07 The Regents Of The University Of California Chimeric antigen receptors and related methods and compositions for the treatment of cancer
CA3171906A1 (en) * 2020-03-16 2021-09-23 University Of Southern California Novel antigen binding domains and synthetic antigen receptors incorporating the same
WO2021189008A1 (en) 2020-03-20 2021-09-23 Lyell Immunopharma, Inc. Novel recombinant cell surface markers
EP4127188A4 (en) 2020-03-31 2024-08-21 Walking Fish Therapeutics MODIFIED B CELLS AND METHODS OF USE THEREOF
KR20230006821A (ko) * 2020-03-31 2023-01-11 워킹 피쉬 테라퓨틱스 변형 b 세포 및 이의 사용 방법
CN112830973B (zh) * 2020-04-08 2022-11-01 苏州克睿基因生物科技有限公司 嵌合多肽及其用途
CA3158133A1 (en) 2020-04-28 2021-11-04 Lyell Immunopharma, Inc. Methods for culturing cells
CN115776991A (zh) * 2020-05-07 2023-03-10 华夏英泰(北京)生物技术有限公司 改进的t细胞受体-共刺激分子嵌合物
US20240294598A1 (en) * 2020-05-25 2024-09-05 China Immunotech (Beijing) Biotechnology Co., Ltd Enhanced synthetic t-cell receptor and antigen receptor
EP4182338A1 (en) 2020-07-17 2023-05-24 Instil Bio (Uk) Limited Receptors providing targeted costimulation for adoptive cell therapy
CN116761815A (zh) * 2020-07-29 2023-09-15 优瑞科生物技术公司 T细胞和嵌合刺激受体及其应用
TW202239768A (zh) 2021-01-27 2022-10-16 美商萊爾免疫藥物股份有限公司 改良之免疫細胞療法
CN114957481A (zh) * 2021-02-25 2022-08-30 华夏英泰(北京)生物技术有限公司 针对cd19和cd22的双靶点star
US12144827B2 (en) 2021-02-25 2024-11-19 Lyell Immunopharma, Inc. ROR1 targeting chimeric antigen receptor
EP4298208A1 (en) 2021-02-25 2024-01-03 Lyell Immunopharma, Inc. Methods for culturing cells
EP4298230A1 (en) 2021-02-25 2024-01-03 Lyell Immunopharma, Inc. Codon-optimized nucleotide sequences encoding an ap-1 transcription factor
EP4347826A1 (en) 2021-06-02 2024-04-10 Lyell Immunopharma, Inc. Nr4a3-deficient immune cells and uses thereof
WO2022266192A1 (en) 2021-06-16 2022-12-22 Instil Bio, Inc. Receptors providing targeted costimulation for adoptive cell therapy
EP4370213A4 (en) 2021-07-16 2025-06-04 Instil Bio (Uk) Limited Chimeric molecules for targeted costimulation for adoptive cell therapy
CN117715929A (zh) * 2021-07-29 2024-03-15 南特细胞公司 用于预防和治疗病毒感染和癌症的经修饰的t细胞受体
EP4419544A1 (en) 2021-10-21 2024-08-28 Lyell Immunopharma, Inc. Enhanced immune cell therapy
IL312204A (en) 2021-10-28 2024-06-01 Lyell Immunopharma Inc Methods for culturing cells expressing ror1-binding protein
AU2022378579A1 (en) 2021-10-28 2024-05-02 Lyell Immunopharma, Inc. Methods of generating cells
IL312201A (en) 2021-10-28 2024-06-01 Lyell Immunopharma Inc Methods for culturing cells expressing c-jun
WO2023133540A1 (en) 2022-01-07 2023-07-13 Lyell Immunopharma, Inc. Il-12 affinity variants
CN114591443A (zh) * 2022-03-07 2022-06-07 皖南医学院第一附属医院(皖南医学院弋矶山医院) 一种基于scTv的嵌合受体CSR及其应用
US20250281538A1 (en) 2022-05-02 2025-09-11 The U.S.A., As Represented By The Secretary, Department Of Health And Human Services Compositions targeting gpc2 and gpc3 and their use for treating solid tumors
JP2025516823A (ja) 2022-05-19 2025-05-30 ライエル・イミュノファーマ・インコーポレイテッド Nr4a3を標的とするポリヌクレオチド及びその使用
TW202413646A (zh) 2022-07-22 2024-04-01 美商萊爾免疫藥物股份有限公司 免疫細胞療法
WO2024064952A1 (en) 2022-09-23 2024-03-28 Lyell Immunopharma, Inc. Methods for culturing nr4a-deficient cells overexpressing c-jun
WO2024064958A1 (en) 2022-09-23 2024-03-28 Lyell Immunopharma, Inc. Methods for culturing nr4a-deficient cells
WO2024077174A1 (en) 2022-10-05 2024-04-11 Lyell Immunopharma, Inc. Methods for culturing nr4a-deficient cells
WO2024102954A1 (en) 2022-11-10 2024-05-16 Massachusetts Institute Of Technology Activation induced clipping system (aics)
WO2024148369A1 (en) 2023-01-07 2024-07-11 Lyell Immunopharma, Inc. Targeted il-12 affinity variants
WO2024182539A1 (en) 2023-02-28 2024-09-06 Lyell Immunopharma, Inc. Methods of culturing reprogrammed cells
KR20260030127A (ko) 2023-06-27 2026-03-05 라이엘 이뮤노파마, 인크. Il-12 안정성 변이체
CN121909034A (zh) 2023-07-24 2026-04-21 斯特兰德生物科技公司 用于产生用于体外细胞疗法的工程化免疫细胞的基于rna的合成回路
EP4520346A1 (en) 2023-09-06 2025-03-12 Gyncentrum Sp. z o.o. Cells, methods and systems for use in the treatment of a cancer with dual-car-t
WO2025217398A1 (en) 2024-04-10 2025-10-16 Lyell Immunopharma, Inc. Methods for culturing cells with improved culture medium
WO2026006604A1 (en) 2024-06-26 2026-01-02 Lyell Immunopharma, Inc. Feeder cell replacement

Family Cites Families (149)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3753357A (en) 1970-12-14 1973-08-21 Ovitron Res Corp Method and apparatus for the preservation of cells and tissues
US4199022A (en) 1978-12-08 1980-04-22 The United States Of America As Represented By The Department Of Energy Method of freezing living cells and tissues with improved subsequent survival
US4559298A (en) 1982-11-23 1985-12-17 American National Red Cross Cryopreservation of biological materials in a non-frozen or vitreous state
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US5567610A (en) 1986-09-04 1996-10-22 Bioinvent International Ab Method of producing human monoclonal antibodies and kit therefor
IL86278A (en) 1988-05-04 2003-06-24 Yeda Res & Dev Endowing cells with antibody specificity using chimeric t cell receptor
GB8823869D0 (en) 1988-10-12 1988-11-16 Medical Res Council Production of antibodies
US6534055B1 (en) 1988-11-23 2003-03-18 Genetics Institute, Inc. Methods for selectively stimulating proliferation of T cells
US6352694B1 (en) 1994-06-03 2002-03-05 Genetics Institute, Inc. Methods for inducing a population of T cells to proliferate using agents which recognize TCR/CD3 and ligands which stimulate an accessory molecule on the surface of the T cells
US5858358A (en) 1992-04-07 1999-01-12 The United States Of America As Represented By The Secretary Of The Navy Methods for selectively stimulating proliferation of T cells
US6905680B2 (en) 1988-11-23 2005-06-14 Genetics Institute, Inc. Methods of treating HIV infected subjects
US5175384A (en) 1988-12-05 1992-12-29 Genpharm International Transgenic mice depleted in mature t-cells and methods for making transgenic mice
US5703055A (en) 1989-03-21 1997-12-30 Wisconsin Alumni Research Foundation Generation of antibodies through lipid mediated DNA delivery
US5399346A (en) 1989-06-14 1995-03-21 The United States Of America As Represented By The Department Of Health And Human Services Gene therapy
US5585362A (en) 1989-08-22 1996-12-17 The Regents Of The University Of Michigan Adenovirus vectors for gene therapy
US5229275A (en) 1990-04-26 1993-07-20 Akzo N.V. In-vitro method for producing antigen-specific human monoclonal antibodies
US5545806A (en) 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
US5661016A (en) 1990-08-29 1997-08-26 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
ATE158021T1 (de) 1990-08-29 1997-09-15 Genpharm Int Produktion und nützung nicht-menschliche transgentiere zur produktion heterologe antikörper
US5633425A (en) 1990-08-29 1997-05-27 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5625126A (en) 1990-08-29 1997-04-29 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
CA2095633C (en) 1990-12-03 2003-02-04 Lisa J. Garrard Enrichment method for variant proteins with altered binding properties
IL104570A0 (en) 1992-03-18 1993-05-13 Yeda Res & Dev Chimeric genes and cells transformed therewith
US5350674A (en) 1992-09-04 1994-09-27 Becton, Dickinson And Company Intrinsic factor - horse peroxidase conjugates and a method for increasing the stability thereof
GB9221657D0 (en) 1992-10-15 1992-11-25 Scotgen Ltd Recombinant bispecific antibodies
US5585358A (en) 1993-07-06 1996-12-17 Yissum Research Development Corporation Of The Hebrew University Of Jerusalem Derivatives of valproic acid amides and 2-valproenoic acid amides, method of making and use thereof as anticonvulsant agents
US7175843B2 (en) 1994-06-03 2007-02-13 Genetics Institute, Llc Methods for selectively stimulating proliferation of T cells
US6692964B1 (en) 1995-05-04 2004-02-17 The United States Of America As Represented By The Secretary Of The Navy Methods for transfecting T cells
US7067318B2 (en) 1995-06-07 2006-06-27 The Regents Of The University Of Michigan Methods for transfecting T cells
JPH11510375A (ja) 1995-06-30 1999-09-14 コベンハブンズ ユニバーサイテッド ペプチド−mhc複合体を指向するファージディスプレイライブラリーからの組換え抗体
DE19544393A1 (de) 1995-11-15 1997-05-22 Hoechst Schering Agrevo Gmbh Synergistische herbizide Mischungen
HK1047109A1 (zh) 1999-10-15 2003-02-07 University Of Massachusetts 作为指定基因干预工具的rna干预轨迹基因
US6326193B1 (en) 1999-11-05 2001-12-04 Cambria Biosciences, Llc Insect control agent
EP1240319A1 (en) 1999-12-15 2002-09-18 Genentech, Inc. Shotgun scanning, a combinatorial method for mapping functional protein epitopes
US6797514B2 (en) 2000-02-24 2004-09-28 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US7572631B2 (en) 2000-02-24 2009-08-11 Invitrogen Corporation Activation and expansion of T cells
US6867041B2 (en) 2000-02-24 2005-03-15 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
KR20030032922A (ko) 2000-02-24 2003-04-26 싸이트 테라피스 인코포레이티드 세포의 동시 자극 및 농축
JP2003531588A (ja) 2000-04-11 2003-10-28 ジェネンテック・インコーポレーテッド 多価抗体とその用途
AU2001275474A1 (en) 2000-06-12 2001-12-24 Akkadix Corporation Materials and methods for the control of nematodes
ATE338124T1 (de) 2000-11-07 2006-09-15 Hope City Cd19-spezifische umgezielte immunzellen
US7771951B2 (en) 2001-12-03 2010-08-10 Amgen Fremont Inc. Antibody categorization based on binding characteristics
US6992176B2 (en) 2002-02-13 2006-01-31 Technion Research & Development Foundation Ltd. Antibody having a T-cell receptor-like specificity, yet higher affinity, and the use of same in the detection and treatment of cancer, viral infection and autoimmune disease
US7446190B2 (en) 2002-05-28 2008-11-04 Sloan-Kettering Institute For Cancer Research Nucleic acids encoding chimeric T cell receptors
CA2488441C (en) 2002-06-03 2015-01-27 Genentech, Inc. Synthetic antibody phage libraries
WO2004065416A2 (en) 2003-01-16 2004-08-05 Genentech, Inc. Synthetic antibody phage libraries
DK1629011T3 (da) 2003-05-31 2010-05-03 Micromet Ag Humane anti-humane-DC3-bindingsmolekyler
US7785903B2 (en) 2004-04-09 2010-08-31 Genentech, Inc. Variable domain library and uses
AU2005247950B2 (en) 2004-05-27 2012-02-02 Receptor Logic, Inc. Antibodies as T cell receptor mimics, methods of production and uses thereof
AU2006232287B2 (en) 2005-03-31 2011-10-06 Chugai Seiyaku Kabushiki Kaisha Methods for producing polypeptides by regulating polypeptide association
CA2611814A1 (en) 2005-06-20 2007-01-04 Medarex, Inc. Cd19 antibodies and their uses
US7612181B2 (en) 2005-08-19 2009-11-03 Abbott Laboratories Dual variable domain immunoglobulin and uses thereof
EP1945246A4 (en) 2005-09-22 2009-03-11 Irun R Cohen IMMUNOGENIC FRAGMENTS OF CONSTANT DOMAINS OF THE T CELL RECEPTOR AND PEPTIDES DERIVED THEREFROM
ES2577292T3 (es) 2005-11-07 2016-07-14 Genentech, Inc. Polipéptidos de unión con secuencias hipervariables de VH/VL diversificadas y consenso
EP1973951A2 (en) 2005-12-02 2008-10-01 Genentech, Inc. Binding polypeptides with restricted diversity sequences
BRPI0710971A2 (pt) 2006-04-28 2011-05-31 Esbatech Ag anticorpos que se ligam ao domìnio extracelular do receptor tirosina cinase alk,seu uso, vetor de expressão,método para produção de um antcorpo, vacina e epìtodo de alk
CA2651174A1 (en) 2006-05-03 2007-11-15 Government Of The United States Of America, Represented By The Secretary , Department Of Health And Human Services Chimeric t cell receptors and related materials and methods of use
TW200812616A (en) 2006-05-09 2008-03-16 Genentech Inc Binding polypeptides with optimized scaffolds
CA2656583A1 (en) 2006-06-01 2007-12-13 Receptor Logic, Ltd. Antibodies as t cell receptor mimics, methods of production and uses thereof
RU2495882C2 (ru) 2006-09-08 2013-10-20 Медиммун, Ллк. Гуманизированные антитела к cd19 и их применение для лечения онкологического, связанного с трансплантацией и аутоиммунного заболевания
EP2155789B1 (en) 2007-05-01 2013-07-24 Research Development Foundation Immunoglobulin fc libraries
CL2008001334A1 (es) 2007-05-08 2008-09-22 Genentech Inc Anticuerpo anti-muc16 disenado con cisteina; conjugado que lo comprende; metodo de produccion; formulacion farmaceutica que lo comprende; y su uso para tratar el cancer.
CN100592373C (zh) 2007-05-25 2010-02-24 群康科技(深圳)有限公司 液晶显示面板驱动装置及其驱动方法
BRPI0914780B8 (pt) 2008-06-25 2022-07-05 Athenix Corp Molécula de ácido nucleico isolada, vetor, célula hospedeira, composição, e métodos para o controle de uma população de pragas, matar uma praga proteção de uma planta de uma praga e produção de um polipeptídeo com atividade pesticida
TWI580431B (zh) 2008-08-19 2017-05-01 腫瘤療法 科學股份有限公司 Hig2與urlc10抗原決定位胜肽以及含此胜肽之疫苗
PE20100362A1 (es) 2008-10-30 2010-05-27 Irm Llc Derivados de purina que expanden las celulas madre hematopoyeticas
US20110286916A1 (en) 2008-11-20 2011-11-24 Jose Miguel Aste-Amezaga Generation and characterization of anti-notch antibodies for therapeutic and diagnostic use
US20100153133A1 (en) 2008-12-16 2010-06-17 International Business Machines Corporation Generating Never-Event Cohorts from Patient Care Data
US20110311517A1 (en) 2009-02-10 2011-12-22 Shenogen Pharma Group, Ltd. Antibodies and methods for treating estrogen receptor-associated diseases
EP2258719A1 (en) 2009-05-19 2010-12-08 Max-Delbrück-Centrum für Molekulare Medizin (MDC) Multiple target T cell receptor
WO2011012720A2 (en) 2009-07-30 2011-02-03 Helmholtz-Zentrum für Infektionsforschung GmbH Compositions for generating an antigen specific immune response
CA2778533A1 (en) 2009-10-22 2011-04-28 Ricardo J. Moro Peptides that bind the alpha-fetoprotein (afp) receptor and uses thereof
US9273283B2 (en) 2009-10-29 2016-03-01 The Trustees Of Dartmouth College Method of producing T cell receptor-deficient T cells expressing a chimeric receptor
CA3255551A1 (en) 2010-03-26 2025-04-15 Memorial Sloan-Kettering Cancer Center MUC16 ANTIBODIES AND METHODS OF USE
WO2012050374A2 (en) 2010-10-13 2012-04-19 Innocell, Inc. Immunotherapy for solid tumors
MX2013011363A (es) 2011-04-01 2014-04-25 Sloan Kettering Inst Cancer Anticuerpos para peptidos citosolicos.
US10239952B2 (en) 2011-04-01 2019-03-26 Memorial Sloan Kettering Cancer Center Anti-WT1/HLA bi-specific antibody
US20130280220A1 (en) * 2012-04-20 2013-10-24 Nabil Ahmed Chimeric antigen receptor for bispecific activation and targeting of t lymphocytes
EP2843051B1 (en) 2012-04-23 2018-06-06 GeneFrontier Corporation Anti-human cd69 antibody, and use thereof for medical purposes
CN103319595B (zh) 2012-07-04 2016-12-28 中国药科大学 抗人afp单链抗体以及融合抗原肽的制备方法和应用
JP2015524255A (ja) 2012-07-13 2015-08-24 ザ トラスティーズ オブ ザ ユニバーシティ オブ ペンシルバニア 二重特異性抗体を共導入することによってcart細胞の活性を強化する方法
US20150183877A1 (en) 2012-07-18 2015-07-02 Eli Lilly And Company Multi-Specific IgG-(Fab)2 Constructs Containing T-Cell Receptor Constant Domains
MX367730B (es) * 2012-09-04 2019-09-04 Cellectis Receptor de antigeno quimerico multi-cadena y usos del mismo.
MX370148B (es) 2012-10-02 2019-12-03 Memorial Sloan Kettering Cancer Center Composiciones y su uso para inmunoterapia.
CN102993305B (zh) 2012-11-16 2015-05-13 上海赛伦生物技术有限公司 人源抗人表皮生长因子受体抗体及其编码基因与应用
HK1216153A1 (zh) 2012-12-13 2016-10-21 University Of Virginia Patent Foundation 用於卵巢癌治疗和诊断的靶向肽
CN103965362B (zh) 2013-02-06 2019-02-01 上海细胞治疗集团有限公司 一种可使t细胞趋向肿瘤部位的嵌合趋化因子受体
CN104968491A (zh) 2013-02-06 2015-10-07 旭硝子株式会社 透明面材以及使用该透明面材的显示装置
CN113684185A (zh) 2013-02-26 2021-11-23 纪念斯隆-凯特琳癌症中心 用于免疫疗法的组合物和方法
DK2970371T3 (da) 2013-03-14 2019-09-30 Agrivida Inc Anvendelse af dimeriseringsdomæner til temperaturregulering af enzymaktivitet
US9657105B2 (en) 2013-03-15 2017-05-23 City Of Hope CD123-specific chimeric antigen receptor redirected T cells and methods of their use
US9937207B2 (en) 2013-03-21 2018-04-10 Sangamo Therapeutics, Inc. Targeted disruption of T cell receptor genes using talens
KR101536668B1 (ko) 2013-06-18 2015-07-15 사회복지법인 삼성생명공익재단 인간 및 마우스 c-Met에 교차결합하는 항체 및 그의 용도
GB201313377D0 (en) 2013-07-26 2013-09-11 Adaptimmune Ltd T cell receptors
EP3925618A1 (en) * 2013-07-29 2021-12-22 2seventy bio, Inc. Multipartite signaling proteins and uses thereof
WO2015063069A1 (en) 2013-10-28 2015-05-07 Benjamin Felder Chimeric antigen receptors with antigen binding domains derived from gamma delta t cell receptors
EP3066131A1 (en) 2013-11-07 2016-09-14 Memorial Sloan-Kettering Cancer Center Fc-enhanced anti-wt1/hla antibody
EP3066130B1 (en) 2013-11-07 2019-05-15 Memorial Sloan-Kettering Cancer Center Anti-wt1/hla bi-specific antibody
WO2015128509A1 (en) * 2014-02-28 2015-09-03 Glenmark Pharmaceuticals S.A. Expression constructs and methods for selecting host cells expressing polypeptides
CN104087592B (zh) 2014-05-13 2016-01-27 天津医科大学总医院 Afp158-166特异性tcr基因及其转基因t细胞及体外增殖方法及用途
LT3194434T (lt) 2014-09-15 2019-09-25 Molmed Spa Chimeriniai antigeno receptoriai
WO2016071343A1 (en) * 2014-11-03 2016-05-12 Immures S.R.L. T cell receptors
MY191537A (en) 2014-12-05 2022-06-30 Memorial Sloan Kettering Cancer Center Chimeric antigen receptors targeting b-cell maturation antigen and uses thereof
AU2015357543B2 (en) 2014-12-05 2021-10-21 Eureka Therapeutics, Inc. Chimeric antigen receptors targeting Fc Receptor-like 5 and uses thereof
CN118271463A (zh) 2014-12-05 2024-07-02 纪念斯隆-凯特琳癌症中心 靶向g-蛋白偶联受体的嵌合抗原受体及其用途
SI3226897T1 (sl) 2014-12-05 2021-08-31 Memorial Sloan Kettering Cancer Center Protitelesa, ki ciljajo na B-celični maturacijski antigen, in postopki uporabe
BR112017011932A8 (pt) 2014-12-05 2022-11-08 Memorial Sloan Kettering Cancer Center Anticorpos direcionados a receptor acoplado a proteína g e métodos de uso
US11673957B2 (en) 2015-03-10 2023-06-13 Eureka Therapeutics, Inc. Anti-ROR2 antibodies
SG11201707538XA (en) 2015-03-17 2017-10-30 Memorial Sloan Kettering Cancer Center Anti-muc16 antibodies and uses thereof
US10738116B2 (en) * 2015-03-19 2020-08-11 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Dual specific anti-CD22-anti-CD19 chimeric antigen receptors
WO2016154047A2 (en) 2015-03-20 2016-09-29 Memorial Sloan-Kettering Cancer Center Monoclonal antigen-binding proteins to intracellular oncogene products
WO2016161390A1 (en) 2015-04-03 2016-10-06 Eureka Therapeutics, Inc. Constructs targeting afp peptide/mhc complexes and uses thereof
CA2988397A1 (en) 2015-05-08 2016-11-17 Eureka Therapeutics, Inc. Constructs targeting hpv16-e7 peptide/mhc complexes and uses thereof
WO2016187216A1 (en) 2015-05-18 2016-11-24 Bluebird Bio, Inc. Anti-ror1 chimeric antigen receptors
PL3298033T5 (pl) 2015-05-18 2023-10-30 TCR2 Therapeutics Inc. Kompozycje i zastosowania medyczne do reprogramowania TCR z zastosowaniem białek fuzyjnych
WO2016187220A2 (en) 2015-05-18 2016-11-24 Five Prime Therapeutics, Inc. Anti-ror1 antibodies
TW201702272A (zh) 2015-05-22 2017-01-16 美國紀念斯隆 凱特琳癌症中心 Prame肽專一性類t細胞受體抗體
NL2014935B1 (en) 2015-06-08 2017-02-03 Applied Immune Tech Ltd T cell receptor like antibodies having fine specificity.
AU2016274767B2 (en) 2015-06-09 2022-05-19 Eureka Therapeutics, Inc. T cell receptor-like antibody agents specific for EBV latent membrane protein 2A peptide presented by human HLA
CN117387731A (zh) 2015-06-12 2024-01-12 美蓓亚三美株式会社 载荷检测器和载荷检测系统
KR20180019725A (ko) 2015-06-23 2018-02-26 메모리얼 슬로안-케터링 캔서 센터 신규의 피디 1 면역 조절제
HK1248255A1 (zh) 2015-06-24 2018-10-12 优瑞科生物技术公司 靶向ny-eso-1肽/mhc复合物的构建体及其用途
US11059880B2 (en) 2015-06-30 2021-07-13 Arizona Board Of Regents On Behalf Of The University Of Arizona Redirected cells with MHC chimeric receptors and methods of use in immunotherapy
TW201708260A (zh) 2015-07-22 2017-03-01 優瑞卡醫療公司 靶向psa胜肽/mhc複合體之構築體及其用途
US11667691B2 (en) * 2015-08-07 2023-06-06 Novartis Ag Treatment of cancer using chimeric CD3 receptor proteins
CN105384825B (zh) * 2015-08-11 2018-06-01 南京传奇生物科技有限公司 一种基于单域抗体的双特异性嵌合抗原受体及其应用
US10562952B2 (en) 2015-09-10 2020-02-18 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Anti-CD276 chimeric antigen receptors
AU2016323985B2 (en) 2015-09-17 2022-12-15 Novartis Ag CAR T cell therapies with enhanced efficacy
MY196631A (en) 2015-10-13 2023-04-24 Eureka Therapeutics Inc Antibody Agents Specific for Human Cd19 and uses Thereof
MX2018004721A (es) 2015-10-23 2018-07-06 Eureka Therapeutics Inc Construcciones quimericas anticuerpo/receptor de celulas t y usos de las mismas.
CN105331585A (zh) 2015-11-13 2016-02-17 科济生物医药(上海)有限公司 携带pd-l1阻断剂的嵌合抗原受体修饰的免疫效应细胞
BR112018011336A2 (pt) 2015-12-04 2018-12-04 Memorial Sloan-Kettering Cancer Center anticorpo anti-fcrl5 isolado ou um fragmento de ligação ao antígeno do mesmo, anticorpo scfv anti-fcrl5 isolado, anticorpo isolado ou porção de ligação ao antígeno do mesmo, composição, imunoconjugado, molécula biespecífica, ácido nucleico isolado, vetor de expressão, célula hospedeira, método para detectar fcrl5 em uma célula ou tecido inteiro, método para tratar câncer em um indivíduo, uso do anticorpo ou fragmento de ligação ao antígeno do mesmo, kit para tratar câncer
IL299616A (en) * 2016-01-08 2023-03-01 Univ California Conditionally active heterodimeric polypeptides and methods of using them
CN109069627A (zh) 2016-01-14 2018-12-21 纪念斯隆-凯特琳癌症中心 对foxp3衍生肽特异性的t细胞受体样抗体
CA3032498A1 (en) 2016-08-02 2018-02-08 TCR2 Therapeutics Inc. Compositions and methods for tcr reprogramming using fusion proteins
WO2018057967A2 (en) 2016-09-23 2018-03-29 Eureka Therapeutics, Inc. Constructs targeting hiv peptide/mhc complexes and uses thereof
WO2018067993A1 (en) 2016-10-07 2018-04-12 TCR2 Therapeutics Inc. Compositions and methods for t-cell receptors reprogramming using fusion proteins
JP7291396B2 (ja) 2016-11-22 2023-06-15 ティーシーアール2 セラピューティクス インク. 融合タンパク質を用いたtcrの再プログラミングのための組成物及び方法
JP2020513754A (ja) 2016-12-21 2020-05-21 ティーシーアール2 セラピューティクス インク. がん治療用に操作されたt細胞
US20190359678A1 (en) 2017-02-09 2019-11-28 The Regents Of The University Of California Chimeric t cell antigen receptors and methods of use thereof
EP3615574A4 (en) 2017-04-26 2021-02-24 Eureka Therapeutics, Inc. SPECIFIC GLYPICAN 3 RECOGNIZING CONSTRUCTS AND THEIR USE
JP7538601B2 (ja) * 2017-04-26 2024-08-22 ユーリカ セラピューティックス, インコーポレイテッド キメラ活性化受容体及びキメラ刺激受容体を発現する細胞並びにその使用
WO2018232020A1 (en) 2017-06-13 2018-12-20 TCR2 Therapeutics Inc. Compositions and methods for tcr reprogramming using fusion proteins
EP3774919A4 (en) 2018-03-30 2021-12-29 Eureka Therapeutics, Inc. Constructs targeting cd22 and uses thereof
US11993661B2 (en) 2018-06-18 2024-05-28 Eureka Therapeutics, Inc. Constructs targeting prostate-specific membrane antigen (PSMA) and uses thereof
CN113366022B (zh) 2018-11-16 2025-11-21 纪念斯隆凯特琳癌症中心 针对粘蛋白-16的抗体及其使用方法
EP3966248A4 (en) 2019-05-08 2023-04-12 Memorial Sloan Kettering Cancer Center HUMAN ANTIBODIES TO FEL MUCIN-16 AND THEIR METHODS OF USE
MX2022000852A (es) 2019-07-24 2022-02-10 Eureka Therapeutics Inc Celulas que expresan receptores de antigenos quimericos y receptores estimulantes quimericos y usos de los mismos.
CN116761815A (zh) 2020-07-29 2023-09-15 优瑞科生物技术公司 T细胞和嵌合刺激受体及其应用

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11613573B2 (en) * 2017-04-26 2023-03-28 Eureka Therapeutics, Inc. Chimeric antibody/T-cell receptor constructs and uses thereof
US11965021B2 (en) 2017-04-26 2024-04-23 Eureka Therapeutics, Inc. Cells expressing chimeric activating receptors and chimeric stimulating receptors and uses thereof

Also Published As

Publication number Publication date
TW201900676A (zh) 2019-01-01
CA3059755A1 (en) 2018-11-01
WO2018200582A1 (en) 2018-11-01
AU2018258046A1 (en) 2019-12-12
IL270136B2 (en) 2024-06-01
IL270136B1 (en) 2024-02-01
IL270161B1 (en) 2025-08-01
KR102762834B1 (ko) 2025-02-07
US20240317855A1 (en) 2024-09-26
SG10201913579WA (en) 2020-02-27
US11965021B2 (en) 2024-04-23
AU2024200970A1 (en) 2024-03-07
AU2018258046B2 (en) 2025-03-20
US20200115448A1 (en) 2020-04-16
TWI882944B (zh) 2025-05-11
EP3615046A4 (en) 2021-03-03
IL270136A (https=) 2019-12-31
US20210101954A1 (en) 2021-04-08
SG10201913655UA (en) 2020-03-30
RU2019137948A3 (https=) 2021-08-26
EP3615046A1 (en) 2020-03-04
AU2018258046C1 (en) 2025-11-06
CA3059753A1 (en) 2018-11-01
SG11201909571SA (en) 2019-11-28
JP2024038039A (ja) 2024-03-19
KR20200012859A (ko) 2020-02-05
SG10201913656TA (en) 2020-03-30
TWI874297B (zh) 2025-03-01
TW201902936A (zh) 2019-01-16
IL270161B2 (en) 2025-12-01
AU2018258045B2 (en) 2024-02-29
US11613573B2 (en) 2023-03-28
JP2020517287A (ja) 2020-06-18
IL310182A (en) 2024-03-01
JP7538601B2 (ja) 2024-08-22
AU2018258045A1 (en) 2019-12-12
RU2019137948A (ru) 2021-05-26
TW202521690A (zh) 2025-06-01
KR102729668B1 (ko) 2024-11-12
EP3615567A4 (en) 2021-06-23
CN110741016A (zh) 2020-01-31
US10822413B2 (en) 2020-11-03
US20210107976A1 (en) 2021-04-15
KR20250022233A (ko) 2025-02-14
WO2018200583A1 (en) 2018-11-01
KR20200014294A (ko) 2020-02-10
SG11201909541WA (en) 2019-11-28
MX2024007576A (es) 2024-07-04
PH12019502411A1 (en) 2020-09-21
EP3615567A1 (en) 2020-03-04
IL321897A (en) 2025-09-01
TW201902937A (zh) 2019-01-16
JP2020517295A (ja) 2020-06-18
JP2023093472A (ja) 2023-07-04
CN110662547A (zh) 2020-01-07
WO2018200585A1 (en) 2018-11-01
IL270161A (https=) 2019-12-31

Similar Documents

Publication Publication Date Title
US20240317855A1 (en) Cells expressing chimeric activating receptors and chimeric stimulating receptors and uses thereof
US20250361286A1 (en) Antibody/t-cell receptor chimeric constructs and uses thereof
RU2780020C2 (ru) Клетки, экспрессирующие химерные активирующие рецепторы и химерные стимулирующие рецепторы, и их применение

Legal Events

Date Code Title Description
AS Assignment

Owner name: EUREKA THERAPEUTICS, INC., CALIFORNIA

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:STALEY, BINNAZ K.;XIE, FEI;XU, YIYANG;AND OTHERS;SIGNING DATES FROM 20190513 TO 20190603;REEL/FRAME:051357/0415

STPP Information on status: patent application and granting procedure in general

Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STCB Information on status: application discontinuation

Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION