US20180133327A1 - Cell Penetrating Peptides and Complexes Comprising the Same - Google Patents
Cell Penetrating Peptides and Complexes Comprising the Same Download PDFInfo
- Publication number
- US20180133327A1 US20180133327A1 US15/557,653 US201515557653A US2018133327A1 US 20180133327 A1 US20180133327 A1 US 20180133327A1 US 201515557653 A US201515557653 A US 201515557653A US 2018133327 A1 US2018133327 A1 US 2018133327A1
- Authority
- US
- United States
- Prior art keywords
- present
- cell
- antigen
- peptide
- complex
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 108010051109 Cell-Penetrating Peptides Proteins 0.000 title claims abstract description 197
- 102000020313 Cell-Penetrating Peptides Human genes 0.000 title claims abstract description 196
- 239000000427 antigen Substances 0.000 claims abstract description 214
- 108091007433 antigens Proteins 0.000 claims abstract description 213
- 102000036639 antigens Human genes 0.000 claims abstract description 213
- 230000000890 antigenic effect Effects 0.000 claims abstract description 161
- 206010028980 Neoplasm Diseases 0.000 claims abstract description 138
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims abstract description 111
- 239000008194 pharmaceutical composition Substances 0.000 claims abstract description 88
- 201000010099 disease Diseases 0.000 claims abstract description 72
- 201000011510 cancer Diseases 0.000 claims abstract description 62
- 208000035475 disorder Diseases 0.000 claims abstract description 39
- 208000035473 Communicable disease Diseases 0.000 claims abstract description 25
- 208000014951 hematologic disease Diseases 0.000 claims abstract description 15
- 206010052779 Transplant rejections Diseases 0.000 claims abstract description 13
- 230000005784 autoimmunity Effects 0.000 claims abstract description 11
- 210000004027 cell Anatomy 0.000 claims description 205
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 177
- 102000002689 Toll-like receptor Human genes 0.000 claims description 140
- 108020000411 Toll-like receptor Proteins 0.000 claims description 140
- 150000001413 amino acids Chemical class 0.000 claims description 114
- 229940122985 Peptide agonist Drugs 0.000 claims description 97
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 87
- 108090000623 proteins and genes Proteins 0.000 claims description 87
- 102000004169 proteins and genes Human genes 0.000 claims description 85
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 82
- 238000000034 method Methods 0.000 claims description 80
- 210000000612 antigen-presenting cell Anatomy 0.000 claims description 59
- 229920001184 polypeptide Polymers 0.000 claims description 54
- 150000007523 nucleic acids Chemical class 0.000 claims description 49
- 239000013598 vector Substances 0.000 claims description 49
- 102000039446 nucleic acids Human genes 0.000 claims description 47
- 108020004707 nucleic acids Proteins 0.000 claims description 47
- 125000006850 spacer group Chemical group 0.000 claims description 46
- 210000004443 dendritic cell Anatomy 0.000 claims description 41
- 102100024333 Toll-like receptor 2 Human genes 0.000 claims description 26
- 101000831567 Homo sapiens Toll-like receptor 2 Proteins 0.000 claims description 25
- 101000669447 Homo sapiens Toll-like receptor 4 Proteins 0.000 claims description 24
- 102100039360 Toll-like receptor 4 Human genes 0.000 claims description 24
- 244000052769 pathogen Species 0.000 claims description 19
- 230000001717 pathogenic effect Effects 0.000 claims description 16
- 239000003937 drug carrier Substances 0.000 claims description 15
- 108090001030 Lipoproteins Proteins 0.000 claims description 14
- 102000004895 Lipoproteins Human genes 0.000 claims description 14
- 238000003384 imaging method Methods 0.000 claims description 13
- 150000002632 lipids Chemical class 0.000 claims description 11
- 208000003174 Brain Neoplasms Diseases 0.000 claims description 10
- 229930186217 Glycolipid Natural products 0.000 claims description 10
- 208000005017 glioblastoma Diseases 0.000 claims description 10
- 230000000149 penetrating effect Effects 0.000 claims description 10
- 229920001282 polysaccharide Polymers 0.000 claims description 10
- 239000005017 polysaccharide Substances 0.000 claims description 10
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 claims description 9
- 210000004899 c-terminal region Anatomy 0.000 claims description 9
- 101000669460 Homo sapiens Toll-like receptor 5 Proteins 0.000 claims description 8
- 102100039357 Toll-like receptor 5 Human genes 0.000 claims description 8
- 229940126586 small molecule drug Drugs 0.000 claims description 6
- 239000003053 toxin Substances 0.000 claims description 6
- 231100000765 toxin Toxicity 0.000 claims description 6
- 108700012359 toxins Proteins 0.000 claims description 6
- HVCOBJNICQPDBP-UHFFFAOYSA-N 3-[3-[3,5-dihydroxy-6-methyl-4-(3,4,5-trihydroxy-6-methyloxan-2-yl)oxyoxan-2-yl]oxydecanoyloxy]decanoic acid;hydrate Chemical compound O.OC1C(OC(CC(=O)OC(CCCCCCC)CC(O)=O)CCCCCCC)OC(C)C(O)C1OC1C(O)C(O)C(O)C(C)O1 HVCOBJNICQPDBP-UHFFFAOYSA-N 0.000 claims description 5
- 239000012216 imaging agent Substances 0.000 claims description 4
- 125000003607 serino group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(O[H])([H])[H] 0.000 claims description 4
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 claims description 3
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 claims description 3
- 239000002872 contrast media Substances 0.000 claims description 3
- 230000003394 haemopoietic effect Effects 0.000 claims description 3
- 150000004676 glycans Chemical class 0.000 claims 1
- 239000000203 mixture Substances 0.000 abstract description 91
- 229960005486 vaccine Drugs 0.000 abstract description 73
- 241000283070 Equus zebra Species 0.000 abstract description 44
- 238000011282 treatment Methods 0.000 abstract description 33
- 230000002265 prevention Effects 0.000 abstract description 18
- 235000001014 amino acid Nutrition 0.000 description 118
- 229940024606 amino acid Drugs 0.000 description 115
- 235000018102 proteins Nutrition 0.000 description 83
- -1 Met Chemical compound 0.000 description 52
- 239000000556 agonist Substances 0.000 description 48
- 210000001744 T-lymphocyte Anatomy 0.000 description 45
- 125000005647 linker group Chemical group 0.000 description 35
- 241000282414 Homo sapiens Species 0.000 description 29
- 241000700605 Viruses Species 0.000 description 27
- 239000003431 cross linking reagent Substances 0.000 description 25
- 108091054437 MHC class I family Proteins 0.000 description 24
- 230000028993 immune response Effects 0.000 description 24
- 150000001875 compounds Chemical class 0.000 description 22
- 239000002158 endotoxin Substances 0.000 description 22
- 229920006008 lipopolysaccharide Polymers 0.000 description 22
- 241000699670 Mus sp. Species 0.000 description 21
- 238000002347 injection Methods 0.000 description 21
- 239000007924 injection Substances 0.000 description 21
- 239000000126 substance Substances 0.000 description 21
- 238000002255 vaccination Methods 0.000 description 21
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 20
- 108091054438 MHC class II family Proteins 0.000 description 20
- 239000012634 fragment Substances 0.000 description 20
- 238000002360 preparation method Methods 0.000 description 20
- 102000043129 MHC class I family Human genes 0.000 description 18
- 108700018351 Major Histocompatibility Complex Proteins 0.000 description 17
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 17
- 238000006467 substitution reaction Methods 0.000 description 17
- 230000020382 suppression by virus of host antigen processing and presentation of peptide antigen via MHC class I Effects 0.000 description 17
- 238000010361 transduction Methods 0.000 description 17
- 230000026683 transduction Effects 0.000 description 17
- 238000000338 in vitro Methods 0.000 description 16
- 239000003446 ligand Substances 0.000 description 16
- 239000007788 liquid Substances 0.000 description 16
- 230000035772 mutation Effects 0.000 description 16
- 102000043131 MHC class II family Human genes 0.000 description 15
- 230000001580 bacterial effect Effects 0.000 description 15
- 239000003814 drug Substances 0.000 description 15
- 238000007920 subcutaneous administration Methods 0.000 description 15
- 239000000872 buffer Substances 0.000 description 14
- 238000001727 in vivo Methods 0.000 description 14
- 230000004048 modification Effects 0.000 description 14
- 238000012986 modification Methods 0.000 description 14
- 108091008874 T cell receptors Proteins 0.000 description 13
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 13
- 210000000170 cell membrane Anatomy 0.000 description 13
- 238000009169 immunotherapy Methods 0.000 description 13
- 239000003795 chemical substances by application Substances 0.000 description 12
- 230000000694 effects Effects 0.000 description 12
- 210000004379 membrane Anatomy 0.000 description 12
- 239000012528 membrane Substances 0.000 description 12
- 230000004044 response Effects 0.000 description 12
- 230000032258 transport Effects 0.000 description 12
- JVJGCCBAOOWGEO-RUTPOYCXSA-N (2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-4-amino-2-[[(2s,3s)-2-[[(2s,3s)-2-[[(2s)-2-azaniumyl-3-hydroxypropanoyl]amino]-3-methylpentanoyl]amino]-3-methylpentanoyl]amino]-4-oxobutanoyl]amino]-3-phenylpropanoyl]amino]-4-carboxylatobutanoyl]amino]-6-azaniumy Chemical compound OC[C@H](N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(O)=O)CC1=CC=CC=C1 JVJGCCBAOOWGEO-RUTPOYCXSA-N 0.000 description 11
- 206010018338 Glioma Diseases 0.000 description 11
- 108010028921 Lipopeptides Proteins 0.000 description 11
- 239000002671 adjuvant Substances 0.000 description 11
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 11
- 208000015181 infectious disease Diseases 0.000 description 11
- 125000003729 nucleotide group Chemical group 0.000 description 11
- 239000000243 solution Substances 0.000 description 11
- 238000010254 subcutaneous injection Methods 0.000 description 11
- 239000004971 Cross linker Substances 0.000 description 10
- WCUXLLCKKVVCTQ-UHFFFAOYSA-M Potassium chloride Chemical compound [Cl-].[K+] WCUXLLCKKVVCTQ-UHFFFAOYSA-M 0.000 description 10
- 229940035032 monophosphoryl lipid a Drugs 0.000 description 10
- 239000002773 nucleotide Substances 0.000 description 10
- 108020004414 DNA Proteins 0.000 description 9
- 108010040721 Flagellin Proteins 0.000 description 9
- 208000032612 Glial tumor Diseases 0.000 description 9
- 201000003176 Severe Acute Respiratory Syndrome Diseases 0.000 description 9
- 230000000875 corresponding effect Effects 0.000 description 9
- 238000009472 formulation Methods 0.000 description 9
- 108020001507 fusion proteins Proteins 0.000 description 9
- 108700002563 poly ICLC Proteins 0.000 description 9
- 150000004804 polysaccharides Chemical class 0.000 description 9
- 230000003612 virological effect Effects 0.000 description 9
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 9
- 102000004127 Cytokines Human genes 0.000 description 8
- 108090000695 Cytokines Proteins 0.000 description 8
- 206010012735 Diarrhoea Diseases 0.000 description 8
- 102000008949 Histocompatibility Antigens Class I Human genes 0.000 description 8
- 101000763579 Homo sapiens Toll-like receptor 1 Proteins 0.000 description 8
- 102100027010 Toll-like receptor 1 Human genes 0.000 description 8
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 8
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 8
- 238000004132 cross linking Methods 0.000 description 8
- 230000003993 interaction Effects 0.000 description 8
- 238000010647 peptide synthesis reaction Methods 0.000 description 8
- 239000011780 sodium chloride Substances 0.000 description 8
- 210000004989 spleen cell Anatomy 0.000 description 8
- 210000001519 tissue Anatomy 0.000 description 8
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 7
- 208000030507 AIDS Diseases 0.000 description 7
- 241000894006 Bacteria Species 0.000 description 7
- 102000018713 Histocompatibility Antigens Class II Human genes 0.000 description 7
- 108091028043 Nucleic acid sequence Proteins 0.000 description 7
- 206010035664 Pneumonia Diseases 0.000 description 7
- 241000725643 Respiratory syncytial virus Species 0.000 description 7
- 239000000969 carrier Substances 0.000 description 7
- 230000008878 coupling Effects 0.000 description 7
- 238000010168 coupling process Methods 0.000 description 7
- 238000005859 coupling reaction Methods 0.000 description 7
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 7
- 210000003743 erythrocyte Anatomy 0.000 description 7
- 238000002474 experimental method Methods 0.000 description 7
- 208000001031 fetal erythroblastosis Diseases 0.000 description 7
- 102000037865 fusion proteins Human genes 0.000 description 7
- 239000001963 growth medium Substances 0.000 description 7
- UYTPUPDQBNUYGX-UHFFFAOYSA-N guanine Chemical compound O=C1NC(N)=NC2=C1N=CN2 UYTPUPDQBNUYGX-UHFFFAOYSA-N 0.000 description 7
- 238000007918 intramuscular administration Methods 0.000 description 7
- 239000000463 material Substances 0.000 description 7
- 201000001441 melanoma Diseases 0.000 description 7
- 238000011321 prophylaxis Methods 0.000 description 7
- 239000007787 solid Substances 0.000 description 7
- 239000000725 suspension Substances 0.000 description 7
- 208000024891 symptom Diseases 0.000 description 7
- 239000003826 tablet Substances 0.000 description 7
- 230000001225 therapeutic effect Effects 0.000 description 7
- JWDFQMWEFLOOED-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 3-(pyridin-2-yldisulfanyl)propanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCSSC1=CC=CC=N1 JWDFQMWEFLOOED-UHFFFAOYSA-N 0.000 description 6
- 206010059313 Anogenital warts Diseases 0.000 description 6
- 238000011740 C57BL/6 mouse Methods 0.000 description 6
- 206010008342 Cervix carcinoma Diseases 0.000 description 6
- 229940046168 CpG oligodeoxynucleotide Drugs 0.000 description 6
- 238000011510 Elispot assay Methods 0.000 description 6
- 108010067306 Fibronectins Proteins 0.000 description 6
- 102000016359 Fibronectins Human genes 0.000 description 6
- 241000233866 Fungi Species 0.000 description 6
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 6
- 208000007514 Herpes zoster Diseases 0.000 description 6
- 241000701806 Human papillomavirus Species 0.000 description 6
- 102100037850 Interferon gamma Human genes 0.000 description 6
- 108010074328 Interferon-gamma Proteins 0.000 description 6
- 241001465754 Metazoa Species 0.000 description 6
- 125000000539 amino acid group Chemical group 0.000 description 6
- 230000027455 binding Effects 0.000 description 6
- 230000015572 biosynthetic process Effects 0.000 description 6
- 210000004369 blood Anatomy 0.000 description 6
- 239000008280 blood Substances 0.000 description 6
- 239000002775 capsule Substances 0.000 description 6
- 230000004700 cellular uptake Effects 0.000 description 6
- 239000003153 chemical reaction reagent Substances 0.000 description 6
- OPTASPLRGRRNAP-UHFFFAOYSA-N cytosine Chemical compound NC=1C=CNC(=O)N=1 OPTASPLRGRRNAP-UHFFFAOYSA-N 0.000 description 6
- 238000003745 diagnosis Methods 0.000 description 6
- 239000003085 diluting agent Substances 0.000 description 6
- 206010014599 encephalitis Diseases 0.000 description 6
- 239000013604 expression vector Substances 0.000 description 6
- 230000006870 function Effects 0.000 description 6
- 206010017758 gastric cancer Diseases 0.000 description 6
- 201000007270 liver cancer Diseases 0.000 description 6
- 208000014018 liver neoplasm Diseases 0.000 description 6
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 6
- 201000004792 malaria Diseases 0.000 description 6
- DAZSWUUAFHBCGE-KRWDZBQOSA-N n-[(2s)-3-methyl-1-oxo-1-pyrrolidin-1-ylbutan-2-yl]-3-phenylpropanamide Chemical compound N([C@@H](C(C)C)C(=O)N1CCCC1)C(=O)CCC1=CC=CC=C1 DAZSWUUAFHBCGE-KRWDZBQOSA-N 0.000 description 6
- 244000045947 parasite Species 0.000 description 6
- 230000004083 survival effect Effects 0.000 description 6
- 238000012360 testing method Methods 0.000 description 6
- 238000001890 transfection Methods 0.000 description 6
- 230000014616 translation Effects 0.000 description 6
- 230000005945 translocation Effects 0.000 description 6
- 230000004614 tumor growth Effects 0.000 description 6
- 239000003981 vehicle Substances 0.000 description 6
- MZOFCQQQCNRIBI-VMXHOPILSA-N (3s)-4-[[(2s)-1-[[(2s)-1-[[(1s)-1-carboxy-2-hydroxyethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-3-[[2-[[(2s)-2,6-diaminohexanoyl]amino]acetyl]amino]-4-oxobutanoic acid Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@@H](N)CCCCN MZOFCQQQCNRIBI-VMXHOPILSA-N 0.000 description 5
- AASYSXRGODIQGY-UHFFFAOYSA-N 1-[1-(2,5-dioxopyrrol-1-yl)hexyl]pyrrole-2,5-dione Chemical group O=C1C=CC(=O)N1C(CCCCC)N1C(=O)C=CC1=O AASYSXRGODIQGY-UHFFFAOYSA-N 0.000 description 5
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 5
- 208000014697 Acute lymphocytic leukaemia Diseases 0.000 description 5
- 208000031261 Acute myeloid leukaemia Diseases 0.000 description 5
- 208000023275 Autoimmune disease Diseases 0.000 description 5
- 201000009030 Carcinoma Diseases 0.000 description 5
- 241000242722 Cestoda Species 0.000 description 5
- 241000701022 Cytomegalovirus Species 0.000 description 5
- 201000010915 Glioblastoma multiforme Diseases 0.000 description 5
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 5
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 description 5
- 241000590002 Helicobacter pylori Species 0.000 description 5
- 208000035186 Hemolytic Autoimmune Anemia Diseases 0.000 description 5
- 101000831496 Homo sapiens Toll-like receptor 3 Proteins 0.000 description 5
- 241000725303 Human immunodeficiency virus Species 0.000 description 5
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 5
- 206010025323 Lymphomas Diseases 0.000 description 5
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 5
- 241000699666 Mus <mouse, genus> Species 0.000 description 5
- 241000699660 Mus musculus Species 0.000 description 5
- NQTADLQHYWFPDB-UHFFFAOYSA-N N-Hydroxysuccinimide Chemical compound ON1C(=O)CCC1=O NQTADLQHYWFPDB-UHFFFAOYSA-N 0.000 description 5
- 208000005718 Stomach Neoplasms Diseases 0.000 description 5
- 208000031981 Thrombocytopenic Idiopathic Purpura Diseases 0.000 description 5
- 102100024324 Toll-like receptor 3 Human genes 0.000 description 5
- 108091023040 Transcription factor Proteins 0.000 description 5
- 102000040945 Transcription factor Human genes 0.000 description 5
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 5
- 241000700647 Variola virus Species 0.000 description 5
- 230000003213 activating effect Effects 0.000 description 5
- 201000003710 autoimmune thrombocytopenic purpura Diseases 0.000 description 5
- JGPOSNWWINVNFV-UHFFFAOYSA-N carboxyfluorescein diacetate succinimidyl ester Chemical compound C=1C(OC(=O)C)=CC=C2C=1OC1=CC(OC(C)=O)=CC=C1C2(C1=C2)OC(=O)C1=CC=C2C(=O)ON1C(=O)CCC1=O JGPOSNWWINVNFV-UHFFFAOYSA-N 0.000 description 5
- 230000001413 cellular effect Effects 0.000 description 5
- 201000010881 cervical cancer Diseases 0.000 description 5
- 230000021615 conjugation Effects 0.000 description 5
- 235000018417 cysteine Nutrition 0.000 description 5
- 239000002552 dosage form Substances 0.000 description 5
- 229940079593 drug Drugs 0.000 description 5
- 239000003995 emulsifying agent Substances 0.000 description 5
- 238000003114 enzyme-linked immunosorbent spot assay Methods 0.000 description 5
- 239000000945 filler Substances 0.000 description 5
- 229940037467 helicobacter pylori Drugs 0.000 description 5
- 208000007475 hemolytic anemia Diseases 0.000 description 5
- 230000006698 induction Effects 0.000 description 5
- 201000006747 infectious mononucleosis Diseases 0.000 description 5
- 206010022000 influenza Diseases 0.000 description 5
- 230000015788 innate immune response Effects 0.000 description 5
- 238000001990 intravenous administration Methods 0.000 description 5
- 230000007246 mechanism Effects 0.000 description 5
- 230000001404 mediated effect Effects 0.000 description 5
- 210000000056 organ Anatomy 0.000 description 5
- 239000003755 preservative agent Substances 0.000 description 5
- 150000003141 primary amines Chemical class 0.000 description 5
- 238000000746 purification Methods 0.000 description 5
- 150000003839 salts Chemical class 0.000 description 5
- 239000007790 solid phase Substances 0.000 description 5
- 230000006641 stabilisation Effects 0.000 description 5
- 238000011105 stabilization Methods 0.000 description 5
- 230000000638 stimulation Effects 0.000 description 5
- 201000011549 stomach cancer Diseases 0.000 description 5
- 238000002560 therapeutic procedure Methods 0.000 description 5
- 238000011830 transgenic mouse model Methods 0.000 description 5
- 210000004881 tumor cell Anatomy 0.000 description 5
- 239000000080 wetting agent Substances 0.000 description 5
- LLXVXPPXELIDGQ-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 3-(2,5-dioxopyrrol-1-yl)benzoate Chemical compound C=1C=CC(N2C(C=CC2=O)=O)=CC=1C(=O)ON1C(=O)CCC1=O LLXVXPPXELIDGQ-UHFFFAOYSA-N 0.000 description 4
- LKKMLIBUAXYLOY-UHFFFAOYSA-N 3-Amino-1-methyl-5H-pyrido[4,3-b]indole Chemical compound N1C2=CC=CC=C2C2=C1C=C(N)N=C2C LKKMLIBUAXYLOY-UHFFFAOYSA-N 0.000 description 4
- 108700031308 Antennapedia Homeodomain Proteins 0.000 description 4
- 241000193738 Bacillus anthracis Species 0.000 description 4
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 4
- 102100025570 Cancer/testis antigen 1 Human genes 0.000 description 4
- 206010009944 Colon cancer Diseases 0.000 description 4
- 229920002261 Corn starch Polymers 0.000 description 4
- 150000008574 D-amino acids Chemical class 0.000 description 4
- 208000001490 Dengue Diseases 0.000 description 4
- 206010012310 Dengue fever Diseases 0.000 description 4
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 4
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 4
- 206010014596 Encephalitis Japanese B Diseases 0.000 description 4
- 241000588724 Escherichia coli Species 0.000 description 4
- 102100041003 Glutamate carboxypeptidase 2 Human genes 0.000 description 4
- 102000001554 Hemoglobins Human genes 0.000 description 4
- 108010054147 Hemoglobins Proteins 0.000 description 4
- 241000711549 Hepacivirus C Species 0.000 description 4
- 208000005176 Hepatitis C Diseases 0.000 description 4
- 208000009889 Herpes Simplex Diseases 0.000 description 4
- 101000856237 Homo sapiens Cancer/testis antigen 1 Proteins 0.000 description 4
- 101000889345 Homo sapiens Cancer/testis antigen 2 Proteins 0.000 description 4
- 241000714260 Human T-lymphotropic virus 1 Species 0.000 description 4
- 241000701074 Human alphaherpesvirus 2 Species 0.000 description 4
- 241001502974 Human gammaherpesvirus 8 Species 0.000 description 4
- 241000713772 Human immunodeficiency virus 1 Species 0.000 description 4
- 201000005807 Japanese encephalitis Diseases 0.000 description 4
- 241000710842 Japanese encephalitis virus Species 0.000 description 4
- 150000008575 L-amino acids Chemical class 0.000 description 4
- 102100031413 L-dopachrome tautomerase Human genes 0.000 description 4
- 101710093778 L-dopachrome tautomerase Proteins 0.000 description 4
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 4
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 4
- 206010023927 Lassa fever Diseases 0.000 description 4
- 208000004554 Leishmaniasis Diseases 0.000 description 4
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 4
- 206010030155 Oesophageal carcinoma Diseases 0.000 description 4
- 206010033128 Ovarian cancer Diseases 0.000 description 4
- 208000002606 Paramyxoviridae Infections Diseases 0.000 description 4
- 206010057249 Phagocytosis Diseases 0.000 description 4
- 206010035226 Plasma cell myeloma Diseases 0.000 description 4
- 208000000474 Poliomyelitis Diseases 0.000 description 4
- 206010038389 Renal cancer Diseases 0.000 description 4
- 241000702670 Rotavirus Species 0.000 description 4
- 108020004459 Small interfering RNA Proteins 0.000 description 4
- 230000005867 T cell response Effects 0.000 description 4
- 241000710886 West Nile virus Species 0.000 description 4
- 239000004480 active ingredient Substances 0.000 description 4
- 230000004075 alteration Effects 0.000 description 4
- 230000001093 anti-cancer Effects 0.000 description 4
- 230000000259 anti-tumor effect Effects 0.000 description 4
- 238000003556 assay Methods 0.000 description 4
- 201000000448 autoimmune hemolytic anemia Diseases 0.000 description 4
- 210000001185 bone marrow Anatomy 0.000 description 4
- 239000001506 calcium phosphate Substances 0.000 description 4
- 229960001714 calcium phosphate Drugs 0.000 description 4
- 229910000389 calcium phosphate Inorganic materials 0.000 description 4
- 235000011010 calcium phosphates Nutrition 0.000 description 4
- 239000001768 carboxy methyl cellulose Substances 0.000 description 4
- 238000012512 characterization method Methods 0.000 description 4
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 4
- 230000006378 damage Effects 0.000 description 4
- 208000025729 dengue disease Diseases 0.000 description 4
- 230000001419 dependent effect Effects 0.000 description 4
- 238000013461 design Methods 0.000 description 4
- 230000004069 differentiation Effects 0.000 description 4
- 239000002270 dispersing agent Substances 0.000 description 4
- 210000003527 eukaryotic cell Anatomy 0.000 description 4
- GNBHRKFJIUUOQI-UHFFFAOYSA-N fluorescein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 GNBHRKFJIUUOQI-UHFFFAOYSA-N 0.000 description 4
- 125000000524 functional group Chemical group 0.000 description 4
- 208000002672 hepatitis B Diseases 0.000 description 4
- 230000001976 improved effect Effects 0.000 description 4
- 238000001802 infusion Methods 0.000 description 4
- 238000001361 intraarterial administration Methods 0.000 description 4
- 238000010255 intramuscular injection Methods 0.000 description 4
- 239000008101 lactose Substances 0.000 description 4
- 210000003141 lower extremity Anatomy 0.000 description 4
- 108020004999 messenger RNA Proteins 0.000 description 4
- 230000035515 penetration Effects 0.000 description 4
- 230000008782 phagocytosis Effects 0.000 description 4
- 239000001103 potassium chloride Substances 0.000 description 4
- 235000011164 potassium chloride Nutrition 0.000 description 4
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 4
- 102000005962 receptors Human genes 0.000 description 4
- 108020003175 receptors Proteins 0.000 description 4
- 239000002924 silencing RNA Substances 0.000 description 4
- 235000010356 sorbitol Nutrition 0.000 description 4
- 239000000600 sorbitol Substances 0.000 description 4
- 230000000087 stabilizing effect Effects 0.000 description 4
- 238000010186 staining Methods 0.000 description 4
- 238000003860 storage Methods 0.000 description 4
- 239000000375 suspending agent Substances 0.000 description 4
- 238000003786 synthesis reaction Methods 0.000 description 4
- 125000003396 thiol group Chemical group [H]S* 0.000 description 4
- 150000003573 thiols Chemical class 0.000 description 4
- 230000000699 topical effect Effects 0.000 description 4
- 238000013518 transcription Methods 0.000 description 4
- 230000035897 transcription Effects 0.000 description 4
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 4
- 201000008827 tuberculosis Diseases 0.000 description 4
- 241000712461 unidentified influenza virus Species 0.000 description 4
- FXYPGCIGRDZWNR-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 3-[[3-(2,5-dioxopyrrolidin-1-yl)oxy-3-oxopropyl]disulfanyl]propanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCSSCCC(=O)ON1C(=O)CCC1=O FXYPGCIGRDZWNR-UHFFFAOYSA-N 0.000 description 3
- INNTZVXVIZIYBF-PXSLIBMESA-N (2S)-6-amino-2-[[(2S)-6-amino-2-[[(2S)-6-amino-2-[[(2S)-6-amino-2-[[(2S)-2-[[(2R)-3-[2,3-di(hexadecanoyloxy)propylsulfanyl]-2-(hexadecanoylamino)propanoyl]amino]-3-hydroxypropanoyl]amino]hexanoyl]amino]hexanoyl]amino]hexanoyl]amino]hexanoic acid trihydrochloride Chemical compound Cl.Cl.Cl.CCCCCCCCCCCCCCCC(=O)N[C@@H](CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(O)=O INNTZVXVIZIYBF-PXSLIBMESA-N 0.000 description 3
- LMDZBCPBFSXMTL-UHFFFAOYSA-N 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide Chemical compound CCN=C=NCCCN(C)C LMDZBCPBFSXMTL-UHFFFAOYSA-N 0.000 description 3
- WEVYNIUIFUYDGI-UHFFFAOYSA-N 3-[6-[4-(trifluoromethoxy)anilino]-4-pyrimidinyl]benzamide Chemical compound NC(=O)C1=CC=CC(C=2N=CN=C(NC=3C=CC(OC(F)(F)F)=CC=3)C=2)=C1 WEVYNIUIFUYDGI-UHFFFAOYSA-N 0.000 description 3
- 208000004881 Amebiasis Diseases 0.000 description 3
- 206010001980 Amoebiasis Diseases 0.000 description 3
- 208000031212 Autoimmune polyendocrinopathy Diseases 0.000 description 3
- WVDDGKGOMKODPV-UHFFFAOYSA-N Benzyl alcohol Chemical compound OCC1=CC=CC=C1 WVDDGKGOMKODPV-UHFFFAOYSA-N 0.000 description 3
- 206010006187 Breast cancer Diseases 0.000 description 3
- 208000026310 Breast neoplasm Diseases 0.000 description 3
- 208000011691 Burkitt lymphomas Diseases 0.000 description 3
- 102100039510 Cancer/testis antigen 2 Human genes 0.000 description 3
- CURLTUGMZLYLDI-UHFFFAOYSA-N Carbon dioxide Chemical compound O=C=O CURLTUGMZLYLDI-UHFFFAOYSA-N 0.000 description 3
- 229920002134 Carboxymethyl cellulose Polymers 0.000 description 3
- 241000606153 Chlamydia trachomatis Species 0.000 description 3
- 206010008631 Cholera Diseases 0.000 description 3
- 208000010833 Chronic myeloid leukaemia Diseases 0.000 description 3
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 3
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 3
- QOSSAOTZNIDXMA-UHFFFAOYSA-N Dicylcohexylcarbodiimide Chemical compound C1CCCCC1N=C=NC1CCCCC1 QOSSAOTZNIDXMA-UHFFFAOYSA-N 0.000 description 3
- 108010010803 Gelatin Proteins 0.000 description 3
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 3
- 206010018612 Gonorrhoea Diseases 0.000 description 3
- 102000002812 Heat-Shock Proteins Human genes 0.000 description 3
- 108010004889 Heat-Shock Proteins Proteins 0.000 description 3
- 208000002250 Hematologic Neoplasms Diseases 0.000 description 3
- 241000700721 Hepatitis B virus Species 0.000 description 3
- 102100037907 High mobility group protein B1 Human genes 0.000 description 3
- 241000282412 Homo Species 0.000 description 3
- 101000892862 Homo sapiens Glutamate carboxypeptidase 2 Proteins 0.000 description 3
- 101000669406 Homo sapiens Toll-like receptor 6 Proteins 0.000 description 3
- 101000669402 Homo sapiens Toll-like receptor 7 Proteins 0.000 description 3
- 241000714259 Human T-lymphotropic virus 2 Species 0.000 description 3
- 206010021245 Idiopathic thrombocytopenic purpura Diseases 0.000 description 3
- 108010002350 Interleukin-2 Proteins 0.000 description 3
- 102000000588 Interleukin-2 Human genes 0.000 description 3
- 208000008839 Kidney Neoplasms Diseases 0.000 description 3
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 3
- 208000006404 Large Granular Lymphocytic Leukemia Diseases 0.000 description 3
- 208000016604 Lyme disease Diseases 0.000 description 3
- 239000004472 Lysine Substances 0.000 description 3
- 241000124008 Mammalia Species 0.000 description 3
- 201000005505 Measles Diseases 0.000 description 3
- 102100028389 Melanoma antigen recognized by T-cells 1 Human genes 0.000 description 3
- 102000000440 Melanoma-associated antigen Human genes 0.000 description 3
- 108050008953 Melanoma-associated antigen Proteins 0.000 description 3
- 201000009906 Meningitis Diseases 0.000 description 3
- 208000005647 Mumps Diseases 0.000 description 3
- 241000588650 Neisseria meningitidis Species 0.000 description 3
- 229930012538 Paclitaxel Natural products 0.000 description 3
- 206010034277 Pemphigoid Diseases 0.000 description 3
- 102000035195 Peptidases Human genes 0.000 description 3
- 108091005804 Peptidases Proteins 0.000 description 3
- 201000005702 Pertussis Diseases 0.000 description 3
- 206010035148 Plague Diseases 0.000 description 3
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 3
- 108010072866 Prostate-Specific Antigen Proteins 0.000 description 3
- 102100038358 Prostate-specific antigen Human genes 0.000 description 3
- 208000003670 Pure Red-Cell Aplasia Diseases 0.000 description 3
- 206010037660 Pyrexia Diseases 0.000 description 3
- 206010037742 Rabies Diseases 0.000 description 3
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 3
- 101710173694 Short transient receptor potential channel 2 Proteins 0.000 description 3
- 241000193990 Streptococcus sp. 'group B' Species 0.000 description 3
- 241000701093 Suid alphaherpesvirus 1 Species 0.000 description 3
- 101800001271 Surface protein Proteins 0.000 description 3
- 206010043376 Tetanus Diseases 0.000 description 3
- 108010060818 Toll-Like Receptor 9 Proteins 0.000 description 3
- 102100039387 Toll-like receptor 6 Human genes 0.000 description 3
- 102100039390 Toll-like receptor 7 Human genes 0.000 description 3
- 102100033117 Toll-like receptor 9 Human genes 0.000 description 3
- 102000003425 Tyrosinase Human genes 0.000 description 3
- 108060008724 Tyrosinase Proteins 0.000 description 3
- 208000000260 Warts Diseases 0.000 description 3
- 208000003152 Yellow Fever Diseases 0.000 description 3
- 241000607479 Yersinia pestis Species 0.000 description 3
- 230000033289 adaptive immune response Effects 0.000 description 3
- 239000000654 additive Substances 0.000 description 3
- 125000003295 alanine group Chemical group N[C@@H](C)C(=O)* 0.000 description 3
- 230000006907 apoptotic process Effects 0.000 description 3
- 230000001363 autoimmune Effects 0.000 description 3
- 230000004071 biological effect Effects 0.000 description 3
- 159000000007 calcium salts Chemical class 0.000 description 3
- OSGAYBCDTDRGGQ-UHFFFAOYSA-L calcium sulfate Chemical compound [Ca+2].[O-]S([O-])(=O)=O OSGAYBCDTDRGGQ-UHFFFAOYSA-L 0.000 description 3
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 3
- 235000010948 carboxy methyl cellulose Nutrition 0.000 description 3
- 239000008112 carboxymethyl-cellulose Substances 0.000 description 3
- 125000003636 chemical group Chemical group 0.000 description 3
- 229940038705 chlamydia trachomatis Drugs 0.000 description 3
- 230000001684 chronic effect Effects 0.000 description 3
- 238000010367 cloning Methods 0.000 description 3
- 239000008120 corn starch Substances 0.000 description 3
- 229940099112 cornstarch Drugs 0.000 description 3
- 229940104302 cytosine Drugs 0.000 description 3
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 3
- 230000007423 decrease Effects 0.000 description 3
- 230000003247 decreasing effect Effects 0.000 description 3
- 238000011161 development Methods 0.000 description 3
- 230000018109 developmental process Effects 0.000 description 3
- 239000000839 emulsion Substances 0.000 description 3
- 230000012202 endocytosis Effects 0.000 description 3
- 210000001163 endosome Anatomy 0.000 description 3
- 102000052116 epidermal growth factor receptor activity proteins Human genes 0.000 description 3
- 108700015053 epidermal growth factor receptor activity proteins Proteins 0.000 description 3
- 150000002148 esters Chemical class 0.000 description 3
- 238000000684 flow cytometry Methods 0.000 description 3
- 230000004927 fusion Effects 0.000 description 3
- 239000008273 gelatin Substances 0.000 description 3
- 229920000159 gelatin Polymers 0.000 description 3
- 235000019322 gelatine Nutrition 0.000 description 3
- 235000011852 gelatine desserts Nutrition 0.000 description 3
- 230000002068 genetic effect Effects 0.000 description 3
- 210000004392 genitalia Anatomy 0.000 description 3
- 230000036541 health Effects 0.000 description 3
- 210000002443 helper t lymphocyte Anatomy 0.000 description 3
- 208000006454 hepatitis Diseases 0.000 description 3
- 231100000283 hepatitis Toxicity 0.000 description 3
- 230000002519 immonomodulatory effect Effects 0.000 description 3
- 210000000987 immune system Anatomy 0.000 description 3
- 230000005764 inhibitory process Effects 0.000 description 3
- 238000003780 insertion Methods 0.000 description 3
- 230000037431 insertion Effects 0.000 description 3
- 230000003834 intracellular effect Effects 0.000 description 3
- 238000007917 intracranial administration Methods 0.000 description 3
- 238000007912 intraperitoneal administration Methods 0.000 description 3
- 210000003734 kidney Anatomy 0.000 description 3
- 201000010982 kidney cancer Diseases 0.000 description 3
- 239000000314 lubricant Substances 0.000 description 3
- 210000004072 lung Anatomy 0.000 description 3
- 206010025135 lupus erythematosus Diseases 0.000 description 3
- 235000019359 magnesium stearate Nutrition 0.000 description 3
- 125000005439 maleimidyl group Chemical group C1(C=CC(N1*)=O)=O 0.000 description 3
- 238000004519 manufacturing process Methods 0.000 description 3
- 230000035800 maturation Effects 0.000 description 3
- 239000002609 medium Substances 0.000 description 3
- 230000001394 metastastic effect Effects 0.000 description 3
- 206010061289 metastatic neoplasm Diseases 0.000 description 3
- 238000012737 microarray-based gene expression Methods 0.000 description 3
- 238000012243 multiplex automated genomic engineering Methods 0.000 description 3
- 208000010805 mumps infectious disease Diseases 0.000 description 3
- 201000000050 myeloid neoplasm Diseases 0.000 description 3
- YOHYSYJDKVYCJI-UHFFFAOYSA-N n-[3-[[6-[3-(trifluoromethyl)anilino]pyrimidin-4-yl]amino]phenyl]cyclopropanecarboxamide Chemical compound FC(F)(F)C1=CC=CC(NC=2N=CN=C(NC=3C=C(NC(=O)C4CC4)C=CC=3)C=2)=C1 YOHYSYJDKVYCJI-UHFFFAOYSA-N 0.000 description 3
- 230000001613 neoplastic effect Effects 0.000 description 3
- 239000003921 oil Substances 0.000 description 3
- 235000019198 oils Nutrition 0.000 description 3
- 229960001592 paclitaxel Drugs 0.000 description 3
- 239000000546 pharmaceutical excipient Substances 0.000 description 3
- NMHMNPHRMNGLLB-UHFFFAOYSA-N phloretic acid Chemical compound OC(=O)CCC1=CC=C(O)C=C1 NMHMNPHRMNGLLB-UHFFFAOYSA-N 0.000 description 3
- 230000001766 physiological effect Effects 0.000 description 3
- 229920001223 polyethylene glycol Polymers 0.000 description 3
- 229940115272 polyinosinic:polycytidylic acid Drugs 0.000 description 3
- 229920000136 polysorbate Polymers 0.000 description 3
- 230000008569 process Effects 0.000 description 3
- 238000012545 processing Methods 0.000 description 3
- 230000035755 proliferation Effects 0.000 description 3
- 210000002307 prostate Anatomy 0.000 description 3
- 230000009145 protein modification Effects 0.000 description 3
- 238000001243 protein synthesis Methods 0.000 description 3
- 201000004409 schistosomiasis Diseases 0.000 description 3
- 210000002966 serum Anatomy 0.000 description 3
- 210000003491 skin Anatomy 0.000 description 3
- 201000010153 skin papilloma Diseases 0.000 description 3
- 159000000000 sodium salts Chemical class 0.000 description 3
- 239000002904 solvent Substances 0.000 description 3
- 239000003381 stabilizer Substances 0.000 description 3
- 239000007929 subcutaneous injection Substances 0.000 description 3
- JJAHTWIKCUJRDK-UHFFFAOYSA-N succinimidyl 4-(N-maleimidomethyl)cyclohexane-1-carboxylate Chemical compound C1CC(CN2C(C=CC2=O)=O)CCC1C(=O)ON1C(=O)CCC1=O JJAHTWIKCUJRDK-UHFFFAOYSA-N 0.000 description 3
- 238000001356 surgical procedure Methods 0.000 description 3
- 208000011580 syndromic disease Diseases 0.000 description 3
- 201000000596 systemic lupus erythematosus Diseases 0.000 description 3
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 3
- 238000013519 translation Methods 0.000 description 3
- 206010061393 typhus Diseases 0.000 description 3
- 241000701161 unidentified adenovirus Species 0.000 description 3
- PUPZLCDOIYMWBV-UHFFFAOYSA-N (+/-)-1,3-Butanediol Chemical compound CC(O)CCO PUPZLCDOIYMWBV-UHFFFAOYSA-N 0.000 description 2
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 2
- DIYPCWKHSODVAP-UHFFFAOYSA-N 1-[3-(2,5-dioxopyrrol-1-yl)benzoyl]oxy-2,5-dioxopyrrolidine-3-sulfonic acid Chemical compound O=C1C(S(=O)(=O)O)CC(=O)N1OC(=O)C1=CC=CC(N2C(C=CC2=O)=O)=C1 DIYPCWKHSODVAP-UHFFFAOYSA-N 0.000 description 2
- UPAQRWMRKQCLSD-HTIIIDOHSA-N 2,3-dipalmitoyl-S-glycerylcysteine Chemical compound CCCCCCCCCCCCCCCC(=O)OCC(CSC[C@H](N)C(O)=O)OC(=O)CCCCCCCCCCCCCCC UPAQRWMRKQCLSD-HTIIIDOHSA-N 0.000 description 2
- BPVHBBXCESDRKW-UHFFFAOYSA-N 5(6)-carboxyfluorescein Chemical compound C12=CC=C(O)C=C2OC2=CC(O)=CC=C2C21OC(=O)C1=CC(C(=O)O)=CC=C21.C12=CC=C(O)C=C2OC2=CC(O)=CC=C2C11OC(=O)C2=CC=C(C(=O)O)C=C21 BPVHBBXCESDRKW-UHFFFAOYSA-N 0.000 description 2
- ZGXJTSGNIOSYLO-UHFFFAOYSA-N 88755TAZ87 Chemical compound NCC(=O)CCC(O)=O ZGXJTSGNIOSYLO-UHFFFAOYSA-N 0.000 description 2
- 208000024893 Acute lymphoblastic leukemia Diseases 0.000 description 2
- 241000702423 Adeno-associated virus - 2 Species 0.000 description 2
- 208000008190 Agammaglobulinemia Diseases 0.000 description 2
- 206010001935 American trypanosomiasis Diseases 0.000 description 2
- 102000052587 Anaphase-Promoting Complex-Cyclosome Apc3 Subunit Human genes 0.000 description 2
- 108700004606 Anaphase-Promoting Complex-Cyclosome Apc3 Subunit Proteins 0.000 description 2
- 241001465677 Ancylostomatoidea Species 0.000 description 2
- 108090000668 Annexin A2 Proteins 0.000 description 2
- 102000004149 Annexin A2 Human genes 0.000 description 2
- 208000003343 Antiphospholipid Syndrome Diseases 0.000 description 2
- 239000004475 Arginine Substances 0.000 description 2
- 241000416162 Astragalus gummifer Species 0.000 description 2
- 241000295638 Australian bat lyssavirus Species 0.000 description 2
- 206010003827 Autoimmune hepatitis Diseases 0.000 description 2
- 108091008875 B cell receptors Proteins 0.000 description 2
- 102100035526 B melanoma antigen 1 Human genes 0.000 description 2
- 208000032568 B-cell prolymphocytic leukaemia Diseases 0.000 description 2
- 208000032791 BCR-ABL1 positive chronic myelogenous leukemia Diseases 0.000 description 2
- 208000004429 Bacillary Dysentery Diseases 0.000 description 2
- 208000009137 Behcet syndrome Diseases 0.000 description 2
- 208000009299 Benign Mucous Membrane Pemphigoid Diseases 0.000 description 2
- 241000724653 Borna disease virus Species 0.000 description 2
- 241000283690 Bos taurus Species 0.000 description 2
- 241001493154 Bunyamwera virus Species 0.000 description 2
- 208000006448 Buruli Ulcer Diseases 0.000 description 2
- 208000023081 Buruli ulcer disease Diseases 0.000 description 2
- 101150108242 CDC27 gene Proteins 0.000 description 2
- VTYYLEPIZMXCLO-UHFFFAOYSA-L Calcium carbonate Chemical compound [Ca+2].[O-]C([O-])=O VTYYLEPIZMXCLO-UHFFFAOYSA-L 0.000 description 2
- 241001493160 California encephalitis virus Species 0.000 description 2
- 206010007048 Campylobacter gastroenteritis Diseases 0.000 description 2
- 108010078791 Carrier Proteins Proteins 0.000 description 2
- 208000024699 Chagas disease Diseases 0.000 description 2
- 241001502567 Chikungunya virus Species 0.000 description 2
- 108020004705 Codon Proteins 0.000 description 2
- 208000015943 Coeliac disease Diseases 0.000 description 2
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 2
- 206010053138 Congenital aplastic anaemia Diseases 0.000 description 2
- 241000711573 Coronaviridae Species 0.000 description 2
- 208000000307 Crimean Hemorrhagic Fever Diseases 0.000 description 2
- 201000003075 Crimean-Congo hemorrhagic fever Diseases 0.000 description 2
- 241000150230 Crimean-Congo hemorrhagic fever orthonairovirus Species 0.000 description 2
- 101710200374 Crotamine Proteins 0.000 description 2
- PMATZTZNYRCHOR-CGLBZJNRSA-N Cyclosporin A Chemical compound CC[C@@H]1NC(=O)[C@H]([C@H](O)[C@H](C)C\C=C\C)N(C)C(=O)[C@H](C(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)N(C)C(=O)CN(C)C1=O PMATZTZNYRCHOR-CGLBZJNRSA-N 0.000 description 2
- 229930105110 Cyclosporin A Natural products 0.000 description 2
- 108010036949 Cyclosporine Proteins 0.000 description 2
- 241000725619 Dengue virus Species 0.000 description 2
- 201000004624 Dermatitis Diseases 0.000 description 2
- 229920002307 Dextran Polymers 0.000 description 2
- 101100216227 Dictyostelium discoideum anapc3 gene Proteins 0.000 description 2
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 2
- 241000150528 Dobrava-Belgrade orthohantavirus Species 0.000 description 2
- 241001520695 Duvenhage lyssavirus Species 0.000 description 2
- 208000030820 Ebola disease Diseases 0.000 description 2
- 241001115402 Ebolavirus Species 0.000 description 2
- 206010014733 Endometrial cancer Diseases 0.000 description 2
- 206010014759 Endometrial neoplasm Diseases 0.000 description 2
- 102100030340 Ephrin type-A receptor 2 Human genes 0.000 description 2
- 102100031940 Epithelial cell adhesion molecule Human genes 0.000 description 2
- 101710087998 Eumenine mastoparan-AF Proteins 0.000 description 2
- 241000579695 European bat 1 lyssavirus Species 0.000 description 2
- 208000004332 Evans syndrome Diseases 0.000 description 2
- 102100040578 G antigen 7 Human genes 0.000 description 2
- 208000025499 G6PD deficiency Diseases 0.000 description 2
- 241000531123 GB virus C Species 0.000 description 2
- 208000022555 Genital disease Diseases 0.000 description 2
- 208000013607 Glanzmann thrombasthenia Diseases 0.000 description 2
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 2
- 206010018444 Glucose-6-phosphate dehydrogenase deficiency Diseases 0.000 description 2
- 108010015899 Glycopeptides Proteins 0.000 description 2
- 102000002068 Glycopeptides Human genes 0.000 description 2
- 102000003886 Glycoproteins Human genes 0.000 description 2
- 108090000288 Glycoproteins Proteins 0.000 description 2
- 208000024869 Goodpasture syndrome Diseases 0.000 description 2
- 208000035895 Guillain-Barré syndrome Diseases 0.000 description 2
- 241000606768 Haemophilus influenzae Species 0.000 description 2
- 206010061192 Haemorrhagic fever Diseases 0.000 description 2
- 241000150562 Hantaan orthohantavirus Species 0.000 description 2
- 208000030836 Hashimoto thyroiditis Diseases 0.000 description 2
- 241000713158 Hazara virus Species 0.000 description 2
- 208000009292 Hemophilia A Diseases 0.000 description 2
- 206010062506 Heparin-induced thrombocytopenia Diseases 0.000 description 2
- 108010088652 Histocompatibility Antigens Class I Proteins 0.000 description 2
- 108010027412 Histocompatibility Antigens Class II Proteins 0.000 description 2
- 208000017604 Hodgkin disease Diseases 0.000 description 2
- 101000874316 Homo sapiens B melanoma antigen 1 Proteins 0.000 description 2
- 101000920667 Homo sapiens Epithelial cell adhesion molecule Proteins 0.000 description 2
- 101000893968 Homo sapiens G antigen 7 Proteins 0.000 description 2
- 101000578784 Homo sapiens Melanoma antigen recognized by T-cells 1 Proteins 0.000 description 2
- 101001057156 Homo sapiens Melanoma-associated antigen C2 Proteins 0.000 description 2
- 101000946889 Homo sapiens Monocyte differentiation antigen CD14 Proteins 0.000 description 2
- 101001133056 Homo sapiens Mucin-1 Proteins 0.000 description 2
- 101000880770 Homo sapiens Protein SSX2 Proteins 0.000 description 2
- 101000763537 Homo sapiens Toll-like receptor 10 Proteins 0.000 description 2
- 101000800483 Homo sapiens Toll-like receptor 8 Proteins 0.000 description 2
- 241000700588 Human alphaherpesvirus 1 Species 0.000 description 2
- 241000701085 Human alphaherpesvirus 3 Species 0.000 description 2
- 241000701041 Human betaherpesvirus 7 Species 0.000 description 2
- 241000711467 Human coronavirus 229E Species 0.000 description 2
- 241001428935 Human coronavirus OC43 Species 0.000 description 2
- 241000701027 Human herpesvirus 6 Species 0.000 description 2
- 241000713340 Human immunodeficiency virus 2 Species 0.000 description 2
- 241000342334 Human metapneumovirus Species 0.000 description 2
- OAKJQQAXSVQMHS-UHFFFAOYSA-N Hydrazine Chemical compound NN OAKJQQAXSVQMHS-UHFFFAOYSA-N 0.000 description 2
- 206010020751 Hypersensitivity Diseases 0.000 description 2
- 206010020983 Hypogammaglobulinaemia Diseases 0.000 description 2
- 201000009794 Idiopathic Pulmonary Fibrosis Diseases 0.000 description 2
- 208000010159 IgA glomerulonephritis Diseases 0.000 description 2
- 206010021263 IgA nephropathy Diseases 0.000 description 2
- 208000026350 Inborn Genetic disease Diseases 0.000 description 2
- 206010061218 Inflammation Diseases 0.000 description 2
- 208000022559 Inflammatory bowel disease Diseases 0.000 description 2
- 241001500351 Influenzavirus A Species 0.000 description 2
- 241001500350 Influenzavirus B Species 0.000 description 2
- 102100030703 Interleukin-22 Human genes 0.000 description 2
- 102000004388 Interleukin-4 Human genes 0.000 description 2
- 108090000978 Interleukin-4 Proteins 0.000 description 2
- 102000004889 Interleukin-6 Human genes 0.000 description 2
- 108090001005 Interleukin-6 Proteins 0.000 description 2
- 241000712890 Junin mammarenavirus Species 0.000 description 2
- 206010059176 Juvenile idiopathic arthritis Diseases 0.000 description 2
- 208000007766 Kaposi sarcoma Diseases 0.000 description 2
- 241001113666 Khasan virus Species 0.000 description 2
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 2
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 2
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 2
- 206010023825 Laryngeal cancer Diseases 0.000 description 2
- 241000712902 Lassa mammarenavirus Species 0.000 description 2
- 206010024238 Leptospirosis Diseases 0.000 description 2
- 241000710769 Louping ill virus Species 0.000 description 2
- 241000712899 Lymphocytic choriomeningitis mammarenavirus Species 0.000 description 2
- 241000701076 Macacine alphaherpesvirus 1 Species 0.000 description 2
- 241000712898 Machupo mammarenavirus Species 0.000 description 2
- PEEHTFAAVSWFBL-UHFFFAOYSA-N Maleimide Chemical compound O=C1NC(=O)C=C1 PEEHTFAAVSWFBL-UHFFFAOYSA-N 0.000 description 2
- 241000711937 Marburg marburgvirus Species 0.000 description 2
- 241001115401 Marburgvirus Species 0.000 description 2
- 241000712079 Measles morbillivirus Species 0.000 description 2
- 102100027252 Melanoma-associated antigen C2 Human genes 0.000 description 2
- 108010036176 Melitten Proteins 0.000 description 2
- 241000579048 Merkel cell polyomavirus Species 0.000 description 2
- 206010027476 Metastases Diseases 0.000 description 2
- 206010049567 Miller Fisher syndrome Diseases 0.000 description 2
- 241000725171 Mokola lyssavirus Species 0.000 description 2
- 241000700560 Molluscum contagiosum virus Species 0.000 description 2
- 102100035877 Monocyte differentiation antigen CD14 Human genes 0.000 description 2
- 108010063954 Mucins Proteins 0.000 description 2
- 102000015728 Mucins Human genes 0.000 description 2
- 208000012192 Mucous membrane pemphigoid Diseases 0.000 description 2
- 241000711386 Mumps virus Species 0.000 description 2
- 241001529936 Murinae Species 0.000 description 2
- 101100481579 Mus musculus Tlr11 gene Proteins 0.000 description 2
- 101100481580 Mus musculus Tlr12 gene Proteins 0.000 description 2
- 241000187917 Mycobacterium ulcerans Species 0.000 description 2
- 206010066289 Mycobacterium ulcerans infection Diseases 0.000 description 2
- 208000033776 Myeloid Acute Leukemia Diseases 0.000 description 2
- 102100031789 Myeloid-derived growth factor Human genes 0.000 description 2
- 208000014767 Myeloproliferative disease Diseases 0.000 description 2
- 208000001894 Nasopharyngeal Neoplasms Diseases 0.000 description 2
- 206010061306 Nasopharyngeal cancer Diseases 0.000 description 2
- 208000033755 Neutrophilic Chronic Leukemia Diseases 0.000 description 2
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 description 2
- 241000702259 Orbivirus Species 0.000 description 2
- 241000283973 Oryctolagus cuniculus Species 0.000 description 2
- 206010061535 Ovarian neoplasm Diseases 0.000 description 2
- 241000283898 Ovis Species 0.000 description 2
- 239000012648 POLY-ICLC Substances 0.000 description 2
- 241001631646 Papillomaviridae Species 0.000 description 2
- 208000000733 Paroxysmal Hemoglobinuria Diseases 0.000 description 2
- 241001494479 Pecora Species 0.000 description 2
- 201000011152 Pemphigus Diseases 0.000 description 2
- 208000002471 Penile Neoplasms Diseases 0.000 description 2
- 206010034299 Penile cancer Diseases 0.000 description 2
- 208000031845 Pernicious anaemia Diseases 0.000 description 2
- 208000007452 Plasmacytoma Diseases 0.000 description 2
- 241000223960 Plasmodium falciparum Species 0.000 description 2
- 241000223801 Plasmodium knowlesi Species 0.000 description 2
- 241000223821 Plasmodium malariae Species 0.000 description 2
- 241001505293 Plasmodium ovale Species 0.000 description 2
- 241000223810 Plasmodium vivax Species 0.000 description 2
- 102100034937 Poly(A) RNA polymerase, mitochondrial Human genes 0.000 description 2
- 239000002202 Polyethylene glycol Substances 0.000 description 2
- 229920002873 Polyethylenimine Polymers 0.000 description 2
- 108091036414 Polyinosinic:polycytidylic acid Proteins 0.000 description 2
- 241001505332 Polyomavirus sp. Species 0.000 description 2
- 241000710884 Powassan virus Species 0.000 description 2
- 208000006664 Precursor Cell Lymphoblastic Leukemia-Lymphoma Diseases 0.000 description 2
- 208000035416 Prolymphocytic B-Cell Leukemia Diseases 0.000 description 2
- 208000033759 Prolymphocytic T-Cell Leukemia Diseases 0.000 description 2
- 241000150258 Prospect Hill orthohantavirus Species 0.000 description 2
- 206010060862 Prostate cancer Diseases 0.000 description 2
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 2
- 239000004365 Protease Substances 0.000 description 2
- 108010029485 Protein Isoforms Proteins 0.000 description 2
- 102000001708 Protein Isoforms Human genes 0.000 description 2
- 102100037686 Protein SSX2 Human genes 0.000 description 2
- 101710149951 Protein Tat Proteins 0.000 description 2
- 201000004681 Psoriasis Diseases 0.000 description 2
- 241000150264 Puumala orthohantavirus Species 0.000 description 2
- 241000711798 Rabies lyssavirus Species 0.000 description 2
- 208000000705 Rift Valley Fever Diseases 0.000 description 2
- 241000713124 Rift Valley fever virus Species 0.000 description 2
- 239000008156 Ringer's lactate solution Substances 0.000 description 2
- 241000710801 Rubivirus Species 0.000 description 2
- 241000607142 Salmonella Species 0.000 description 2
- 241001135555 Sandfly fever Sicilian virus Species 0.000 description 2
- 206010039491 Sarcoma Diseases 0.000 description 2
- 241000150278 Seoul orthohantavirus Species 0.000 description 2
- 206010040550 Shigella infections Diseases 0.000 description 2
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 2
- 241000150288 Sin Nombre orthohantavirus Species 0.000 description 2
- 208000021386 Sjogren Syndrome Diseases 0.000 description 2
- 108091027967 Small hairpin RNA Proteins 0.000 description 2
- 208000001203 Smallpox Diseases 0.000 description 2
- CDBYLPFSWZWCQE-UHFFFAOYSA-L Sodium Carbonate Chemical compound [Na+].[Na+].[O-]C([O-])=O CDBYLPFSWZWCQE-UHFFFAOYSA-L 0.000 description 2
- UIIMBOGNXHQVGW-UHFFFAOYSA-M Sodium bicarbonate Chemical compound [Na+].OC([O-])=O UIIMBOGNXHQVGW-UHFFFAOYSA-M 0.000 description 2
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 2
- 241000710888 St. Louis encephalitis virus Species 0.000 description 2
- 241000191967 Staphylococcus aureus Species 0.000 description 2
- 229920002472 Starch Polymers 0.000 description 2
- 235000021355 Stearic acid Nutrition 0.000 description 2
- 241000193998 Streptococcus pneumoniae Species 0.000 description 2
- 241001505901 Streptococcus sp. 'group A' Species 0.000 description 2
- 206010042276 Subacute endocarditis Diseases 0.000 description 2
- 241001115376 Sudan ebolavirus Species 0.000 description 2
- 201000008717 T-cell large granular lymphocyte leukemia Diseases 0.000 description 2
- 208000026651 T-cell prolymphocytic leukemia Diseases 0.000 description 2
- 241000712908 Tacaribe mammarenavirus Species 0.000 description 2
- 241001115374 Tai Forest ebolavirus Species 0.000 description 2
- 208000005485 Thrombocytosis Diseases 0.000 description 2
- 208000004006 Tick-borne encephalitis Diseases 0.000 description 2
- 241000710771 Tick-borne encephalitis virus Species 0.000 description 2
- 102100027009 Toll-like receptor 10 Human genes 0.000 description 2
- 102100033110 Toll-like receptor 8 Human genes 0.000 description 2
- 241000711517 Torovirus Species 0.000 description 2
- 241000713154 Toscana virus Species 0.000 description 2
- 229920001615 Tragacanth Polymers 0.000 description 2
- 108700015934 Triose-phosphate isomerases Proteins 0.000 description 2
- 102100033598 Triosephosphate isomerase Human genes 0.000 description 2
- 241000223109 Trypanosoma cruzi Species 0.000 description 2
- 241000150289 Tula orthohantavirus Species 0.000 description 2
- 208000034784 Tularaemia Diseases 0.000 description 2
- 208000037386 Typhoid Diseases 0.000 description 2
- 208000025865 Ulcer Diseases 0.000 description 2
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 2
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 description 2
- 208000024780 Urticaria Diseases 0.000 description 2
- 206010046914 Vaginal infection Diseases 0.000 description 2
- 241000711973 Vesicular stomatitis Indiana virus Species 0.000 description 2
- 108010003533 Viral Envelope Proteins Proteins 0.000 description 2
- 241000710772 Yellow fever virus Species 0.000 description 2
- 241001115400 Zaire ebolavirus Species 0.000 description 2
- 229920000392 Zymosan Polymers 0.000 description 2
- 230000002159 abnormal effect Effects 0.000 description 2
- 230000002378 acidificating effect Effects 0.000 description 2
- 230000004913 activation Effects 0.000 description 2
- 208000002552 acute disseminated encephalomyelitis Diseases 0.000 description 2
- 230000004721 adaptive immunity Effects 0.000 description 2
- 208000009956 adenocarcinoma Diseases 0.000 description 2
- 208000026935 allergic disease Diseases 0.000 description 2
- 150000001408 amides Chemical class 0.000 description 2
- 150000001412 amines Chemical class 0.000 description 2
- 229960002749 aminolevulinic acid Drugs 0.000 description 2
- 206010002026 amyotrophic lateral sclerosis Diseases 0.000 description 2
- 206010002449 angioimmunoblastic T-cell lymphoma Diseases 0.000 description 2
- 210000004102 animal cell Anatomy 0.000 description 2
- 238000011122 anti-angiogenic therapy Methods 0.000 description 2
- 239000003963 antioxidant agent Substances 0.000 description 2
- 238000013459 approach Methods 0.000 description 2
- 239000007864 aqueous solution Substances 0.000 description 2
- 239000007900 aqueous suspension Substances 0.000 description 2
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 2
- 150000001540 azides Chemical class 0.000 description 2
- 210000003719 b-lymphocyte Anatomy 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- 108010081355 beta 2-Microglobulin Proteins 0.000 description 2
- 239000011230 binding agent Substances 0.000 description 2
- 230000037396 body weight Effects 0.000 description 2
- 210000000481 breast Anatomy 0.000 description 2
- 239000001110 calcium chloride Substances 0.000 description 2
- 229910001628 calcium chloride Inorganic materials 0.000 description 2
- 229940022399 cancer vaccine Drugs 0.000 description 2
- 239000001569 carbon dioxide Substances 0.000 description 2
- 229910002092 carbon dioxide Inorganic materials 0.000 description 2
- 125000002091 cationic group Chemical group 0.000 description 2
- 230000002490 cerebral effect Effects 0.000 description 2
- 208000019065 cervical carcinoma Diseases 0.000 description 2
- 238000012412 chemical coupling Methods 0.000 description 2
- 238000010382 chemical cross-linking Methods 0.000 description 2
- 238000001311 chemical methods and process Methods 0.000 description 2
- 238000006243 chemical reaction Methods 0.000 description 2
- 238000002512 chemotherapy Methods 0.000 description 2
- 150000001805 chlorine compounds Chemical class 0.000 description 2
- 210000000349 chromosome Anatomy 0.000 description 2
- 208000032852 chronic lymphocytic leukemia Diseases 0.000 description 2
- 201000010903 chronic neutrophilic leukemia Diseases 0.000 description 2
- 201000010002 cicatricial pemphigoid Diseases 0.000 description 2
- 238000003776 cleavage reaction Methods 0.000 description 2
- 239000013599 cloning vector Substances 0.000 description 2
- 230000001268 conjugating effect Effects 0.000 description 2
- 239000000470 constituent Substances 0.000 description 2
- 239000006071 cream Substances 0.000 description 2
- PEFQQQGFYPMQLH-WFQFKEFWSA-N crotamin Chemical compound C([C@H]1C(=O)N2CCC[C@H]2C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(N[C@@H]2C(=O)N[C@@H](CC(C)C)C(=O)N3CCC[C@H]3C(=O)N3CCC[C@H]3C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=3C=CC=CC=3)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H]3CSSC[C@H](NC(=O)[C@H](CC=4NC=NC=4)NC(=O)CNC(=O)CNC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC=4NC=NC=4)NC(=O)[C@@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CC=4C=CC(O)=CC=4)CSSC[C@@H](C(=O)N[C@@H](CSSC2)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CO)C(=O)NCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC=2C4=CC=CC=C4NC=2)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC=2C4=CC=CC=C4NC=2)NC(=O)[C@H](CCCNC(N)=N)NC3=O)C(=O)N1)=O)[C@@H](C)CC)C1=CC=CC=C1 PEFQQQGFYPMQLH-WFQFKEFWSA-N 0.000 description 2
- 210000000805 cytoplasm Anatomy 0.000 description 2
- 230000001086 cytosolic effect Effects 0.000 description 2
- 231100000433 cytotoxic Toxicity 0.000 description 2
- 230000001472 cytotoxic effect Effects 0.000 description 2
- 238000012217 deletion Methods 0.000 description 2
- 230000037430 deletion Effects 0.000 description 2
- 238000001514 detection method Methods 0.000 description 2
- ZLFRJHOBQVVTOJ-UHFFFAOYSA-N dimethyl hexanediimidate Chemical compound COC(=N)CCCCC(=N)OC ZLFRJHOBQVVTOJ-UHFFFAOYSA-N 0.000 description 2
- 239000007884 disintegrant Substances 0.000 description 2
- 208000009190 disseminated intravascular coagulation Diseases 0.000 description 2
- 229960004679 doxorubicin Drugs 0.000 description 2
- 238000012377 drug delivery Methods 0.000 description 2
- 238000004520 electroporation Methods 0.000 description 2
- 201000003914 endometrial carcinoma Diseases 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 230000000688 enterotoxigenic effect Effects 0.000 description 2
- 208000028104 epidemic louse-borne typhus Diseases 0.000 description 2
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 2
- 230000002538 fungal effect Effects 0.000 description 2
- 210000001035 gastrointestinal tract Anatomy 0.000 description 2
- 239000000499 gel Substances 0.000 description 2
- 208000016361 genetic disease Diseases 0.000 description 2
- 239000008103 glucose Substances 0.000 description 2
- 208000008605 glucosephosphate dehydrogenase deficiency Diseases 0.000 description 2
- 125000000291 glutamic acid group Chemical group N[C@@H](CCC(O)=O)C(=O)* 0.000 description 2
- 235000011187 glycerol Nutrition 0.000 description 2
- 230000013595 glycosylation Effects 0.000 description 2
- 238000006206 glycosylation reaction Methods 0.000 description 2
- XKUKSGPZAADMRA-UHFFFAOYSA-N glycyl-glycyl-glycine Chemical compound NCC(=O)NCC(=O)NCC(O)=O XKUKSGPZAADMRA-UHFFFAOYSA-N 0.000 description 2
- 208000001786 gonorrhea Diseases 0.000 description 2
- 230000012010 growth Effects 0.000 description 2
- 239000003102 growth factor Substances 0.000 description 2
- 229960000789 guanidine hydrochloride Drugs 0.000 description 2
- PJJJBBJSCAKJQF-UHFFFAOYSA-N guanidinium chloride Chemical compound [Cl-].NC(N)=[NH2+] PJJJBBJSCAKJQF-UHFFFAOYSA-N 0.000 description 2
- 229940047650 haemophilus influenzae Drugs 0.000 description 2
- 201000009277 hairy cell leukemia Diseases 0.000 description 2
- 210000003128 head Anatomy 0.000 description 2
- 208000014829 head and neck neoplasm Diseases 0.000 description 2
- 210000003709 heart valve Anatomy 0.000 description 2
- 208000034737 hemoglobinopathy Diseases 0.000 description 2
- 208000009429 hemophilia B Diseases 0.000 description 2
- 208000005252 hepatitis A Diseases 0.000 description 2
- 201000010284 hepatitis E Diseases 0.000 description 2
- 210000004408 hybridoma Anatomy 0.000 description 2
- 230000002209 hydrophobic effect Effects 0.000 description 2
- 229960002751 imiquimod Drugs 0.000 description 2
- DOUYETYNHWVLEO-UHFFFAOYSA-N imiquimod Chemical compound C1=CC=CC2=C3N(CC(C)C)C=NC3=C(N)N=C21 DOUYETYNHWVLEO-UHFFFAOYSA-N 0.000 description 2
- 210000002865 immune cell Anatomy 0.000 description 2
- 230000036039 immunity Effects 0.000 description 2
- 230000002163 immunogen Effects 0.000 description 2
- 230000005847 immunogenicity Effects 0.000 description 2
- 230000003308 immunostimulating effect Effects 0.000 description 2
- 201000001371 inclusion conjunctivitis Diseases 0.000 description 2
- 238000011534 incubation Methods 0.000 description 2
- 210000004263 induced pluripotent stem cell Anatomy 0.000 description 2
- 230000001939 inductive effect Effects 0.000 description 2
- 230000002458 infectious effect Effects 0.000 description 2
- 230000002757 inflammatory effect Effects 0.000 description 2
- 230000004054 inflammatory process Effects 0.000 description 2
- 239000004615 ingredient Substances 0.000 description 2
- 208000018337 inherited hemoglobinopathy Diseases 0.000 description 2
- 239000003112 inhibitor Substances 0.000 description 2
- 210000005061 intracellular organelle Anatomy 0.000 description 2
- 239000007927 intramuscular injection Substances 0.000 description 2
- 238000007919 intrasynovial administration Methods 0.000 description 2
- 238000007913 intrathecal administration Methods 0.000 description 2
- 150000002500 ions Chemical class 0.000 description 2
- 230000002427 irreversible effect Effects 0.000 description 2
- 230000000366 juvenile effect Effects 0.000 description 2
- 206010023841 laryngeal neoplasm Diseases 0.000 description 2
- 210000004901 leucine-rich repeat Anatomy 0.000 description 2
- 208000032839 leukemia Diseases 0.000 description 2
- 230000000670 limiting effect Effects 0.000 description 2
- 239000002502 liposome Substances 0.000 description 2
- 238000011068 loading method Methods 0.000 description 2
- 239000006210 lotion Substances 0.000 description 2
- 201000005202 lung cancer Diseases 0.000 description 2
- 201000005296 lung carcinoma Diseases 0.000 description 2
- 208000020816 lung neoplasm Diseases 0.000 description 2
- 230000001926 lymphatic effect Effects 0.000 description 2
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 2
- 210000002540 macrophage Anatomy 0.000 description 2
- 238000012423 maintenance Methods 0.000 description 2
- VDXZNPDIRNWWCW-JFTDCZMZSA-N melittin Chemical compound NCC(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(=O)N[C@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(N)=O)CC1=CNC2=CC=CC=C12 VDXZNPDIRNWWCW-JFTDCZMZSA-N 0.000 description 2
- 201000011475 meningoencephalitis Diseases 0.000 description 2
- 229960000485 methotrexate Drugs 0.000 description 2
- 244000005700 microbiome Species 0.000 description 2
- 239000002480 mineral oil Substances 0.000 description 2
- 235000010446 mineral oil Nutrition 0.000 description 2
- 238000010369 molecular cloning Methods 0.000 description 2
- 210000001616 monocyte Anatomy 0.000 description 2
- 208000007538 neurilemmoma Diseases 0.000 description 2
- 208000008795 neuromyelitis optica Diseases 0.000 description 2
- 208000002154 non-small cell lung carcinoma Diseases 0.000 description 2
- 239000000346 nonvolatile oil Substances 0.000 description 2
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical compound CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 2
- OQCDKBAXFALNLD-UHFFFAOYSA-N octadecanoic acid Natural products CCCCCCCC(C)CCCCCCCCC(O)=O OQCDKBAXFALNLD-UHFFFAOYSA-N 0.000 description 2
- 239000004006 olive oil Substances 0.000 description 2
- 235000008390 olive oil Nutrition 0.000 description 2
- 150000002923 oximes Chemical class 0.000 description 2
- 208000008443 pancreatic carcinoma Diseases 0.000 description 2
- 230000003071 parasitic effect Effects 0.000 description 2
- 230000036961 partial effect Effects 0.000 description 2
- 239000002245 particle Substances 0.000 description 2
- 201000001976 pemphigus vulgaris Diseases 0.000 description 2
- 239000000816 peptidomimetic Substances 0.000 description 2
- 235000019271 petrolatum Nutrition 0.000 description 2
- 229910000073 phosphorus hydride Inorganic materials 0.000 description 2
- 230000026731 phosphorylation Effects 0.000 description 2
- 238000006366 phosphorylation reaction Methods 0.000 description 2
- 239000013612 plasmid Substances 0.000 description 2
- 239000013600 plasmid vector Substances 0.000 description 2
- 229940118768 plasmodium malariae Drugs 0.000 description 2
- 229940115270 poly iclc Drugs 0.000 description 2
- 229920000747 poly(lactic acid) Polymers 0.000 description 2
- 108040000983 polyphosphate:AMP phosphotransferase activity proteins Proteins 0.000 description 2
- 229920001451 polypropylene glycol Polymers 0.000 description 2
- 230000004481 post-translational protein modification Effects 0.000 description 2
- 230000001323 posttranslational effect Effects 0.000 description 2
- XAEFZNCEHLXOMS-UHFFFAOYSA-M potassium benzoate Chemical compound [K+].[O-]C(=O)C1=CC=CC=C1 XAEFZNCEHLXOMS-UHFFFAOYSA-M 0.000 description 2
- IOLCXVTUBQKXJR-UHFFFAOYSA-M potassium bromide Chemical compound [K+].[Br-] IOLCXVTUBQKXJR-UHFFFAOYSA-M 0.000 description 2
- BWHMMNNQKKPAPP-UHFFFAOYSA-L potassium carbonate Chemical compound [K+].[K+].[O-]C([O-])=O BWHMMNNQKKPAPP-UHFFFAOYSA-L 0.000 description 2
- 159000000001 potassium salts Chemical class 0.000 description 2
- 229920001592 potato starch Polymers 0.000 description 2
- 239000002243 precursor Substances 0.000 description 2
- 230000001737 promoting effect Effects 0.000 description 2
- 230000004850 protein–protein interaction Effects 0.000 description 2
- 238000001959 radiotherapy Methods 0.000 description 2
- 230000002829 reductive effect Effects 0.000 description 2
- 206010039073 rheumatoid arthritis Diseases 0.000 description 2
- 201000005404 rubella Diseases 0.000 description 2
- 206010039667 schwannoma Diseases 0.000 description 2
- 230000007017 scission Effects 0.000 description 2
- 230000028327 secretion Effects 0.000 description 2
- 201000005113 shigellosis Diseases 0.000 description 2
- 238000002741 site-directed mutagenesis Methods 0.000 description 2
- 239000004055 small Interfering RNA Substances 0.000 description 2
- JHJLBTNAGRQEKS-UHFFFAOYSA-M sodium bromide Chemical compound [Na+].[Br-] JHJLBTNAGRQEKS-UHFFFAOYSA-M 0.000 description 2
- 235000019333 sodium laurylsulphate Nutrition 0.000 description 2
- 101150082315 spas-1 gene Proteins 0.000 description 2
- 210000000952 spleen Anatomy 0.000 description 2
- 108010088201 squamous cell carcinoma-related antigen Proteins 0.000 description 2
- 238000010561 standard procedure Methods 0.000 description 2
- 235000019698 starch Nutrition 0.000 description 2
- 239000008117 stearic acid Substances 0.000 description 2
- 229940031000 streptococcus pneumoniae Drugs 0.000 description 2
- 208000008467 subacute bacterial endocarditis Diseases 0.000 description 2
- 235000000346 sugar Nutrition 0.000 description 2
- 239000012730 sustained-release form Substances 0.000 description 2
- 230000002194 synthesizing effect Effects 0.000 description 2
- 208000006379 syphilis Diseases 0.000 description 2
- 239000006188 syrup Substances 0.000 description 2
- 235000020357 syrup Nutrition 0.000 description 2
- 238000011285 therapeutic regimen Methods 0.000 description 2
- 206010043554 thrombocytopenia Diseases 0.000 description 2
- 208000008732 thymoma Diseases 0.000 description 2
- 238000011200 topical administration Methods 0.000 description 2
- 206010044325 trachoma Diseases 0.000 description 2
- 235000010487 tragacanth Nutrition 0.000 description 2
- 239000000196 tragacanth Substances 0.000 description 2
- 229940116362 tragacanth Drugs 0.000 description 2
- 108091006106 transcriptional activators Proteins 0.000 description 2
- 238000012546 transfer Methods 0.000 description 2
- 206010044412 transitional cell carcinoma Diseases 0.000 description 2
- PBKWZFANFUTEPS-CWUSWOHSSA-N transportan Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(C)C)C(N)=O)[C@@H](C)CC)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)CN)[C@@H](C)O)C1=CC=C(O)C=C1 PBKWZFANFUTEPS-CWUSWOHSSA-N 0.000 description 2
- 108010062760 transportan Proteins 0.000 description 2
- 201000008297 typhoid fever Diseases 0.000 description 2
- 230000034512 ubiquitination Effects 0.000 description 2
- 238000010798 ubiquitination Methods 0.000 description 2
- 231100000397 ulcer Toxicity 0.000 description 2
- 241001529453 unidentified herpesvirus Species 0.000 description 2
- 201000000627 variola minor Diseases 0.000 description 2
- 208000014016 variola minor infection Diseases 0.000 description 2
- 239000002435 venom Substances 0.000 description 2
- 231100000611 venom Toxicity 0.000 description 2
- 210000001048 venom Anatomy 0.000 description 2
- 210000005253 yeast cell Anatomy 0.000 description 2
- 229940051021 yellow-fever virus Drugs 0.000 description 2
- VRDGQQTWSGDXCU-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 2-iodoacetate Chemical compound ICC(=O)ON1C(=O)CCC1=O VRDGQQTWSGDXCU-UHFFFAOYSA-N 0.000 description 1
- SYYLQNPWAPHRFV-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 3-(3-methyldiazirin-3-yl)propanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCC1(C)N=N1 SYYLQNPWAPHRFV-UHFFFAOYSA-N 0.000 description 1
- BQWBEDSJTMWJAE-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 4-[(2-iodoacetyl)amino]benzoate Chemical compound C1=CC(NC(=O)CI)=CC=C1C(=O)ON1C(=O)CCC1=O BQWBEDSJTMWJAE-UHFFFAOYSA-N 0.000 description 1
- GKSPIZSKQWTXQG-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 4-[1-(pyridin-2-yldisulfanyl)ethyl]benzoate Chemical compound C=1C=C(C(=O)ON2C(CCC2=O)=O)C=CC=1C(C)SSC1=CC=CC=N1 GKSPIZSKQWTXQG-UHFFFAOYSA-N 0.000 description 1
- PMJWDPGOWBRILU-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 4-[4-(2,5-dioxopyrrol-1-yl)phenyl]butanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCCC(C=C1)=CC=C1N1C(=O)C=CC1=O PMJWDPGOWBRILU-UHFFFAOYSA-N 0.000 description 1
- WCMOHMXWOOBVMZ-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 6-[3-(2,5-dioxopyrrol-1-yl)propanoylamino]hexanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCCCCNC(=O)CCN1C(=O)C=CC1=O WCMOHMXWOOBVMZ-UHFFFAOYSA-N 0.000 description 1
- QYEAAMBIUQLHFQ-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 6-[3-(pyridin-2-yldisulfanyl)propanoylamino]hexanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCCCCNC(=O)CCSSC1=CC=CC=N1 QYEAAMBIUQLHFQ-UHFFFAOYSA-N 0.000 description 1
- DQJCDTNMLBYVAY-ZXXIYAEKSA-N (2S,5R,10R,13R)-16-{[(2R,3S,4R,5R)-3-{[(2S,3R,4R,5S,6R)-3-acetamido-4,5-dihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy}-5-(ethylamino)-6-hydroxy-2-(hydroxymethyl)oxan-4-yl]oxy}-5-(4-aminobutyl)-10-carbamoyl-2,13-dimethyl-4,7,12,15-tetraoxo-3,6,11,14-tetraazaheptadecan-1-oic acid Chemical compound NCCCC[C@H](C(=O)N[C@@H](C)C(O)=O)NC(=O)CC[C@H](C(N)=O)NC(=O)[C@@H](C)NC(=O)C(C)O[C@@H]1[C@@H](NCC)C(O)O[C@H](CO)[C@H]1O[C@H]1[C@H](NC(C)=O)[C@@H](O)[C@H](O)[C@@H](CO)O1 DQJCDTNMLBYVAY-ZXXIYAEKSA-N 0.000 description 1
- GPWYBXDQHZIBPR-AKGZTFGVSA-N (2r)-2-amino-3-(2,3-dihydroxypropylsulfanyl)propanoic acid Chemical group OC(=O)[C@@H](N)CSCC(O)CO GPWYBXDQHZIBPR-AKGZTFGVSA-N 0.000 description 1
- PZFZLRNAOHUQPH-DJBVYZKNSA-N (2r)-3-[(2r)-2,3-di(hexadecanoyloxy)propyl]sulfanyl-2-(hexadecanoylamino)propanoic acid Chemical compound CCCCCCCCCCCCCCCC(=O)N[C@H](C(O)=O)CSC[C@H](OC(=O)CCCCCCCCCCCCCCC)COC(=O)CCCCCCCCCCCCCCC PZFZLRNAOHUQPH-DJBVYZKNSA-N 0.000 description 1
- YKFCISHFRZHKHY-NGQGLHOPSA-N (2s)-2-amino-3-(3,4-dihydroxyphenyl)-2-methylpropanoic acid;trihydrate Chemical compound O.O.O.OC(=O)[C@](N)(C)CC1=CC=C(O)C(O)=C1.OC(=O)[C@](N)(C)CC1=CC=C(O)C(O)=C1 YKFCISHFRZHKHY-NGQGLHOPSA-N 0.000 description 1
- SSOORFWOBGFTHL-OTEJMHTDSA-N (4S)-5-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-6-amino-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[2-[(2S)-2-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-6-amino-1-[[(2S)-1-[[(2S)-1-[[(2S,3S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-6-amino-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-5-amino-1-[[(2S)-1-[[(2S)-1-[[(2S)-6-amino-1-[[(2S)-6-amino-1-[[(2S)-1-[[(2S)-1-[[(2S)-5-amino-1-[[(2S)-5-carbamimidamido-1-[[(2S)-5-carbamimidamido-1-[[(1S)-4-carbamimidamido-1-carboxybutyl]amino]-1-oxopentan-2-yl]amino]-1-oxopentan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-1-oxohexan-2-yl]amino]-1-oxohexan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-1-oxopropan-2-yl]amino]-1-oxohexan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-1-oxohexan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1-oxopropan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]carbamoyl]pyrrolidin-1-yl]-2-oxoethyl]amino]-3-(1H-indol-3-yl)-1-oxopropan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-1-oxohexan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-3-(1H-imidazol-4-yl)-1-oxopropan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-4-[[(2S)-2-[[(2S)-2-[[(2S)-2,6-diaminohexanoyl]amino]-3-methylbutanoyl]amino]propanoyl]amino]-5-oxopentanoic acid Chemical compound CC[C@H](C)[C@H](NC(=O)[C@@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@@H](N)CCCCN)C(C)C)C(C)C)C(C)C)C(C)C)C(C)C)C(C)C)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O SSOORFWOBGFTHL-OTEJMHTDSA-N 0.000 description 1
- WRIDQFICGBMAFQ-UHFFFAOYSA-N (E)-8-Octadecenoic acid Natural products CCCCCCCCCC=CCCCCCCC(O)=O WRIDQFICGBMAFQ-UHFFFAOYSA-N 0.000 description 1
- 125000003088 (fluoren-9-ylmethoxy)carbonyl group Chemical group 0.000 description 1
- ZORQXIQZAOLNGE-UHFFFAOYSA-N 1,1-difluorocyclohexane Chemical compound FC1(F)CCCCC1 ZORQXIQZAOLNGE-UHFFFAOYSA-N 0.000 description 1
- OGYGFUAIIOPWQD-UHFFFAOYSA-N 1,3-thiazolidine Chemical compound C1CSCN1 OGYGFUAIIOPWQD-UHFFFAOYSA-N 0.000 description 1
- VILFTWLXLYIEMV-UHFFFAOYSA-N 1,5-difluoro-2,4-dinitrobenzene Chemical compound [O-][N+](=O)C1=CC([N+]([O-])=O)=C(F)C=C1F VILFTWLXLYIEMV-UHFFFAOYSA-N 0.000 description 1
- WEYNBWVKOYCCQT-UHFFFAOYSA-N 1-(3-chloro-4-methylphenyl)-3-{2-[({5-[(dimethylamino)methyl]-2-furyl}methyl)thio]ethyl}urea Chemical compound O1C(CN(C)C)=CC=C1CSCCNC(=O)NC1=CC=C(C)C(Cl)=C1 WEYNBWVKOYCCQT-UHFFFAOYSA-N 0.000 description 1
- RVRLFABOQXZUJX-UHFFFAOYSA-N 1-[1-(2,5-dioxopyrrol-1-yl)ethyl]pyrrole-2,5-dione Chemical compound O=C1C=CC(=O)N1C(C)N1C(=O)C=CC1=O RVRLFABOQXZUJX-UHFFFAOYSA-N 0.000 description 1
- SGVWDRVQIYUSRA-UHFFFAOYSA-N 1-[2-[2-(2,5-dioxopyrrol-1-yl)ethyldisulfanyl]ethyl]pyrrole-2,5-dione Chemical compound O=C1C=CC(=O)N1CCSSCCN1C(=O)C=CC1=O SGVWDRVQIYUSRA-UHFFFAOYSA-N 0.000 description 1
- FERLGYOHRKHQJP-UHFFFAOYSA-N 1-[2-[2-[2-(2,5-dioxopyrrol-1-yl)ethoxy]ethoxy]ethyl]pyrrole-2,5-dione Chemical compound O=C1C=CC(=O)N1CCOCCOCCN1C(=O)C=CC1=O FERLGYOHRKHQJP-UHFFFAOYSA-N 0.000 description 1
- WHEOHCIKAJUSJC-UHFFFAOYSA-N 1-[2-[bis[2-(2,5-dioxopyrrol-1-yl)ethyl]amino]ethyl]pyrrole-2,5-dione Chemical compound O=C1C=CC(=O)N1CCN(CCN1C(C=CC1=O)=O)CCN1C(=O)C=CC1=O WHEOHCIKAJUSJC-UHFFFAOYSA-N 0.000 description 1
- IPJGAEWUPXWFPL-UHFFFAOYSA-N 1-[3-(2,5-dioxopyrrol-1-yl)phenyl]pyrrole-2,5-dione Chemical compound O=C1C=CC(=O)N1C1=CC=CC(N2C(C=CC2=O)=O)=C1 IPJGAEWUPXWFPL-UHFFFAOYSA-N 0.000 description 1
- WXXSHAKLDCERGU-UHFFFAOYSA-N 1-[4-(2,5-dioxopyrrol-1-yl)butyl]pyrrole-2,5-dione Chemical compound O=C1C=CC(=O)N1CCCCN1C(=O)C=CC1=O WXXSHAKLDCERGU-UHFFFAOYSA-N 0.000 description 1
- FPKVOQKZMBDBKP-UHFFFAOYSA-N 1-[4-[(2,5-dioxopyrrol-1-yl)methyl]cyclohexanecarbonyl]oxy-2,5-dioxopyrrolidine-3-sulfonic acid Chemical compound O=C1C(S(=O)(=O)O)CC(=O)N1OC(=O)C1CCC(CN2C(C=CC2=O)=O)CC1 FPKVOQKZMBDBKP-UHFFFAOYSA-N 0.000 description 1
- VHYRLCJMMJQUBY-UHFFFAOYSA-N 1-[4-[4-(2,5-dioxopyrrol-1-yl)phenyl]butanoyloxy]-2,5-dioxopyrrolidine-3-sulfonic acid Chemical compound O=C1C(S(=O)(=O)O)CC(=O)N1OC(=O)CCCC1=CC=C(N2C(C=CC2=O)=O)C=C1 VHYRLCJMMJQUBY-UHFFFAOYSA-N 0.000 description 1
- NWHAVGHJSKQCHH-UHFFFAOYSA-N 1-[6-(2,5-dioxopyrrol-1-yl)hexanoyloxy]-2,5-dioxopyrrolidine-3-sulfonic acid Chemical compound O=C1C(S(=O)(=O)O)CC(=O)N1OC(=O)CCCCCN1C(=O)C=CC1=O NWHAVGHJSKQCHH-UHFFFAOYSA-N 0.000 description 1
- KHAWDEWNXJIVCJ-UHFFFAOYSA-N 1-fluoro-4-(4-fluoro-3-nitrophenyl)sulfonyl-2-nitrobenzene Chemical compound C1=C(F)C([N+](=O)[O-])=CC(S(=O)(=O)C=2C=C(C(F)=CC=2)[N+]([O-])=O)=C1 KHAWDEWNXJIVCJ-UHFFFAOYSA-N 0.000 description 1
- IIZPXYDJLKNOIY-JXPKJXOSSA-N 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCC\C=C/C\C=C/C\C=C/C\C=C/CCCCC IIZPXYDJLKNOIY-JXPKJXOSSA-N 0.000 description 1
- ASNTZYQMIUCEBV-UHFFFAOYSA-N 2,5-dioxo-1-[6-[3-(pyridin-2-yldisulfanyl)propanoylamino]hexanoyloxy]pyrrolidine-3-sulfonic acid Chemical compound O=C1C(S(=O)(=O)O)CC(=O)N1OC(=O)CCCCCNC(=O)CCSSC1=CC=CC=N1 ASNTZYQMIUCEBV-UHFFFAOYSA-N 0.000 description 1
- SYEKJCKNTHYWOJ-UHFFFAOYSA-N 2-(2,5-dioxopyrrolidin-1-yl)-2-sulfobutanedioic acid;ethane-1,2-diol Chemical compound OCCO.OC(=O)CC(S(O)(=O)=O)(C(O)=O)N1C(=O)CCC1=O.OC(=O)CC(S(O)(=O)=O)(C(O)=O)N1C(=O)CCC1=O SYEKJCKNTHYWOJ-UHFFFAOYSA-N 0.000 description 1
- VYMHBQQZUYHXSS-UHFFFAOYSA-N 2-(3h-dithiol-3-yl)pyridine Chemical group C1=CSSC1C1=CC=CC=N1 VYMHBQQZUYHXSS-UHFFFAOYSA-N 0.000 description 1
- PELJUXRZJGLQNN-UHFFFAOYSA-N 2-(3h-dithiol-3-yl)pyridine;1-hydroperoxyperoxydecane;1-hydroxypyrrolidine-2,5-dione Chemical compound ON1C(=O)CCC1=O.C1=CSSC1C1=CC=CC=N1.CCCCCCCCCCOOOO PELJUXRZJGLQNN-UHFFFAOYSA-N 0.000 description 1
- KVLGZJYDZKSTAJ-UHFFFAOYSA-N 2-(3h-dithiol-3-yl)pyridine;1-hydroperoxyperoxytetratriacontane;1-hydroxypyrrolidine-2,5-dione Chemical compound ON1C(=O)CCC1=O.C1=CSSC1C1=CC=CC=N1.CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCOOOO KVLGZJYDZKSTAJ-UHFFFAOYSA-N 0.000 description 1
- QMOQBVOBWVNSNO-UHFFFAOYSA-N 2-[[2-[[2-[(2-azaniumylacetyl)amino]acetyl]amino]acetyl]amino]acetate Chemical compound NCC(=O)NCC(=O)NCC(=O)NCC(O)=O QMOQBVOBWVNSNO-UHFFFAOYSA-N 0.000 description 1
- BFSVOASYOCHEOV-UHFFFAOYSA-N 2-diethylaminoethanol Chemical compound CCN(CC)CCO BFSVOASYOCHEOV-UHFFFAOYSA-N 0.000 description 1
- RLFPCLMBTQOMLI-UHFFFAOYSA-N 2-iodo-n-[2-[(2-iodoacetyl)amino]ethyl]acetamide Chemical compound ICC(=O)NCCNC(=O)CI RLFPCLMBTQOMLI-UHFFFAOYSA-N 0.000 description 1
- LEACJMVNYZDSKR-UHFFFAOYSA-N 2-octyldodecan-1-ol Chemical compound CCCCCCCCCCC(CO)CCCCCCCC LEACJMVNYZDSKR-UHFFFAOYSA-N 0.000 description 1
- LQJBNNIYVWPHFW-UHFFFAOYSA-N 20:1omega9c fatty acid Natural products CCCCCCCCCCC=CCCCCCCCC(O)=O LQJBNNIYVWPHFW-UHFFFAOYSA-N 0.000 description 1
- FPQQSJJWHUJYPU-UHFFFAOYSA-N 3-(dimethylamino)propyliminomethylidene-ethylazanium;chloride Chemical compound Cl.CCN=C=NCCCN(C)C FPQQSJJWHUJYPU-UHFFFAOYSA-N 0.000 description 1
- NITXODYAMWZEJY-UHFFFAOYSA-N 3-(pyridin-2-yldisulfanyl)propanehydrazide Chemical compound NNC(=O)CCSSC1=CC=CC=N1 NITXODYAMWZEJY-UHFFFAOYSA-N 0.000 description 1
- ULKDIPSSLZFIQU-UHFFFAOYSA-N 3-[(2-bromoacetyl)amino]propanoic acid Chemical compound OC(=O)CCNC(=O)CBr ULKDIPSSLZFIQU-UHFFFAOYSA-N 0.000 description 1
- QQHITEBEBQNARV-UHFFFAOYSA-N 3-[[2-carboxy-2-(2,5-dioxopyrrolidin-1-yl)-2-sulfoethyl]disulfanyl]-2-(2,5-dioxopyrrolidin-1-yl)-2-sulfopropanoic acid Chemical compound O=C1CCC(=O)N1C(S(O)(=O)=O)(C(=O)O)CSSCC(S(O)(=O)=O)(C(O)=O)N1C(=O)CCC1=O QQHITEBEBQNARV-UHFFFAOYSA-N 0.000 description 1
- SVMCPPLCIXHWBS-UHFFFAOYSA-N 3-amino-2,6-dichlorobenzoic acid Chemical compound NC1=CC=C(Cl)C(C(O)=O)=C1Cl SVMCPPLCIXHWBS-UHFFFAOYSA-N 0.000 description 1
- BHPSIKROCCEKQR-UHFFFAOYSA-N 3-sulfanylpyrrole-2,5-dione Chemical compound SC1=CC(=O)NC1=O BHPSIKROCCEKQR-UHFFFAOYSA-N 0.000 description 1
- RHKWIGHJGOEUSM-UHFFFAOYSA-N 3h-imidazo[4,5-h]quinoline Chemical class C1=CN=C2C(N=CN3)=C3C=CC2=C1 RHKWIGHJGOEUSM-UHFFFAOYSA-N 0.000 description 1
- ZMRMMAOBSFSXLN-UHFFFAOYSA-N 4-[4-(2,5-dioxopyrrol-1-yl)phenyl]butanehydrazide Chemical compound C1=CC(CCCC(=O)NN)=CC=C1N1C(=O)C=CC1=O ZMRMMAOBSFSXLN-UHFFFAOYSA-N 0.000 description 1
- NQXOUNOJWFMRLG-UHFFFAOYSA-N 4-[4-(2,5-dioxopyrrol-1-yl)phenyl]butanoic acid;pyrrolidine-2,5-dione Chemical compound O=C1CCC(=O)N1.C1=CC(CCCC(=O)O)=CC=C1N1C(=O)C=CC1=O NQXOUNOJWFMRLG-UHFFFAOYSA-N 0.000 description 1
- QLHLYJHNOCILIT-UHFFFAOYSA-N 4-o-(2,5-dioxopyrrolidin-1-yl) 1-o-[2-[4-(2,5-dioxopyrrolidin-1-yl)oxy-4-oxobutanoyl]oxyethyl] butanedioate Chemical compound O=C1CCC(=O)N1OC(=O)CCC(=O)OCCOC(=O)CCC(=O)ON1C(=O)CCC1=O QLHLYJHNOCILIT-UHFFFAOYSA-N 0.000 description 1
- 102100033051 40S ribosomal protein S19 Human genes 0.000 description 1
- 102100030310 5,6-dihydroxyindole-2-carboxylic acid oxidase Human genes 0.000 description 1
- 101710163881 5,6-dihydroxyindole-2-carboxylic acid oxidase Proteins 0.000 description 1
- BRJHNRIXCCGTKK-UHFFFAOYSA-N 8,11-diimino-2,2-dioxo-1,5,7-trioxa-2lambda6-thiacycloundecan-6-one Chemical compound C1(CCC(OC(=O)OCCS(=O)(=O)O1)=N)=N BRJHNRIXCCGTKK-UHFFFAOYSA-N 0.000 description 1
- QSBYPNXLFMSGKH-UHFFFAOYSA-N 9-Heptadecensaeure Natural products CCCCCCCC=CCCCCCCCC(O)=O QSBYPNXLFMSGKH-UHFFFAOYSA-N 0.000 description 1
- 230000005730 ADP ribosylation Effects 0.000 description 1
- 206010000234 Abortion spontaneous Diseases 0.000 description 1
- 206010063409 Acarodermatitis Diseases 0.000 description 1
- 206010056508 Acquired epidermolysis bullosa Diseases 0.000 description 1
- 241000251468 Actinopterygii Species 0.000 description 1
- 206010000748 Acute febrile neutrophilic dermatosis Diseases 0.000 description 1
- 208000036762 Acute promyelocytic leukaemia Diseases 0.000 description 1
- 102100021305 Acyl-CoA:lysophosphatidylglycerol acyltransferase 1 Human genes 0.000 description 1
- 208000026872 Addison Disease Diseases 0.000 description 1
- 101710137115 Adenylyl cyclase-associated protein 1 Proteins 0.000 description 1
- 208000002485 Adiposis dolorosa Diseases 0.000 description 1
- 208000000230 African Trypanosomiasis Diseases 0.000 description 1
- 206010001488 Aggression Diseases 0.000 description 1
- 201000010000 Agranulocytosis Diseases 0.000 description 1
- XZWXFWBHYRFLEF-FSPLSTOPSA-N Ala-His Chemical compound C[C@H](N)C(=O)N[C@H](C(O)=O)CC1=CN=CN1 XZWXFWBHYRFLEF-FSPLSTOPSA-N 0.000 description 1
- 208000032671 Allergic granulomatous angiitis Diseases 0.000 description 1
- 102000002572 Alpha-Globulins Human genes 0.000 description 1
- 108010068307 Alpha-Globulins Proteins 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 102100023635 Alpha-fetoprotein Human genes 0.000 description 1
- 206010060937 Amniotic cavity infection Diseases 0.000 description 1
- 206010002065 Anaemia megaloblastic Diseases 0.000 description 1
- 208000030760 Anaemia of chronic disease Diseases 0.000 description 1
- 206010061424 Anal cancer Diseases 0.000 description 1
- 206010073478 Anaplastic large-cell lymphoma Diseases 0.000 description 1
- 206010002556 Ankylosing Spondylitis Diseases 0.000 description 1
- 241000048021 Anterhynchium flavomarginatum micado Species 0.000 description 1
- 108700042778 Antimicrobial Peptides Proteins 0.000 description 1
- 102000044503 Antimicrobial Peptides Human genes 0.000 description 1
- 108020004491 Antisense DNA Proteins 0.000 description 1
- 108020000948 Antisense Oligonucleotides Proteins 0.000 description 1
- 108020005544 Antisense RNA Proteins 0.000 description 1
- 208000001839 Antisynthetase syndrome Diseases 0.000 description 1
- 208000032467 Aplastic anaemia Diseases 0.000 description 1
- 102100021569 Apoptosis regulator Bcl-2 Human genes 0.000 description 1
- 206010003011 Appendicitis Diseases 0.000 description 1
- 101100288313 Arabidopsis thaliana KTI4 gene Proteins 0.000 description 1
- 101000719121 Arabidopsis thaliana Protein MEI2-like 1 Proteins 0.000 description 1
- IIFDPDVJAHQFSR-WHFBIAKZSA-N Asn-Glu Chemical compound NC(=O)C[C@H](N)C(=O)N[C@H](C(O)=O)CCC(O)=O IIFDPDVJAHQFSR-WHFBIAKZSA-N 0.000 description 1
- JHFNSBBHKSZXKB-VKHMYHEASA-N Asp-Gly Chemical compound OC(=O)C[C@H](N)C(=O)NCC(O)=O JHFNSBBHKSZXKB-VKHMYHEASA-N 0.000 description 1
- 102100022108 Aspartyl/asparaginyl beta-hydroxylase Human genes 0.000 description 1
- 241000228212 Aspergillus Species 0.000 description 1
- 206010053622 Asplenia Diseases 0.000 description 1
- 206010003571 Astrocytoma Diseases 0.000 description 1
- 206010071576 Autoimmune aplastic anaemia Diseases 0.000 description 1
- 208000000659 Autoimmune lymphoproliferative syndrome Diseases 0.000 description 1
- 206010069002 Autoimmune pancreatitis Diseases 0.000 description 1
- 208000022106 Autoimmune polyendocrinopathy type 2 Diseases 0.000 description 1
- 208000011594 Autoinflammatory disease Diseases 0.000 description 1
- 208000010839 B-cell chronic lymphocytic leukemia Diseases 0.000 description 1
- 208000003950 B-cell lymphoma Diseases 0.000 description 1
- 101150009389 BZLF1 gene Proteins 0.000 description 1
- 102100021663 Baculoviral IAP repeat-containing protein 5 Human genes 0.000 description 1
- 201000002827 Balo concentric sclerosis Diseases 0.000 description 1
- 206010004146 Basal cell carcinoma Diseases 0.000 description 1
- 208000023328 Basedow disease Diseases 0.000 description 1
- 208000027496 Behcet disease Diseases 0.000 description 1
- 108060000903 Beta-catenin Proteins 0.000 description 1
- 102000015735 Beta-catenin Human genes 0.000 description 1
- 208000008439 Biliary Liver Cirrhosis Diseases 0.000 description 1
- 208000033222 Biliary cirrhosis primary Diseases 0.000 description 1
- 208000033932 Blackfan-Diamond anemia Diseases 0.000 description 1
- 206010005003 Bladder cancer Diseases 0.000 description 1
- 208000009766 Blau syndrome Diseases 0.000 description 1
- 206010005949 Bone cancer Diseases 0.000 description 1
- 208000018084 Bone neoplasm Diseases 0.000 description 1
- 208000003508 Botulism Diseases 0.000 description 1
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 1
- 206010006417 Bronchial carcinoma Diseases 0.000 description 1
- 241001415830 Bubo Species 0.000 description 1
- FERIUCNNQQJTOY-UHFFFAOYSA-M Butyrate Chemical compound CCCC([O-])=O FERIUCNNQQJTOY-UHFFFAOYSA-M 0.000 description 1
- FERIUCNNQQJTOY-UHFFFAOYSA-N Butyric acid Natural products CCCC(O)=O FERIUCNNQQJTOY-UHFFFAOYSA-N 0.000 description 1
- 102100040840 C-type lectin domain family 7 member A Human genes 0.000 description 1
- 102000049320 CD36 Human genes 0.000 description 1
- 108010045374 CD36 Antigens Proteins 0.000 description 1
- 108010029697 CD40 Ligand Proteins 0.000 description 1
- 102100032937 CD40 ligand Human genes 0.000 description 1
- 210000001266 CD8-positive T-lymphocyte Anatomy 0.000 description 1
- 201000002829 CREST Syndrome Diseases 0.000 description 1
- 101100005789 Caenorhabditis elegans cdk-4 gene Proteins 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- 241000282836 Camelus dromedarius Species 0.000 description 1
- 241000222122 Candida albicans Species 0.000 description 1
- 241000282465 Canis Species 0.000 description 1
- 108090000565 Capsid Proteins Proteins 0.000 description 1
- 102100026548 Caspase-8 Human genes 0.000 description 1
- 108090000538 Caspase-8 Proteins 0.000 description 1
- 208000005024 Castleman disease Diseases 0.000 description 1
- 108090000994 Catalytic RNA Proteins 0.000 description 1
- 102000053642 Catalytic RNA Human genes 0.000 description 1
- 102000004178 Cathepsin E Human genes 0.000 description 1
- 108090000611 Cathepsin E Proteins 0.000 description 1
- 208000003163 Cavernous Hemangioma Diseases 0.000 description 1
- 102000019034 Chemokines Human genes 0.000 description 1
- 108010012236 Chemokines Proteins 0.000 description 1
- 201000006082 Chickenpox Diseases 0.000 description 1
- 208000008158 Chorioamnionitis Diseases 0.000 description 1
- 208000006545 Chronic Obstructive Pulmonary Disease Diseases 0.000 description 1
- 208000030939 Chronic inflammatory demyelinating polyneuropathy Diseases 0.000 description 1
- 201000000724 Chronic recurrent multifocal osteomyelitis Diseases 0.000 description 1
- 208000006344 Churg-Strauss Syndrome Diseases 0.000 description 1
- 208000008853 Ciguatera Poisoning Diseases 0.000 description 1
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 1
- 102100022641 Coagulation factor IX Human genes 0.000 description 1
- 102100026735 Coagulation factor VIII Human genes 0.000 description 1
- 206010053567 Coagulopathies Diseases 0.000 description 1
- 208000010007 Cogan syndrome Diseases 0.000 description 1
- 102100035167 Coiled-coil domain-containing protein 54 Human genes 0.000 description 1
- 208000011038 Cold agglutinin disease Diseases 0.000 description 1
- 206010009868 Cold type haemolytic anaemia Diseases 0.000 description 1
- 206010009900 Colitis ulcerative Diseases 0.000 description 1
- 102000008186 Collagen Human genes 0.000 description 1
- 108010035532 Collagen Proteins 0.000 description 1
- 206010010252 Concentric sclerosis Diseases 0.000 description 1
- 208000032170 Congenital Abnormalities Diseases 0.000 description 1
- 206010010741 Conjunctivitis Diseases 0.000 description 1
- 241000759568 Corixa Species 0.000 description 1
- 208000011231 Crohn disease Diseases 0.000 description 1
- 208000014311 Cushing syndrome Diseases 0.000 description 1
- 108050006400 Cyclin Proteins 0.000 description 1
- DZLQXIFVQFTFJY-BYPYZUCNSA-N Cys-Gly-Gly Chemical compound SC[C@H](N)C(=O)NCC(=O)NCC(O)=O DZLQXIFVQFTFJY-BYPYZUCNSA-N 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- 102000053602 DNA Human genes 0.000 description 1
- 230000004568 DNA-binding Effects 0.000 description 1
- 102100040606 Dermatan-sulfate epimerase Human genes 0.000 description 1
- 101710127030 Dermatan-sulfate epimerase Proteins 0.000 description 1
- 206010012438 Dermatitis atopic Diseases 0.000 description 1
- 206010012442 Dermatitis contact Diseases 0.000 description 1
- 206010012468 Dermatitis herpetiformis Diseases 0.000 description 1
- 201000004449 Diamond-Blackfan anemia Diseases 0.000 description 1
- YXHKONLOYHBTNS-UHFFFAOYSA-N Diazomethane Chemical compound C=[N+]=[N-] YXHKONLOYHBTNS-UHFFFAOYSA-N 0.000 description 1
- 208000004986 Diffuse Cerebral Sclerosis of Schilder Diseases 0.000 description 1
- 201000003066 Diffuse Scleroderma Diseases 0.000 description 1
- 208000024134 Diffuse cutaneous systemic sclerosis Diseases 0.000 description 1
- 208000002699 Digestive System Neoplasms Diseases 0.000 description 1
- 102000016607 Diphtheria Toxin Human genes 0.000 description 1
- 108010053187 Diphtheria Toxin Proteins 0.000 description 1
- 206010013029 Diphyllobothriasis Diseases 0.000 description 1
- 241001137876 Diphyllobothrium Species 0.000 description 1
- 208000006926 Discoid Lupus Erythematosus Diseases 0.000 description 1
- 102100037070 Doublecortin domain-containing protein 2 Human genes 0.000 description 1
- 102100028570 Drebrin-like protein Human genes 0.000 description 1
- 208000021866 Dressler syndrome Diseases 0.000 description 1
- 241000255601 Drosophila melanogaster Species 0.000 description 1
- 208000035220 Dyserythropoietic Congenital Anemia Diseases 0.000 description 1
- 108050002772 E3 ubiquitin-protein ligase Mdm2 Proteins 0.000 description 1
- 102000012199 E3 ubiquitin-protein ligase Mdm2 Human genes 0.000 description 1
- 102000012804 EPCAM Human genes 0.000 description 1
- 101150084967 EPCAM gene Proteins 0.000 description 1
- 101150029707 ERBB2 gene Proteins 0.000 description 1
- 239000004150 EU approved colour Substances 0.000 description 1
- 241000244160 Echinococcus Species 0.000 description 1
- 206010014490 Elliptocytosis hereditary Diseases 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- 102100038132 Endogenous retrovirus group K member 6 Pro protein Human genes 0.000 description 1
- 201000009273 Endometriosis Diseases 0.000 description 1
- 102100039328 Endoplasmin Human genes 0.000 description 1
- 102100029727 Enteropeptidase Human genes 0.000 description 1
- 108010013369 Enteropeptidase Proteins 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 208000018428 Eosinophilic granulomatosis with polyangiitis Diseases 0.000 description 1
- 108010055196 EphA2 Receptor Proteins 0.000 description 1
- 108010055179 EphA4 Receptor Proteins 0.000 description 1
- 101710116743 Ephrin type-A receptor 2 Proteins 0.000 description 1
- 102100021616 Ephrin type-A receptor 4 Human genes 0.000 description 1
- 241000283086 Equidae Species 0.000 description 1
- 206010015150 Erythema Diseases 0.000 description 1
- 208000007985 Erythema Infectiosum Diseases 0.000 description 1
- 208000031637 Erythroblastic Acute Leukemia Diseases 0.000 description 1
- 206010015251 Erythroblastosis foetalis Diseases 0.000 description 1
- 208000036566 Erythroleukaemia Diseases 0.000 description 1
- 208000000461 Esophageal Neoplasms Diseases 0.000 description 1
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 1
- 239000001856 Ethyl cellulose Substances 0.000 description 1
- ZZSNKZQZMQGXPY-UHFFFAOYSA-N Ethyl cellulose Chemical compound CCOCC1OC(OC)C(OCC)C(OCC)C1OC1C(O)C(O)C(OC)C(CO)O1 ZZSNKZQZMQGXPY-UHFFFAOYSA-N 0.000 description 1
- 201000003675 Evans' syndrome Diseases 0.000 description 1
- 108700024394 Exon Proteins 0.000 description 1
- 201000003542 Factor VIII deficiency Diseases 0.000 description 1
- 108010074860 Factor Xa Proteins 0.000 description 1
- 201000004939 Fanconi anemia Diseases 0.000 description 1
- 108010049003 Fibrinogen Proteins 0.000 description 1
- 102000008946 Fibrinogen Human genes 0.000 description 1
- 102100028043 Fibroblast growth factor 3 Human genes 0.000 description 1
- 102100028075 Fibroblast growth factor 6 Human genes 0.000 description 1
- 108090000382 Fibroblast growth factor 6 Proteins 0.000 description 1
- 241000192125 Firmicutes Species 0.000 description 1
- 238000012413 Fluorescence activated cell sorting analysis Methods 0.000 description 1
- 206010016880 Folate deficiency Diseases 0.000 description 1
- 208000007212 Foot-and-Mouth Disease Diseases 0.000 description 1
- 241000710198 Foot-and-mouth disease virus Species 0.000 description 1
- 102100035233 Furin Human genes 0.000 description 1
- 108090001126 Furin Proteins 0.000 description 1
- 102100039717 G antigen 1 Human genes 0.000 description 1
- 102100039699 G antigen 4 Human genes 0.000 description 1
- 102100039698 G antigen 5 Human genes 0.000 description 1
- 101710092267 G antigen 5 Proteins 0.000 description 1
- 102100039713 G antigen 6 Human genes 0.000 description 1
- 101710092269 G antigen 6 Proteins 0.000 description 1
- 101710113436 GTPase KRas Proteins 0.000 description 1
- 208000022072 Gallbladder Neoplasms Diseases 0.000 description 1
- 201000000628 Gas Gangrene Diseases 0.000 description 1
- 208000007882 Gastritis Diseases 0.000 description 1
- 208000015872 Gaucher disease Diseases 0.000 description 1
- 208000007465 Giant cell arteritis Diseases 0.000 description 1
- SSHIXEILTLPAQT-WHFBIAKZSA-N Gln-Asp Chemical compound NC(=O)CC[C@H](N)C(=O)N[C@@H](CC(O)=O)C(O)=O SSHIXEILTLPAQT-WHFBIAKZSA-N 0.000 description 1
- 206010018364 Glomerulonephritis Diseases 0.000 description 1
- PABVKUJVLNMOJP-WHFBIAKZSA-N Glu-Cys Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CS)C(O)=O PABVKUJVLNMOJP-WHFBIAKZSA-N 0.000 description 1
- 102100035172 Glucose-6-phosphate 1-dehydrogenase Human genes 0.000 description 1
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 1
- SXRSQZLOMIGNAQ-UHFFFAOYSA-N Glutaraldehyde Chemical compound O=CCCCC=O SXRSQZLOMIGNAQ-UHFFFAOYSA-N 0.000 description 1
- JLXVRFDTDUGQEE-YFKPBYRVSA-N Gly-Arg Chemical compound NCC(=O)N[C@H](C(O)=O)CCCN=C(N)N JLXVRFDTDUGQEE-YFKPBYRVSA-N 0.000 description 1
- IDOGEHIWMJMAHT-BYPYZUCNSA-N Gly-Gly-Cys Chemical compound NCC(=O)NCC(=O)N[C@@H](CS)C(O)=O IDOGEHIWMJMAHT-BYPYZUCNSA-N 0.000 description 1
- BCCRXDTUTZHDEU-VKHMYHEASA-N Gly-Ser Chemical compound NCC(=O)N[C@@H](CO)C(O)=O BCCRXDTUTZHDEU-VKHMYHEASA-N 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 108010017080 Granulocyte Colony-Stimulating Factor Proteins 0.000 description 1
- 102000004269 Granulocyte Colony-Stimulating Factor Human genes 0.000 description 1
- 208000015023 Graves' disease Diseases 0.000 description 1
- 102100028972 HLA class I histocompatibility antigen, A alpha chain Human genes 0.000 description 1
- 108010075704 HLA-A Antigens Proteins 0.000 description 1
- 208000023661 Haematological disease Diseases 0.000 description 1
- 101710154606 Hemagglutinin Proteins 0.000 description 1
- 208000018565 Hemochromatosis Diseases 0.000 description 1
- 208000036066 Hemophagocytic Lymphohistiocytosis Diseases 0.000 description 1
- 208000031220 Hemophilia Diseases 0.000 description 1
- 208000032843 Hemorrhage Diseases 0.000 description 1
- 102000008055 Heparan Sulfate Proteoglycans Human genes 0.000 description 1
- 229920002971 Heparan sulfate Polymers 0.000 description 1
- 208000001825 Hereditary elliptocytosis Diseases 0.000 description 1
- 241000224421 Heterolobosea Species 0.000 description 1
- 239000005057 Hexamethylene diisocyanate Substances 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 208000032672 Histiocytosis haematophagic Diseases 0.000 description 1
- 208000010747 Hodgkins lymphoma Diseases 0.000 description 1
- 108700005087 Homeobox Genes Proteins 0.000 description 1
- 108010048671 Homeodomain Proteins Proteins 0.000 description 1
- 102000009331 Homeodomain Proteins Human genes 0.000 description 1
- 101001042227 Homo sapiens Acyl-CoA:lysophosphatidylglycerol acyltransferase 1 Proteins 0.000 description 1
- 101000971171 Homo sapiens Apoptosis regulator Bcl-2 Proteins 0.000 description 1
- 101000901030 Homo sapiens Aspartyl/asparaginyl beta-hydroxylase Proteins 0.000 description 1
- 101100165850 Homo sapiens CA9 gene Proteins 0.000 description 1
- 101000911390 Homo sapiens Coagulation factor VIII Proteins 0.000 description 1
- 101000737052 Homo sapiens Coiled-coil domain-containing protein 54 Proteins 0.000 description 1
- 101000954709 Homo sapiens Doublecortin domain-containing protein 2 Proteins 0.000 description 1
- 101000915399 Homo sapiens Drebrin-like protein Proteins 0.000 description 1
- 101000812663 Homo sapiens Endoplasmin Proteins 0.000 description 1
- 101000886137 Homo sapiens G antigen 1 Proteins 0.000 description 1
- 101000886678 Homo sapiens G antigen 2D Proteins 0.000 description 1
- 101000886136 Homo sapiens G antigen 4 Proteins 0.000 description 1
- 101000985516 Homo sapiens Hermansky-Pudlak syndrome 5 protein Proteins 0.000 description 1
- 101001025337 Homo sapiens High mobility group protein B1 Proteins 0.000 description 1
- 101001053708 Homo sapiens Inhibitor of growth protein 2 Proteins 0.000 description 1
- 101001002470 Homo sapiens Interferon lambda-1 Proteins 0.000 description 1
- 101000853002 Homo sapiens Interleukin-25 Proteins 0.000 description 1
- 101000853000 Homo sapiens Interleukin-26 Proteins 0.000 description 1
- 101000998139 Homo sapiens Interleukin-32 Proteins 0.000 description 1
- 101000614481 Homo sapiens Kidney-associated antigen 1 Proteins 0.000 description 1
- 101001051093 Homo sapiens Low-density lipoprotein receptor Proteins 0.000 description 1
- 101001134060 Homo sapiens Melanocyte-stimulating hormone receptor Proteins 0.000 description 1
- 101001036689 Homo sapiens Melanoma-associated antigen B5 Proteins 0.000 description 1
- 101001036675 Homo sapiens Melanoma-associated antigen B6 Proteins 0.000 description 1
- 101001057159 Homo sapiens Melanoma-associated antigen C3 Proteins 0.000 description 1
- 101000623901 Homo sapiens Mucin-16 Proteins 0.000 description 1
- 101001133081 Homo sapiens Mucin-2 Proteins 0.000 description 1
- 101001128431 Homo sapiens Myeloid-derived growth factor Proteins 0.000 description 1
- 101000604197 Homo sapiens Neuronatin Proteins 0.000 description 1
- 101001114052 Homo sapiens P antigen family member 4 Proteins 0.000 description 1
- 101000874141 Homo sapiens Probable ATP-dependent RNA helicase DDX43 Proteins 0.000 description 1
- 101001136592 Homo sapiens Prostate stem cell antigen Proteins 0.000 description 1
- 101001109419 Homo sapiens RNA-binding protein NOB1 Proteins 0.000 description 1
- 101001062222 Homo sapiens Receptor-binding cancer antigen expressed on SiSo cells Proteins 0.000 description 1
- 101000857677 Homo sapiens Runt-related transcription factor 1 Proteins 0.000 description 1
- 101000821981 Homo sapiens Sarcoma antigen 1 Proteins 0.000 description 1
- 101000665137 Homo sapiens Scm-like with four MBT domains protein 1 Proteins 0.000 description 1
- 101000824971 Homo sapiens Sperm surface protein Sp17 Proteins 0.000 description 1
- 101000648624 Homo sapiens TATA element modulatory factor Proteins 0.000 description 1
- 101000648075 Homo sapiens Trafficking protein particle complex subunit 1 Proteins 0.000 description 1
- 239000004354 Hydroxyethyl cellulose Substances 0.000 description 1
- 229920000663 Hydroxyethyl cellulose Polymers 0.000 description 1
- 206010062767 Hypophysitis Diseases 0.000 description 1
- 101710123134 Ice-binding protein Proteins 0.000 description 1
- 101710082837 Ice-structuring protein Proteins 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 1
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 1
- 238000012404 In vitro experiment Methods 0.000 description 1
- 102100024067 Inhibitor of growth protein 2 Human genes 0.000 description 1
- 108050002021 Integrator complex subunit 2 Proteins 0.000 description 1
- 108010014726 Interferon Type I Proteins 0.000 description 1
- 102000002227 Interferon Type I Human genes 0.000 description 1
- 102100026720 Interferon beta Human genes 0.000 description 1
- 108010047761 Interferon-alpha Proteins 0.000 description 1
- 102000006992 Interferon-alpha Human genes 0.000 description 1
- 108090000467 Interferon-beta Proteins 0.000 description 1
- 102000000589 Interleukin-1 Human genes 0.000 description 1
- 108010002352 Interleukin-1 Proteins 0.000 description 1
- 102000003814 Interleukin-10 Human genes 0.000 description 1
- 108090000174 Interleukin-10 Proteins 0.000 description 1
- 102000013462 Interleukin-12 Human genes 0.000 description 1
- 108010065805 Interleukin-12 Proteins 0.000 description 1
- 102000003816 Interleukin-13 Human genes 0.000 description 1
- 108090000176 Interleukin-13 Proteins 0.000 description 1
- 102100020793 Interleukin-13 receptor subunit alpha-2 Human genes 0.000 description 1
- 101710112634 Interleukin-13 receptor subunit alpha-2 Proteins 0.000 description 1
- 102000003812 Interleukin-15 Human genes 0.000 description 1
- 108090000172 Interleukin-15 Proteins 0.000 description 1
- 102000049772 Interleukin-16 Human genes 0.000 description 1
- 101800003050 Interleukin-16 Proteins 0.000 description 1
- 102000013691 Interleukin-17 Human genes 0.000 description 1
- 108050003558 Interleukin-17 Proteins 0.000 description 1
- 102000003810 Interleukin-18 Human genes 0.000 description 1
- 108090000171 Interleukin-18 Proteins 0.000 description 1
- 102100039879 Interleukin-19 Human genes 0.000 description 1
- 108050009288 Interleukin-19 Proteins 0.000 description 1
- 102000013264 Interleukin-23 Human genes 0.000 description 1
- 108010065637 Interleukin-23 Proteins 0.000 description 1
- 102100036679 Interleukin-26 Human genes 0.000 description 1
- 108010066979 Interleukin-27 Proteins 0.000 description 1
- 108010002386 Interleukin-3 Proteins 0.000 description 1
- 102000000646 Interleukin-3 Human genes 0.000 description 1
- 102100021596 Interleukin-31 Human genes 0.000 description 1
- 101710181613 Interleukin-31 Proteins 0.000 description 1
- 102100033501 Interleukin-32 Human genes 0.000 description 1
- 108010067003 Interleukin-33 Proteins 0.000 description 1
- 102000017761 Interleukin-33 Human genes 0.000 description 1
- 108010002616 Interleukin-5 Proteins 0.000 description 1
- 102000000743 Interleukin-5 Human genes 0.000 description 1
- 108010002586 Interleukin-7 Proteins 0.000 description 1
- 102000000704 Interleukin-7 Human genes 0.000 description 1
- 102000004890 Interleukin-8 Human genes 0.000 description 1
- 108090001007 Interleukin-8 Proteins 0.000 description 1
- 108010002335 Interleukin-9 Proteins 0.000 description 1
- 102000000585 Interleukin-9 Human genes 0.000 description 1
- 102000015696 Interleukins Human genes 0.000 description 1
- 108010063738 Interleukins Proteins 0.000 description 1
- 208000005615 Interstitial Cystitis Diseases 0.000 description 1
- 208000005016 Intestinal Neoplasms Diseases 0.000 description 1
- 206010058142 Intestine transplant rejection Diseases 0.000 description 1
- 208000015710 Iron-Deficiency Anemia Diseases 0.000 description 1
- 208000000209 Isaacs syndrome Diseases 0.000 description 1
- 239000007760 Iscove's Modified Dulbecco's Medium Substances 0.000 description 1
- 102100034872 Kallikrein-4 Human genes 0.000 description 1
- 208000011200 Kawasaki disease Diseases 0.000 description 1
- 101710134365 Kinesin-like protein KIF2A Proteins 0.000 description 1
- 102100023426 Kinesin-like protein KIF2A Human genes 0.000 description 1
- FADYJNXDPBKVCA-UHFFFAOYSA-N L-Phenylalanyl-L-lysin Natural products NCCCCC(C(O)=O)NC(=O)C(N)CC1=CC=CC=C1 FADYJNXDPBKVCA-UHFFFAOYSA-N 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- 239000002147 L01XE04 - Sunitinib Substances 0.000 description 1
- 208000032004 Large-Cell Anaplastic Lymphoma Diseases 0.000 description 1
- 208000007764 Legionnaires' Disease Diseases 0.000 description 1
- 241000222722 Leishmania <genus> Species 0.000 description 1
- 206010024229 Leprosy Diseases 0.000 description 1
- 235000010643 Leucaena leucocephala Nutrition 0.000 description 1
- 240000007472 Leucaena leucocephala Species 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 206010024434 Lichen sclerosus Diseases 0.000 description 1
- 208000012309 Linear IgA disease Diseases 0.000 description 1
- 206010024641 Listeriosis Diseases 0.000 description 1
- 102100024640 Low-density lipoprotein receptor Human genes 0.000 description 1
- 108010074338 Lymphokines Proteins 0.000 description 1
- 102000008072 Lymphokines Human genes 0.000 description 1
- 102100026894 Lymphotoxin-beta Human genes 0.000 description 1
- 108090000362 Lymphotoxin-beta Proteins 0.000 description 1
- JPNRPAJITHRXRH-BQBZGAKWSA-N Lys-Asn Chemical compound NCCCC[C@H](N)C(=O)N[C@H](C(O)=O)CC(N)=O JPNRPAJITHRXRH-BQBZGAKWSA-N 0.000 description 1
- 241001082241 Lythrum hyssopifolia Species 0.000 description 1
- 108010010995 MART-1 Antigen Proteins 0.000 description 1
- 241000829100 Macaca mulatta polyomavirus 1 Species 0.000 description 1
- 108010046938 Macrophage Colony-Stimulating Factor Proteins 0.000 description 1
- 102100028123 Macrophage colony-stimulating factor 1 Human genes 0.000 description 1
- 235000019759 Maize starch Nutrition 0.000 description 1
- 208000032271 Malignant tumor of penis Diseases 0.000 description 1
- 229920000057 Mannan Polymers 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 208000030156 Marburg disease Diseases 0.000 description 1
- 101710118867 Maurocalcin Proteins 0.000 description 1
- 208000000172 Medulloblastoma Diseases 0.000 description 1
- 208000000682 Megaloblastic Anemia Diseases 0.000 description 1
- 241000256853 Megascolia flavifrons Species 0.000 description 1
- 102100034216 Melanocyte-stimulating hormone receptor Human genes 0.000 description 1
- 102100039475 Melanoma-associated antigen B5 Human genes 0.000 description 1
- 102100039483 Melanoma-associated antigen B6 Human genes 0.000 description 1
- 102100027248 Melanoma-associated antigen C3 Human genes 0.000 description 1
- 108010052285 Membrane Proteins Proteins 0.000 description 1
- 102000018697 Membrane Proteins Human genes 0.000 description 1
- 208000027530 Meniere disease Diseases 0.000 description 1
- 206010027202 Meningitis bacterial Diseases 0.000 description 1
- 241000699673 Mesocricetus auratus Species 0.000 description 1
- 108090000015 Mesothelin Proteins 0.000 description 1
- 102000003735 Mesothelin Human genes 0.000 description 1
- DZMGFGQBRYWJOR-YUMQZZPRSA-N Met-Pro Chemical compound CSCC[C@H](N)C(=O)N1CCC[C@H]1C(O)=O DZMGFGQBRYWJOR-YUMQZZPRSA-N 0.000 description 1
- 206010059282 Metastases to central nervous system Diseases 0.000 description 1
- 206010027457 Metastases to liver Diseases 0.000 description 1
- 206010027527 Microangiopathic haemolytic anaemia Diseases 0.000 description 1
- 229920000168 Microcrystalline cellulose Polymers 0.000 description 1
- 229930191564 Monensin Natural products 0.000 description 1
- GAOZTHIDHYLHMS-UHFFFAOYSA-N Monensin A Natural products O1C(CC)(C2C(CC(O2)C2C(CC(C)C(O)(CO)O2)C)C)CCC1C(O1)(C)CCC21CC(O)C(C)C(C(C)C(OC)C(C)C(O)=O)O2 GAOZTHIDHYLHMS-UHFFFAOYSA-N 0.000 description 1
- 208000010190 Monoclonal Gammopathy of Undetermined Significance Diseases 0.000 description 1
- 102000013967 Monokines Human genes 0.000 description 1
- 108010050619 Monokines Proteins 0.000 description 1
- 208000026072 Motor neurone disease Diseases 0.000 description 1
- 241000713333 Mouse mammary tumor virus Species 0.000 description 1
- 229920000715 Mucilage Polymers 0.000 description 1
- 102100034256 Mucin-1 Human genes 0.000 description 1
- 102100023123 Mucin-16 Human genes 0.000 description 1
- 102100034263 Mucin-2 Human genes 0.000 description 1
- 208000034578 Multiple myelomas Diseases 0.000 description 1
- MSFSPUZXLOGKHJ-UHFFFAOYSA-N Muraminsaeure Natural products OC(=O)C(C)OC1C(N)C(O)OC(CO)C1O MSFSPUZXLOGKHJ-UHFFFAOYSA-N 0.000 description 1
- 101100481581 Mus musculus Tlr13 gene Proteins 0.000 description 1
- 206010028424 Myasthenic syndrome Diseases 0.000 description 1
- 241000204031 Mycoplasma Species 0.000 description 1
- 241000204048 Mycoplasma hominis Species 0.000 description 1
- 208000031888 Mycoses Diseases 0.000 description 1
- 201000003793 Myelodysplastic syndrome Diseases 0.000 description 1
- 208000033761 Myelogenous Chronic BCR-ABL Positive Leukemia Diseases 0.000 description 1
- 201000007224 Myeloproliferative neoplasm Diseases 0.000 description 1
- 108060008487 Myosin Proteins 0.000 description 1
- 102000003505 Myosin Human genes 0.000 description 1
- 201000002481 Myositis Diseases 0.000 description 1
- GXCLVBGFBYZDAG-UHFFFAOYSA-N N-[2-(1H-indol-3-yl)ethyl]-N-methylprop-2-en-1-amine Chemical compound CN(CCC1=CNC2=C1C=CC=C2)CC=C GXCLVBGFBYZDAG-UHFFFAOYSA-N 0.000 description 1
- 102000012064 NLR Proteins Human genes 0.000 description 1
- 239000007832 Na2SO4 Substances 0.000 description 1
- 208000006816 Neonatal Sepsis Diseases 0.000 description 1
- 206010072359 Neuromyotonia Diseases 0.000 description 1
- 102100038816 Neuronatin Human genes 0.000 description 1
- 241000714209 Norwalk virus Species 0.000 description 1
- 108010051791 Nuclear Antigens Proteins 0.000 description 1
- 102000019040 Nuclear Antigens Human genes 0.000 description 1
- 239000005642 Oleic acid Substances 0.000 description 1
- ZQPPMHVWECSIRJ-UHFFFAOYSA-N Oleic acid Natural products CCCCCCCCC=CCCCCCCCC(O)=O ZQPPMHVWECSIRJ-UHFFFAOYSA-N 0.000 description 1
- 201000010133 Oligodendroglioma Diseases 0.000 description 1
- 108010038807 Oligopeptides Proteins 0.000 description 1
- 102000015636 Oligopeptides Human genes 0.000 description 1
- 241000243985 Onchocerca volvulus Species 0.000 description 1
- 206010031252 Osteomyelitis Diseases 0.000 description 1
- 206010033078 Otitis media Diseases 0.000 description 1
- 101710093908 Outer capsid protein VP4 Proteins 0.000 description 1
- 101710135467 Outer capsid protein sigma-1 Proteins 0.000 description 1
- 101710116435 Outer membrane protein Proteins 0.000 description 1
- 108010058846 Ovalbumin Proteins 0.000 description 1
- 102100023240 P antigen family member 4 Human genes 0.000 description 1
- 208000025174 PANDAS Diseases 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 206010053869 POEMS syndrome Diseases 0.000 description 1
- 102000036673 PRAME Human genes 0.000 description 1
- 108060006580 PRAME Proteins 0.000 description 1
- 102100034640 PWWP domain-containing DNA repair factor 3A Human genes 0.000 description 1
- 108050007154 PWWP domain-containing DNA repair factor 3A Proteins 0.000 description 1
- 208000021155 Paediatric autoimmune neuropsychiatric disorders associated with streptococcal infection Diseases 0.000 description 1
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 1
- 206010033701 Papillary thyroid cancer Diseases 0.000 description 1
- 235000019483 Peanut oil Nutrition 0.000 description 1
- 208000008223 Pemphigoid Gestationis Diseases 0.000 description 1
- 101000882917 Penaeus paulensis Hemolymph clottable protein Proteins 0.000 description 1
- 229930182555 Penicillin Natural products 0.000 description 1
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 1
- 108010033276 Peptide Fragments Proteins 0.000 description 1
- 102000007079 Peptide Fragments Human genes 0.000 description 1
- 108010013639 Peptidoglycan Proteins 0.000 description 1
- 241000009328 Perro Species 0.000 description 1
- 239000004264 Petrolatum Substances 0.000 description 1
- 208000009565 Pharyngeal Neoplasms Diseases 0.000 description 1
- 206010034811 Pharyngeal cancer Diseases 0.000 description 1
- FADYJNXDPBKVCA-STQMWFEESA-N Phe-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H](N)CC1=CC=CC=C1 FADYJNXDPBKVCA-STQMWFEESA-N 0.000 description 1
- GKZIWHRNKRBEOH-HOTGVXAUSA-N Phe-Phe Chemical compound C([C@H]([NH3+])C(=O)N[C@@H](CC=1C=CC=CC=1)C([O-])=O)C1=CC=CC=C1 GKZIWHRNKRBEOH-HOTGVXAUSA-N 0.000 description 1
- FSXRLASFHBWESK-HOTGVXAUSA-N Phe-Tyr Chemical compound C([C@H](N)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)C1=CC=CC=C1 FSXRLASFHBWESK-HOTGVXAUSA-N 0.000 description 1
- 102100036050 Phosphatidylinositol N-acetylglucosaminyltransferase subunit A Human genes 0.000 description 1
- 241001674048 Phthiraptera Species 0.000 description 1
- 206010035104 Pituitary tumour Diseases 0.000 description 1
- 208000000766 Pityriasis Lichenoides Diseases 0.000 description 1
- 206010048895 Pityriasis lichenoides et varioliformis acuta Diseases 0.000 description 1
- 206010035718 Pneumonia legionella Diseases 0.000 description 1
- 208000005374 Poisoning Diseases 0.000 description 1
- 229920003171 Poly (ethylene oxide) Polymers 0.000 description 1
- 208000008601 Polycythemia Diseases 0.000 description 1
- 229920001214 Polysorbate 60 Polymers 0.000 description 1
- 108700011066 PreScission Protease Proteins 0.000 description 1
- 208000012654 Primary biliary cholangitis Diseases 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- 102100035724 Probable ATP-dependent RNA helicase DDX43 Human genes 0.000 description 1
- 101710114165 Progranulin Proteins 0.000 description 1
- 102100037632 Progranulin Human genes 0.000 description 1
- 102100036691 Proliferating cell nuclear antigen Human genes 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- 102100036735 Prostate stem cell antigen Human genes 0.000 description 1
- 101710176177 Protein A56 Proteins 0.000 description 1
- 206010051292 Protein S Deficiency Diseases 0.000 description 1
- 208000037003 Pseudocroup Diseases 0.000 description 1
- 201000001263 Psoriatic Arthritis Diseases 0.000 description 1
- 208000036824 Psoriatic arthropathy Diseases 0.000 description 1
- 108700014121 Pyruvate Kinase Deficiency of Red Cells Proteins 0.000 description 1
- 235000009001 Quillaja saponaria Nutrition 0.000 description 1
- 241001454523 Quillaja saponaria Species 0.000 description 1
- 101150040459 RAS gene Proteins 0.000 description 1
- 101150076031 RAS1 gene Proteins 0.000 description 1
- 102100022491 RNA-binding protein NOB1 Human genes 0.000 description 1
- 239000012980 RPMI-1640 medium Substances 0.000 description 1
- 206010071141 Rasmussen encephalitis Diseases 0.000 description 1
- 208000004160 Rasmussen subacute encephalitis Diseases 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 208000003782 Raynaud disease Diseases 0.000 description 1
- 208000012322 Raynaud phenomenon Diseases 0.000 description 1
- 102100029165 Receptor-binding cancer antigen expressed on SiSo cells Human genes 0.000 description 1
- 208000015634 Rectal Neoplasms Diseases 0.000 description 1
- 208000033464 Reiter syndrome Diseases 0.000 description 1
- 208000006265 Renal cell carcinoma Diseases 0.000 description 1
- 201000000582 Retinoblastoma Diseases 0.000 description 1
- 102100023606 Retinoic acid receptor alpha Human genes 0.000 description 1
- 206010039207 Rocky Mountain Spotted Fever Diseases 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- 102100025373 Runt-related transcription factor 1 Human genes 0.000 description 1
- 108050003189 SH2B adapter protein 1 Proteins 0.000 description 1
- 241000607729 Salmonella enterica subsp. enterica serovar Abortus Species 0.000 description 1
- 241001222774 Salmonella enterica subsp. enterica serovar Minnesota Species 0.000 description 1
- 102100021466 Sarcoma antigen 1 Human genes 0.000 description 1
- 241000447727 Scabies Species 0.000 description 1
- 206010039587 Scarlet Fever Diseases 0.000 description 1
- 201000010848 Schnitzler Syndrome Diseases 0.000 description 1
- 102100038689 Scm-like with four MBT domains protein 1 Human genes 0.000 description 1
- 101000910357 Scorpio palmatus Maurocalcin Proteins 0.000 description 1
- UJTZHGHXJKIAOS-WHFBIAKZSA-N Ser-Gln Chemical compound OC[C@H](N)C(=O)N[C@H](C(O)=O)CCC(N)=O UJTZHGHXJKIAOS-WHFBIAKZSA-N 0.000 description 1
- LZLREEUGSYITMX-JQWIXIFHSA-N Ser-Trp Chemical compound C1=CC=C2C(C[C@H](NC(=O)[C@H](CO)N)C(O)=O)=CNC2=C1 LZLREEUGSYITMX-JQWIXIFHSA-N 0.000 description 1
- 101710173693 Short transient receptor potential channel 1 Proteins 0.000 description 1
- 208000000453 Skin Neoplasms Diseases 0.000 description 1
- PMZURENOXWZQFD-UHFFFAOYSA-L Sodium Sulfate Chemical compound [Na+].[Na+].[O-]S([O-])(=O)=O PMZURENOXWZQFD-UHFFFAOYSA-L 0.000 description 1
- HVUMOYIDDBPOLL-XWVZOOPGSA-N Sorbitan monostearate Chemical compound CCCCCCCCCCCCCCCCCC(=O)OC[C@@H](O)[C@H]1OC[C@H](O)[C@H]1O HVUMOYIDDBPOLL-XWVZOOPGSA-N 0.000 description 1
- 208000000102 Squamous Cell Carcinoma of Head and Neck Diseases 0.000 description 1
- 102100035748 Squamous cell carcinoma antigen recognized by T-cells 3 Human genes 0.000 description 1
- 101710185775 Squamous cell carcinoma antigen recognized by T-cells 3 Proteins 0.000 description 1
- 241000191940 Staphylococcus Species 0.000 description 1
- 206010072148 Stiff-Person syndrome Diseases 0.000 description 1
- 206010042135 Stomatitis necrotising Diseases 0.000 description 1
- 241000187747 Streptomyces Species 0.000 description 1
- 101710172711 Structural protein Proteins 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- 241000282887 Suidae Species 0.000 description 1
- 108010002687 Survivin Proteins 0.000 description 1
- 208000010265 Sweet syndrome Diseases 0.000 description 1
- 206010042742 Sympathetic ophthalmia Diseases 0.000 description 1
- 108090000054 Syndecan-2 Proteins 0.000 description 1
- 230000024932 T cell mediated immunity Effects 0.000 description 1
- 101150057140 TACSTD1 gene Proteins 0.000 description 1
- 108010032166 TARP Proteins 0.000 description 1
- 102100028866 TATA element modulatory factor Human genes 0.000 description 1
- 239000012317 TBTU Substances 0.000 description 1
- 108700019889 TEL-AML1 fusion Proteins 0.000 description 1
- 208000029246 TEMPI syndrome Diseases 0.000 description 1
- 102100033082 TNF receptor-associated factor 3 Human genes 0.000 description 1
- 101150033985 TPI gene Proteins 0.000 description 1
- 101150032817 TPI1 gene Proteins 0.000 description 1
- 208000001106 Takayasu Arteritis Diseases 0.000 description 1
- 101710192266 Tegument protein VP22 Proteins 0.000 description 1
- 208000024313 Testicular Neoplasms Diseases 0.000 description 1
- 206010057644 Testis cancer Diseases 0.000 description 1
- 210000000447 Th1 cell Anatomy 0.000 description 1
- 210000000068 Th17 cell Anatomy 0.000 description 1
- 210000004241 Th2 cell Anatomy 0.000 description 1
- 208000002903 Thalassemia Diseases 0.000 description 1
- 240000006474 Theobroma bicolor Species 0.000 description 1
- DSGIVWSDDRDJIO-ZXXMMSQZSA-N Thr-Thr Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(O)=O DSGIVWSDDRDJIO-ZXXMMSQZSA-N 0.000 description 1
- 206010043515 Throat cancer Diseases 0.000 description 1
- 108090000190 Thrombin Proteins 0.000 description 1
- 206010043561 Thrombocytopenic purpura Diseases 0.000 description 1
- 208000007536 Thrombosis Diseases 0.000 description 1
- 201000007023 Thrombotic Thrombocytopenic Purpura Diseases 0.000 description 1
- 208000033781 Thyroid carcinoma Diseases 0.000 description 1
- 208000024770 Thyroid neoplasm Diseases 0.000 description 1
- 108010060888 Toll-like receptor 2 Proteins 0.000 description 1
- 206010062129 Tongue neoplasm Diseases 0.000 description 1
- 201000005485 Toxoplasmosis Diseases 0.000 description 1
- 102100025256 Trafficking protein particle complex subunit 1 Human genes 0.000 description 1
- 208000005448 Trichomonas Infections Diseases 0.000 description 1
- 206010044620 Trichomoniasis Diseases 0.000 description 1
- LVTKHGUGBGNBPL-UHFFFAOYSA-N Trp-P-1 Chemical compound N1C2=CC=CC=C2C2=C1C(C)=C(N)N=C2C LVTKHGUGBGNBPL-UHFFFAOYSA-N 0.000 description 1
- 241000223104 Trypanosoma Species 0.000 description 1
- 102100031988 Tumor necrosis factor ligand superfamily member 6 Human genes 0.000 description 1
- 108050002568 Tumor necrosis factor ligand superfamily member 6 Proteins 0.000 description 1
- 102100040418 Tumor protein D52 Human genes 0.000 description 1
- 101710190247 Tumor protein D52 Proteins 0.000 description 1
- 206010054094 Tumour necrosis Diseases 0.000 description 1
- 206010053613 Type IV hypersensitivity reaction Diseases 0.000 description 1
- 101710107540 Type-2 ice-structuring protein Proteins 0.000 description 1
- 102100027244 U4/U6.U5 tri-snRNP-associated protein 1 Human genes 0.000 description 1
- 101710155955 U4/U6.U5 tri-snRNP-associated protein 1 Proteins 0.000 description 1
- 201000006704 Ulcerative Colitis Diseases 0.000 description 1
- 206010046431 Urethral cancer Diseases 0.000 description 1
- 206010046458 Urethral neoplasms Diseases 0.000 description 1
- 208000002495 Uterine Neoplasms Diseases 0.000 description 1
- 241000700618 Vaccinia virus Species 0.000 description 1
- 201000008100 Vaginitis Diseases 0.000 description 1
- 206010046980 Varicella Diseases 0.000 description 1
- 108010067390 Viral Proteins Proteins 0.000 description 1
- 208000027276 Von Willebrand disease Diseases 0.000 description 1
- 241000282485 Vulpes vulpes Species 0.000 description 1
- 206010047741 Vulval cancer Diseases 0.000 description 1
- 208000033559 Waldenström macroglobulinemia Diseases 0.000 description 1
- 201000006449 West Nile encephalitis Diseases 0.000 description 1
- 206010057293 West Nile viral infection Diseases 0.000 description 1
- 208000006110 Wiskott-Aldrich syndrome Diseases 0.000 description 1
- FMGQSPLVSTYWJK-UHFFFAOYSA-N [N-]=[N+]=[N-].CC Chemical compound [N-]=[N+]=[N-].CC FMGQSPLVSTYWJK-UHFFFAOYSA-N 0.000 description 1
- CLZISMQKJZCZDN-UHFFFAOYSA-N [benzotriazol-1-yloxy(dimethylamino)methylidene]-dimethylazanium Chemical compound C1=CC=C2N(OC(N(C)C)=[N+](C)C)N=NC2=C1 CLZISMQKJZCZDN-UHFFFAOYSA-N 0.000 description 1
- DPXJVFZANSGRMM-UHFFFAOYSA-N acetic acid;2,3,4,5,6-pentahydroxyhexanal;sodium Chemical compound [Na].CC(O)=O.OCC(O)C(O)C(O)C(O)C=O DPXJVFZANSGRMM-UHFFFAOYSA-N 0.000 description 1
- 230000021736 acetylation Effects 0.000 description 1
- 238000006640 acetylation reaction Methods 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 208000017733 acquired polycythemia vera Diseases 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 208000021841 acute erythroid leukemia Diseases 0.000 description 1
- 230000010933 acylation Effects 0.000 description 1
- 238000005917 acylation reaction Methods 0.000 description 1
- 239000000853 adhesive Substances 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 208000015230 aggressive NK-cell leukemia Diseases 0.000 description 1
- 230000016571 aggressive behavior Effects 0.000 description 1
- 208000012761 aggressive behavior Diseases 0.000 description 1
- 230000032683 aging Effects 0.000 description 1
- 108010070944 alanylhistidine Proteins 0.000 description 1
- 235000010443 alginic acid Nutrition 0.000 description 1
- 239000000783 alginic acid Substances 0.000 description 1
- 229920000615 alginic acid Polymers 0.000 description 1
- 229960001126 alginic acid Drugs 0.000 description 1
- 150000004781 alginic acids Chemical class 0.000 description 1
- 125000001931 aliphatic group Chemical group 0.000 description 1
- 230000007815 allergy Effects 0.000 description 1
- VREFGVBLTWBCJP-UHFFFAOYSA-N alprazolam Chemical compound C12=CC(Cl)=CC=C2N2C(C)=NN=C2CN=C1C1=CC=CC=C1 VREFGVBLTWBCJP-UHFFFAOYSA-N 0.000 description 1
- 229940037003 alum Drugs 0.000 description 1
- AZDRQVAHHNSJOQ-UHFFFAOYSA-N alumane Chemical class [AlH3] AZDRQVAHHNSJOQ-UHFFFAOYSA-N 0.000 description 1
- 229910052782 aluminium Inorganic materials 0.000 description 1
- XAGFODPZIPBFFR-UHFFFAOYSA-N aluminium Chemical compound [Al] XAGFODPZIPBFFR-UHFFFAOYSA-N 0.000 description 1
- CEGOLXSVJUTHNZ-UHFFFAOYSA-K aluminium tristearate Chemical compound [Al+3].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O CEGOLXSVJUTHNZ-UHFFFAOYSA-K 0.000 description 1
- 229940063655 aluminum stearate Drugs 0.000 description 1
- 230000009435 amidation Effects 0.000 description 1
- 238000007112 amidation reaction Methods 0.000 description 1
- 230000006229 amino acid addition Effects 0.000 description 1
- 125000003277 amino group Chemical group 0.000 description 1
- 125000004103 aminoalkyl group Chemical group 0.000 description 1
- 201000007538 anal carcinoma Diseases 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- 230000019552 anatomical structure morphogenesis Effects 0.000 description 1
- 208000007502 anemia Diseases 0.000 description 1
- 208000022400 anemia due to chronic disease Diseases 0.000 description 1
- 229910052925 anhydrite Inorganic materials 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 150000001450 anions Chemical class 0.000 description 1
- 230000003042 antagnostic effect Effects 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 230000002424 anti-apoptotic effect Effects 0.000 description 1
- 230000000844 anti-bacterial effect Effects 0.000 description 1
- 230000000702 anti-platelet effect Effects 0.000 description 1
- 230000005809 anti-tumor immunity Effects 0.000 description 1
- 230000006023 anti-tumor response Effects 0.000 description 1
- 239000003146 anticoagulant agent Substances 0.000 description 1
- 230000030741 antigen processing and presentation Effects 0.000 description 1
- 230000014102 antigen processing and presentation of exogenous peptide antigen via MHC class I Effects 0.000 description 1
- 239000002246 antineoplastic agent Substances 0.000 description 1
- 229940041181 antineoplastic drug Drugs 0.000 description 1
- 239000003816 antisense DNA Substances 0.000 description 1
- 239000000074 antisense oligonucleotide Substances 0.000 description 1
- 238000012230 antisense oligonucleotides Methods 0.000 description 1
- 230000005975 antitumor immune response Effects 0.000 description 1
- 238000003782 apoptosis assay Methods 0.000 description 1
- 239000012062 aqueous buffer Substances 0.000 description 1
- 230000010516 arginylation Effects 0.000 description 1
- 206010003246 arthritis Diseases 0.000 description 1
- 229940009098 aspartate Drugs 0.000 description 1
- 108010047857 aspartylglycine Proteins 0.000 description 1
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 1
- 201000008937 atopic dermatitis Diseases 0.000 description 1
- 208000010668 atopic eczema Diseases 0.000 description 1
- 201000004984 autoimmune cardiomyopathy Diseases 0.000 description 1
- 208000027625 autoimmune inner ear disease Diseases 0.000 description 1
- 201000004339 autoimmune neuropathy Diseases 0.000 description 1
- 201000005011 autoimmune peripheral neuropathy Diseases 0.000 description 1
- 201000011385 autoimmune polyendocrine syndrome Diseases 0.000 description 1
- 201000009780 autoimmune polyendocrine syndrome type 2 Diseases 0.000 description 1
- 206010071572 autoimmune progesterone dermatitis Diseases 0.000 description 1
- 201000004982 autoimmune uveitis Diseases 0.000 description 1
- 208000022362 bacterial infectious disease Diseases 0.000 description 1
- 201000009904 bacterial meningitis Diseases 0.000 description 1
- 239000013602 bacteriophage vector Substances 0.000 description 1
- 230000004888 barrier function Effects 0.000 description 1
- 210000000270 basal cell Anatomy 0.000 description 1
- 210000002469 basement membrane Anatomy 0.000 description 1
- 239000011324 bead Substances 0.000 description 1
- 235000019445 benzyl alcohol Nutrition 0.000 description 1
- 102000015736 beta 2-Microglobulin Human genes 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- UCMIRNVEIXFBKS-UHFFFAOYSA-N beta-alanine Chemical group NCCC(O)=O UCMIRNVEIXFBKS-UHFFFAOYSA-N 0.000 description 1
- 230000003115 biocidal effect Effects 0.000 description 1
- 230000031018 biological processes and functions Effects 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 230000008512 biological response Effects 0.000 description 1
- 238000005460 biophysical method Methods 0.000 description 1
- NXVYSVARUKNFNF-NXEZZACHSA-N bis(2,5-dioxopyrrolidin-1-yl) (2r,3r)-2,3-dihydroxybutanedioate Chemical compound O=C([C@H](O)[C@@H](O)C(=O)ON1C(CCC1=O)=O)ON1C(=O)CCC1=O NXVYSVARUKNFNF-NXEZZACHSA-N 0.000 description 1
- LNQHREYHFRFJAU-UHFFFAOYSA-N bis(2,5-dioxopyrrolidin-1-yl) pentanedioate Chemical compound O=C1CCC(=O)N1OC(=O)CCCC(=O)ON1C(=O)CCC1=O LNQHREYHFRFJAU-UHFFFAOYSA-N 0.000 description 1
- VYLDEYYOISNGST-UHFFFAOYSA-N bissulfosuccinimidyl suberate Chemical compound O=C1C(S(=O)(=O)O)CC(=O)N1OC(=O)CCCCCCC(=O)ON1C(=O)C(S(O)(=O)=O)CC1=O VYLDEYYOISNGST-UHFFFAOYSA-N 0.000 description 1
- 201000000053 blastoma Diseases 0.000 description 1
- 230000000740 bleeding effect Effects 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 230000008499 blood brain barrier function Effects 0.000 description 1
- 210000000601 blood cell Anatomy 0.000 description 1
- 201000001383 blood group incompatibility Diseases 0.000 description 1
- 210000004204 blood vessel Anatomy 0.000 description 1
- 210000001218 blood-brain barrier Anatomy 0.000 description 1
- 238000006664 bond formation reaction Methods 0.000 description 1
- 210000000988 bone and bone Anatomy 0.000 description 1
- 229940098773 bovine serum albumin Drugs 0.000 description 1
- 210000004556 brain Anatomy 0.000 description 1
- 201000008275 breast carcinoma Diseases 0.000 description 1
- 150000001649 bromium compounds Chemical class 0.000 description 1
- 208000003362 bronchogenic carcinoma Diseases 0.000 description 1
- 208000016335 bubo Diseases 0.000 description 1
- 239000008366 buffered solution Substances 0.000 description 1
- 108010025307 buforin II Proteins 0.000 description 1
- 208000000594 bullous pemphigoid Diseases 0.000 description 1
- 229960005069 calcium Drugs 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- 229910001622 calcium bromide Inorganic materials 0.000 description 1
- 229910000019 calcium carbonate Inorganic materials 0.000 description 1
- WGEFECGEFUFIQW-UHFFFAOYSA-L calcium dibromide Chemical compound [Ca+2].[Br-].[Br-] WGEFECGEFUFIQW-UHFFFAOYSA-L 0.000 description 1
- AXCZMVOFGPJBDE-UHFFFAOYSA-L calcium dihydroxide Chemical compound [OH-].[OH-].[Ca+2] AXCZMVOFGPJBDE-UHFFFAOYSA-L 0.000 description 1
- 239000000920 calcium hydroxide Substances 0.000 description 1
- 229910001861 calcium hydroxide Inorganic materials 0.000 description 1
- BMLSTPRTEKLIPM-UHFFFAOYSA-I calcium;potassium;disodium;hydrogen carbonate;dichloride;dihydroxide;hydrate Chemical compound O.[OH-].[OH-].[Na+].[Na+].[Cl-].[Cl-].[K+].[Ca+2].OC([O-])=O BMLSTPRTEKLIPM-UHFFFAOYSA-I 0.000 description 1
- ZEWYCNBZMPELPF-UHFFFAOYSA-J calcium;potassium;sodium;2-hydroxypropanoic acid;sodium;tetrachloride Chemical compound [Na].[Na+].[Cl-].[Cl-].[Cl-].[Cl-].[K+].[Ca+2].CC(O)C(O)=O ZEWYCNBZMPELPF-UHFFFAOYSA-J 0.000 description 1
- 238000009566 cancer vaccine Methods 0.000 description 1
- 229940095731 candida albicans Drugs 0.000 description 1
- 201000003984 candidiasis Diseases 0.000 description 1
- 239000004202 carbamide Substances 0.000 description 1
- TWFZGCMQGLPBSX-UHFFFAOYSA-N carbendazim Chemical compound C1=CC=C2NC(NC(=O)OC)=NC2=C1 TWFZGCMQGLPBSX-UHFFFAOYSA-N 0.000 description 1
- 150000001718 carbodiimides Chemical class 0.000 description 1
- 229910052799 carbon Inorganic materials 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-N carbonic acid Chemical class OC(O)=O BVKZGUZCCUSVTD-UHFFFAOYSA-N 0.000 description 1
- 150000004649 carbonic acid derivatives Chemical class 0.000 description 1
- 150000007942 carboxylates Chemical class 0.000 description 1
- 208000002458 carcinoid tumor Diseases 0.000 description 1
- 239000004359 castor oil Substances 0.000 description 1
- 235000019438 castor oil Nutrition 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 229920006317 cationic polymer Polymers 0.000 description 1
- 150000001768 cations Chemical class 0.000 description 1
- 230000020411 cell activation Effects 0.000 description 1
- 230000010261 cell growth Effects 0.000 description 1
- 239000013592 cell lysate Substances 0.000 description 1
- 230000006037 cell lysis Effects 0.000 description 1
- 210000003855 cell nucleus Anatomy 0.000 description 1
- 238000001516 cell proliferation assay Methods 0.000 description 1
- 238000002659 cell therapy Methods 0.000 description 1
- 210000002421 cell wall Anatomy 0.000 description 1
- 230000007969 cellular immunity Effects 0.000 description 1
- 230000036755 cellular response Effects 0.000 description 1
- 235000010980 cellulose Nutrition 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 229920002301 cellulose acetate Polymers 0.000 description 1
- 210000003169 central nervous system Anatomy 0.000 description 1
- 229940083181 centrally acting adntiadrenergic agent methyldopa Drugs 0.000 description 1
- 229940081733 cetearyl alcohol Drugs 0.000 description 1
- 208000003796 chancre Diseases 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 238000007385 chemical modification Methods 0.000 description 1
- 208000003167 cholangitis Diseases 0.000 description 1
- 201000005795 chronic inflammatory demyelinating polyneuritis Diseases 0.000 description 1
- 208000025302 chronic primary adrenal insufficiency Diseases 0.000 description 1
- 230000015271 coagulation Effects 0.000 description 1
- 238000005345 coagulation Methods 0.000 description 1
- 229920001436 collagen Polymers 0.000 description 1
- 210000001072 colon Anatomy 0.000 description 1
- 208000029742 colonic neoplasm Diseases 0.000 description 1
- 239000003086 colorant Substances 0.000 description 1
- 201000010989 colorectal carcinoma Diseases 0.000 description 1
- 238000002648 combination therapy Methods 0.000 description 1
- 201000003056 complement component 2 deficiency Diseases 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 239000003184 complementary RNA Substances 0.000 description 1
- 201000004440 congenital dyserythropoietic anemia Diseases 0.000 description 1
- 208000011664 congenital factor XI deficiency Diseases 0.000 description 1
- 210000000795 conjunctiva Anatomy 0.000 description 1
- 208000010247 contact dermatitis Diseases 0.000 description 1
- 238000011254 conventional chemotherapy Methods 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 235000005687 corn oil Nutrition 0.000 description 1
- 239000002285 corn oil Substances 0.000 description 1
- 210000004087 cornea Anatomy 0.000 description 1
- 230000002596 correlated effect Effects 0.000 description 1
- 235000012343 cottonseed oil Nutrition 0.000 description 1
- 239000002385 cottonseed oil Substances 0.000 description 1
- 210000004748 cultured cell Anatomy 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 208000004921 cutaneous lupus erythematosus Diseases 0.000 description 1
- 125000004122 cyclic group Chemical group 0.000 description 1
- 231100000135 cytotoxicity Toxicity 0.000 description 1
- 230000003013 cytotoxicity Effects 0.000 description 1
- 108010025838 dectin 1 Proteins 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 239000003405 delayed action preparation Substances 0.000 description 1
- 230000003111 delayed effect Effects 0.000 description 1
- 229940124447 delivery agent Drugs 0.000 description 1
- 230000017858 demethylation Effects 0.000 description 1
- 238000010520 demethylation reaction Methods 0.000 description 1
- 206010061811 demyelinating polyneuropathy Diseases 0.000 description 1
- 201000001981 dermatomyositis Diseases 0.000 description 1
- 230000001687 destabilization Effects 0.000 description 1
- 206010012601 diabetes mellitus Diseases 0.000 description 1
- 235000005911 diet Nutrition 0.000 description 1
- 230000037213 diet Effects 0.000 description 1
- 235000014113 dietary fatty acids Nutrition 0.000 description 1
- 238000009792 diffusion process Methods 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- FRTGEIHSCHXMTI-UHFFFAOYSA-N dimethyl octanediimidate Chemical compound COC(=N)CCCCCCC(=N)OC FRTGEIHSCHXMTI-UHFFFAOYSA-N 0.000 description 1
- LRPQMNYCTSPGCX-UHFFFAOYSA-N dimethyl pimelimidate Chemical compound COC(=N)CCCCCC(=N)OC LRPQMNYCTSPGCX-UHFFFAOYSA-N 0.000 description 1
- XEYBRNLFEZDVAW-ARSRFYASSA-N dinoprostone Chemical compound CCCCC[C@H](O)\C=C\[C@H]1[C@H](O)CC(=O)[C@@H]1C\C=C/CCCC(O)=O XEYBRNLFEZDVAW-ARSRFYASSA-N 0.000 description 1
- 229960002986 dinoprostone Drugs 0.000 description 1
- FSXRLASFHBWESK-UHFFFAOYSA-N dipeptide phenylalanyl-tyrosine Natural products C=1C=C(O)C=CC=1CC(C(O)=O)NC(=O)C(N)CC1=CC=CC=C1 FSXRLASFHBWESK-UHFFFAOYSA-N 0.000 description 1
- 206010013023 diphtheria Diseases 0.000 description 1
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 1
- 208000037765 diseases and disorders Diseases 0.000 description 1
- ZWIBGKZDAWNIFC-UHFFFAOYSA-N disuccinimidyl suberate Chemical compound O=C1CCC(=O)N1OC(=O)CCCCCCC(=O)ON1C(=O)CCC1=O ZWIBGKZDAWNIFC-UHFFFAOYSA-N 0.000 description 1
- 239000000890 drug combination Substances 0.000 description 1
- 239000012636 effector Substances 0.000 description 1
- 230000008030 elimination Effects 0.000 description 1
- 238000003379 elimination reaction Methods 0.000 description 1
- 201000008184 embryoma Diseases 0.000 description 1
- 230000001804 emulsifying effect Effects 0.000 description 1
- 239000008387 emulsifying waxe Substances 0.000 description 1
- 239000012645 endogenous antigen Substances 0.000 description 1
- 210000002472 endoplasmic reticulum Anatomy 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 230000002708 enhancing effect Effects 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 229940088598 enzyme Drugs 0.000 description 1
- 201000001564 eosinophilic gastroenteritis Diseases 0.000 description 1
- 201000011114 epidermolysis bullosa acquisita Diseases 0.000 description 1
- 208000001606 epiglottitis Diseases 0.000 description 1
- 210000000981 epithelium Anatomy 0.000 description 1
- 231100000321 erythema Toxicity 0.000 description 1
- 201000004101 esophageal cancer Diseases 0.000 description 1
- BEFDCLMNVWHSGT-UHFFFAOYSA-N ethenylcyclopentane Chemical compound C=CC1CCCC1 BEFDCLMNVWHSGT-UHFFFAOYSA-N 0.000 description 1
- 235000019325 ethyl cellulose Nutrition 0.000 description 1
- 229920001249 ethyl cellulose Polymers 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 230000007717 exclusion Effects 0.000 description 1
- 230000029142 excretion Effects 0.000 description 1
- 208000021045 exocrine pancreatic carcinoma Diseases 0.000 description 1
- 210000003414 extremity Anatomy 0.000 description 1
- 210000001508 eye Anatomy 0.000 description 1
- 201000007219 factor XI deficiency Diseases 0.000 description 1
- 239000003925 fat Substances 0.000 description 1
- 229930195729 fatty acid Natural products 0.000 description 1
- 239000000194 fatty acid Substances 0.000 description 1
- 150000004665 fatty acids Chemical class 0.000 description 1
- 210000004700 fetal blood Anatomy 0.000 description 1
- 229940012952 fibrinogen Drugs 0.000 description 1
- 239000000796 flavoring agent Substances 0.000 description 1
- 238000000799 fluorescence microscopy Methods 0.000 description 1
- OVBPIULPVIDEAO-LBPRGKRZSA-N folic acid Chemical compound C=1N=C2NC(N)=NC(=O)C2=NC=1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 OVBPIULPVIDEAO-LBPRGKRZSA-N 0.000 description 1
- 201000010175 gallbladder cancer Diseases 0.000 description 1
- GIVLTTJNORAZON-HDBOBKCLSA-N ganglioside GM2 (18:0) Chemical compound O[C@@H]1[C@@H](O)[C@H](OC[C@H](NC(=O)CCCCCCCCCCCCCCCCC)[C@H](O)\C=C\CCCCCCCCCCCCC)O[C@H](CO)[C@H]1O[C@H]1[C@H](O)[C@@H](O[C@]2(O[C@H]([C@H](NC(C)=O)[C@@H](O)C2)[C@H](O)[C@H](O)CO)C(O)=O)[C@@H](O[C@H]2[C@@H]([C@@H](O)[C@@H](O)[C@@H](CO)O2)NC(C)=O)[C@@H](CO)O1 GIVLTTJNORAZON-HDBOBKCLSA-N 0.000 description 1
- 208000010749 gastric carcinoma Diseases 0.000 description 1
- 238000001476 gene delivery Methods 0.000 description 1
- 238000001415 gene therapy Methods 0.000 description 1
- 201000006592 giardiasis Diseases 0.000 description 1
- 235000001727 glucose Nutrition 0.000 description 1
- 229930195712 glutamate Natural products 0.000 description 1
- 125000005456 glyceride group Chemical group 0.000 description 1
- ZEMPKEQAKRGZGQ-XOQCFJPHSA-N glycerol triricinoleate Natural products CCCCCC[C@@H](O)CC=CCCCCCCCC(=O)OC[C@@H](COC(=O)CCCCCCCC=CC[C@@H](O)CCCCCC)OC(=O)CCCCCCCC=CC[C@H](O)CCCCCC ZEMPKEQAKRGZGQ-XOQCFJPHSA-N 0.000 description 1
- 108010084264 glycyl-glycyl-cysteine Proteins 0.000 description 1
- 108010067216 glycyl-glycyl-glycine Proteins 0.000 description 1
- 108010001064 glycyl-glycyl-glycyl-glycine Proteins 0.000 description 1
- 208000024908 graft versus host disease Diseases 0.000 description 1
- 238000003306 harvesting Methods 0.000 description 1
- 201000000459 head and neck squamous cell carcinoma Diseases 0.000 description 1
- 210000002216 heart Anatomy 0.000 description 1
- 239000000185 hemagglutinin Substances 0.000 description 1
- 201000011066 hemangioma Diseases 0.000 description 1
- 201000005787 hematologic cancer Diseases 0.000 description 1
- 230000002489 hematologic effect Effects 0.000 description 1
- 208000024200 hematopoietic and lymphoid system neoplasm Diseases 0.000 description 1
- 210000003958 hematopoietic stem cell Anatomy 0.000 description 1
- 230000002949 hemolytic effect Effects 0.000 description 1
- 208000014752 hemophagocytic syndrome Diseases 0.000 description 1
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 1
- 206010066957 hepatosplenic T-cell lymphoma Diseases 0.000 description 1
- 208000009601 hereditary spherocytosis Diseases 0.000 description 1
- 239000000833 heterodimer Substances 0.000 description 1
- 238000005734 heterodimerization reaction Methods 0.000 description 1
- RRAMGCGOFNQTLD-UHFFFAOYSA-N hexamethylene diisocyanate Chemical compound O=C=NCCCCCCN=C=O RRAMGCGOFNQTLD-UHFFFAOYSA-N 0.000 description 1
- FUZZWVXGSFPDMH-UHFFFAOYSA-M hexanoate Chemical compound CCCCCC([O-])=O FUZZWVXGSFPDMH-UHFFFAOYSA-M 0.000 description 1
- 208000002557 hidradenitis Diseases 0.000 description 1
- 201000007162 hidradenitis suppurativa Diseases 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- 208000029080 human African trypanosomiasis Diseases 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- 229920002674 hyaluronan Polymers 0.000 description 1
- 229940099552 hyaluronan Drugs 0.000 description 1
- KIUKXJAPPMFGSW-MNSSHETKSA-N hyaluronan Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)C1O[C@H]1[C@H](O)[C@@H](O)[C@H](O[C@H]2[C@@H](C(O[C@H]3[C@@H]([C@@H](O)[C@H](O)[C@H](O3)C(O)=O)O)[C@H](O)[C@@H](CO)O2)NC(C)=O)[C@@H](C(O)=O)O1 KIUKXJAPPMFGSW-MNSSHETKSA-N 0.000 description 1
- 150000007857 hydrazones Chemical class 0.000 description 1
- 125000001183 hydrocarbyl group Chemical group 0.000 description 1
- 239000000017 hydrogel Substances 0.000 description 1
- 238000004191 hydrophobic interaction chromatography Methods 0.000 description 1
- 150000004679 hydroxides Chemical class 0.000 description 1
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 1
- NPZTUJOABDZTLV-UHFFFAOYSA-N hydroxybenzotriazole Substances O=C1C=CC=C2NNN=C12 NPZTUJOABDZTLV-UHFFFAOYSA-N 0.000 description 1
- 235000019447 hydroxyethyl cellulose Nutrition 0.000 description 1
- 230000033444 hydroxylation Effects 0.000 description 1
- 238000005805 hydroxylation reaction Methods 0.000 description 1
- 230000009610 hypersensitivity Effects 0.000 description 1
- 201000004108 hypersplenism Diseases 0.000 description 1
- 150000002463 imidates Chemical group 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 230000003053 immunization Effects 0.000 description 1
- 238000002649 immunization Methods 0.000 description 1
- 238000003018 immunoassay Methods 0.000 description 1
- 238000003365 immunocytochemistry Methods 0.000 description 1
- 230000006054 immunological memory Effects 0.000 description 1
- 239000002955 immunomodulating agent Substances 0.000 description 1
- 239000007943 implant Substances 0.000 description 1
- 238000002513 implantation Methods 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000011065 in-situ storage Methods 0.000 description 1
- 201000008319 inclusion body myositis Diseases 0.000 description 1
- 210000002074 inflammatory monocyte Anatomy 0.000 description 1
- 230000028709 inflammatory response Effects 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 239000007972 injectable composition Substances 0.000 description 1
- 229940102223 injectable solution Drugs 0.000 description 1
- 229940102213 injectable suspension Drugs 0.000 description 1
- 229910052500 inorganic mineral Inorganic materials 0.000 description 1
- 102000004114 interleukin 20 Human genes 0.000 description 1
- 108090000681 interleukin 20 Proteins 0.000 description 1
- 108010074108 interleukin-21 Proteins 0.000 description 1
- 108010074109 interleukin-22 Proteins 0.000 description 1
- 102000003898 interleukin-24 Human genes 0.000 description 1
- 108090000237 interleukin-24 Proteins 0.000 description 1
- 229940047122 interleukins Drugs 0.000 description 1
- 208000036971 interstitial lung disease 2 Diseases 0.000 description 1
- 201000002313 intestinal cancer Diseases 0.000 description 1
- 238000010212 intracellular staining Methods 0.000 description 1
- 239000007928 intraperitoneal injection Substances 0.000 description 1
- 230000002601 intratumoral effect Effects 0.000 description 1
- 150000004694 iodide salts Chemical class 0.000 description 1
- 238000004255 ion exchange chromatography Methods 0.000 description 1
- 239000012948 isocyanate Substances 0.000 description 1
- 150000002513 isocyanates Chemical class 0.000 description 1
- QXJSBBXBKPUZAA-UHFFFAOYSA-N isooleic acid Natural products CCCCCCCC=CCCCCCCCCC(O)=O QXJSBBXBKPUZAA-UHFFFAOYSA-N 0.000 description 1
- 201000002215 juvenile rheumatoid arthritis Diseases 0.000 description 1
- 108010024383 kallikrein 4 Proteins 0.000 description 1
- MJRDGTVDJKACQZ-VKHMYHEASA-N l-photo-leucine Chemical compound OC(=O)[C@@H](N)CC1(C)N=N1 MJRDGTVDJKACQZ-VKHMYHEASA-N 0.000 description 1
- 238000002372 labelling Methods 0.000 description 1
- 208000030175 lameness Diseases 0.000 description 1
- 201000004962 larynx cancer Diseases 0.000 description 1
- 235000010445 lecithin Nutrition 0.000 description 1
- 239000000787 lecithin Substances 0.000 description 1
- 229940067606 lecithin Drugs 0.000 description 1
- 210000000265 leukocyte Anatomy 0.000 description 1
- 206010024378 leukocytosis Diseases 0.000 description 1
- 201000011486 lichen planus Diseases 0.000 description 1
- 238000001638 lipofection Methods 0.000 description 1
- 239000012669 liquid formulation Substances 0.000 description 1
- 239000007791 liquid phase Substances 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 230000033001 locomotion Effects 0.000 description 1
- 238000001325 log-rank test Methods 0.000 description 1
- 230000005923 long-lasting effect Effects 0.000 description 1
- 231100000053 low toxicity Toxicity 0.000 description 1
- 239000007937 lozenge Substances 0.000 description 1
- 201000005249 lung adenocarcinoma Diseases 0.000 description 1
- 201000005243 lung squamous cell carcinoma Diseases 0.000 description 1
- 210000002751 lymph Anatomy 0.000 description 1
- 210000001165 lymph node Anatomy 0.000 description 1
- 230000002101 lytic effect Effects 0.000 description 1
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 1
- 208000026037 malignant tumor of neck Diseases 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- LUEWUZLMQUOBSB-GFVSVBBRSA-N mannan Chemical class O[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@@H](O[C@@H]2[C@H](O[C@@H](O[C@H]3[C@H](O[C@@H](O)[C@@H](O)[C@H]3O)CO)[C@@H](O)[C@H]2O)CO)[C@H](O)[C@H]1O LUEWUZLMQUOBSB-GFVSVBBRSA-N 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 238000004949 mass spectrometry Methods 0.000 description 1
- 108010077372 mast cell degranulating peptide Proteins 0.000 description 1
- QMBRLNFAEHGOLY-UHFFFAOYSA-N mcd peptide Chemical compound N1C(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(CCCCN)NC(=O)C(N)C(C)CC)CSSCC(C(=O)NCC(=O)NC(CCCCN)C(=O)NC(CC(N)=O)C(N)=O)NC(=O)C(C(C)CC)NC(=O)C(CCCCN)NC(=O)C(CCCNC(N)=N)NC(=O)C(NC(=O)C(C(C)CC)NC(=O)C(CC2N=CN=C2)NC(=O)C2CCCN2C(=O)C(CCCCN)NC(=O)C(C(C)CC)NC(=O)C(C(C)C)NC2=O)CSSCC1C(=O)NC(CCCCN)C(=O)NC(CCCNC(N)=N)C(=O)NC2CC1C=NC=N1 QMBRLNFAEHGOLY-UHFFFAOYSA-N 0.000 description 1
- 231100001016 megaloblastic anemia Toxicity 0.000 description 1
- 206010027191 meningioma Diseases 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- TWXDDNPPQUTEOV-FVGYRXGTSA-N methamphetamine hydrochloride Chemical compound Cl.CN[C@@H](C)CC1=CC=CC=C1 TWXDDNPPQUTEOV-FVGYRXGTSA-N 0.000 description 1
- 208000005135 methemoglobinemia Diseases 0.000 description 1
- MBAXWTVHCRPVFW-UHFFFAOYSA-N methyl 3-[(3-imino-3-methoxypropyl)disulfanyl]propanimidate Chemical compound COC(=N)CCSSCCC(=N)OC MBAXWTVHCRPVFW-UHFFFAOYSA-N 0.000 description 1
- 229920000609 methyl cellulose Polymers 0.000 description 1
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 1
- 239000004292 methyl p-hydroxybenzoate Substances 0.000 description 1
- 235000010270 methyl p-hydroxybenzoate Nutrition 0.000 description 1
- 230000011987 methylation Effects 0.000 description 1
- 238000007069 methylation reaction Methods 0.000 description 1
- 235000010981 methylcellulose Nutrition 0.000 description 1
- 239000001923 methylcellulose Substances 0.000 description 1
- 235000019813 microcrystalline cellulose Nutrition 0.000 description 1
- 229940016286 microcrystalline cellulose Drugs 0.000 description 1
- 239000008108 microcrystalline cellulose Substances 0.000 description 1
- 238000000520 microinjection Methods 0.000 description 1
- 208000008275 microscopic colitis Diseases 0.000 description 1
- 235000010755 mineral Nutrition 0.000 description 1
- 239000011707 mineral Substances 0.000 description 1
- 229940042472 mineral oil Drugs 0.000 description 1
- 208000015994 miscarriage Diseases 0.000 description 1
- 230000002297 mitogenic effect Effects 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 108091005601 modified peptides Proteins 0.000 description 1
- 208000008588 molluscum contagiosum Diseases 0.000 description 1
- 229960005358 monensin Drugs 0.000 description 1
- GAOZTHIDHYLHMS-KEOBGNEYSA-N monensin A Chemical compound C([C@@](O1)(C)[C@H]2CC[C@@](O2)(CC)[C@H]2[C@H](C[C@@H](O2)[C@@H]2[C@H](C[C@@H](C)[C@](O)(CO)O2)C)C)C[C@@]21C[C@H](O)[C@@H](C)[C@@H]([C@@H](C)[C@@H](OC)[C@H](C)C(O)=O)O2 GAOZTHIDHYLHMS-KEOBGNEYSA-N 0.000 description 1
- 201000005328 monoclonal gammopathy of uncertain significance Diseases 0.000 description 1
- 208000005264 motor neuron disease Diseases 0.000 description 1
- 229940051875 mucins Drugs 0.000 description 1
- 208000001725 mucocutaneous lymph node syndrome Diseases 0.000 description 1
- 201000006417 multiple sclerosis Diseases 0.000 description 1
- 231100000350 mutagenesis Toxicity 0.000 description 1
- 206010028417 myasthenia gravis Diseases 0.000 description 1
- 201000005962 mycosis fungoides Diseases 0.000 description 1
- 206010028537 myelofibrosis Diseases 0.000 description 1
- 208000025113 myeloid leukemia Diseases 0.000 description 1
- 230000007498 myristoylation Effects 0.000 description 1
- QCQYVCMYGCHVMR-AAZUGDAUSA-N n-[(2r,3r,4s,5r)-4,5,6-trihydroxy-1-oxo-3-[(2r,3r,4s,5r,6r)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxyhexan-2-yl]acetamide Chemical compound CC(=O)N[C@@H](C=O)[C@H]([C@@H](O)[C@H](O)CO)O[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O QCQYVCMYGCHVMR-AAZUGDAUSA-N 0.000 description 1
- OHDXDNUPVVYWOV-UHFFFAOYSA-N n-methyl-1-(2-naphthalen-1-ylsulfanylphenyl)methanamine Chemical compound CNCC1=CC=CC=C1SC1=CC=CC2=CC=CC=C12 OHDXDNUPVVYWOV-UHFFFAOYSA-N 0.000 description 1
- 239000002105 nanoparticle Substances 0.000 description 1
- 210000000822 natural killer cell Anatomy 0.000 description 1
- 210000003739 neck Anatomy 0.000 description 1
- 208000025440 neoplasm of neck Diseases 0.000 description 1
- 210000005170 neoplastic cell Anatomy 0.000 description 1
- 210000003061 neural cell Anatomy 0.000 description 1
- 230000001537 neural effect Effects 0.000 description 1
- 201000001119 neuropathy Diseases 0.000 description 1
- 230000007823 neuropathy Effects 0.000 description 1
- 238000006386 neutralization reaction Methods 0.000 description 1
- 230000003472 neutralizing effect Effects 0.000 description 1
- 208000004235 neutropenia Diseases 0.000 description 1
- 210000000440 neutrophil Anatomy 0.000 description 1
- 201000008585 noma Diseases 0.000 description 1
- YZUUTMGDONTGTN-UHFFFAOYSA-N nonaethylene glycol Chemical compound OCCOCCOCCOCCOCCOCCOCCOCCOCCO YZUUTMGDONTGTN-UHFFFAOYSA-N 0.000 description 1
- 239000002687 nonaqueous vehicle Substances 0.000 description 1
- 230000002560 nonimmunologic effect Effects 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 210000001331 nose Anatomy 0.000 description 1
- 235000015097 nutrients Nutrition 0.000 description 1
- GLDOVTGHNKAZLK-UHFFFAOYSA-N octadecan-1-ol Chemical compound CCCCCCCCCCCCCCCCCCO GLDOVTGHNKAZLK-UHFFFAOYSA-N 0.000 description 1
- 208000003177 ocular onchocerciasis Diseases 0.000 description 1
- 239000002674 ointment Substances 0.000 description 1
- ZQPPMHVWECSIRJ-KTKRTIGZSA-N oleic acid Chemical compound CCCCCCCC\C=C/CCCCCCCC(O)=O ZQPPMHVWECSIRJ-KTKRTIGZSA-N 0.000 description 1
- 229940046166 oligodeoxynucleotide Drugs 0.000 description 1
- 238000006384 oligomerization reaction Methods 0.000 description 1
- 229920001542 oligosaccharide Polymers 0.000 description 1
- 150000002482 oligosaccharides Chemical class 0.000 description 1
- 229940006093 opthalmologic coloring agent diagnostic Drugs 0.000 description 1
- 210000003463 organelle Anatomy 0.000 description 1
- 150000002891 organic anions Chemical class 0.000 description 1
- 230000008520 organization Effects 0.000 description 1
- 229940092253 ovalbumin Drugs 0.000 description 1
- 230000002611 ovarian Effects 0.000 description 1
- 230000003647 oxidation Effects 0.000 description 1
- 238000007254 oxidation reaction Methods 0.000 description 1
- 239000001301 oxygen Substances 0.000 description 1
- 229910052760 oxygen Inorganic materials 0.000 description 1
- 230000000242 pagocytic effect Effects 0.000 description 1
- 201000005580 palindromic rheumatism Diseases 0.000 description 1
- 210000000496 pancreas Anatomy 0.000 description 1
- 201000002528 pancreatic cancer Diseases 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 208000017262 paroxysmal cold hemoglobinuria Diseases 0.000 description 1
- 201000003045 paroxysmal nocturnal hemoglobinuria Diseases 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 239000000312 peanut oil Substances 0.000 description 1
- 230000006320 pegylation Effects 0.000 description 1
- MCYTYTUNNNZWOK-LCLOTLQISA-N penetratin Chemical compound C([C@H](NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)CCCNC(N)=N)[C@@H](C)CC)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(N)=O)C1=CC=CC=C1 MCYTYTUNNNZWOK-LCLOTLQISA-N 0.000 description 1
- 108010043655 penetratin Proteins 0.000 description 1
- 229940049954 penicillin Drugs 0.000 description 1
- MXHCPCSDRGLRER-UHFFFAOYSA-N pentaglycine Chemical compound NCC(=O)NCC(=O)NCC(=O)NCC(=O)NCC(O)=O MXHCPCSDRGLRER-UHFFFAOYSA-N 0.000 description 1
- 210000005259 peripheral blood Anatomy 0.000 description 1
- 239000011886 peripheral blood Substances 0.000 description 1
- 208000033808 peripheral neuropathy Diseases 0.000 description 1
- 210000001322 periplasm Anatomy 0.000 description 1
- 229940066842 petrolatum Drugs 0.000 description 1
- 239000008238 pharmaceutical water Substances 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- 239000012071 phase Substances 0.000 description 1
- 108010073025 phenylalanylphenylalanine Proteins 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 239000002953 phosphate buffered saline Substances 0.000 description 1
- 150000003905 phosphatidylinositols Chemical class 0.000 description 1
- 229910052698 phosphorus Inorganic materials 0.000 description 1
- 239000002504 physiological saline solution Substances 0.000 description 1
- 231100000572 poisoning Toxicity 0.000 description 1
- 230000000607 poisoning effect Effects 0.000 description 1
- 229920000729 poly(L-lysine) polymer Polymers 0.000 description 1
- 108010011110 polyarginine Proteins 0.000 description 1
- 208000037244 polycythemia vera Diseases 0.000 description 1
- 229920001601 polyetherimide Polymers 0.000 description 1
- 239000004626 polylactic acid Substances 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 102000040430 polynucleotide Human genes 0.000 description 1
- 108091033319 polynucleotide Proteins 0.000 description 1
- 239000002157 polynucleotide Substances 0.000 description 1
- 229920005862 polyol Polymers 0.000 description 1
- 150000003077 polyols Chemical class 0.000 description 1
- 235000010989 polyoxyethylene sorbitan monostearate Nutrition 0.000 description 1
- 239000001818 polyoxyethylene sorbitan monostearate Substances 0.000 description 1
- 239000003910 polypeptide antibiotic agent Substances 0.000 description 1
- 229940113124 polysorbate 60 Drugs 0.000 description 1
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 239000011736 potassium bicarbonate Substances 0.000 description 1
- 229910000028 potassium bicarbonate Inorganic materials 0.000 description 1
- 229910000027 potassium carbonate Inorganic materials 0.000 description 1
- TYJJADVDDVDEDZ-UHFFFAOYSA-M potassium hydrogencarbonate Chemical compound [K+].OC([O-])=O TYJJADVDDVDEDZ-UHFFFAOYSA-M 0.000 description 1
- OTYBMLCTZGSZBG-UHFFFAOYSA-L potassium sulfate Chemical compound [K+].[K+].[O-]S([O-])(=O)=O OTYBMLCTZGSZBG-UHFFFAOYSA-L 0.000 description 1
- 229910052939 potassium sulfate Inorganic materials 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 230000013823 prenylation Effects 0.000 description 1
- 230000003449 preventive effect Effects 0.000 description 1
- 201000009395 primary hyperaldosteronism Diseases 0.000 description 1
- 238000011809 primate model Methods 0.000 description 1
- 230000037452 priming Effects 0.000 description 1
- 238000004393 prognosis Methods 0.000 description 1
- 230000005522 programmed cell death Effects 0.000 description 1
- 230000000750 progressive effect Effects 0.000 description 1
- 230000007126 proinflammatory cytokine response Effects 0.000 description 1
- 230000000770 proinflammatory effect Effects 0.000 description 1
- 230000000069 prophylactic effect Effects 0.000 description 1
- 239000004405 propyl p-hydroxybenzoate Substances 0.000 description 1
- 235000010232 propyl p-hydroxybenzoate Nutrition 0.000 description 1
- 235000013772 propylene glycol Nutrition 0.000 description 1
- QELSKZZBTMNZEB-UHFFFAOYSA-N propylparaben Chemical compound CCCOC(=O)C1=CC=C(O)C=C1 QELSKZZBTMNZEB-UHFFFAOYSA-N 0.000 description 1
- XEYBRNLFEZDVAW-UHFFFAOYSA-N prostaglandin E2 Natural products CCCCCC(O)C=CC1C(O)CC(=O)C1CC=CCCCC(O)=O XEYBRNLFEZDVAW-UHFFFAOYSA-N 0.000 description 1
- 208000023958 prostate neoplasm Diseases 0.000 description 1
- 235000019833 protease Nutrition 0.000 description 1
- 235000019419 proteases Nutrition 0.000 description 1
- 125000006239 protecting group Chemical group 0.000 description 1
- 238000000751 protein extraction Methods 0.000 description 1
- 238000001742 protein purification Methods 0.000 description 1
- 230000002797 proteolythic effect Effects 0.000 description 1
- 208000005069 pulmonary fibrosis Diseases 0.000 description 1
- 208000009954 pyoderma gangrenosum Diseases 0.000 description 1
- 230000006340 racemization Effects 0.000 description 1
- 230000005855 radiation Effects 0.000 description 1
- 102000016914 ras Proteins Human genes 0.000 description 1
- 208000002574 reactive arthritis Diseases 0.000 description 1
- 238000003259 recombinant expression Methods 0.000 description 1
- 230000007115 recruitment Effects 0.000 description 1
- 206010038038 rectal cancer Diseases 0.000 description 1
- 208000020615 rectal carcinoma Diseases 0.000 description 1
- 230000000306 recurrent effect Effects 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 210000003289 regulatory T cell Anatomy 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 238000005067 remediation Methods 0.000 description 1
- 201000010174 renal carcinoma Diseases 0.000 description 1
- 238000009877 rendering Methods 0.000 description 1
- 230000010076 replication Effects 0.000 description 1
- 230000000754 repressing effect Effects 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 238000002271 resection Methods 0.000 description 1
- 229950010550 resiquimod Drugs 0.000 description 1
- BXNMTOQRYBFHNZ-UHFFFAOYSA-N resiquimod Chemical compound C1=CC=CC2=C(N(C(COCC)=N3)CC(C)(C)O)C3=C(N)N=C21 BXNMTOQRYBFHNZ-UHFFFAOYSA-N 0.000 description 1
- 108091008726 retinoic acid receptors α Proteins 0.000 description 1
- 230000001177 retroviral effect Effects 0.000 description 1
- 201000003068 rheumatic fever Diseases 0.000 description 1
- 108091092562 ribozyme Proteins 0.000 description 1
- 238000007363 ring formation reaction Methods 0.000 description 1
- 235000002020 sage Nutrition 0.000 description 1
- 229930182490 saponin Natural products 0.000 description 1
- 150000007949 saponins Chemical class 0.000 description 1
- 235000017709 saponins Nutrition 0.000 description 1
- 201000000306 sarcoidosis Diseases 0.000 description 1
- 208000005687 scabies Diseases 0.000 description 1
- 201000000980 schizophrenia Diseases 0.000 description 1
- 239000002795 scorpion venom Substances 0.000 description 1
- 206010039766 scrub typhus Diseases 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 150000003354 serine derivatives Chemical class 0.000 description 1
- 206010040400 serum sickness Diseases 0.000 description 1
- 239000008159 sesame oil Substances 0.000 description 1
- 235000011803 sesame oil Nutrition 0.000 description 1
- 208000007056 sickle cell anemia Diseases 0.000 description 1
- 230000019491 signal transduction Effects 0.000 description 1
- 230000011664 signaling Effects 0.000 description 1
- 239000000377 silicon dioxide Substances 0.000 description 1
- 235000020374 simple syrup Nutrition 0.000 description 1
- 201000000849 skin cancer Diseases 0.000 description 1
- 201000008261 skin carcinoma Diseases 0.000 description 1
- 201000002612 sleeping sickness Diseases 0.000 description 1
- 208000000587 small cell lung carcinoma Diseases 0.000 description 1
- 210000000813 small intestine Anatomy 0.000 description 1
- 208000014680 small intestine neoplasm Diseases 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- 229910000030 sodium bicarbonate Inorganic materials 0.000 description 1
- 229910000029 sodium carbonate Inorganic materials 0.000 description 1
- 235000019812 sodium carboxymethyl cellulose Nutrition 0.000 description 1
- 229920001027 sodium carboxymethylcellulose Polymers 0.000 description 1
- 239000008354 sodium chloride injection Substances 0.000 description 1
- 229940080313 sodium starch Drugs 0.000 description 1
- 229910052938 sodium sulfate Inorganic materials 0.000 description 1
- VUFNRPJNRFOTGK-UHFFFAOYSA-M sodium;1-[4-[(2,5-dioxopyrrol-1-yl)methyl]cyclohexanecarbonyl]oxy-2,5-dioxopyrrolidine-3-sulfonate Chemical compound [Na+].O=C1C(S(=O)(=O)[O-])CC(=O)N1OC(=O)C1CCC(CN2C(C=CC2=O)=O)CC1 VUFNRPJNRFOTGK-UHFFFAOYSA-M 0.000 description 1
- HHSGWIABCIVPJT-UHFFFAOYSA-M sodium;1-[4-[(2-iodoacetyl)amino]benzoyl]oxy-2,5-dioxopyrrolidine-3-sulfonate Chemical compound [Na+].O=C1C(S(=O)(=O)[O-])CC(=O)N1OC(=O)C1=CC=C(NC(=O)CI)C=C1 HHSGWIABCIVPJT-UHFFFAOYSA-M 0.000 description 1
- 210000004872 soft tissue Anatomy 0.000 description 1
- 239000008247 solid mixture Substances 0.000 description 1
- 238000010532 solid phase synthesis reaction Methods 0.000 description 1
- 238000005063 solubilization Methods 0.000 description 1
- 230000007928 solubilization Effects 0.000 description 1
- 239000004334 sorbic acid Substances 0.000 description 1
- 235000010199 sorbic acid Nutrition 0.000 description 1
- 229940075582 sorbic acid Drugs 0.000 description 1
- 235000011069 sorbitan monooleate Nutrition 0.000 description 1
- 239000001593 sorbitan monooleate Substances 0.000 description 1
- 229940035049 sorbitan monooleate Drugs 0.000 description 1
- 235000011076 sorbitan monostearate Nutrition 0.000 description 1
- 239000001587 sorbitan monostearate Substances 0.000 description 1
- 229940035048 sorbitan monostearate Drugs 0.000 description 1
- 238000001228 spectrum Methods 0.000 description 1
- 206010062113 splenic marginal zone lymphoma Diseases 0.000 description 1
- 210000004988 splenocyte Anatomy 0.000 description 1
- 208000000995 spontaneous abortion Diseases 0.000 description 1
- 230000002269 spontaneous effect Effects 0.000 description 1
- 239000007921 spray Substances 0.000 description 1
- 206010041823 squamous cell carcinoma Diseases 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 229940032147 starch Drugs 0.000 description 1
- 210000000130 stem cell Anatomy 0.000 description 1
- 239000008174 sterile solution Substances 0.000 description 1
- 201000000498 stomach carcinoma Diseases 0.000 description 1
- 238000005556 structure-activity relationship Methods 0.000 description 1
- 229960002317 succinimide Drugs 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 125000001273 sulfonato group Chemical group [O-]S(*)(=O)=O 0.000 description 1
- 150000003467 sulfuric acid derivatives Chemical class 0.000 description 1
- WINHZLLDWRZWRT-ATVHPVEESA-N sunitinib Chemical compound CCN(CC)CCNC(=O)C1=C(C)NC(\C=C/2C3=CC(F)=CC=C3NC\2=O)=C1C WINHZLLDWRZWRT-ATVHPVEESA-N 0.000 description 1
- 229960001796 sunitinib Drugs 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 238000013268 sustained release Methods 0.000 description 1
- 239000003765 sweetening agent Substances 0.000 description 1
- 230000002195 synergetic effect Effects 0.000 description 1
- 238000007910 systemic administration Methods 0.000 description 1
- 230000009885 systemic effect Effects 0.000 description 1
- 239000000454 talc Substances 0.000 description 1
- 229910052623 talc Inorganic materials 0.000 description 1
- 235000012222 talc Nutrition 0.000 description 1
- 239000003760 tallow Substances 0.000 description 1
- 238000002626 targeted therapy Methods 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- BWMISRWJRUSYEX-SZKNIZGXSA-N terbinafine hydrochloride Chemical compound Cl.C1=CC=C2C(CN(C\C=C\C#CC(C)(C)C)C)=CC=CC2=C1 BWMISRWJRUSYEX-SZKNIZGXSA-N 0.000 description 1
- 125000005931 tert-butyloxycarbonyl group Chemical group [H]C([H])([H])C(OC(*)=O)(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- 201000003120 testicular cancer Diseases 0.000 description 1
- 210000001550 testis Anatomy 0.000 description 1
- MHXBHWLGRWOABW-UHFFFAOYSA-N tetradecyl octadecanoate Chemical compound CCCCCCCCCCCCCCCCCC(=O)OCCCCCCCCCCCCCC MHXBHWLGRWOABW-UHFFFAOYSA-N 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- 150000007970 thio esters Chemical class 0.000 description 1
- ATGUDZODTABURZ-UHFFFAOYSA-N thiolan-2-ylideneazanium;chloride Chemical compound Cl.N=C1CCCS1 ATGUDZODTABURZ-UHFFFAOYSA-N 0.000 description 1
- 229960004072 thrombin Drugs 0.000 description 1
- 201000002510 thyroid cancer Diseases 0.000 description 1
- 208000013077 thyroid gland carcinoma Diseases 0.000 description 1
- 208000030045 thyroid gland papillary carcinoma Diseases 0.000 description 1
- 201000004647 tinea pedis Diseases 0.000 description 1
- 239000003970 toll like receptor agonist Substances 0.000 description 1
- 201000006134 tongue cancer Diseases 0.000 description 1
- 239000012049 topical pharmaceutical composition Substances 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 230000002463 transducing effect Effects 0.000 description 1
- 102000035160 transmembrane proteins Human genes 0.000 description 1
- 108091005703 transmembrane proteins Proteins 0.000 description 1
- 208000009174 transverse myelitis Diseases 0.000 description 1
- 230000001960 triggered effect Effects 0.000 description 1
- 201000002311 trypanosomiasis Diseases 0.000 description 1
- 230000005951 type IV hypersensitivity Effects 0.000 description 1
- 208000027930 type IV hypersensitivity disease Diseases 0.000 description 1
- 241000701447 unidentified baculovirus Species 0.000 description 1
- 241001430294 unidentified retrovirus Species 0.000 description 1
- 210000003708 urethra Anatomy 0.000 description 1
- 201000005112 urinary bladder cancer Diseases 0.000 description 1
- 230000002568 urticarial effect Effects 0.000 description 1
- 206010046766 uterine cancer Diseases 0.000 description 1
- 206010046885 vaginal cancer Diseases 0.000 description 1
- 208000013139 vaginal neoplasm Diseases 0.000 description 1
- 210000005166 vasculature Anatomy 0.000 description 1
- 235000015112 vegetable and seed oil Nutrition 0.000 description 1
- 239000008158 vegetable oil Substances 0.000 description 1
- 230000009385 viral infection Effects 0.000 description 1
- 239000013603 viral vector Substances 0.000 description 1
- 230000009278 visceral effect Effects 0.000 description 1
- 208000002670 vitamin B12 deficiency Diseases 0.000 description 1
- 208000012137 von Willebrand disease (hereditary or acquired) Diseases 0.000 description 1
- 201000005102 vulva cancer Diseases 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
- 239000003871 white petrolatum Substances 0.000 description 1
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/30—Macromolecular organic or inorganic compounds, e.g. inorganic polyphosphates
- A61K47/42—Proteins; Polypeptides; Degradation products thereof; Derivatives thereof, e.g. albumin, gelatin or zein
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70517—CD8
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/04—Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
- A61K38/10—Peptides having 12 to 20 amino acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/177—Receptors; Cell surface antigens; Cell surface determinants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/18—Growth factors; Growth regulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/385—Haptens or antigens, bound to carriers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/19—Dendritic cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/20—Cellular immunotherapy characterised by the effect or the function of the cells
- A61K40/24—Antigen-presenting cells [APC]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4271—Melanoma antigens
- A61K40/4273—Glycoprotein 100 [Gp100]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4277—Fusion proteins originating from gene translocation in cancer cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
- A61K47/6425—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent the peptide or protein in the drug conjugate being a receptor, e.g. CD4, a cell surface antigen, i.e. not a peptide ligand targeting the antigen, or a cell surface determinant, i.e. a part of the surface of a cell
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/6811—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
- A61K47/6865—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell the tumour determinant being from skin, nerves or brain cancer cell
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/475—Growth factors; Growth regulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70514—CD4
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K19/00—Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
- C07K7/04—Linear peptides containing only normal peptide links
- C07K7/06—Linear peptides containing only normal peptide links having 5 to 11 amino acids
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
- C07K7/04—Linear peptides containing only normal peptide links
- C07K7/08—Linear peptides containing only normal peptide links having 12 to 20 amino acids
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/10—Cells modified by introduction of foreign genetic material
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/515—Animal cells
- A61K2039/5154—Antigen presenting cells [APCs], e.g. dendritic cells or macrophages
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/60—Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
- A61K2039/6031—Proteins
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/10—Fusion polypeptide containing a localisation/targetting motif containing a tag for extracellular membrane crossing, e.g. TAT or VP22
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/33—Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/40—Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/16011—Herpesviridae
- C12N2710/16211—Lymphocryptovirus, e.g. human herpesvirus 4, Epstein-Barr Virus
- C12N2710/16233—Use of viral protein as therapeutic agent other than vaccine, e.g. apoptosis inducing or anti-inflammatory
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- the present invention relates to the field of cell penetrating peptides, in particular as means for delivering a cargo into a cell, for example in biological and medical applications.
- the present invention also relates to complexes comprising the cell penetrating peptide and a cargo molecule and to the use of such complexes in medical applications such as the prevention and/or treatment of various human diseases, including infectious diseases and cancers.
- the basic function of the cell membrane of eukaryotic cells is to protect the cell from its surroundings. Accordingly, the cell membrane tightly controls the movement of substances in and out from cells. Some very small compounds, such as certain molecules and ions, for example carbon dioxide (CO 2 ) and oxygen (O 2 ), can move across the cell membrane by diffusion. However, for other molecules and ions, the membrane acts as a barrier. If exogenously applied substances, such as drugs or nutrients, mediate their effects by or after cellular uptake, e.g., from the blood or from the gut, transport of those substances across the cell membrane must be ensured.
- CO 2 carbon dioxide
- O 2 oxygen
- Immunotherapy is the prevention or treatment of a disease by inducing, enhancing or suppressing an immune response.
- a modification, in particular an induction or enhancement, of the immune response is typically mediated by cellular uptake of the administered antigen or antigenic epitope and presentation of said antigen or antigenic epitope at the surface of the cell in the context of major histocompatibility complex (MHC) class I and/or MHC class II.
- MHC major histocompatibility complex
- cell penetration is also an essential prerequisite for signal transduction therapy, for therapies influencing transcription and translation, e.g. tumor therapy based on modulation of transcription and translation, and, possibly, for gene therapy (cf. Reissmann S., 2015, Journal of peptide science, 2014, 20(10): 760-784).
- CPPs cell penetrating peptides
- cell penetrating peptides are (short) peptides that are able to transport different types of cargo molecules across the cell membrane, and, thus, facilitate cellular uptake of various molecular cargoes (from nanosize particles to small chemical molecules and large fragments of DNA).
- the cargo is associated with the peptides either through chemical linkage via covalent bonds or through non-covalent interactions.
- Cell penetrating peptides typically have an amino acid composition that either contains a high relative abundance of positively charged amino acids such as lysine or arginine or have a sequence that contains an alternating pattern of polar/charged amino acids and non-polar, hydrophobic amino acids. These two types of structures are referred to as polycationic or amphipathic, respectively.
- Cell-Penetrating peptides are of different sizes, amino acid sequences, and charges, but all CPPs have a common characteristic that is the ability to translocate the plasma membrane and facilitate the delivery of various molecular cargoes to the cytoplasm or to an organelle of a cell.
- CPP translocation distinguish three main entry mechanisms: direct penetration in the membrane, endocytosis-mediated entry, and translocation through the formation of a transitory structure (Jafari S, Solmaz M D, Khosro A, 2015, Bioimpacts 5(2): 103-111; Madani F, Lindberg S, Langel Ü, Futaki S, Gräslund A, 2011, J Biophys: 414729).
- CPP transduction is an area of ongoing research.
- Cell-penetrating peptides have found numerous applications in medicine as drug delivery agents in the treatment of different diseases including cancer and virus inhibitors, as well as contrast agents for cell labeling and imaging.
- the first 16-mer peptide CPP called Penetratin was characterized from the third helix of the homeodomain of Antennapedia (Derossi, D., et al., The third helix of the Antennapedia homeodomain translocates through biological membranes. J Biol Chem, 1994. 269(14): p. 10444-50), followed in 1998 by the identification of the minimal domain of TAT required for protein transduction (Vives, E., P. Brodin, and B. Lebleu, A truncated HIV-1 Tat protein basic domain rapidly translocates through the plasma membrane and accumulates in the cell nucleus. J Biol Chem, 1997. 272(25): p. 16010-7).
- VP22 Elliott, G. and P. O'Hare, Intercellular trafficking and protein delivery by a herpesvirus structural protein. Cell, 1997. 88(2): p. 223-33
- ZEBRA Rothe, R., et al., Characterization of the cell-penetrating properties of the Epstein-Barr virus ZEBRA trans-activator. J Biol Chem, 2010. 285(26): p. 20224-33
- melittin Dempsey, C.E., The actions of melittin on membranes.
- crotamine Nascimento, F. D., et al., Crotamine mediates gene delivery into cells through the binding to heparan sulfate proteoglycans. J Biol Chem, 2007. 282(29): p. 21349-60
- buforin Kobayashi, S., et al., Membrane translocation mechanism of the antimicrobial peptide buforin 2. Biochemistry, 2004. 43(49): p. 15610-6).
- Synthetic CPPs were also designed including the poly-arginine (R8, R9, R10 and R12) (Futaki, S., et al., Arginine-rich peptides. An abundant source of membrane-permeable peptides having potential as carriers for intracellular protein delivery. J Biol Chem, 2001. 276(8): p. 5836-40) or transportan (Pooga, M., et al., Cell penetration by transportan. FASEB J, 1998. 12(1): p. 67-77).
- auxiliary compounds or charged polymers such as PEIs
- all these auxiliary compounds may be cytotoxic and, thus, cause severe side-effects in a clinical application. To avoid such endosomal trapping, it was searched for new CPPs with non-endosomal uptake mechanisms.
- ZEBRA a protein, which is responsible for the initiation of the Epstein-Barr virus lytic cycle and which belongs to the basic leucine zipper (bZIP) family of transcription factors, crosses the cell membrane in a pathway largely independent of endocytosis (Rothe, R., et al., Characterization of the cell-penetrating properties of the Epstein-Barr virus ZEBRA trans-activator. J Biol Chem, 2010. 285(26): p. 20224-33). Moreover, Rothe et al. identified a minimal domain (MD) of ZEBRA, which is required for internalization.
- MD minimal domain
- WO 2014/041505 A1 discloses improved cell penetrating peptides, which are derived from ZEBRA's minimal domain and which are 15 to 30 amino acids long.
- the cell penetrating peptides disclosed in WO 2014/041505 A1 are considerably shorter than ZEBRA's minimal domain.
- the fragments of ZEBRA's minimal domain, which 15 to 30 amino acids long as disclosed in WO 2014/041505 A1 provide a higher immunogenic potential as compared to shorter and longer fragments of ZEBRA's minimal domain.
- the term “comprise”, and variations such as “comprises” and “comprising”, will be understood to imply the inclusion of a stated member, integer or step but not the exclusion of any other non-stated member, integer or step.
- the term “consist of” is a particular embodiment of the term “comprise”, wherein any other non-stated member, integer or step is excluded. In the context of the present invention, the term “comprise” encompasses the term “consist of”.
- the term “comprising” thus encompasses “including” as well as “consisting” e.g., a composition “comprising” X may consist exclusively of X or may include something additional e.g., X+Y.
- peptide refers to peptide, oligopeptide, oligomer or protein including fusion protein, respectively, comprising at least two amino acids joined to each other preferably by a normal peptide bond, or, alternatively, by a modified peptide bond, such as for example in the cases of isosteric peptides.
- a peptide, polypeptide or protein can be composed of L-amino acids and/or D-amino acids.
- a peptide, polypeptide or protein is either (entirely) composed of L-amino acids or (entirely) of D-amino acids, thereby forming “retro-inverso peptide sequences”.
- the term “retro-inverso (peptide) sequences” refers to an isomer of a linear peptide sequence in which the direction of the sequence is reversed and the chirality of each amino acid residue is inverted (see e.g. Jameson et al., Nature, 368,744-746 (1994); Brady et al., Nature, 368,692-693 (1994)).
- peptide also include “peptidomimetics” which are defined as peptide analogs containing non-peptidic structural elements, which peptides are capable of mimicking or antagonizing the biological action(s) of a natural parent peptide.
- a peptidomimetic lacks classical peptide characteristics such as enzymatically scissile peptide bonds.
- a peptide, polypeptide or protein can comprise amino acids other than the 20 amino acids defined by the genetic code in addition to these amino acids, or it can be composed of amino acids other than the 20 amino acids defined by the genetic code.
- a peptide, polypeptide or protein in the context of the present invention can equally be composed of amino acids modified by natural processes, such as post-translational maturation processes or by chemical processes, which are well known to a person skilled in the art. Such modifications are fully detailed in the literature. These modifications can appear anywhere in the polypeptide: in the peptide skeleton, in the amino acid chain or even at the carboxy- or amino-terminal ends.
- a peptide or polypeptide can be branched following an ubiquitination or be cyclic with or without branching. This type of modification can be the result of natural or synthetic post-translational processes that are well known to a person skilled in the art.
- peptide in the context of the present invention in particular also include modified peptides, polypeptides and proteins.
- peptide, polypeptide or protein modifications can include acetylation, acylation, ADP-ribosylation, amidation, covalent fixation of a nucleotide or of a nucleotide derivative, covalent fixation of a lipid or of a lipidic derivative, the covalent fixation of a phosphatidylinositol, covalent or non-covalent cross-linking, cyclization, disulfide bond formation, demethylation, glycosylation including pegylation, hydroxylation, iodization, methylation, myristoylation, oxidation, proteolytic processes, phosphorylation, prenylation, racemization, seneloylation, sulfatation, amino acid addition such as arginylation or ubiquitination.
- classical peptides, polypeptides or proteins are preferred.
- a “classical” peptide, polypeptide or protein is typically composed of amino acids selected from the 20 amino acids defined by the genetic code, linked to each other by a normal peptide bond.
- the present invention provides a cell penetrating peptide (CPP) comprising an amino acid sequence sharing at least 80% sequence identity with SEQ ID NO: 1, wherein the amino acid sequence sharing at least 80% sequence identity with SEQ ID NO:1:
- CPP cell penetrating peptide
- Such a CPP allows for efficient delivery, i.e. transport and loading, in particular of at least one antigen or antigenic epitope, into cells, in particular into the antigen presenting cells (APCs), more preferably into dendritic cells (DCs) and, thus, to the dendritic cells' antigen processing machinery.
- APCs antigen presenting cells
- DCs dendritic cells
- the present inventors have surprisingly found that a CPP according to the present invention is unexpectedly superior to the cell penetrating peptides disclosed in WO 2014/041505 A1 as shown in the Examples of the present specification—in particular in in vivo settings, such as in tumor/cancer applications.
- cell penetrating peptides refers to (short) peptides that are able to transport different types of cargo molecules across plasma membrane, and, thus, facilitate cellular uptake of various molecular cargoes (from nanosize particles to small chemical molecules and large fragments of DNA).
- CPPs cell penetrating peptides
- PTDs protein transduction domain
- Cell penetrating functionality (or cellular internalization), of the cell penetrating peptide or complex comprising said cell penetrating peptide, according to the invention can be checked by standard methods known to one skilled in the art, including flow cytometry or fluorescence microscopy of live and fixed cells, immunocytochemistry of cells transduced with said peptide or complex, and Western blot.
- Cellular internalization of the cargo molecule linked to the cell penetrating peptide generally means transport of the cargo molecule across the plasma membrane and thus entry of the cargo molecule into the cell.
- the cargo molecule can, then, be released in the cytoplasm, directed to an intracellular organelle, or further presented at the cell surface.
- the cell penetrating peptide comprises an amino acid sequence sharing at least 80% sequence identity with SEQ ID NO: 1:
- SEQ ID NO: 1 shows a peptide having a length of 42 amino acids, which corresponds to amino acids 178 to 219 of ZEBRA (SEQ ID NO: 2)—except that the cysteine (Cys) at position 189 in the ZEBRA amino acid sequence is substituted by a serine (Ser). This serine, which is located at position 12 of SEQ ID NO: 1, is shown underlined in SEQ ID NO: 1 above.
- the peptide according to SEQ ID NO: 1 has cell penetrating functionality as described herein, since it represents a large part of ZEBRA's minimal domain.
- the cell penetrating peptide according to SEQ ID NO: 1 is also referred to herein as “Z13”.
- ZEBRA also known as Zta, Z, EB1, or BZLF1 generally means the basic-leucine zipper (bZIP) transcriptional activator of the Epstein-Barr virus (EBV).
- bZIP basic-leucine zipper
- EBV Epstein-Barr virus
- the amino acid sequence of ZEBRA is disclosed under NCBI accession number YP_401673 and comprises 245 amino acids represented in SEQ ID NO: 2:
- Amino acids 178 to 219 of ZEBRA which correspond to SEQ ID NO: 1—except that the cysteine (Cys) at position 189 in the ZEBRA amino acid sequence is substituted by a serine (Ser)—are shown underlined.
- an amino acid sequence “sharing a sequence identity” of at least, for example, 80% with a query amino acid sequence of the present invention is intended to mean that the sequence of the subject amino acid sequence is identical to the query sequence except that the subject amino acid sequence may include up to twenty (in the present example of 80%) amino acid mutations per each 100 amino acids of the query amino acid sequence.
- up to 20% (20 of 100) of the amino acid residues in the subject sequence may be deleted, inserted or substituted with another amino acid.
- a “% identity” of a first sequence may be determined with respect to a second sequence.
- the sequences are aligned such that they give a maximum correlation between the sequences. This may include inserting “gaps” in either one or both sequences, to enhance the degree of alignment.
- a % identity may then be determined over the whole length of each of the sequences being compared (so-called global alignment), that is particularly suitable for sequences of the same or similar length, or over shorter, defined lengths (so-called local alignment), that is more suitable for sequences of unequal length.
- mutation relates to a change in the nucleic acid sequence and/or in the amino acid sequence in comparison to a reference sequence, e.g. a corresponding naturally occurring sequence.
- a mutation e.g. in comparison to a naturally occurring sequence, may be, for example, a spontaneous mutation, an induced mutation, e.g. induced by enzymes, chemicals or radiation, or a mutation obtained by site-directed mutagenesis (molecular biology methods for making specific and intentional changes in the nucleic acid sequence and/or in the amino acid sequence).
- mutation or “mutating” shall be understood to also include physically making a mutation, e.g. in a nucleic acid sequence or in an amino acid sequence.
- a mutation includes substitution, deletion and insertion of one or more nucleotides or amino acids as well as inversion of several successive nucleotides or amino acids.
- a mutation may be introduced into the nucleotide sequence encoding said amino acid sequence in order to express a (recombinant) mutated polypeptide.
- a mutation may be achieved e.g., by altering, e.g., by site-directed mutagenesis, a codon of a nucleic acid molecule encoding one amino acid to result in a codon encoding a different amino acid, or by synthesizing a sequence variant, e.g., by knowing the nucleotide sequence of a nucleic acid molecule encoding a polypeptide and by designing the synthesis of a nucleic acid molecule comprising a nucleotide sequence encoding a variant of the polypeptide without the need for mutating one or more nucleotides of a nucleic acid molecule.
- substitution mutations in the amino acid sequence sharing at least 80% sequence identity with SEQ ID NO: 1 in comparison to SEQ ID NO: 1 are substitution mutations.
- substitutions for one or more amino acids present in the referenced amino acid sequence should be made conservatively.
- conservative substitutions include substitution of one aliphatic residue for another, such as Ile, Val, Leu, or Ala for one another, or substitutions of one polar residue for another, such as between Lys and Arg; Glu and Asp; or Gln and Asn.
- Other such conservative substitutions for example, substitutions of entire regions having similar hydrophobicity properties, are well known (Kyte and Doolittle, 1982, J. Mol. Biol. 157(1):105-132).
- amino acid sequence sharing at least 80% sequence identity with SEQ ID NO: 1 (i) either no amino acid mutation is present in comparison to SEQ ID NO: 1 (100% identity) or, (ii) at least one of the amino acids of SEQ ID NO: 1 selected from the group consisting of Y3, N5, Q18, L19, L20, Q21, H22, Y23, E25, S31, S32, E33, N34, and D35 is mutated (deleted, inserted or substituted; positions indicated in respect to SEQ ID NO: 1) but none of the other amino acids is mutated (deleted, inserted or substituted).
- substitution mutations are preferred and conservative substitutions as described above are particularly preferred.
- the serine at position 12 of SEQ ID NO: 1 (S12) must not be mutated.
- CPP according to the present invention comprises an amino acid sequence sharing at least 80% sequence identity with SEQ ID NO: 1; and SEQ ID NO: 1 is 42 amino acids long, up to 8 amino acids may be mutated.
- the minimum length of the sequence sharing at least 80% sequence identity with SEQ ID NO: 1 is 36 amino acids, and, therefore, up to six amino acids may be deleted, but up to eight amino acids may be inserted or substituted.
- an amino acid selected from the group consisting of Y3, N5, Q18, L19, L20, Q21, H22, Y23, E25, S31, S32, E33, N34, and D35 is mutated (deleted, inserted or substituted; positions indicated in respect to SEQ ID NO: 1), but none of the other amino acids of SEQ ID NO: 1 is mutated.
- the CPP according to the present invention comprises an amino acid sequence sharing a sequence identity of at least 85%, preferably a sequence identity of at least 90%, more preferably a sequence identity of at least 95% and most preferably a sequence identity of at least 98% with SEQ ID NO: 1 as described above.
- a sequence identity provides cell penetrating functionality, has a serine at position 12, has a length of at least 36 amino acids in total and shares the preferred embodiments as described above, e.g. the type of preferred mutations and the selection of amino acids, which may be mutated in SEQ ID NO: 1.
- the amino acid sequence sharing at least 80%, 85%, 90%, 95% or 98% sequence identity with SEQ ID NO: 1, as described herein has a length of at least 38 amino acids in total. More preferably the amino acid sequence sharing at least 80%, 85%, 90%, 95% or 98% sequence identity with SEQ ID NO: 1, as described herein, has a length of at least 40 amino acids in total. Even more preferably the amino acid sequence sharing at least 80%, 85%, 90%, 95% or 98% sequence identity with SEQ ID NO: 1, as described herein, has a length of at least 42 amino acids in total.
- the amino acid sequence sharing at least 80%, 85%, 90%, 95% or 98% sequence identity with SEQ ID NO: 1, as described herein has a length of no more than 50 amino acids in total. More preferably, the amino acid sequence sharing at least 80%, 85%, 90%, 95% or 98% sequence identity with SEQ ID NO: 1, as described herein, has a length of no more than 48 amino acids in total. Even more preferably, the amino acid sequence sharing at least 80%, 85%, 90%, 95% or 98% sequence identity with SEQ ID NO: 1, as described herein, has a length of no more than 45 amino acids in total. Most preferably, the amino acid sequence sharing at least 80%, 85%, 90%, 95% or 98% sequence identity with SEQ ID NO: 1, as described herein, has a length of no more than 43 amino acids in total.
- amino acid sequence sharing at least 80%, 85%, 90%, 95% or 98% sequence identity with SEQ ID NO: 1, as described herein, has a length of 42 amino acids in total.
- the cell penetrating peptide according to the present invention has a length of no more than 100 amino acids in total, more preferably the cell penetrating peptide has a length of no more than 75 amino acids in total, even more preferably the cell penetrating peptide has a length of no more than 60 amino acids in total and most preferably the cell penetrating peptide has a length of no more than 50 amino acids in total.
- the CPP according to the present invention consists of an amino acid sequence sharing at least 80%, 85%, 90%, 95% or 98% sequence identity with SEQ ID NO: 1, as described herein.
- the cell penetrating peptide according to the present invention consists of an amino acid sequence according to SEQ ID NO: 1.
- the primary amino acid sequence of the cell penetrating peptide of the invention may further be post-translationally modified, such as by glycosylation or phosphorylation, without departing from the invention.
- N- and/or the C-terminus of the CPP according to the present invention may be chemically modified, for example by addition of chemical groups.
- chemical groups which can be added to the N- and/or the C-terminus of the cell penetrating peptide include for example a (G4S)n linker, wherein “G4S” refers to the amino acid sequence GGGGS (SEQ ID NO: 53), which may be present once or repeatedly, for example 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more times, as indicated by the number “n”.
- linkers which are described with their amino acid sequences in Table I of Reddy Chichili V P, Kumar V, Sivaraman J. 2013. Linkers in the structural biology of protein-protein interactions. Protein Sci. 22:153-167.
- the present invention provides a complex comprising the cell penetrating peptide according to the present invention as described herein and a cargo molecule.
- the cargo molecule may be associated with the peptides either through chemical linkage via covalent bonds or through non-covalent interactions.
- the cell penetrating peptide according to the present invention as described herein and the cargo molecule are covalently linked in the complex according to the present invention.
- a “covalent linkage” refers to a chemical bond that involves the sharing of electron pairs between atoms.
- a “covalent linkage” in particular involves a stable balance of attractive and repulsive forces between atoms when they share electrons. For many molecules, the sharing of electrons allows each atom to attain the equivalent of a full outer shell, corresponding to a stable electronic configuration.
- Covalent bonding includes many kinds of interactions, including for example a-bonding, Tr-bonding, metal-to-metal bonding, agostic interactions, and three-center two-electron bonds.
- the complex according to the present invention may comprise one single cell penetrating peptide or more than one cell penetrating peptides.
- the complex according to the present invention comprises no more than five cell penetrating peptides, more preferably the complex according to the present invention comprises no more than four cell penetrating peptides, even more preferably the complex according to the present invention comprises no more than three cell penetrating peptides, particularly preferably the complex according to the present invention comprises no more than two cell penetrating peptides and most preferably the complex according to the present invention comprises one single cell penetrating peptide.
- the cargo molecule is selected from the group consisting of: (i) a peptide, a polypeptide, or a protein; (ii) a polysaccharide; (iii) a lipid; (iv) a lipoprotein; (v) a glycolipid; (vi) a nucleic acid; (vii) a small molecule drug or toxin; and (viii) an imaging or contrast agent.
- the cargo molecule may be a peptide, a protein, a polysaccharide, a lipid, a combination thereof including lipoproteins and glycolipids, a nucleic acid (e.g.
- DNA, siRNA, shRNA, antisense oligonucleotides decoy DNA, plasmid, preferably siRNA or shRNA, more preferably siRNA), or a small molecule drug (e.g. cyclosporine A, paclitaxel, doxorubicin, methotrexate, 5-aminolevulinic acid), or any combination thereof, in particular if more than one cargo molecule is comprised by the inventive complex.
- a small molecule drug e.g. cyclosporine A, paclitaxel, doxorubicin, methotrexate, 5-aminolevulinic acid
- the cargo molecule can comprise for example at least one, i.e. one or more, peptides, polypeptides or proteins linked together and/or at least one, i.e. one or more, nucleic acids, e.g. wherein each one encodes one peptide or polypeptide.
- the at least one cargo molecule can be a combination of a protein, a lipid, and/or a polysaccharide including lipoproteins and glycolipids.
- the complex according to the present invention comprises more than one cargo molecule, it can comprise more than one peptide, polypeptide, or protein, more than one polysaccharide, more than one lipid, more than one lipoprotein, more than one glycolipid, more than one nucleic acid, more than one small molecule drug or toxin, or a combination thereof.
- the cargo molecule is a peptide, a polypeptide or a protein.
- the cargo molecule is at least one antigen or antigenic epitope.
- an “antigen” is any structural substance which serves as a target for the receptors of an adaptive immune response, in particular as a target for antibodies, T cell receptors, and/or B cell receptors.
- An “epitope”, also known as “antigenic determinant”, is the part (or fragment) of an antigen that is recognized by the immune system, in particular by antibodies, T cell receptors, and/or B cell receptors.
- one antigen has at least one epitope, i.e. a single antigen has one or more epitopes.
- epitope is mainly used to designate T cell epitopes, which are presented on the surface of an antigen-presenting cell, where they are bound to Major Histocompatibility Complex (MHC).
- MHC Major Histocompatibility Complex
- T cell epitopes presented by MHC class I molecules are typically, but not exclusively, peptides between 8 and 11 amino acids in length, whereas MHC class II molecules present longer peptides, generally, but not exclusively, between 12 and 25 amino acids in length.
- the complex according to the invention comprises at least one antigen or antigenic epitope comprising or consisting of one or more epitope(s) from a tumor-associated antigen, a tumor-specific antigen, and/or an antigenic protein from a pathogen, including viral, bacterial, fungal, protozoal and multicellular parasitic antigenic protein.
- the at least one antigen or antigenic epitope comprises or consists of at least one pathogen epitope and/or at least one tumor epitope. Even more preferably, the at least one antigen or antigenic epitope comprises or consists of at least one tumor epitope.
- the complex according to the present invention comprises only such antigen(s) or antigenic epitope(s), which are tumor-associated antigen(s), tumor-specific antigen(s), and/or tumor epitope(s).
- tumor epitope means an epitope from a tumor-associated antigen or from a tumor-specific antigen. Such epitopes are typically specific (or associated) for a certain kind of tumor. For instance, tumor epitopes include glioma epitopes. Suitable tumor epitopes can be retrieved for example from tumor epitope databases, e.g. from van der Bruggen P, Stroobant V, Vigneron N, Van den Eynde B. Peptide database: T cell-defined tumor antigens.
- tumor antigens recognized by CD4+ or CD8+ T cells are classified into four major groups on the basis of their expression pattern, or from the database “Tantigen” (TANTIGEN version 1.0, Dec. 1, 2009; developed by Bioinformatics Core at Cancer Vaccine Center, Dana-Farber Cancer Institute; URL: http://cvc.dfci.harvard.edu/tadb/).
- tumor epitopes include e.g.
- TRP2-derived epitopes glycoprotein 100 (gp100) melanoma antigen-derived epitopes, IEa epitopes, IL13r ⁇ 2, Epha2 (ephrin type-A receptor 2), immunogenic fragments thereof, and fusions of such antigens and/or fragments.
- tumor-related or tissue-specific antigens useful in a complex according to the present invention include, but are not limited to, the following antigens: Prostate: prostate-specific antigen (PSA), prostate-specific membrane antigen (PSMA), PAP, PSCA (PNAS 95(4) 1735-1740 1998), prostate mucin antigen (PMA) (Beckett and Wright, 1995, Int. J.
- Cancer 62: 703-710) Prostase, Her-2neu, SPAS-1; Melanoma: TRP-2, tyrosinase, Melan A/Mart-1, gplOO, BAGE, GAGE, GM2 ganglioside; Breast: Her2-neu, kinesin 2, TATA element modulatory factor 1, tumor protein D52, MAGE D, ING2, HIP-55, TGF-1 anti-apoptotic factor, HOM-Mel-40/SSX2, epithelial antigen (LEA 135), DF31MUC1 antigen (Apostolopoulos et al., 1996 Immunol. Cell. Biol. 74: 457-464; Pandey et al., 1995, Cancer Res.
- Testis MAGE-1, HOM-Mel-40/SSX2, NY-ESO-1; Colorectal: EGFR, CEA; Lung: MAGE D, EGFR Ovarian Her-2neu; Baldder: transitional cell carcinoma (TCC) (Jones et al., 1997, Anticancer Res.
- pathogen epitope means an epitope from an antigenic protein, an antigenic polysaccharide, an antigenic lipid, an antigenic lipoprotein or an antigenic glycolipid from a pathogen including viruses, bacteria, fungi, protozoa and multicellular parasites.
- Antigenic proteins, polysaccharides, lipids, lipoproteins or glycolipids from pathogens include, herewith, proteins, polysaccharides, lipids, lipoproteins and glycolipids, respectively, from pathogens responsible of diseases which can be a target for vaccination including, for instance, Amoebiasis, Anthrax, Buruli Ulcer (Mycobacterium ulcerans), Caliciviruses associated diarrhoea, Campylobacter diarrhoea , Cervical Cancer (Human papillomavirus), Chlamydia trachomatis associated genital diseases, Cholera, Crimean-Congo haemorrhagic fever, Dengue Fever, Diptheria, Ebola haemorrhagic fever, Enterotoxigenic Escherichia coli (ETEC) diarrhoea, Gastric Cancer ( Helicobacter pylori ), Gonorrhea, Group A Streptococcus associated diseases, Group
- the at least one antigen or antigenic epitope will be presented at the cell surface in an MHC class I and/or MHC class II context and/or in a CD1 context, whereby presentation at the cell surface in an MHC class I and/or MHC class II context is preferred.
- the phrase “epitope presentation in the MHC class I context” refers in particular to a CD8 + epitope lying in the groove of a MHC class I molecule at the surface of a cell.
- the phrase “epitope presentation in the MHC class II context” refers in particular to a CD4 + epitope lying in the groove of a MHC class II molecule at the surface of a cell.
- the phrase “epitope presentation in the CD1 context” refers in particular to a lipidic epitope lying in the groove of a cluster of differentiation 1 molecule at the surface of a cell.
- the cell penetrating peptide facilitates presentation of the at least one antigenic epitope at the cell surface in MHC class I and/or MHC class II context.
- the complex according to the invention comprises a cell penetrating peptide and at least one antigen or antigenic epitope, and allows the transport and presentation of said epitopes at the cell surface of antigen presenting cells in an MHC class I and MHC class II context, and is, thus, useful in vaccination and immunotherapy. Therefore, it is particularly preferred in the complex according to the present invention that the cell penetrating peptide facilitates presentation of the at least one antigenic epitope at the cell surface in MHC class I and MHC class II context.
- the present inventors assume that the two mechanisms of entry provided by ZEBRA-derived CPPs, namely (i) direct translocation and (ii) lipid raft-mediated endocytosis (Rothe R, Liguori L, Villegas-Mendez A, Marques B, Grunwald D, Drouet E, et al. Characterization of the cell-penetrating properties of the Epstein-Barr virus ZEBRA trans-activator. The Journal of biological chemistry 2010;285(26):20224-33), should promote both MHC class I and II restricted presentation of cargo antigens to CD8 + and CD4 + T cells, respectively.
- such a CPP can deliver multi-epitopic peptides to dendritic cells (DCs), and subsequently to promote CTL and Th cell activation and anti-tumor function.
- DCs dendritic cells
- ZEBRA-derived CPP can thus efficiently deliver the complex according to the present invention to antigen presenting cells (APCs) and lead to multi-epitopic MHC class I and II restricted presentation.
- MHC class I designates one of the two primary classes of the Major Histocompatibility Complex molecules.
- the MHC class I (also noted “MHC I”) molecules are found on every nucleated cell of the body.
- the function of MHC class I is to display an epitope to cytotoxic cells (CTLs).
- CTLs cytotoxic cells
- MHC class I molecules consist of two polypeptide chains, ⁇ - and ⁇ 2-microglobulin (b2m). Only the a chain is polymorphic and encoded by a HLA gene, while the b2m subunit is not polymorphic and encoded by the Beta-2 microglobulin gene.
- MHC class II designates the other primary class of the Major Histocompatibility Complex molecules.
- the MHC class II also noted “MHC II” molecules are found only on a few specialized cell types, including macrophages, dendritic cells and B cells, all of which are dedicated antigen-presenting cells (APCs).
- APCs dedicated antigen-presenting cells
- the complex according to the present invention comprises at least one antigen or antigenic epitope, which is at least one CD4 + epitope and/or at least one CD8 + epitope. More preferably, the complex according to the present invention comprises at least two antigenic epitopes, which are at least one CD4 + epitope and at least one CD8 + epitope.
- CD4 + epitope or “CD4 + -restricted epitope”, as used herein, designate an epitope recognized by a CD4 + T cell, said epitope in particular consisting of an antigen fragment lying in the groove of a MHC class II molecule.
- a single CD4 + epitope comprised in the complex according to the present invention preferably consists of about 12-25 amino acids. It can also consist of, for example, about 8-25 amino acids or about 6-100 amino acids.
- CD8 + epitope or “CD8 + -restricted epitope”, as used herein, designate an epitope recognized by a CD8 + T cell, said epitope in particular consisting of an antigen fragment lying in the groove of a MHC class I molecule.
- a single CD8 + epitope comprised in the complex according to the present invention preferably consists of about 8-11 amino acids. It can also consist of, for example, about 8-15 amino acids or about 6-100 amino acids.
- the at least one antigen can comprise or the at least one antigenic epitope can consist of a CD4 + epitope and/or a CD8 + epitope corresponding to antigenic determinant(s) of a tumor-associated antigen, a tumor-specific antigen, or an antigenic protein from a pathogen.
- the complex according to the present invention comprises at least two antigens or antigenic epitopes, wherein at least one antigen or antigenic epitope comprises or consists a CD4 + epitope and at least one antigen or antigenic epitope comprises or consists a CD8 + epitope.
- a complex according to the present invention comprising at least two antigens or antigenic epitopes, wherein at least one antigen or antigenic epitope comprises or consists of a CD4 + epitope and at least one antigen or antigenic epitope comprises or consists a CD8 + epitope, provides an integrated immune response allowing simultaneous priming of CTLs and T h cells and is thus preferable to immunity against only one CD8 + epitope or only one CD4 + epitope.
- the complex according to the present invention may preferably comprise an Ealpha-CD4 30 epitope and a gp100-CD8 + epitope.
- the complex according to the present invention comprises or consists of more than one, i.e. at least two, antigens or antigenic epitopes, in particular 2, 3, 4, 5, 6, 7, 8, 9, 10 or more antigens or antigenic epitopes.
- the complex according to the present invention may preferably comprise or consist of at least two, e.g. 2, 3, 4, 5, 6, 7, 8, 9, 10 or more, CD4 + epitopes and/or at least two, e.g. 2, 3, 4, 5, 6, 7, 8, 9, 10 or more, CD8 + epitopes.
- the at least two antigens or antigenic epitopes are preferably different antigens or antigenic epitopes, more preferably the at least two antigens or antigenic epitopes are different from each other but relating to the same kind of tumor.
- a multi-antigenic vaccine will (i) avoid outgrowth of antigen-loss variants, (ii) target different tumor cells within a heterogeneous tumor mass and (iii) circumvent patient-to-patient tumor variability.
- the complex according to the present invention particularly preferably comprises at least four antigens or antigenic epitopes, in particular with at least two CD8 30 epitopes and at least two CD4 + epitopes.
- Such a complex according to the present invention induces multi-epitopic CD8 CTLs and CD4 T h cells to function synergistically to counter tumor cells and promote efficient anti-tumor immunity. T h cells are also involved in the maintenance of long-lasting cellular immunity that was monitored after vaccination.
- Such a complex according to the present invention induces polyclonal, multi-epitopic immune responses and poly-functional CD8 + and CD4 + T cells, and thus efficacious anti-tumor activity.
- the complex according to the present invention comprises at least two antigens or antigenic epitopes, more preferably the complex according to the present invention comprises at least three antigens or antigenic epitopes, even more preferably the complex according to the present invention comprises at least four antigens or antigenic epitopes, particularly preferably the complex according to the present invention comprises at least five antigens or antigenic epitopes and most preferably the complex according to the present invention comprises at least six antigens or antigenic epitopes.
- the antigens or antigenic epitopes comprised by the complex according to the present invention may be the same or different, preferably the antigens or antigenic epitopes comprised by the complex according to the present invention are different from each other.
- the complex according to the present invention comprises at least one CD4 + epitope and at least one CD8 + epitope.
- the complex according to the present invention may preferably comprise a gp100-CD8 + epitope, an Ealpha-CD4 + epitope, and a further CD4 + epitope and a further CD8 + epitope.
- the complex according to the present invention may comprise a polypeptide or protein comprising a gp100-CD8 + epitope and an Ealpha-CD4 + epitope.
- such a polypeptide or protein comprised by the complex according to the present invention comprises or consists of an amino acid sequence according to SEQ ID NO: 3 or sequence variants thereof as defined above:
- a particularly preferred complex according to the present invention comprises (i) the CPP according to SEQ ID NO: 1 and (ii) the cargo according to SEQ ID NO: 3.
- a preferred example of such a complex is according to SEQ ID NO: 4 shown below:
- the at least one antigen or antigenic epitope comprised by the complex according to the present invention is a peptide, polypeptide, or a protein.
- antigen or antigenic epitope of peptidic, polypeptidic, or proteic nature useful in the invention include tumor antigens or antigenic epitopes thereof as described herein, allergy antigens or antigenic epitopes thereof, auto-immune self-antigens or antigenic epitopes thereof, pathogenic antigens or antigenic epitopes thereof as described herein, and antigens or antigenic epitopes thereof from viruses, preferably from cytomegalovirus (CMV), orthopox variola virus, orthopox alastrim virus, parapox ovis virus, molluscum contagiosum virus, herpes simplex virus 1, herpes simplex virus 2, herpes B virus, varicella zoster virus, pseudorabies virus, human cytomegaly virus, human herpes virus 6, human herpes
- CMV
- human immunodeficiency virus type 1 or human immunodeficiency virus type 2 influenza virus, Lassa virus, lymphocytic choriomeningitis virus, Tacaribe virus, Junin virus , Machupo virus, Borna disease virus, Bunyamwera virus , California encephalitis virus, Rift Valley fever virus, sand fly fever virus, Toscana virus, Crimean-Congo haemorrhagic fever virus, Hazara virus, Khasan virus, Hantaan virus, Seoul virus, Prospect Hill virus, Puumala virus, Dobrava Belgrade virus, Tula virus, sin capita virus, Lake Victoria Marburg virus, Zaire Ebola virus , Sudan Ebola virus , Ivory Coast Ebola virus , influenza virus A, influenza virus B, influenza viruses C, parainfluenza virus, Marburg virus, measles virus, mumps virus, respiratory syncytial virus, human metapneumovirus , vesicular stomatitis Indiana virus,
- epitopes as well as variants of antigens as defined above exhibit an amino acid sequence identity of about 10%, in particular at least 10%, about 20%, in particular at least 20%, about 30%, in particular at least 30%, about 40%, in particular at least 40%, about 50%, in particular at least 50%, about 60%, in particular at least 60%, about 70%, in particular at least 70%, about 80%, in particular at least 80%, about 90% in particular at least 90%, at least 95% or at least 98% with one of the antigen or antigenic epitope sequences as shown or described above
- antigens or antigenic epitopes in the category of peptide, polypeptide or protein include a combination of multiple glioma epitopes such as those described in Novellino et al (2005, Cancer Immunol Immunother, 54(3):187-207), Vigneron et al. (2013, Cancer Immun. 13:15).
- a single complex according to the present invention may also comprise only a subset, i.e. one or more of all of said glioma epitopes.
- different complexes according to the present invention comprise different subsets of all of said glioma epitopes, so that for example a vaccine according to the present invention comprising such different complexes according to the present invention comprises all of said glioma epitopes but distributed in the different complexes.
- a complex according to the invention may also comprise at least one antigen or antigenic epitope, wherein said antigen or antigenic epitope is a polysaccharide, a lipid, a lipoprotein, and/or a glycolipid, in particular a polysaccharidic, lipidic, lipoproteic, and/or glycolipidic epitope, which can be, for example, pathogen epitopes as defined herewith.
- said antigen or antigenic epitope is a polysaccharide, a lipid, a lipoprotein, and/or a glycolipid, in particular a polysaccharidic, lipidic, lipoproteic, and/or glycolipidic epitope, which can be, for example, pathogen epitopes as defined herewith.
- the complex according to the invention may comprise at least one antigen or antigenic epitope, wherein said antigen or antigenic epitope is polysaccharidic, lipidic, lipoproteic, and/or glycolipidic, including viral, bacterial, fungal, protozoal and multicellular parasitic antigens or antigenic epitopes.
- said epitopes will be presented at the cell surface in an MHC class I and/or MHC class II context as described above.
- said lipidic epitopes will be presented at the cell surface in a CD1 (cluster of differentiation 1) context as described above.
- the complex according to the present invention may also comprise at least one antigen or antigenic epitope, wherein said antigen or antigenic epitope is a small molecule drug or toxin.
- cargo molecules within the category of small molecule drugs or toxins useful in the invention include cyclosporine A, paclitaxel, doxorubicin, methotrexate, 5-aminolevulinic acid, diphtheria toxin, sunitinib and those molecules reviewed in De wit Amer (2010, Neuro Oncol, 12(3):304-16).
- the complex according to the present invention comprises at least one antigen or antigenic epitope, preferably the complex according to the present invention comprises more than one antigen or antigenic epitope, in particular 2, 3, 4, 5, 6, 7, 8, 9, 10 or more antigens or antigenic epitopes, more preferably the complex according to the present invention comprises (at least) two or three antigens or antigenic epitopes, even more preferably the complex according to the present invention comprises (at least) four or five antigens or antigenic epitopes.
- antigen or antigenic epitope is comprised by the complex according to the present invention it is understood that said antigen or antigenic epitope is in particular also covalently linked in the complex according to the present invention, e.g. to another antigen or antigenic epitope and/or to another component of the complex according to the present invention, such as the cell penetrating peptide, and/or to another cargo molecule, e.g. a TLR peptide agonist.
- the various antigens or antigenic epitopes comprised by the complex according to the present invention may be the same or different.
- the various antigens or antigenic epitopes comprised by the complex according to the present invention are different from each other, thus providing a multi-antigenic and/or multi-epitopic complex.
- the more than one antigen or antigenic epitope in particular 2, 3, 4, 5, 6, 7, 8, 9, 10 or more antigens or antigenic epitopes, are positioned consecutively in the complex according to the present invention.
- all antigens and/or antigenic epitopes comprised by the complex are positioned in a stretch, which is neither interrupted by the cell penetrating peptide nor by another cargo molecule, such as a TLR peptide agonist.
- the CPP and, optionally, a further cargo molecule are positioned in the complex for example before or after such a stretch of all antigens and/or antigenic epitopes.
- the antigens and/or antigenic epitopes positioned consecutively in such a way may be linked to each other for example by a spacer or linker as described below, which is in particular neither a CPP nor another cargo molecule such as a TLR peptide agonist.
- the various antigens and/or antigenic epitopes may also be positioned in any other way in the complex according to the present invention, for example with the CPP and, optionally, a further cargo molecule positioned in between two or more antigens and/or antigenic epitopes, i.e. with one or more antigens and/or antigenic epitopes positioned between the CPP and, optionally, a further cargo molecule (or vice versa) and, optionally, one or more antigens and/or antigenic epitopes positioned at the respective other end of the CPP and, optionally, a further cargo molecule.
- a number of different antigens or antigenic epitopes relating to the same kind of disease, in particular to the same kind of tumor may be advantageously comprised by a single complex according to the present invention.
- a number of different antigens or antigenic epitopes relating to the same kind of disease, in particular to the same kind of tumor may be distributed to subsets of different antigens or antigenic epitopes, in particular subsets complementing each other in the context of a certain kind of disease, e.g. tumor, which are comprised by different complexes according to the present invention, whereby such different complexes comprising different subsets may advantageously be administered simultaneously, e.g. in a single vaccine, to a subject in need thereof.
- the complex according to the present invention comprises a TLR peptide agonist.
- a TLR peptide agonist is a preferred peptidic cargo molecule in the complex according to the present invention.
- the complex according to the present invention comprises—in addition to the CPP—at least one antigen or antigenic epitope as described above (i.e. one or more antigens or antigenic epitopes with the preferred embodiments as described above) and, furthermore, a TLR peptide agonist.
- a complex according to the present invention provides (i) stimulation of multi-epitopic cytotoxic T cell-mediated immunity, (ii) induction of T h cells and (iii) promotion of immunological memory.
- a complex according to the present invention provides a potent vaccine, in particular having improved anti-tumor activity.
- TLR Toll Like Receptor
- TLR-3 poly I:C
- TLR-4 monophosphoryl lipid A
- MPL monophosphoryl lipid A
- TLR-5 flagellin
- TLR-7 imiquimod
- TLR-9 CpG
- the TLR peptide agonist allows an increased targeting towards dendritic cells along with self-adjuvancity.
- physical linkage of a TLR peptide agonist to the CPP and, optionally, to a further cargo molecule, such as at least one antigen or antigenic epitope as described herein in the complex according to the present invention provides an enhanced immune response by simultaneous stimulation of antigen presenting cells (APCs), in particular dendritic cells, that internalize, metabolize and display antigen(s).
- APCs antigen presenting cells
- a “TLR peptide agonist” is an agonist of a Toll-like receptor (TLR), i.e. it binds to a TLR and activates the TLR, in particular to produce a biological response.
- TLR peptide agonist is a peptide, a polypeptide or a protein as defined above.
- the TLR peptide agonist comprises from 10 to 150 amino acids, more preferably from 15 to 130 amino acids, even more preferably from 20 to 120 amino acids, particularly preferably from 25 to 110 amino acids, and most preferably from 30 to 100 amino acids.
- TLRs Toll like receptors
- LRRs leucine-rich repeats
- Toll like receptors include TLRs1-10. Compounds capable of activating TLR receptors and modifications and derivatives thereof are well documented in the art.
- TLR1 may be activated by bacterial lipoproteins and acetylated forms thereof
- TLR2 may in addition be activated by Gram positive bacterial glycolipids, LPS, LP A, LTA, fimbriae, outer membrane proteins, heat shock proteins from bacteria or from the host, and Mycobacterial lipoarabinomannans.
- TLR3 may be activated by dsRNA, in particular of viral origin, or by the chemical compound poly(LC).
- TLR4 may be activated by Gram negative LPS, LTA, Heat shock proteins from the host or from bacterial origin, viral coat or envelope proteins, taxol or derivatives thereof, hyaluronan containing oligosaccharides and fibronectins.
- TLR5 may be activated with bacterial flagellae or flagellin.
- TLR6 may be activated by mycobacterial lipoproteins and group B streptococcus heat labile soluble factor (GBS- F) or staphylococcus modulins.
- TLR7 may be activated by imidazoquinolines.
- TLR9 may be activated by unmethylated CpG DNA or chromatin—IgG complexes.
- the TLR peptide agonist comprised by the complex according to the present invention is an agonist of TLR1, 2, 4, 5, 6, and/or 10.
- TLRs are expressed either on the cell surface (TLR1, 2, 4, 5, 6, and 10) or on membranes of intracellular organelles, such as endosomes (TLR3, 4, 7, 8, and 9).
- the natural ligands for the endosomal receptors turned out to be nucleic acid-based molecules (except for TLR4).
- the cell surface-expressed TLR1, 2, 4, 5, 6, and 10 recognize molecular patterns of extracellular microbes (Monie, T. P., Bryant, C. E., et al. 2009: Activating immunity: Lessons from the TLRs and NLRs. Trends Biochem. Sci. 34(11), 553-561).
- TLRs are expressed on several cell types but virtually all TLRs are expressed on DCs allowing these specialized cells to sense all possible pathogens and danger signals.
- the TLR peptide agonist comprised by the complex according to the present invention is more preferably a peptide agonist of TLR2, TLR4 and/or TLR5.
- the TLR peptide agonist is a TLR2 peptide agonist and/or a TLR4 peptide agonist.
- the TLR peptide agonist is a TLR4 peptide agonist.
- the TLR peptide agonist is one TLR peptide agonist, which is both, a TLR2 and a TLR4 agonist.
- TLR2 can detect a wide variety of ligands derived from bacteria, viruses, parasites, and fungi.
- the ligand specificity is often determined by the interaction of TLR2 with other TLRs, such as TLR1, 6, or 10, or non-TLR molecules, such as dectin-1, CD14, or CD36.
- TLR1 TLR1, 6, or 10
- non-TLR molecules such as dectin-1, CD14, or CD36.
- TLR2 can identify triacyl lipoproteins or lipopeptides from (myco)bacterial origin, such as Pam3CSK4 and peptidoglycan (PGA; Gay, N. J., and Gangloff, M. (2007): Structure and function of Toll receptors and their ligands. Annu. Rev. Biochem.
- TLR2 interacts with a broad and structurally diverse range of ligands, including molecules expressed by microbes and fungi.
- Multiple TLR2 agonists have been identified, including natural and synthetic lipopeptides (e.g. Mycoplasma fermentas macrophage-activating lipopeptide (MALP-2)), peptidoglycans (PG such as those from S. aureus ), lipopolysaccharides from various bacterial strains (LPS), polysaccharides (e.g. zymosan), glycosylphosphatidyl-inositol-anchored structures from gram positive bacteria (e.g.
- lipopeptides e.g. Mycoplasma fermentas macrophage-activating lipopeptide (MALP-2)
- PG peptidoglycans
- LPS lipopolysaccharides from various bacterial strains
- polysaccharides e.g. zymosan
- LTA lipoteichoic acid
- lipo-arabinomannan from mycobacteria and lipomannas from M. tuberculosis .
- Certain viral determinants may also trigger via TLR2 (Barbalat R, Lau L, Locksley R M, Barton G M. Toll-like receptor 2 on inflammatory monocytes induces type I interferon in response to viral but not bacterial ligands. Nat Immunol. 2009: 10(11):1200-7).
- Bacterial lipopeptides are structural components of cell walls. They consist of an acylated s-glycerylcysteine moiety to which a peptide can be conjugated via the cysteine residue.
- TLR2 agonists which are bacterial lipopeptides, include MALP-2 and it's synthetic analogue di-palmitoyl-S-glyceryl cysteine (Pam 2 Cys) or tri-palmitoyl-S-glyceryl cysteine (Pam 3 Cys).
- TLR4 Monophosphoryl Lipid A from Salmonella minnesota R595 (MPLA), lipopolysaccharides (LPS), mannans ( Candida albicans ), glycoinositolphospholipids ( Trypanosoma ), viral envelope proteins (RSV and MMTV) and endogenous antigens including fibrinogen and heat-shock proteins.
- MPLA Salmonella minnesota R595
- LPS lipopolysaccharides
- mannans Candida albicans
- GMV glycoinositolphospholipids
- RSV and MMTV viral envelope proteins
- endogenous antigens including fibrinogen and heat-shock proteins.
- Such agonists of TLR4 are for example described in Akira S, Uematsu S, Takeuchi O. Pathogen recognition and innate immunity. Cell. Feb 24; 2006: 124(4):783-801 or in Kumar H, Kawai T, Akira S. Toll-like receptors and innate immunity. Biochem
- LPS which is found in the outer membrane of gram negative bacteria, is the most widely studied of the TLR4 ligands. Suitable LPS-derived TLR4 agonist peptides are described for example in WO 2013/120073 (A1).
- TLR5 is triggered by a region of the flagellin molecule expressed by nearly all motile bacteria.
- flagellin, or peptides or proteins derived from flagellin and/or variants or fragments of flagellin are also suitable as TLR peptide agonists comprised by the complex according to the present invention.
- TLR peptide agonists thus include the TLR2 lipopeptide agonists MALP-2, Pam 2 Cys and Pam 3 Cys or modifications thereof, different forms of the TLR4 agonist LPS, e.g. N. meningitidis wild-type L3-LPS and mutant penta-acylated LpxL1-LPS, and the TLR5 agonist flagellin.
- the TLR peptide agonist comprised by the complex according to the present invention is neither a lipopeptide nor a lipoprotein, neither a glycopeptide nor a glycoprotein. More preferably, the TLR peptide agonist comprised by the complex according to the present invention is a classical peptide, polypeptide or protein as defined herein.
- a preferred TLR2 peptide agonist is annexin II or an immunomodulatory fragment thereof, which are described in detail in WO 2012/048190 A1, WO 2015/073632 A1 and U.S. patent application Ser. No. 13/0331546.
- a TLR2 peptide agonist comprising an amino acid sequence according to SEQ ID NO: 4 or SEQ ID NO: 7 of WO 2012/048190 A1 or fragments or variants thereof are preferred.
- Particularly preferred TLR2 peptide agonists are disclosed in WO 2015/073632 A1, with the most preferred TLR2 peptide agonist having amino acid sequence according to SEQ ID NO: 1 of WO 2015/073632 A1.
- TLR2 peptide agonist comprising or consisting of an amino acid sequence according to SEQ ID NO: 5 or a sequence variant thereof is particularly preferred in the complex according to the present invention.
- TLR2 peptide agonist Anaxa [SEQ ID NO: 5] STVHEILCKLSLEGDHSTPPSAYGSVKPYTNFDAE
- sequence variant refers to any alteration in a sequence as compared to a reference sequence.
- sequence variant includes nucleotide sequence variants and amino acid sequence variants.
- a reference sequence is any of the sequences listed in the “Table of Sequences and SEQ ID Numbers” (Sequence listing), i.e. SEQ ID NO: 1 to SEQ ID NO: 52.
- a sequence variant shares, in particular over the whole length of the sequence, at least 70%, at least 75%, preferably at least 80%, more preferably at least 85%, even more preferably at least 90%, particularly preferably at least 95%, most preferably at least 98% sequence identity with a reference sequence, whereby sequence identity is calculated as described above.
- a sequence variant is a functional sequence variant, which means that the sequence variant preserves the specific function of the reference sequence (for example cell penetrating peptide functionality, antigenic epitope functionality, TLR agonist functionality etc., depending on the functionality of the reference sequence as disclosed herein).
- an amino acid sequence variant has an altered sequence in which one or more of the amino acids in the reference sequence is deleted or substituted, or one or more amino acids are inserted into the sequence of the reference amino acid sequence.
- the amino acid sequence variant has an amino acid sequence which is at least 70%, at least 75%, preferably at least 80%, more preferably at least 85%, even more preferably at least 90%, particularly preferably at least 95%, most preferably at least 98% identical to the reference sequence.
- variant sequences which are at least 90% identical have no more than 10 alterations, i.e. any combination of deletions, insertions or substitutions, per 100 amino acids of the reference sequence.
- TLR peptides agonists are particularly preferred, which correspond to motifs that bind to TLR4, in particular (i) peptides mimicking the natural LPS ligand (RS01: Gln-Glu-lle-Asn-Ser-Ser- Tyr and RS09: Ala-Pro-Pro-His-Ala-Leu-Ser) and (ii) Fibronectin derived peptides.
- the cellular glycoprotein Fibronectin (FN) has multiple isoforms generated from a single gene by alternative splicing of three exons. One of these isoforms is the extra domain A (EDA), which interacts with TLR4.
- suitable TLR peptide agonists thus comprise a fibronectin EDA domain or a fragment or variant thereof.
- suitable fibronectin EDA domains or a fragments or variants thereof are disclosed in EP 1 913 954 B1, EP 2 476 440 A1, US 2009/0220532 A1, and WO 2011/101332 A1.
- TLR4 peptide agonist comprising or consisting of an amino acid sequence according to SEQ ID NO: 6 or a sequence variant thereof is particularly preferred in the complex according to the present invention.
- TLR4 peptide agonist EDA [SEQ ID NO: 6] NIDRPKGLAFTDVDVDSIKIAWESPQGQVSRYRVTYSSPEDGIRELFPAP DGEDDTAELQGLRPGSEYTVSVVALHDDMESQPLIGIQST
- high-mobility group box 1 protein HMGB1
- peptide fragments thereof are assumed to be TLR4 agonists.
- TLR4 agonists such as TLR4 agonists.
- the complex according to the present invention preferably comprises one or more TLR peptide agonist, preferably the complex according to the present invention comprises exactly one TLR peptide agonist, however, the complex according to the present invention may also comprise more than one TLR peptide agonist, in particular 2, 3, 4, 5, 6, 7, 8, 9, 10 or more TLR peptide agonists, for example the complex according to the present invention may comprise (at least) two or three TLR peptide agonists. If more than one TLR peptide agonist is comprised by the complex according to the present invention it is understood that said TLR peptide agonist is in particular also covalently linked in the complex according to the present invention, e.g. to another TLR peptide agonist and/or to the cell penetrating peptide and/or, optionally, to another cargo molecule, such as an antigen or antigenic epitope as described herein.
- the complex according to the present invention comprises one single TLR peptide agonist.
- the complex according to the present invention comprises one single TLR peptide agonist and no further component having TLR agonist properties except the one single TLR peptide agonist as described.
- the various TLR peptide agonists comprised by the complex according to the present invention may be the same or different.
- the various TLR peptide agonists comprised by the complex according to the present invention are different from each other.
- more than one TLR peptide agonists in particular 2, 3, 4, 5, 6, 7, 8, 9, 10 TLR agonists, are positioned consecutively in the complex according to the present invention. This means in particular that all TLR peptide agonists comprised by the complex are positioned in a stretch, which is neither interrupted by the cell penetrating peptide, nor by another cargo molecule, such as at least one antigen or antigenic epitope.
- the CPP and, optionally, another cargo molecule, such as at least one antigen or antigenic epitope are positioned in the complex for example before or after such a stretch of all TLR peptide agonists.
- the TLR peptide agonists positioned consecutively in such a way may be linked to each other for example by a spacer or linker as described below, which is in particular neither the CPP nor another cargo molecule, such as at least one antigen or antigenic epitope.
- the various TLR peptide agonists may also be positioned in any other way in the complex according to the present invention, for example with the CPP and/or, optionally, another cargo molecule, such as at least one antigen or antigenic epitope positioned in between two or more TLR peptide agonists, i.e. with one or more TLR peptide agonist positioned between the CPP and, optionally, another cargo molecule, such as at least one antigen or antigenic epitope (or vice versa) and, optionally, one or more TLR peptide agonists positioned at the respective other end of the CPP and/or, optionally, another cargo molecule, such as at least one antigen or antigenic epitope.
- another cargo molecule such as at least one antigen or antigenic epitope positioned in between two or more TLR peptide agonists, i.e. with one or more TLR peptide agonist positioned between the CPP and, optionally, another cargo molecule, such as at least one antigen or
- TLR peptide agonists activating the same or different TLR receptors may be advantageously comprised by a single complex according to the present invention.
- a number of different TLR peptide agonists activating the same or different TLR receptors may be distributed to subsets of different TLR peptide agonists activating the same or different TLR receptors, which are comprised by different complexes according to the present invention, whereby such different complexes comprising different subsets may advantageously be administered simultaneously, e.g. in a single vaccine, to a subject in need thereof.
- the CPP and the one or more cargo molecules are covalently linked by chemical coupling in any suitable manner known in the art, such as cross-linking methods.
- any suitable manner known in the art such as cross-linking methods.
- chemical cross-linking methods are non-specific, i.e., they do not direct the point of coupling to any particular site on the the CPP and the one or more cargo molecules.
- non-specific cross-linking agents may attack functional sites or sterically block active sites, rendering the fused components of the complex according to the present invention biologically inactive. It is referred to the knowledge of the skilled artisan to block potentially reactive groups by using appropriate protecting groups.
- Coupling specificity can be increased by direct chemical coupling to a functional group found only once or a few times in the CPP and the one or more cargo molecules, which functional group is to be cross-linked to the another of the CPP and the one or more cargo molecules.
- the cystein thiol group may be used, if just one cystein residue is present in the CPP or in one or more cargo molecules of complex according to the present invention.
- a cross-linking reagent specific for primary amines will be selective for the amino terminus of the respective component.
- cross-linking may also be carried out via the side chain of a glutamic acid residue placed at the N-terminus of the peptide such that a amide bond can be generated through its side-chain. Therefore, it may be advantageous to link a glutamic acid residue to the N-terminus of the CPP or one or more cargo molecules.
- a cysteine residue is to be introduced into the CPP or one or more cargo molecules, introduction at or near its N- or C-terminus is preferred.
- Conventional methods are available for such amino acid sequence alterations based on modifications of the CPP or the one or more cargo molecules by either adding one or more additional amino acids, e.g.
- cystein residue to the translocation sequence or by substituting at least one residue of the translocation sequence(s) being comprised in the respective component.
- the CPP or one or more cargo molecules have preferably one cystein residue.
- Any second cystein residue should preferably be avoided and can, optionally, be replaced when they occur in the respective component comprised by the complex according to the present invention.
- cysteine residue is replaced in the original sequence of the CPP or of one or more cargo molecules, it is typically desirable to minimize resulting changes in the peptide folding of the respective component. Changes in folding are minimized when the replacement is chemically and sterically similar to cysteine. Therefore, serine is preferred as a replacement for cystein.
- Coupling of the CPP and the one or more cargo molecules can be accomplished via a coupling or conjugating agent including standard peptide synthesis coupling reagents such as HOBt, HBTU, DICI, TBTU.
- a coupling or conjugating agent including standard peptide synthesis coupling reagents such as HOBt, HBTU, DICI, TBTU.
- reagents for example, N-succinimidyl 3-(2-pyridyldithio)propionate (SPDP) or N,N′-(1,3-phenylene)bismaleimide; N,N′-ethylene-bis-(iodoacetamide) or other such reagent having 6 to 11 carbon methylene bridges; and 1,5-difluoro-2,4-dinitrobenzene.
- SPDP N-succinimidyl 3-(2-pyridyldithio)propionate
- N,N′-(1,3-phenylene)bismaleimide N,N′-ethylene-bis-(iodoacetamide) or other such reagent having 6 to 11 carbon methylene bridges
- 1,5-difluoro-2,4-dinitrobenzene 1,5-difluoro-2,4-dinitrobenzene.
- cross-linking agents useful for this purpose include: p,p′-difluoro-m,m′-dinitrodiphenylsulfone; dimethyl adipimidate; phenol-1,4-disulfonylchloride; hexamethylenediisocyanate or diisothiocyanate, or azophenyl-p-diisocyanate; glutaraldehyde and disdiazobenzidine.
- Cross-linking agents may be homobifunctional, i.e., having two functional groups that undergo the same reaction.
- a preferred homobifunctional cross-linking agent is bismaleimidohexane (BMH).
- BMH contains two maleimide functional groups, which react specifically with sulfhydryl-containing compounds under mild conditions (pH 6.5-7.7).
- the two maleimide groups are connected by a hydrocarbon chain. Therefore, BMH is useful for irreversible cross-linking of proteins (or polypeptides) that contain cysteine residues.
- Cross-linking agents may also be heterobifunctional. Heterobifunctional cross-linking agents have two different functional groups, for example an amine-reactive group and a thiol-reactive group, that will cross-link two proteins having free amines and thiols, respectively.
- heterobifunctional cross-linking agents are Succinimidyl-4-(N-maleimidomethyl)-cyclohexane-1-carboxylate (SMCC), m-maleimidobenzoyl-N-hydroxysuccinimide ester (MBS), and succinimide 4-(p-maleimidophenyl)butyrate (SMPB), an extended chain analog of MBS.
- SMCC Succinimidyl-4-(N-maleimidomethyl)-cyclohexane-1-carboxylate
- MBS m-maleimidobenzoyl-N-hydroxysuccinimide ester
- SMPB succinimide 4-(p-maleimidophenyl)butyrate
- cross-linking agents often have low solubility in water, a hydrophilic moiety, such as a sulfonate group, may be added to the cross-linking agent to improve its water solubility.
- Sulfo-MBS and sulfo-SMCC are examples of cross-linking agents modified for water solubility.
- Many cross-linking agents yield a conjugate that is essentially non-cleavable under cellular conditions. Therefore, some cross-linking agents contain a covalent bond, such as a disulfide, that is cleavable under cellular conditions.
- cleavable cross-linkers For example, Traut's reagent, dithiobis (succinimidylpropionate) (DSP), and N-succinimidyl 3-(2-pyridyldithio)propionate (SPDP) are well-known cleavable cross-linkers.
- DSP dithiobis
- SPDP N-succinimidyl 3-(2-pyridyldithio)propionate
- cleavable cross-linking agent permits the cell penetrating peptide and the one or more cargo molecules comprised by the complex according to the present invention to separate from each other after delivery into the target cell.
- direct disulfide linkage may also be useful.
- Chemical cross-linking may also include the use of spacer arms.
- Spacer arms provide intramolecular flexibility or adjust intramolecular distances between conjugated moieties and thereby may help preserve biological activity.
- a spacer arm may be in the form of a protein (or polypeptide) moiety that includes spacer amino acids, e.g. proline.
- a spacer arm may be part of the cross-linking agent, such as in “long-chain SPDP” (Pierce Chem. Co., Rockford, Ill., cat. No. 21651 H). Numerous cross-linking agents, including the ones discussed above, are commercially available. Detailed instructions for their use are readily available from the commercial suppliers.
- Cross-linking agents for peptide or protein crosslinking include for example (i) amine-to-amine crosslinkers, e.g. homobifunctional amine-specific protein crosslinking reagents based on NHS-ester and imidoester reactive groups for selective conjugation of primary amines; available in short, long, cleavable, irreversible, membrane permeable, and cell surface varieties; (ii) sulfhydryl-to-carbohydrate crosslinkers, e.g. crosslinking reagents based on maleimide and hydrazide reactive groups for conjugation and formation of covalent crosslinks; (iii) sulfhydryl-to-sulfhydryl crosslinkers, e.g.
- homobifunctional sulfhydryl-specific crosslinking reagents based on maleimide or pyridyldithiol reactive groups for selective covalent conjugation of protein and peptide thiols (reduced cysteines) to form stable thioether bonds;
- photoreactive crosslinkers e.g. aryl azide, diazirine, and other photo-reactive (light-activated) chemical heterobifunctional crosslinking reagents to conjugate proteins, nucleic acids and other molecular structures involved in receptor-ligand interaction complexes via two-step activation;
- amine-to-sulfhydryl crosslinkers e.g.
- heterobifunctional protein crosslinking reagents for conjugation between primary amine (lysine) and sulfhydryl (cysteine) groups of proteins and other molecules; available with different lengths and types of spacer arms; and (vi) amine-to-amine crosslinkers, e.g. carboxyl-to-amine crosslinkers, e.g. Carbodiimide crosslinking reagents, DCC and EDC (EDAC), for conjugating carboxyl groups (glutamate, aspartate, C-termini) to primary amines (lysine, N-termini) and also N-hydroxysuccinimide (NHS) for stable activation of carboxylates for amine-conjugation.
- amine-to-amine crosslinkers e.g. carboxyl-to-amine crosslinkers, e.g. Carbodiimide crosslinking reagents, DCC and EDC (EDAC)
- carboxyl groups glutamate, aspartate, C-termini
- crosslinkers in general which can be used in the complex according to the present invention, include N-( ⁇ -Maleimidoacetoxy)-succinimide ester, N-5-Azido-2-nitrobenzyloxy-succinimide, 1,4-Bis-Maleimidobutane, 1,4-Bis-Maleimmidyl-2,3-dihydroxy-butane, Bis-Maleimidohexane, Bis-Maleimidoethane, N-( ⁇ -Maleimidopropionic acid)hydrazide*TFA, N-( ⁇ -Maleimidopropyloxy)succinimide ester, 1,8-Bis-Maleimidodiethylene-glycol, 1,11-Bis-Maleimidotriethyleneglycol, Bis (sulfosuccinimidyl)suberate, Bis (sulfosuccinimidyl)glutarate-d0, Bis (sulf
- the linkage between the CPP and the one or more cargo molecules of the complex according to the present invention may be directly or indirectly, i.e. the CPP and the one or more cargo molecules directly adjoin or they may be linked by an additional component of the complex, e.g. a spacer or a linker.
- a direct linkage may be realized preferably by an amide bridge, if the components to be linked have reactive amino or carboxy groups. More specifically, if the components to be linked are peptides, polypeptides or proteins, a peptide bond is preferred. Such a peptide bond may be formed using a chemical synthesis involving both components (an N-terminal end of one component and the C-terminal end of the other component) to be linked, or may be formed directly via a protein synthesis of the entire peptide sequence of both components, wherein both (protein or peptide) components are preferably synthesized in one step. Such protein synthesis methods include e.g., without being limited thereto, liquid phase peptide synthesis methods or solid peptide synthesis methods, e.g.
- solid peptide synthesis methods according to Merrifield, t-Boc solid-phase peptide synthesis, Fmoc solid-phase peptide synthesis, BOP (Benzotriazole-1-yl-oxy-tris-(dimethylamino)-phosphonium hexafluorophosphate) based solid-phase peptide synthesis, etc.
- BOP Benzotriazole-1-yl-oxy-tris-(dimethylamino)-phosphonium hexafluorophosphate
- ester or ether linkages are preferred.
- a linkage may occur via the side chains, e.g. by a disulfide bridge.
- Further components of other chemical nature e.g. the at least one antigen or antigenic epitope if it is not of peptidic nature, may be likewise attached to the components of peptidic nature, e.g. the CPP and the one or more cargo molecules, if it is of peptidic nature.
- the linkage via a side chain will preferably be based on side chain amino, thiol or hydroxyl groups, e.g. via an amide or ester or ether linkage.
- a linkage of a peptidic main chain with a peptidic side chain of another component may also be via an isopeptide bond.
- An isopeptide bond is an amide bond that is not present on the main chain of a protein. The bond forms between the carboxyl terminus of one peptide or protein and the amino group of a lysine residue on another (target) peptide or protein.
- the complex according to the present invention may optionally comprise a spacer or linker, which are non-immunologic moieties, which are preferably cleavable, and which link the CPP and the one or more cargo molecules, and/or optionally link one cargo molecule to another cargo molecule, and/or optionally link consecutive antigens or antigenic epitopes, and/or optionally link consecutive TLR peptide agonists, and/or which can be placed at the N- and/or C-terminal part of the components of the complex and/or at the N- and/or C-terminal part of the complex itself.
- a spacer or linker which are non-immunologic moieties, which are preferably cleavable, and which link the CPP and the one or more cargo molecules, and/or optionally link one cargo molecule to another cargo molecule, and/or optionally link consecutive antigens or antigenic epitopes, and/or optionally link consecutive TLR peptide agonists, and/or which can be placed at the
- a linker or spacer may preferably provide further functionalities in addition to linking of the components, and preferably being cleavable, more preferably naturally cleavable inside the target cell, e.g. by enzymatic cleavage.
- further functionalities do in particular not include any immunological functionalities.
- Examples of further functionalities, in particular regarding linkers in fusion proteins, can be found in Chen X. et al., 2013: Fusion Protein Linkers: Property, Design and Functionality. Adv Drug Deliv Rev. 65(10): 1357-1369, wherein for example also in vivo cleavable linkers are disclosed.
- linkers e.g. flexible linkers and rigid linkers, and linker designing tools and databases, which can be useful in the complex according to the present invention or to design a linker to be used in the complex according to the present invention.
- Said spacer may be peptidic or non-peptidic, preferably the spacer is peptidic.
- a peptidic spacer consists of about 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acids, more preferably of about 1, 2, 3, 4, or 5 amino acids.
- the amino acid sequence of the peptidic spacer may be identical to that of the N-terminal or C-terminal flanking region of any of the CPP or the one or more cargo molecules.
- a preferred spacer is the natural flanking amino acid residues of the cargo sequence, for example the natural flanking amino acid residues of each antigenic epitope comprised by the complex according to the present invention.
- the spacers/linkers used in the complex according to the present invention are the natural flanking four amino acid residues of each antigenic epitope comprised by the complex.
- a peptidic spacer can consist of non-natural amino acid sequences such as an amino acid sequence resulting from conservative amino acid substitutions of said natural flanking regions or sequences of known cleavage sites for proteases such as an enterokinase target site (amino acid sequence: DDDK, SEQ ID NO: 7), factor Xa target site (amino acid sequence: IEDGR, SEQ ID NO: 8), thrombin target site (amino acid sequence: LVPRGS, SEQ ID NO: 9), protease TEV target site (amino acid sequence: ENLYFQG, SEQ ID NO: 10), PreScission protease target site (amino acid sequence LEVLFQGP, SEQ ID NO: 11), polycationic amino acids, e.g.
- the peptidic spacer does not contain any Cys (C) residues.
- the linker sequence contains at least 20%, more preferably at least 40% and even more preferably at least 50% Gly or ⁇ -alanine residues, e.g.
- Appropriate linker sequences can be easily selected and prepared by a person skilled in the art. They may be composed of D and/or L amino acids.
- peptidic spacer examples include the amino acid sequences EQLE (SEQ ID NO: 15) or TEWT (SEQ ID NO: 16) or any conservative substitutions thereof.
- Further preferred linkers/spacers include those, which are described with their amino acid sequences in Table I of Reddy Chichili V P, Kumar V, Sivaraman J. 2013. Linkers in the structural biology of protein-protein interactions. Protein Sci. 22:153-167.
- a non-peptidic spacer can include or may be an ester, a thioester, and a di-sulfide.
- the complex according to the invention may comprise a spacer or linker, in particular a peptidic spacer, placed between the CPP and the one or more cargo molecules.
- This peptidic spacer can be chosen by one skilled in the art so that it may be cut by the cell machinery once the complex comprising the cell penetrating peptide and the cargo molecule has been internalized.
- each of the antigens or antigenic epitopes and/or each of the TLR peptide agonists comprised in the complex of the invention can be either directly linked to each other or linked via spacers or linkers such as described herein, e.g., a peptidic spacer consisting of a few amino acids.
- the complex according to the present invention comprises several antigens or antigenic epitopes or when the complex comprises several TLR peptide agonists
- some antigens or antigenic epitopes and/or some TLR peptide agonists comprised by the complex of the invention are directly linked to each other and some other antigens or antigenic epitopes and/or some other TLR peptide agonists are linked via spacers or linkers such as described herein, e.g. a peptidic spacer consisting of a few amino acids.
- any two successive cargo molecules or components comprised in the complex of the invention may be linked to each other by spacers consisting of the natural flanking regions of said antigens or antigenic epitopes or of said TLR peptide agonists, respectively.
- spacers may consist of up to about 8 amino acids corresponding to up to about 4 amino acids of the N-terminal or C-terminal flanking region of the first component to be linked, followed by up to about 4 amino acids of the N-terminal or C-terminal flanking region of the second component to be linked.
- the spacer used to link a first antigen/antigenic epitope, a TLR peptide agonist, or in more general a first component of the complex (“antigen/epitope/TLR peptide agonist/component 1”) to a second antigen/antigenic epitope, a TLR peptide agonist, or in more general a second component of the complex (“antigen/epitope/TLR peptide agonist/component 2”) consists of about 8 amino acids corresponding to any possible combination ranging from: 0 flanking amino acid of antigen/epitope/TLR peptide agonist/component 1 and 8 flanking amino acids of antigen/epitope/TLR peptide agonist/component 2, to 8 flanking amino acids of antigen/epitope/TLR peptide agonist/component 1 and 0 flanking amino acid of antigen/epitope/TLR peptide agonist/component 2, i.e.
- the total of 8 amino acids constituting a spacer linking two consecutive antigen/epitope/TLR peptide agonist/component is not an absolute value and the spacer could also be composed of a total of, for instance, 3 amino acids, 4 amino acids, 5 amino acids, 6 amino acids, 7 amino acids, 9 amino acids or 10 amino acids.
- equivalent combinations as mentioned above are also an illustration of the invention in the situation where a spacer has less or more than 8 amino acids.
- the spacer used to link a first antigen/antigenic epitope, a first TLR peptide agonist, or in more general a first component of the complex (“antigen/epitope/TLR peptide agonist/component 1”) to a second antigen/antigenic epitope, a first TLR peptide agonist, or in more general a second component of the complex (“antigen/epitope/TLR peptide agonist/component 2”) consists of e.g. 1, 2, 3, 4, or 5 amino acids.
- said spacer's amino acid sequence can correspond to the 4 amino acids of the N-terminal or C-terminal flanking region of antigen/epitope/TLR peptide agonist/component 1 or antigen/epitope/TLR peptide agonist/component 2.
- a spacer as described above may also be placed at the C-terminal part of the last antigen/epitope/TLR peptide agonist/component comprised in the complex according to the present invention.
- linkages between the CPP and, optionally, one or more cargo molecules are well documented in the literature and can depend on the nature of the cargo molecule, e.g. the at least one antigen or antigenic epitope.
- linkages between the CPP and, optionally, one or more cargo molecules can be achieved via cleavable disulphide linkages through total stepwise solid-phase synthesis or solution-phase or solid-phase fragment coupling, stable amide, thiazolidine, oxime and hydrazine linkage, disulphide linkage, stable thiomaleimide linkage, peptide bond (including peptide bonds between amino acids of a fusion protein), or electrostatic or hydrophobic interactions.
- the at least cargo molecule e.g. the at least one antigen or antigenic epitope, comprised by the complex according to the present invention as well as any optional spacer or linker comprised by the complex according to the present invention are of peptidic nature. More preferably, all components of the complex according to the present invention, e.g. the cell penetrating peptide and the at least one cargo molecule, which is a peptide, polypeptide or protein and any optional peptidic linker or spacer are linked in the complex according to the present invention by a peptide bond. Most preferably, the complex according to the present invention is thus a peptide, a polypeptide or a protein, such as a fusion protein, e.g. a recombinant fusion protein.
- the complex according to the present invention is a polypeptide or a protein, in particular a fusion protein or a fusion polypeptide.
- the complexes and the CPPs according to the present invention are typically recombinant peptides, polypeptides or proteins.
- the term “recombinant” as used herein means that it (here: the polypeptide or the protein) does not occur naturally.
- the CPP according to the invention has a serine (Ser) at position 12 (cf. SEQ ID NO: 1), which corresponds to position 189 of ZEBRA (SEQ ID NO: 2).
- the CPP according to the present invention is a recombinant peptide. Therefore, the complex according to the present invention, which comprises the (recombinant) CPP according to the present invention is also recombinant.
- the complex according to the present invention comprises the CPP and one or more cargo molecules, wherein CPP and the cargo molecule are preferably of different origins, i.e. do not naturally occur in this combination.
- the cargo molecule is not derived from EBV (Epstein-Barr virus), in particular the cargo molecule is preferably not a an EBV peptide or an EBV protein.
- a complex comprising or consisting of an amino acid sequence according to SEQ ID NO: 18 or SEQ ID NO: 19, a sequence variant thereof as described herein or a complex comprising or consisting of an amino acid sequence sharing at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% or at least 98% sequence identity with any of SEQ ID NO: 18 and SEQ ID NO: 19 is more preferred;
- a complex comprising or consisting
- SEQ ID NO: 17 MHHHHHHNID RPKGLAFTDV DVDSIKIAWE SPQGQVSRYR VTYSSPEDGI RELFPAPDGEDDTAELQGLR PGSEYTVSVV ALHDDMESQP LIGIQSTKRY KNRVASRKSR AKFKQLLQHY REVAAAKSSE NDRLRLLLKE SLKISQAVHA AHAEINEAGR EVVGVGALKV PRNQDWLGVP RFAKFASFEA QGALANIAVD KANLDVEQLE SIINFEKLTE WTGS SEQ ID NO: 18: MHHHHHHSTV HEILCKLSLE GDHSTPPSAY GSVKPYTNFD AEKRYKNRVA SRKSRAKFKQ LLQHYREVAA AKSSENDRLR LLLKESLKIS QAVHAAHAEI NEAGREVVGV GALKVPRNQD WLGVPRFAKF ASFEAQGALA NIAVDKANLD VEQLESIINF EKL
- the at least one antigen or antigenic epitope is positioned C-terminally of the cell penetrating peptide, whereby the cell penetrating peptide and the at least one antigen or antigenic epitope are optionally linked by a further component, e.g. a linker, a spacer, or by a TLR peptide agonist.
- a further component e.g. a linker, a spacer, or by a TLR peptide agonist.
- the at least one antigen or antigenic epitope is positioned C-terminally of the cell penetrating peptide, whereby the cell penetrating peptide and the at least one antigen or antigenic epitope are optionally linked by a further component, e.g. a linker, a spacer, but not by the at least one TLR peptide agonist.
- the complex according to the present invention is a (recombinant) polypeptide or a (recombinant) protein as described above, which comprises, as cargo molecules, at least one antigen or antigenic epitope and a TLR peptide agonist, and in such a preferred complex according to the present invention the cell penetrating peptide, the at least one antigen or antigenic epitope and the TLR peptide agonist are positioned in N-terminus ⁇ C-terminus direction of the main chain of said complex in the order:
- TLR peptide agonist cell penetrating peptide—at least one antigen or antigenic epitope
- cell penetrating peptide wherein the cell penetrating peptide, the at least one antigen or antigenic epitope and the
- TLR peptide agonist may be linked by a further component, in particular by a linker or a spacer.
- the present invention provides a nucleic acid encoding the cell penetrating peptide according to the present invention as described herein and/or the complex according to the present invention as described herein, wherein the complex is a polypeptide or a protein.
- the present invention provides polynucleotides encoding the cell penetrating peptide according to the present invention and/or the complex according to the present invention, as defined above.
- nucleic acids preferably comprise single stranded, double stranded or partially double stranded nucleic acids, preferably selected from genomic DNA, cDNA, RNA, siRNA, antisense DNA, antisense RNA, ribozyme, complimentary RNA/DNA sequences with or without expression elements, a mini-gene, gene fragments, regulatory elements, promoters, and combinations thereof.
- the invention relates to a nucleic acid encoding the cell penetrating peptide as described above and/or the complex as described above, which is in particular a polypeptide or protein, said complex comprising a cell penetrating peptide and a peptidic cargo molecule, e.g. at least one antigen or antigenic epitope, which is a polypeptide or protein, and/or at least one TLR peptide agonist, wherein the cell penetrating peptide, the at least one antigen or antigenic epitope, and the at least one TLR peptide agonist are covalently linked, optionally with peptidic spacer(s) or linker(s) as described herein.
- a nucleic acid encoding the cell penetrating peptide as described above and/or the complex as described above, which is in particular a polypeptide or protein
- said complex comprising a cell penetrating peptide and a peptidic cargo molecule, e.g. at least one
- the more than one antigen or antigenic epitope which is a polypeptide or protein, is comprised by said complex, the more than one antigens or antigenic epitopes are also covalently linked, optionally with peptidic spacer(s) or linker(s) as described herein.
- the nucleic acid according to the present invention encodes the cell penetrating peptide as described above and/or the complex as described above, which is a (recombinant) fusion protein comprising the cell penetrating peptide as described above and at least one cargo molecule, which is preferably TLR agonist as described above and at least one, preferably at least two, more preferably at least three, even more preferably at least four, particularly preferably at least five, most preferably at least six antigens or antigenic epitopes as described above, preferably arranged in a consecutive manner as described above.
- a cargo molecule which is preferably TLR agonist as described above and at least one, preferably at least two, more preferably at least three, even more preferably at least four, particularly preferably at least five, most preferably at least six antigens or antigenic epitopes as described above, preferably arranged in a consecutive manner as described above.
- the present invention provides a vector, in particular a recombinant vector, comprising a nucleic acid according to the present invention as described above.
- vector refers to a nucleic acid molecule, preferably to an artificial nucleic acid molecule, i.e. a nucleic acid molecule which does not occur in nature.
- a vector in the context of the present invention is suitable for incorporating or harboring a desired nucleic acid sequence.
- Such vectors may be storage vectors, expression vectors, cloning vectors, transfer vectors etc.
- a storage vector is a vector which allows the convenient storage of a nucleic acid molecule.
- the vector may comprise a sequence corresponding, e.g., to a desired antibody or antibody fragment thereof according to the present invention.
- An expression vector may be used for production of expression products such as RNA, e.g.
- an expression vector may comprise sequences needed for transcription of a sequence stretch of the vector, such as a promoter sequence.
- a cloning vector is typically a vector that contains a cloning site, which may be used to incorporate nucleic acid sequences into the vector.
- a cloning vector may be, e.g., a plasmid vector or a bacteriophage vector.
- a transfer vector may be a vector which is suitable for transferring nucleic acid molecules into cells or organisms, for example, viral vectors.
- a vector in the context of the present invention may be, e.g., an RNA vector or a DNA vector.
- a vector is a DNA molecule.
- a vector in the sense of the present application comprises a cloning site, a selection marker, such as an antibiotic resistance factor, and a sequence suitable for multiplication of the vector, such as an origin of replication.
- a vector in the context of the present application is a plasmid vector.
- a vector in the context of the present application is an expression vector.
- Cells transformed with a vector according to the present invention are also included within the scope of the invention.
- examples of such cells include, but are not limited to, bacterial cells, e.g. E. coli , and eukaryotic cells, e.g., yeast cells, animal cells or plant cells.
- the cells are mammalian, e.g., human, CHO, HEK293T, PER.C6, NS0, myeloma or hybridoma cells.
- the present invention also relates to a cell expressing the antibody, or the antigen binding fragment thereof, according to the present invention; or comprising the vector according to the present invention.
- a cell may be transfected with a vector according to the present invention, preferably with an expression vector.
- transfection refers to the introduction of nucleic acid molecules, such as DNA or RNA (e.g. mRNA) molecules, into cells, preferably into eukaryotic cells.
- RNA e.g. mRNA
- the term “transfection” encompasses any method known to the skilled person for introducing nucleic acid molecules into cells, preferably into eukaryotic cells, such as into mammalian cells. Such methods encompass, for example, electroporation, lipofection, e.g.
- the introduction is non-viral.
- the vector according to the present invention can be derived from bacterial plasmids, transposons, yeast episomes, insertion elements, yeast chromosome elements, viruses such as baculovirus, papilloma viruses such as SV40, vaccinia viruses, adenoviruses, fox pox viruses, pseudorabies viruses, retroviruses.
- such vectors in particular recombinant vectors, can equally be cosmid or phagemid derivatives.
- the nucleotide sequence in particular the nucleic acid according to the present invention, may be inserted in the recombinant expression vector by methods well known to a person skilled in the art such as, for example, those described in MOLECULAR CLONING: A LABORATORY MANUAL, Sambrook et al., 4th Ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 2001.
- the vector in particular the recombinant vector, may also include nucleotide sequences that control the regulation of the expression, in particular of the nucleic acid according to the present invention, as well as nucleotide sequences permitting the expression, the transcription, and the translation, in particular of the nucleic acid according to the present invention. Typically, these sequences are selected according to the host cells used.
- an appropriate secretion signal can be integrated in the vector according to the present invention, in particular in a recombinant vector, so that the polypeptide or protein encoded by the nucleic acid according to the present invention, will be directed, for example towards the lumen of the endoplasmic reticulum, towards the periplasmic space, on the membrane or towards the extracellular environment.
- the choice of an appropriate secretion signal may facilitate subsequent protein purification.
- the present invention provides a host cell comprising the vector, in particular the recombinant vector, according to the present invention.
- the introduction of the vector, in particular the recombinant vector, according to the present invention into a host cell can be carried out according to methods that are well known to a person skilled in the art, such as those described in BASIC METHODS IN MOLECULAR BIOLOGY, Davis et al., 2nd ed., McGraw-Hill Professional Publishing, 1995, and MOLECULAR CLONING: A LABORATORY MANUAL, supra, including for example transfection as described above, e.g. by calcium phosphate, by DEAE dextran, or by cationic lipids; microinjection, electroporation, transduction or infection.
- the host cell can be, for example, bacterial cells such as E. coli , cells of fungi such as yeast cells and cells of Aspergillus, Streptomyces , insect cells, and/or any cell line, e.g. Chinese Hamster Ovary cells (CHO), C127 mouse cell line, BHK cell line of Syrian hamster cells, Human Embryonic Kidney 293 (HEK 293) cells.
- the host cell according to the present invention is mammalian, e.g., human, CHO, HEK293T, PER.C6, NS0, myeloma or hybridoma cells.
- Dendritic cells and dendritic cell lines are particularly preferred as a host cell.
- the choice of a culture medium depends in particular on the choice of the cell type and/or the cell line, whereby the skilled person is aware of suitable culture media, which are appropriate for a selected cell type and/or cell line.
- the host cells can be used, for example, to express a polypeptide or protein, in particular the cell penetrating peptide according to the present invention and/or the complex according to the present invention, on the basis of the vector and/or the nucleic acid according to the present invention.
- the expressed polypeptide or protein, in particular the cell penetrating peptide according to the present invention and/or the complex according to the present invention can be used in a method as described hereinafter.
- the present invention also provides a method for preparing the cell penetrating peptide according to the present invention and/or the complex according to the present invention, in particular wherein the complex is a polypeptide or protein. Said method comprises the steps of:
- kits and/or reagents may be used, for example BugBusterTM from Novagen.
- the method for preparing the cell penetrating peptide according to the present invention and/or the complex according to the present invention as described above further comprises the following step:
- step (iii) follows step (ii) as described above.
- the method for preparing the cell penetrating peptide according to the present invention and/or the complex according to the present invention as described above further comprises the following step:
- step (iv) follows step (ii), or, if present, step (iii) as described above.
- cell penetrating peptide according to the present invention and/or the complex according to the present invention may also be prepared by synthetic chemistry methods, for example by solid-phase peptide synthesis.
- Purification of those peptides or proteins may be carried out by means of any technique known in the art for protein/peptide purification.
- Exemplary techniques include ion-exchange chromatography, hydrophobic interaction chromatography, and immunoaffinity methods.
- the present invention also provides a method for preparing the cell penetrating peptide according to the present invention and/or the complex according to the present invention comprising the steps of:
- the cell penetrating peptide and/or the complex which are chemically synthesized in step (i) and purified in step (ii), comprise (a) an amino acid sequences as described herein for the cell penetrating peptide as described herein and/or (b) an amino acid sequences as described herein for the cell penetrating peptide and an amino acid sequence as described herein for one or more cargo molecules such as a TLR peptide agonist, and, optionally if the at least one antigen and/or antigenic epitope is a peptide or a protein, an amino acid sequence as described herein for an antigen or antigenic epitope.
- the present invention also provides a method for preparing the complex according to the present invention, wherein
- the present invention relates to a cell loaded with the cell penetrating peptide according to the present invention and/or the complex according to the invention.
- the cells loaded with the cell penetrating peptide according to the present invention and/or the complex according to the invention are cells from a subject to be treated, in particular isolated cells from a subject to be treated, i.e. cells isolated from a subject to be treated.
- the term “subject” refers in particular to mammals.
- mammals contemplated by the present invention include human, primates, domesticated animals such as cattle, sheep, pigs, horses, laboratory rodents and the like. More preferably, the term “subject” refers to a human subject.
- treatment and “treating” and the like generally mean obtaining a desired pharmacological and physiological effect.
- the effect may be prophylactic in terms of preventing or partially preventing a disease, a symptom or a condition thereof and/or may be therapeutic in terms of a partial or complete cure of a disease, a condition, a symptom or an adverse effect attributed to the disease.
- treatment covers any treatment of a disease in a mammal, in particular in a human, and includes: (a) preventing the disease from occurring in a subject who may be predisposed to the disease but the outbreak of the disease has not yet occurred and/or the disease has not yet been diagnosed in this subject, for example a preventive early asymptomatic intervention; (b) inhibiting the disease, i.e., arresting or slowing down its development; or (c) relieving the disease, i.e., causing an at least partial regression of the disease and/or of at least one of its symptoms or conditions such as improvement or remediation of damage.
- prevention of a disease or disorder includes the prevention of the appearance or development of a cancer in an individual identified as at risk of developing said cancer, for instance due to past occurrence of said cancer in the circle of the individual's relatives, and prevention of infection with tumor promoting pathogens such as, for example, Epstein-Barr virus (EBV), Human papillomavirus (HPV), Hepatitis B virus (HBV), Hepatitis C virus (HCV), Human Herpes virus 8 (HHV8), human T-cell leukemia virus type 1 (HTLV-1), Merkel cell polyomavirus (MCV) and Helicobacter pylori.
- prevention/treatment of a cancer is the stabilization or delay of an already diagnosed cancer in an individual.
- the cell loaded with the complex according to the invention is an antigen-presenting cell (APC).
- the antigen presenting cell is selected from the group consisting of a dendritic cell (DC), a macrophage and a B-cell.
- DC dendritic cell
- B-cell dendritic cells, in particular dendritic cells (conventional and/or plasmacytoid) isolated from a subject to be treated, are more preferred.
- antigen-presenting cells in particular dendritic cells
- methods to isolate antigen-presenting cells, in particular dendritic cells, from a subject include harvesting monocytes or hematopoietic stem cells from bone marrow, cord blood, or peripheral blood. They also include the use of embryonic stem (ES) cells and induced pluripotent stem cells (iPS).
- ES embryonic stem
- iPS induced pluripotent stem cells
- Antigen presenting cells, in particular dendritic cells or their precursors can be enriched by methods including elutriation and magnetic bead based separation, which may involve enrichment for CD14 + 0 precursor cells.
- Methods to load the cell penetrating peptide according to the present invention and/or the complex according to the present invention into the cells, preferably into the above-mentioned antigen presenting cells, more preferably into dendritic cells, and further to prepare such cells before administration to a subject are known to one skilled in the art.
- preparation of dendritic cells can include their culture or differentiation using cytokines that may include for example GM-CSF and IL-4. Dendritic cell lines may also be employed.
- Loading of the complex of the invention into the cells, preferably into APC, more preferably into the dendritic cells, can involve co-incubation of the complex of the invention with the cells in culture, making use of the intrinsic properties of the cell penetrating peptide comprised by the complex according to the invention (i.e. its internalization ability).
- Further culture of the cells, e.g. the dendritic cells, thus loaded to induce efficient maturation can include addition of cytokines including IL-1 ⁇ , IL-6, TNF ⁇ , PGE2, IFN ⁇ , and adjuvants which may include poly-IC, poly-ICLC (i.e.
- the present invention also concerns imaging cells used for cell therapy, such as stem cells, dendritic cells, T cells or natural killer cells, wherein the cells are loaded with the complex according to the invention, which may further comprise an imaging agent.
- imaging cells used for cell therapy such as stem cells, dendritic cells, T cells or natural killer cells, wherein the cells are loaded with the complex according to the invention, which may further comprise an imaging agent.
- the present invention also provides a method for preparing cells, in particular antigen presenting cells, loaded with the cell penetrating peptide according to the present invention and/or the complex according to the present invention as described above, said method comprising the steps of:
- the cells are loaded with the complex according to the present invention, wherein the complex is a polypeptide or a protein.
- the complex is a polypeptide or a protein.
- the cells loaded with a complex(es) according to the present invention comprising at least one antigen or antigenic epitope present the at least one antigen or antigenic epitope comprised by said complex at the cell surface in an MHC class I context and/or in an MHC class II context as described herein.
- the invention provides a composition comprising at least one component selected from:
- composition according to the present invention comprises the complex according to the present invention as described above.
- composition according to the present invention may also comprises more than one of the above components (i) to (vi).
- the composition according to the present invention may comprise at least two different complexes under (ii), at least two different nucleic acids under (iii), at least two different vectors under (iv), at least two different host cells under (v), and/or at least two different cells under (vi); e.g., the composition of the invention may comprise at least two different complexes (ii) and/or at least two different nucleic acids (iii).
- the different complexes (ii) comprised by the composition as described above may differ in the at least one cargo molecule, for example in the antigens or antigenic epitopes or in the subsets of more than one antigen or antigenic epitope, or in the TLR peptide agonist.
- the different nucleic acids (iii) comprised by the composition as described above may differ in that they encode such different complexes; the different vectors (iv) comprised by the composition as described above may differ in that they comprise such different nucleic acids; the different host cells (v) comprised by the composition as described above may differ in that they comprise such different vectors; and the different cells loaded with a complex (vi) comprised by the composition as described above may differ in that they are loaded with such different complexes.
- the present invention also provides the cell penetrating peptide and/or the complex as described herein or cells loaded with said CPP and/or said complex, as described herein, for use as a medicament, in particular as a vaccine.
- the composition according to the present invention is preferably a vaccine.
- the present invention also provides a vaccine comprising at least one component selected from:
- the vaccine according to the present invention comprises the complex according to the present invention as described above.
- composition according to the present invention regarding more than one of the components (i) to (vi), also apply for the vaccine according to the present invention.
- the term “vaccine” refers to a biological preparation that provides innate and/or adaptive immunity, typically to a particular disease, preferably cancer.
- a vaccine supports in particular an innate and/or an adaptive immune response of the immune system of a subject to be treated.
- an antigen or antigenic epitope of the complex according to the present invention typically leads to or supports an adaptive immune response in the patient to be treated, and/or a TLR peptide agonist of the complex according to the present invention may lead to or support an innate immune response.
- inventive composition in particular the inventive vaccine, may also comprise a pharmaceutically acceptable carrier, adjuvant, and/or vehicle as defined below for the inventive pharmaceutical composition.
- a pharmaceutically acceptable carrier in the specific context of the inventive composition, in particular of the inventive vaccine, the choice of a pharmaceutically acceptable carrier is determined in principle by the manner in which the inventive composition, in particular the inventive vaccine, is administered.
- inventive composition, in particular the inventive vaccine can be administered, for example, systemically or locally.
- Routes for systemic administration in general include, for example, transdermal, oral, parenteral routes, including subcutaneous, intravenous, intramuscular, intraarterial, intradermal and intraperitoneal injections and/or intranasal administration routes.
- inventive compositions for local administration in general include, for example, topical administration routes but also intradermal, transdermal, subcutaneous, or intramuscular injections or intralesional, intracranial, intrapulmonal, intracardial, intranodal and sublingual injections.
- inventive composition, in particular the vaccines may be administered by an intradermal, subcutaneous, intranodal or intramuscular route.
- inventive composition, in particular the vaccine may be administered by subcutaneous, intranodal or intramuscular route.
- the inventive composition, in particular the vaccines may be administered by subcutaneous or intranodal route.
- the inventive composition, in particular the vaccines may be administered by subcutaneous route.
- inventive composition, in particular the inventive vaccines are therefore preferably formulated in liquid (or sometimes in solid) form.
- the suitable amount of the inventive composition, in particular the inventive vaccine, to be administered can be determined by routine experiments with animal models. Such models include, without implying any limitation, rabbit, sheep, mouse, rat, dog and non-human primate models.
- Preferred unit dose forms for injection include sterile solutions of water, physiological saline or mixtures thereof. The pH of such solutions should be adjusted to about 7.4.
- Suitable carriers for injection include hydrogels, devices for controlled or delayed release, polylactic acid and collagen matrices.
- Suitable pharmaceutically acceptable carriers for topical application include those which are suitable for use in lotions, creams, gels and the like. If the inventive composition, in particular the inventive vaccine, is to be administered orally, tablets, capsules and the like are the preferred unit dose form.
- the pharmaceutically acceptable carriers for the preparation of unit dose forms which can be used for oral administration are well known in the prior art. The choice thereof will depend on secondary considerations such as taste, costs and storability, which are not critical for the purposes of the present invention, and can be made without difficulty by a person skilled in the art.
- inventive composition in particular the inventive vaccine, can additionally contain one or more auxiliary substances in order to further increase its immunogenicity.
- various mechanisms can come into consideration in this respect. For example, compounds that permit the maturation of dendritic cells (DCs), for example lipopolysaccharides, TNF-alpha or CD40 ligand, form a first class of suitable auxiliary substances.
- DCs dendritic cells
- TNF-alpha or CD40 ligand form a first class of suitable auxiliary substances.
- auxiliary substance any agent that influences the immune system in the manner of a “danger signal” (LPS, GP96, etc.) or cytokines, such as GM-CSF, which allow an immune response produced by the immune-stimulating adjuvant according to the invention to be enhanced and/or influenced in a targeted manner.
- a “danger signal” LPS, GP96, etc.
- cytokines such as GM-CSF
- auxiliary substances are cytokines, such as monokines, lymphokines, interleukins or chemokines, that further promote the innate immune response, such as IL-1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-12, IL-13, IL-14, IL-15, IL-16, IL-17, IL-18, IL-19, IL-20, IL-21, IL-22, IL-23, IL-24, IL-25, IL-26, IL-27, IL-28, IL-29, IL-30, IL-31, IL-32, IL-33, IFN-alpha, IFN-beta, IFN-gamma, GM-CSF, G-CSF, M-CSF, LT-beta or TNF-alpha, growth factors, such as hGH.
- cytokines such as monokines, lymphokines, interleukins
- emulsifiers such as, for example, Tween®
- wetting agents such as, for example, sodium lauryl sulfate
- colouring agents such as, for example, sodium lauryl sulfate
- taste-imparting agents pharmaceutical carriers
- tablet-forming agents such as, for example, stabilizers; antioxidants; preservatives.
- inventive composition in particular the inventive vaccine, can also additionally contain any further compound, which is known to be immune-stimulating due to its binding affinity (as ligands) to human Toll-like receptors TLR1, TLR2, TLR3, TLR4, TLR5, TLR6, TLR7, TLR8, TLR9, TLR10, or due to its binding affinity (as ligands) to murine Toll-like receptors TLR1, TLR2, TLR3, TLR4, TLR5, TLR6, TLR7, TLR8, TLR9, TLR10, TLR11, TLR12 or TLR13.
- binding affinity as ligands
- CpG nucleic acids in particular CpG-RNA or CpG-DNA.
- a CpG-RNA or CpG-DNA can be a single-stranded CpG-DNA (ss CpG-DNA), a double-stranded CpG-DNA (dsDNA), a single-stranded CpG-RNA (ss CpG-RNA) or a double-stranded CpG-RNA (ds CpG-RNA).
- the CpG nucleic acid is preferably in the form of CpG-RNA, more preferably in the form of single-stranded CpG-RNA (ss CpG-RNA).
- the CpG nucleic acid preferably contains at least one or more (mitogenic) cytosine/guanine dinucleotide sequence(s) (CpG motif(s)).
- CpG motif(s) cytosine/guanine dinucleotide sequence(s)
- at least one CpG motif contained in these sequences in particular the C (cytosine) and the G (guanine) of the CpG motif, is unmethylated. All further cytosines or guanines optionally contained in these sequences can be either methylated or unmethylated.
- the C (cytosine) and the G (guanine) of the CpG motif can also be present in methylated form.
- the present invention also provides the complex as described above or cells loaded with said complex or a composition or a vaccine as described above for use in the prevention and/or treatment of diseases or disorders including for example cancers, hematological disorders, infectious diseases, autoimmunity disorders and transplant rejections, whereby cancer is preferred.
- diseases or disorders including for example cancers, hematological disorders, infectious diseases, autoimmunity disorders and transplant rejections, whereby cancer is preferred.
- the present invention also provides the complex as described above or cells loaded with said complex or a composition as described above for use as an imaging or diagnostic composition.
- the present invention also provides a pharmaceutical composition, in particular a vaccine composition as described above, and a method for treating a subject, preferably a mammalian subject, and most preferably a human subject, who is suffering from a disease or disorder, in particular from a disorder that can be treated by immunotherapy, such as cancers, infectious diseases, autoimmunity disorders and transplant rejections.
- a pharmaceutical composition in particular a vaccine composition as described above, and a method for treating a subject, preferably a mammalian subject, and most preferably a human subject, who is suffering from a disease or disorder, in particular from a disorder that can be treated by immunotherapy, such as cancers, infectious diseases, autoimmunity disorders and transplant rejections.
- the present invention provides a pharmaceutical composition
- a pharmaceutical composition comprising at least one complex according to the present invention or at least one cell loaded with a complex according to the present invention, and optionally a pharmaceutically acceptable carrier and/or vehicle, or any excipient, buffer, stabilizer or other materials well known to those skilled in the art.
- the pharmaceutical composition comprises at least one complex according to the present invention or at least one cell loaded with a complex according to the present invention, and a pharmaceutically acceptable carrier.
- the inventive pharmaceutical composition may in particular comprise a pharmaceutically acceptable carrier and/or vehicle.
- a pharmaceutically acceptable carrier typically includes the liquid or non-liquid basis of the inventive pharmaceutical composition. If the inventive pharmaceutical composition is provided in liquid form, the carrier will typically be pyrogen-free water; isotonic saline or buffered (aqueous) solutions, e.g phosphate, citrate etc. buffered solutions.
- water or preferably a buffer preferably an aqueous buffer
- a sodium salt preferably at least 30 mM of a sodium salt
- a calcium salt preferably at least 0.05 mM of a calcium salt
- optionally a potassium salt preferably at least 1 mM of a potassium salt.
- the sodium, calcium and, optionally, potassium salts may occur in the form of their halogenides, e.g. chlorides, iodides, or bromides, in the form of their hydroxides, carbonates, hydrogen carbonates, or sulfates, etc.
- examples of sodium salts include e.g.
- examples of the optional potassium salts include e.g. KCl, Kl, KBr, K 2 CO 3 , KHCO 3 , K 2 SO 4
- examples of calcium salts include e.g. CaCl 2 , Cal 2 , CaBr 2 , CaCO 3 , CaSO 4 , Ca(OH) 2 .
- organic anions of the aforementioned cations may be contained in the buffer.
- the buffer suitable for injection purposes as defined above may contain salts selected from sodium chloride (NaCl), calcium chloride (CaCl 2 ) and optionally potassium chloride (KCl), wherein further anions may be present additional to the chlorides.
- CaCl 2 can also be replaced by another salt like KCl.
- the salts in the injection buffer are present in a concentration of at least 30 mM sodium chloride (NaCl), at least 1 mM potassium chloride (KCl) and at least 0,05 mM calcium chloride (CaCl 2 ).
- the injection buffer may be hypertonic, isotonic or hypotonic with reference to the specific reference medium, i.e.
- the buffer may have a higher, identical or lower salt content with reference to the specific reference medium, wherein preferably such concentrations of the afore mentioned salts may be used, which do not lead to damage of cells due to osmosis or other concentration effects.
- Reference media are e.g. liquids occurring in “in vivd” methods, such as blood, lymph, cytosolic liquids, or other body liquids, or e.g. liquids, which may be used as reference media in “in vitro” methods, such as common buffers or liquids.
- Such common buffers or liquids are known to a skilled person. Saline (0.9% NaCl) and Ringer-Lactate solution are particularly preferred as a liquid basis.
- one or more compatible solid or liquid fillers or diluents or encapsulating compounds may be used as well for the inventive pharmaceutical composition, which are suitable for administration to a subject to be treated.
- the term “compatible” as used herein means that these constituents of the inventive pharmaceutical composition are capable of being mixed with the complex according to the present invention as defined above in such a manner that no interaction occurs which would substantially reduce the pharmaceutical effectiveness of the inventive pharmaceutical composition under typical use conditions.
- Pharmaceutically acceptable carriers, fillers and diluents must, of course, have sufficiently high purity and sufficiently low toxicity to make them suitable for administration to a subject to be treated.
- Some examples of compounds which can be used as pharmaceutically acceptable carriers, fillers or constituents thereof are sugars, such as, for example, lactose, glucose and sucrose; starches, such as, for example, corn starch or potato starch; cellulose and its derivatives, such as, for example, sodium carboxymethylcellulose, ethylcellulose, cellulose acetate; powdered tragacanth; malt; gelatin; tallow; solid glidants, such as, for example, stearic acid, magnesium stearate; calcium sulfate; vegetable oils, such as, for example, groundnut oil, cottonseed oil, sesame oil, olive oil, corn oil and oil from theobroma; polyols, such as, for example, polypropylene glycol, glycerol, sorbitol, mannitol and polyethylene glycol; alginic acid.
- sugars such as, for example, lactose, glucose and sucrose
- starches such as, for example, corn star
- the inventive pharmaceutical composition may be administered orally, parenterally, by inhalation spray, topically, rectally, nasally, buccally, vaginally or via an implanted reservoir.
- parenteral as used herein includes subcutaneous, intravenous, intramuscular, intra-articular, intra-synovial, intrasternal, intrathecal, intrahepatic, intralesional, intracranial, transdermal, intradermal, intrapulmonal, intraperitoneal, intracardial, intraarterial, intranodal and sublingual injection or infusion techniques.
- the inventive pharmaceutical composition may be administered intradermally, intramuscularly, intranodally or subcutaneously. More preferably the inventive pharmaceutical composition may be administered intramuscularly, intranodally or subcutaneously. Even more preferably the inventive pharmaceutical composition may be administered intranodally or subcutaneously. Most preferably, the inventive pharmaceutical composition may be administered subcutaneously.
- the inventive pharmaceutical composition may be administered by parenteral injection, more preferably by subcutaneous, intravenous, intramuscular, intra-articular, intra-synovial, intrasternal, intrathecal, intrahepatic, intralesional, intracranial, transdermal, intradermal, intrapulmonal, intraperitoneal, intracardial, intraarterial, intranodal and sublingual injection or via infusion techniques.
- Sterile injectable forms of the inventive pharmaceutical compositions may be aqueous or oleaginous suspension. These suspensions may be formulated according to techniques known in the art using suitable dispersing or wetting agents and suspending agents.
- the sterile injectable preparation may also be a sterile injectable solution or suspension in a non-toxic parenterally-acceptable diluent or solvent, for example as a solution in 1.3-butanediol.
- a non-toxic parenterally-acceptable diluent or solvent for example as a solution in 1.3-butanediol.
- acceptable vehicles and solvents that may be employed are water, Ringer's solution and isotonic sodium chloride solution.
- sterile, fixed oils are conventionally employed as a solvent or suspending medium.
- any bland fixed oil may be employed including synthetic mono- or di-glycerides.
- Fatty acids such as oleic acid and its glyceride derivatives are useful in the preparation of injectables, as are natural pharmaceutically-acceptable oils, such as olive oil or castor oil, especially in their polyoxyethylated versions.
- These oil solutions or suspensions may also contain a long-chain alcohol diluent or dispersant, such as carboxymethyl cellulose or similar dispersing agents that are commonly used in the formulation of pharmaceutically acceptable dosage forms including emulsions and suspensions.
- Other commonly used surfactants such as Tweens, Spans and other emulsifying agents or bioavailability enhancers which are commonly used in the manufacture of pharmaceutically acceptable solid, liquid, or other dosage forms may also be used for the purposes of formulation of the inventive pharmaceutical composition.
- the active ingredient will preferably be in the form of a parenterally acceptable aqueous solution which is pyrogen-free and has suitable pH, isotonicity and stability.
- a parenterally acceptable aqueous solution which is pyrogen-free and has suitable pH, isotonicity and stability.
- isotonic vehicles such as Sodium Chloride Injection, Ringer's Injection, Lactated Ringer's Injection.
- Preservatives, stabilizers, buffers, antioxidants and/or other additives may be included, as required.
- administration is preferably in a “prophylactically effective amount” or a “therapeutically effective amount” (as the case may be), this being sufficient to show benefit to the individual.
- a “prophylactically effective amount” or a “therapeutically effective amount” as the case may be
- the actual amount administered, and rate and time-course of administration, will depend on the nature and severity of what is being treated.
- inventive pharmaceutical composition as defined above may also be administered orally in any orally acceptable dosage form including, but not limited to, capsules, tablets, aqueous suspensions or solutions.
- carriers commonly used include lactose and corn starch.
- Lubricating agents such as magnesium stearate, are also typically added.
- useful diluents include lactose and dried cornstarch.
- the active ingredient i.e. the inventive transporter cargo conjugate molecule as defined above, is combined with emulsifying and suspending agents. If desired, certain sweetening, flavoring or coloring agents may also be added.
- the inventive pharmaceutical composition may also be administered topically, especially when the target of treatment includes areas or organs readily accessible by topical application, e.g. including diseases of the skin or of any other accessible epithelial tissue. Suitable topical formulations are readily prepared for each of these areas or organs.
- the inventive pharmaceutical composition may be formulated in a suitable ointment, containing the inventive immunostimulatory composition, particularly its components as defined above, suspended or dissolved in one or more carriers.
- Carriers for topical administration include, but are not limited to, mineral oil, liquid petrolatum, white petrolatum, propylene glycol, polyoxyethylene, polyoxypropylene compound, emulsifying wax and water.
- the inventive pharmaceutical composition can be formulated in a suitable lotion or cream.
- suitable carriers include, but are not limited to, mineral oil, sorbitan monostearate, polysorbate 60, cetyl esters wax, cetearyl alcohol, 2-octyldodecanol, benzyl alcohol and water.
- prescription of treatment e.g. decisions on dosage etc. when using the above pharmaceutical composition is typically within the responsibility of general practitioners and other medical doctors, and typically takes account of the disorder to be treated, the condition of the individual patient, the site of delivery, the method of administration and other factors known to practitioners. Examples of the techniques and protocols mentioned above can be found in REMINGTON'S PHARMACEUTICAL SCIENCES, 16th edition, Osol, A. (ed), 1980.
- the inventive pharmaceutical composition typically comprises a “safe and effective amount” of the components of the inventive pharmaceutical composition, in particular of the complex according to the present invention as defined above and/or cells loaded with said complex.
- a “safe and effective amount” means an amount of the complex according to the present invention that is sufficient to significantly induce a positive modification of a disease or disorder, i.e. an amount of the complex according to the present invention or cells loaded with said complex, that elicits the biological or medicinal response in a tissue, system, animal or human that is being sought.
- An effective amount may be a “therapeutically effective amount” for the alleviation of the symptoms of the disease or condition being treated and/or a “prophylactically effective amount” for prophylaxis of the symptoms of the disease or condition being prevented.
- the term also includes the amount of active complex sufficient to reduce the progression of the disease, notably to reduce or inhibit the tumor growth or infection and thereby elicit the response being sought, in particular such response could be an immune response directed against the antigens or antigenic epitopes comprised in by the complex (i.e. an “inhibition effective amount”).
- an “inhibition effective amount” is small enough to avoid serious side-effects, that is to say to permit a sensible relationship between advantage and risk.
- a “safe and effective amount” of the components of the inventive pharmaceutical composition, particularly of the complex according to the present invention as defined above, will furthermore vary in connection with the particular condition to be treated and also with the age and physical condition of the patient to be treated, the body weight, general health, sex, diet, time of administration, rate of excretion, drug combination, the activity of the specific components a), b), and c) of the complex according to the present invention as defined above, the severity of the condition, the duration of the treatment, the nature of the accompanying therapy, of the particular pharmaceutically acceptable carrier used, and similar factors, within the knowledge and experience of the accompanying doctor.
- the inventive pharmaceutical composition may be used for human and also for veterinary medical purposes, preferably for human medical purposes, as a pharmaceutical composition in general or as a vaccine.
- compositions in particular vaccine compositions, or formulations according to the invention may be administered as a pharmaceutical formulation which can contain a complex according to the present invention in any form described herein.
- pharmaceutical formulation and “pharmaceutical composition” as used in the context of the present invention refer in particular to preparations which are in such a form as to permit biological activity of the active ingredient(s) to be unequivocally effective and which contain no additional component which would be toxic to subjects to which the said formulation would be administered.
- an “efficacy” of a treatment can be measured based on changes in the course of a disease in response to a use or a method according to the present invention.
- the efficacy of a treatment of cancer can be measured by a reduction of tumor volume, and/or an increase of progression free survival time, and/or a decreased risk of relapse post-resection for primary cancer.
- assessment of efficacy can be by the spectrum of clinical patterns of antitumor response for immunotherapeutic agents through novel immune-related response criteria (irRC), which are adapted from Response Evaluation Criteria in Solid Tumors (RECIST) and World Health Organization (WHO) criteria ( J. Natl. Cancer Inst.
- the efficacy of prevention of infectious disease is ultimately assessed by epidemiological studies in human populations, which often correlates with titres of neutralizing antibodies in sera, and induction of multifunctional pathogen specific T cell responses.
- Preclinical assessment can include resistance to infection after challenge with infectious pathogen.
- Treatment of an infectious disease can be measured by inhibition of the pathogen's growth or elimination of the pathogen (and, thus, absence of detection of the pathogen), correlating with pathogen specific antibodies and/or T cell immune responses.
- compositions in particular vaccine compositions, or formulations according to the invention may also be administered as a pharmaceutical formulation which can contain antigen presenting cells loaded with a complex according to the invention in any form described herein.
- the vaccine and/or the composition according to the present invention may also be formulated as pharmaceutical compositions and unit dosages thereof, in particular together with a conventionally employed adjuvant, immunomodulatory material, carrier, diluent or excipient as described above and below, and in such form may be employed as solids, such as tablets or filled capsules, or liquids such as solutions, suspensions, emulsions, elixirs, or capsules filled with the same, all for oral use, or in the form of sterile injectable solutions for parenteral (including subcutaneous and intradermal) use by injection or continuous infusion.
- injectable compositions are typically based upon injectable sterile saline or phosphate-buffered saline or other injectable carriers known in the art.
- Such pharmaceutical compositions and unit dosage forms thereof may comprise ingredients in conventional proportions, with or without additional active compounds or principles, and such unit dosage forms may contain any suitable effective amount of the active ingredient commensurate with the intended daily dosage range to be employed.
- suitable adjuvants and/or immunomodulatory materials include MPL® (Corixa), aluminum-based minerals including aluminum compounds (generically called Alum), ASO1-4, MF59, CalciumPhosphate, Liposomes, Iscom, polyinosinic:polycytidylic acid (polylC), including its stabilized form poly-ICLC (Hiltonol), CpG oligodeoxynucleotides, Granulocyte-macrophage colony-stimulating factor (GM-CSF), lipopolysaccharide (LPS), Montanide, polylactide co-glycolide (PLG), Flagellin, Soap Bark tree saponins (QS21), amino alkyl glucosamide compounds (e.g.
- RC529 two component antibacterial peptides with synthetic oligodeoxynucleotides (e.g. IC31), Imiquimod, Resiquimod, Immunostimulatory sequences (ISS), monophosphoryl lipid A (MPLA), Fibroblast-stimulating lipopeptide (FSL1), and anti-CD40 antibodies.
- synthetic oligodeoxynucleotides e.g. IC31
- Imiquimod Imiquimod
- Resiquimod Immunostimulatory sequences
- MPLA monophosphoryl lipid A
- FSL1 Fibroblast-stimulating lipopeptide
- compositions in particular pharmaceutical compositions and vaccines, according to the present invention may be liquid formulations including, but not limited to, aqueous or oily suspensions, solutions, emulsions, syrups, and elixirs.
- the compositions may also be formulated as a dry product for reconstitution with water or other suitable vehicle before use.
- Such liquid preparations may contain additives including, but not limited to, suspending agents, emulsifying agents, non-aqueous vehicles and preservatives.
- Suspending agents include, but are not limited to, sorbitol syrup, methyl cellulose, glucose/sugar syrup, gelatin, hydroxyethyl cellulose, carboxymethyl cellulose, aluminum stearate gel, and hydrogenated edible fats.
- Emulsifying agents include, but are not limited to, lecithin, sorbitan monooleate, and acacia.
- Preservatives include, but are not limited to, methyl or propyl p-hydroxybenzoate and sorbic acid.
- Dispersing or wetting agents include but are not limited to poly(ethylene glycol), glycerol, bovine serum albumin, Tween®, Span®.
- compositions in particular pharmaceutical compositions and vaccines, according to the present invention may also be formulated as a depot preparation, which may be administered by implantation or by intramuscular injection.
- compositions in particular pharmaceutical compositions and vaccines, according to the present invention may also be solid compositions, which may be in the form of tablets or lozenges formulated in a conventional manner.
- tablets and capsules for oral administration may contain conventional excipients including, but not limited to, binding agents, fillers, lubricants, disintegrants and wetting agents.
- Binding agents include, but are not limited to, syrup, accacia, gelatin, sorbitol, tragacanth, mucilage of starch and polyvinylpyrrolidone.
- Fillers include, but are not limited to, lactose, sugar, microcrystalline cellulose, maizestarch, calcium phosphate, and sorbitol.
- Lubricants include, but are not limited to, magnesium stearate, stearic acid, talc, polyethylene glycol, and silica.
- Disintegrants include, but are not limited to, potato starch and sodium starch glycollate.
- Wetting agents include, but are not limited to, sodium lauryl sulfate. Tablets may be coated according to methods well known in the art.
- compositions in particular pharmaceutical compositions and vaccines, according to the present invention may also be administered in sustained release forms or from sustained release drug delivery systems.
- compositions in particular pharmaceutical compositions and vaccines, according to the present invention may be adapted for delivery by repeated administration.
- the present invention provides a method of preparing a pharmaceutical composition according to the present invention comprising the step of mixing complex according to the present invention or cells, in particular antigen-presenting cells, loaded with a complex according to the present invention, and a pharmaceutically acceptable carrier.
- the complex according to the present invention and the cell loaded with a complex according to the present invention may be used (for the preparation of a pharmaceutical composition and/or the preparation of a vaccine) for the prevention, treatment and/or amelioration of any of the diseases and disorders as defined herein, in particular those that can be treated or prevented by immunotherapy such as cancers and infectious diseases.
- the invention provides imaging or diagnosis compositions.
- a still other aspect concerns methods for delivering an imaging agent and methods for diagnosing a disease or disorder in a subject, preferably a mammalian subject, and most preferably a human subject who is suspected of suffering from a medical disorder, and in particular a cancer, infectious disease, autoimmunity disorder and transplant rejection.
- compositions and modes of administration described herewith for the pharmaceutical compositions can also be suitable to the imaging or diagnosis compositions according to the invention.
- the pharmaceutical composition as described herein comprises at least two different complexes according to the present invention.
- kits-of-parts comprising at least one of:
- the kit-of-parts of the invention may comprise more than one component (i) to (vi).
- the kit-of-parts according to the present invention may comprise at least two different complexes under (ii), at least two different nucleic acids under (iii), at least two different vectors under (iv), at least two different host cells under (v), and/or at least two different cells under (vi); e.g., the kit-of-parts of the invention may comprise at least two different complexes (ii) and/or at least two different nucleic acids (iii).
- kit-of-parts may be packaged in one or more containers.
- the above components may be provided in a lyophilized or dry form or dissolved in a suitable buffer.
- the kit may also comprise additional reagents including, for instance, preservatives, growth media, and/or buffers for storage and/or reconstitution of the above-referenced components, washing solutions, and the like.
- additional reagents including, for instance, preservatives, growth media, and/or buffers for storage and/or reconstitution of the above-referenced components, washing solutions, and the like.
- the kit-of-parts according to the present invention may optionally contain instructions of use.
- the present invention also provides a vaccination kit for treating, preventing and/or stabilizing a cancer or an infectious disease, comprising the pharmaceutical composition according to the present invention or a vaccine according to the present invention and instructions for use of said pharmaceutical composition or of said vaccine.
- compositions and/or the kit-of-parts according to the present inventions may be used in imaging techniques and/or in diagnosis of disease or disorder as disclosed herein.
- the present invention provides the use of any one of: (i) the complex according to the present invention, (ii) the pharmaceutical composition according to the present invention and/or (ii) cells, such as antigen-presenting cells, loaded with a complex according to the present invention, as a medicament.
- the present invention provides the use of any one of: (i) the complex according to the present invention, (ii) the pharmaceutical composition according to the present invention and/or (ii) cells, such as antigen-presenting cells, loaded with a complex according to the present invention (for the preparation of a medicament) for the prevention, treatment or stabilization of a disease or disorder, such as those which can be treated by immunotherapy, including cancers, infectious diseases, autoimmunity disorders, hematological diseases and transplant rejections.
- a disease or disorder such as those which can be treated by immunotherapy, including cancers, infectious diseases, autoimmunity disorders, hematological diseases and transplant rejections.
- the disease to be prevented and/or treated is cancer and/or a hematological disorder, preferably a malignant neoplasm of the brain or a malignant neoplasm of lymphoid, hematopoietic and related tissue, most preferably glioblastoma.
- a hematological disorder preferably a malignant neoplasm of the brain or a malignant neoplasm of lymphoid, hematopoietic and related tissue, most preferably glioblastoma.
- the present invention provides any one of: (i) the complex according to the present invention, (ii) the pharmaceutical composition according to the present invention and/or (ii) cells, such as antigen-presenting cells, loaded with a complex according to the present invention, for use in the prevention, treatment or stabilization of a disease or disorder, such as those which can be treated by immunotherapy, including cancers, infectious diseases, autoimmunity disorders, hematological diseases and transplant rejections.
- a disease or disorder such as those which can be treated by immunotherapy, including cancers, infectious diseases, autoimmunity disorders, hematological diseases and transplant rejections.
- the present invention also provides a complex according to the present invention, which allows the transport and presentation of the at least one antigen or antigenic epitope comprised by the complex at the cell surface of antigen presenting cells in an MHC class I and/or MHC class II context, for use in vaccination and/or immunotherapy.
- the present invention provides a method of preventing, treating and/or repressing a disease or disorder such as those which can be treated by immunotherapy, including cancers, infectious diseases, autoimmunity disorders, hematological diseases and transplant rejections in a subject, wherein said method comprises administering any one of: (i) a complex of the invention, (ii) cells, such as antigen-presenting cells, loaded with a complex of the invention, or (iii) a pharmaceutical composition of (i) or (ii), to said subject.
- the present invention provides a method for eliciting or improving, in a subject, an immune response against one or multiple epitopes that is dependent on CD4 + helper T cells and/or CD8 + cytotoxic T cells, wherein said method comprises administering any one of: (i) a complex according to the present invention, and/or (ii) cells, such as antigen-presenting cells, loaded with said complex, or (iii) a pharmaceutical composition of (i) or (ii), to said subject.
- An immune response that is dependent on CD4 + and/or CD8 + response can be determined by evaluating an inflammatory response, a pro-inflammatory cytokine response, including an increase in the expression of one or more of IFN- ⁇ , TNF- ⁇ and IL-2 mRNA or protein relative to the level before administration of the compounds of the invention. It can also be measured by an increase in the frequency or absolute number of antigen-specific T cells after administration of the compounds of the invention, measured by HLA-peptide multimer staining, ELISPOT assays, and delayed type hypersensitivity tests. It can also be indirectly measured by an increase in antigen-specific serum antibodies that are dependent on antigen-specific T helper cells.
- the present invention also provides a method for eliciting or improving, in a subject, an immune response against one or multiple antigens or antigenic epitopes that is restricted by multiple MHC class I molecules and/or multiple MHC class II molecules, wherein said method comprises administering any one of: (i) a complex according to the present invention, and/or (ii) cells, such as antigen-presenting cells, loaded with said complex, or (iii) a pharmaceutical composition of (i) or (ii), to said subject.
- a method for eliciting or improving, in a subject, an immune response against multiple epitopes that is restricted by multiple MHC class I molecules and/or multiple MHC class II molecules can be determined by evaluating a cytokine response, including an increase in the expression of one or more of IFN- ⁇ , TNF- ⁇ and IL-2 mRNA or protein relative to the level before administration of the compounds of the invention, after in vitro stimulation of T cells with individual peptides binding to discrete MHC class I and class II molecules on antigen presenting cells. Restriction to different MHC molecules can also be validated by using antigen presenting cells expressing different MHC molecules, or by using MHC blocking antibodies. It can also be measured by an increase in the frequency or absolute number of antigen-specific T cells after administration of the compounds of the invention, measured by HLA-peptide multimer staining, which uses multimers assembled with discrete MHC molecules.
- the immune response is directed against one or multiple epitopes of a tumor-associated antigen or a tumor-specific antigen as, for instance, a combination of glioma epitopes such as those described in Novellino et al . (2005, Cancer Immuno Immunother, 54(3):187-207) and Vigneron et al . (2013, Cancer Immun. 13:15).
- the immune response may be directed against multiple epitopes of an antigenic protein from a pathogen.
- the methods according to the present invention as described herein may be for eliciting or improving, in a subject, an immune response against one or multiple epitopes that is restricted by MHC class I molecules and/or MHC class II molecules.
- the present invention provides the use of any one of: (i) a complex according to the present invention, and/or (ii) cells, such as antigen-presenting cells, loaded with the complex according to the present invention, for the preparation of an imaging composition for imaging techniques or for the preparation of a diagnosis composition for diagnosing a disease or disorder, respectively.
- a complex according to the present invention and/or cells, such as antigen-presenting cells, loaded with the complex according to the present invention, loaded with the complex according to the present invention, for the preparation of an imaging composition for imaging techniques or for the preparation of a diagnosis composition for diagnosing a disease or disorder, respectively.
- the diseases or disorders that can be diagnosed with the invention include those which can be treated by immunotherapy, for instance cancers, infectious diseases, autoimmunity disorders and transplant rejections.
- the complex according to the present invention, the cell, such as antigen-presenting cell, loaded with the complex according to the present invention, the inventive composition, the inventive pharmaceutical composition or the inventive vaccine may be utilized in diagnosis as a diagnostic tool, e.g. in (in vivo or in vitro) assays, e.g. in immunoassays, to detect, prognose, diagnose, or monitor various conditions and disease states of disorders or diseases mentioned.
- (in vitro) assays may be performed by delivering the complex according to the present invention, the cell, such as antigen-presenting cell, loaded with the complex according to the present invention, the inventive composition, the inventive pharmaceutical composition or the inventive vaccine to target cells typically selected from e.g. cultured animal cells, human cells or micro-organisms, and to monitor the cell response by biophysical methods typically known to a skilled person.
- the target cells typically used therein may be cultured cells (in vitro) or in vivo cells, i.e. cells composing the organs or tissues of living animals or humans, or microorganisms found in living animals or humans. Particularly preferable in this context are so called markers or labels, which may be contained in the complex according to the present invention.
- the invention provides a method of diagnosing a disease or disorder in a subject, wherein said method comprises administering any one of: (i) a complex of the invention, (ii) cells, such as antigen-presenting cells, loaded with the complex of the invention, or (iii) a pharmaceutical formulation of (i) or (ii), to said subject or to said subject's sample ex vivo.
- the present invention also provides a diagnostic composition comprising the cell penetrating peptide according to the present invention and/or the complex according to the present invention.
- a diagnostic composition may be used in a method of diagnosing a disease or disorder in a subject as described above.
- the present invention provides an imaging method wherein said method comprises using, in vitro, ex vivo or in vivo, any one of: (i) a complex of the invention, (ii) cells, such as antigen-presenting cells, loaded with the complex of the invention, or (iii) a pharmaceutical formulation of (i) or (ii).
- uses and methods according to the present invention comprise administration of a complex according to the invention.
- uses and methods according to the present invention comprise administration of more than one complex, cells, or pharmaceutical formulation according to the invention.
- at least two different complexes are used or administered, wherein each complex comprises at least one antigen or antigenic epitope and said antigen or antigenic epitope or (if more than one antigen or antigenic epitope is comprised by said complex) said subset of antigens or antigenic epitopes are different between the two complexes.
- the cells according to the present invention may be antigen presenting cells, in particular dendritic cells, more preferably dendritic cells from the subject to be treated.
- disease as used in the context of the present invention is intended to be generally synonymous, and is used interchangeably with, the terms “disorder” and “condition” (as in medical condition), in that all reflect an abnormal condition of the human or animal body or of one of its parts that impairs normal functioning, is typically manifested by distinguishing signs and symptoms, and causes the human or animal to have a reduced duration or quality of life.
- Diseases to be treated and/or prevented by use of the complex according to the present invention; the cell, such as antigen-presenting cell, loaded with the complex according to the present invention; the inventive composition; the inventive pharmaceutical composition or the inventive vaccine include cancer, hematological disorders, infectious diseases, autoimmunity disorders and transplant rejections. Thereby, treatment and/or prevention of cancer and infectious diseases is preferred and treatment and/or prevention of cancer is more preferred.
- a malignant neoplasm of the brain or a malignant neoplasm of lymphoid, hematopoietic and related tissue are preferred and glioblastoma is more preferred.
- the complex according to the present invention; the cell, such as antigen-presenting cell, loaded with the complex according to the present invention; the inventive composition; the inventive pharmaceutical composition or the inventive vaccine may be used for (the preparation of a medicament for) the prophylaxis, treatment and/or amelioration of cancer or tumor diseases, including diseases caused by defective apoptosis, preferably selected from acusticus neurinoma, anal carcinoma, astrocytoma, basalioma, Behcet's syndrome, bladder cancer, blastomas, bone cancer, brain metastases, brain tumors, brain cancer (glioblastomas), breast cancer (mamma carcinoma), Burkitt's lymphoma, carcinoids, cervical cancer, colon carcinoma, colorectal cancer, corpus carcinoma, craniopharyngeomas, CUP syndrome, endometrial carcinoma, gall bladder cancer, genital tumors, including cancers of the genitourinary tract, glioblastoma, gliomas, head
- Burkitt's lymphoma EBV-induced B-cell lymphoma, cervix carcinoma), heptatitis B-induced tumors (hepatocell carcinomas), HTLV-1- and HTLV-2-induced lymphomas, vulval cancer, wart conditions or involvement, etc.
- the terms “therapy” and “therapeutic” preferably mean to have at least some minimal physiological effect upon being administered to a living body.
- a physiological effect upon administering a “therapeutic” anti-tumor compound may be the inhibition of tumor growth, or decrease in tumor size, or prevention reoccurrence of the tumor.
- anti-tumor drug therefore preferably means any therapeutic agent having therapeutic effect against a tumor, neoplastic disease or cancer.
- cancers include brain cancer, prostate cancer, breast cancer, ovarian cancer, esophageal cancer, lung cancer, liver cancer, kidney cancer, melanoma, gut carcinoma, lung carcinoma, head and neck squamous cell carcinoma, chronic myeloid leukemia, colorectal carcinoma, gastric carcinoma, endometrial carcinoma, myeloid leukemia, lung squamous cell carcinoma, acute lymphoblastic leukemia, acute myelogenous leukemia, bladder tumor, promyelocytic leukemia, non-small cell lung carcinoma, sarcoma.
- the cancer may be a solid tumor, blood cancer, or lymphatic cancer.
- the cancer may be benign or metastatic.
- the cancer to be prevented and/or treated is a glioma, more preferably highly invasive glioblastoma multiforme (GBM).
- GBM highly invasive glioblastoma multiforme
- Gliomas are the most frequent form of primary brain tumors in adults, with glioblastoma multiforme (GBM) having the poorest prognosis. This tumor is notorious for its highly invasive and aggressive behavior.
- the complex according to the present invention; the cell, such as antigen-presenting cell, loaded with the complex according to the present invention; the inventive composition; the inventive pharmaceutical composition or the inventive vaccine may be used in conjunction with existing modalities for glioma, more specifically highly invasive GBM.
- T lymphocytes can actively seek out neoplastic cells in the brain, and have the potential to safely eliminate specific tumor cells without damaging the surrounding healthy tissues.
- the complex according to the present invention; the cell, such as antigen-presenting cell, loaded with the complex according to the present invention; the inventive composition; the inventive pharmaceutical composition or the inventive vaccine may be used for (the preparation of a medicament for) the prophylaxis, treatment and/or amelioration of infectious diseases, preferably viral, retroviral, bacterial or protozoological infectious diseases.
- infectious diseases are typically selected from AIDS, anthrax, Japanese encephalitis, bacterial infectious diseases such as miscarriage (prostate inflammation), anthrax, appendicitis, borreliosis, botulism, Camphylobacter, Chlamydia trachomatis (inflammation of the urethra, conjunctivitis), cholera, diphtheria, donavanosis, epiglottitis, typhus fever, gas gangrene, gonorrhoea, rabbit fever, Heliobacter pylori , whooping cough, climatic bubo, osteomyelitis, Legionnaire's disease, chicken-pox, condyloma acuminata, cytomegalic virus (CMV), dengue fever, early summer meningoencephalitis (ESME), Ebola virus , colds, fifth disease, foot-and-mouth disease, herpes simplex type I, herpes simplex type II, herpes zoster,
- human immunodeficiency virus type 1 or human immunodeficiency virus type 2 influenza virus, Lassa virus, lymphocytic choriomeningitis virus, Tacaribe virus, Junin virus, Machupo virus, Borna disease virus, Bunyamwera virus, California encephalitis virus, Rift Valley fever virus, sand fly fever virus, Toscana virus, Crimean-Congo haemorrhagic fever virus, Hazara virus, Khasan virus, Hantaan virus, Seoul virus, Prospect Hill virus, Puumala virus, Dobrava Belgrade virus, Tula virus, sinari virus, Lake Victoria Marburg virus, Zaire Ebola virus, Sudan Ebola virus, Ivory Coast Ebola virus, influenza virus A, influenza virus B, influenza viruses C, parainfluenza virus, measles virus, mumps virus, respiratory syncytial virus, human metapneumovirus , vesicular stomatitis Indiana virus, rabies virus, Mokola virus,
- infectious diseases include diseases caused by viruses, bacteria, fungi, protozoa and multicellular parasites. They include, for instance, Amoebiasis, Anthrax, Buruli Ulcer (Mycobacterium ulcerans), Caliciviruses associated diarrhoea, Campylobacter diarrhoea, Cervical Cancer ( Human papillomavirus ), Chlamydia trachomatis associated genital diseases, Cholera, Crimean-Congo haemorrhagic fever, Dengue Fever, Diptheria, Ebola haemorrhagic fever, Enterotoxigenic Escherichia coli (ETEC) diarrhoea, Gastric Cancer ( Helicobacter pylori ), Gonorrhea, Group A Streptococcus associated diseases, Group B Streptococcus associated diseases, Haemophilus influenzae B pneumonia and invasive disease, Hepatitis A, Hepatitis B, Hepatitis C, Hepati
- the complex according to the present invention; the cell, such as antigen-presenting cell, loaded with the complex according to the present invention; the inventive composition; the inventive pharmaceutical composition or the inventive vaccine may be used for (the preparation of a medicament for) the prophylaxis, treatment and/or amelioration of autoimmune disorders, for example autoimmune diseases of the CNS, auto-inflammatory diseases, Celiac disease; Sjogren's syndrome, systemic lupus erythematosus etc.
- autoimmune diseases arise from an abnormal immune response of the body against substances and tissues normally present in the body (autoimmunity). This may be restricted to certain organs (e.g. in autoimmune thyroiditis) or may involve a particular tissue in different places (e.g.
- Autoimmune diseases which may affect the basement membrane in both the lung and the kidney).
- Autoimmune diseases may be classified by corresponding type of hypersensitivity: type I (i.e. urticaria induced by autologous serum), type II, type III, or type IV.
- autoimmune diseases include Blau syndrome, Bullous pemphigoid, Cancer, Castleman's disease, Celiac disease, Chagas disease, Chronic inflammatory demyelinating polyneuropathy, Chronic recurrent multifocal osteomyelitis, chronic obstructive pulmonary disease, Churg-Strauss syndrome, Cicatricial pemphigoid, Cogan syndrome, Cold agglutinin disease, Complement component 2 deficiency, Contact dermatitis, Cranial arteritis, CREST syndrome, Crohn's disease, Cushing's Syndrome, Dercum's disease, Dermatitis herpetiformis, Dermatomyositis, Diabetes mellitus type 1, Diffuse cutaneous systemic sclerosis, Dressler's syndrome, lupus, Discoid lupus erythematosus, Eczema, Acute disseminated encephalomyelitis (ADEM), Addison's disease, Agammaglobulinemia, Amyotroph
- the complex according to the present invention; the cell, such as antigen-presenting cell, loaded with the complex according to the present invention; the inventive composition; the inventive pharmaceutical composition or the inventive vaccine may be used for (the preparation of a medicament for) the prophylaxis, treatment and/or amelioration of hematological disorders, which are typically disorders which primarily affect the blood.
- Hematological malignancies are preferred.
- hematological diseases include myeloid disorders, including Hemoglobinopathies (congenital abnormality of the hemoglobin molecule or of the rate of hemoglobin synthesis), e.g. Sickle-cell disease, Thalassemia, Methemoglobinemia; Anemias (lack of red blood cells or hemoglobin), e.g.
- Hemolytic anemias deficiency of red blood cells
- Genetic disorders of RBC membrane such as Hereditary spherocytosis, Hereditary elliptocytosis, and Congenital dyserythropoietic anemia
- Genetic disorders of RBC metabolism such as Glucose-6-phosphate dehydrogenase deficiency (G6PD), and Pyruvate kinase deficiency
- Immune mediated hemolytic anemia direct Coombs test is positive
- Autoimmune hemolytic anemia including Warm antibody autoimmune hemolytic anemia (such as Idiopathic, Systemic lupus erythematosus (SLE), and Evans' syndrome (antiplatelet antibodies and hemolytic antibodies)) and Cold antibody autoimmune hemolytic anemia (such as Idiopathic cold hemagglutinin syndrome, Infectious mononucle
- ABO hemolytic disease of the newborn Anti-Kell hemolytic disease of the newborn, Rhesus c hemolytic disease of the newborn, Rhesus E hemolytic disease of the newborn, and other blood group incompatibility (RhC, Rhe, Kid, Duffy, MN, P and others)
- Drug induced immune mediated hemolytic anemia including Penicillin (high dose) and Methyldopa, Hemoglobinopathies (i.e.
- Paroxysmal nocturnal hemoglobinuria rare acquired clonal disorder of red blood cell surface proteins
- Direct physical damage to RBCs including Microangiopathic hemolytic anemia and Secondary to artificial heart valve(s)
- Aplastic anemia such as Fanconi anemia, Diamond-Blackfan anemia (inherited pure red cell aplasia), and Acquired pure red cell aplasia; Decreased numbers of cells, e.g.
- Myelodysplastic syndrome Myelofibrosis, Neutropenia (decrease in the number of neutrophils), Agranulocytosis, Glanzmann's thrombasthenia, and Thrombocytopenia (decrease in the number of platelets) including Idiopathic thrombocytopenic purpura (ITP), Thrombotic thrombocytopenic purpura (TTP), and Heparin-induced thrombocytopenia (HIT); Myeloproliferative disorders (Increased numbers of cells), e.g.
- Polycythemia vera increase in the number of cells in general
- Erythrocytosis increase in the number of red blood cells
- Leukocytosis increase in the number of white blood cells
- Thrombocytosis increase in the number of platelets
- Myeloproliferative disorder Coagulopathies (disorders of bleeding and coagulation), e.g.
- Thrombocytosis Recurrent thrombosis, Disseminated intravascular coagulation, Disorders of clotting proteins including Hemophilia such as Hemophilia A, Hemophilia B (also known as Christmas disease), and Hemophilia C, Von Willebrand disease, Disseminated intravascular coagulation, Protein S deficiency, and Antiphospholipid syndrome, and Disorders of platelets including Thrombocytopenia, Glanzmann's thrombasthenia, and Wiskott-Aldrich syndrome.
- Hematological diseases also include Hematological malignancies including Hematological malignancies, e.g.
- Lymphomas including Hodgkin's disease and Non-Hodgkin's lymphoma such as Burkitt's lymphoma, Anaplastic large cell lymphoma, Splenic marginal zone lymphoma, Hepatosplenic T-cell lymphoma, and Angioimmunoblastic T-cell lymphoma (AILT), Myelomas such as Multiple myeloma, Waldenström macroglobulinemia, and Plasmacytoma, Leukemias such as Acute lymphocytic leukemia (ALL), Chronic lymphocytic leukemia (CLL), Acute myelogenous leukemia (AML), Chronic Idiopathic Myleofibrosis (MF), Chronic myelogenous leukemia (CML), T-cell prolymphocytic leukemia (T-PLL), B-cell prolymphocytic leukemia (B-PLL), Chronic neutrophilic leukemia (CNL), Hairy cell leukemia (HCL), T-cell large
- examples of hematological diseases also include miscellaneous haematological diseases including Hemochromatosis, Asplenia, Hypersplenism such as Gauchers disease, Monoclonal gammopathy of undetermined significance, Hemophagocytic lymphohistiocytosis, and Tempi syndrome.
- examples of hematological diseases also include Hematological changes secondary to non-hematological disorders including Anemia of chronic disease, Infectious mononucleosis, AIDS, Malaria, and Leishmaniasis.
- the complex according to the present invention; the cell, such as antigen-presenting cell, loaded with the complex according to the present invention; the inventive composition; the inventive pharmaceutical composition or the inventive vaccine may be used for (the preparation of a medicament for) the prophylaxis, treatment and/or amelioration of transplant rejection, including e.g. graft-versus-host reaction.
- Transplant rejection includes hyperacute rejection, acute rejection and chronic rejection of a transplant. Examples of transplant rejection include skin, kidney, heart, lung, pancreas, liver, blood cell, bone marrow, cornea, accidental severed limb, in particular fingers, hand, foot, face, nose, bone, cardiac valve, blood vessel or intestine transplant rejection reaction.
- the complex according to the present invention; the cell, such as antigen-presenting cell, loaded with the complex according to the present invention; the inventive composition; the inventive pharmaceutical composition or the inventive vaccine may be administered in any manner as described above, including orally, parenterally, intravenously, rectally, or combinations thereof.
- Parenteral administration includes, but is not limited to, intravenous, intra-arterial, intra-peritoneal, subcutaneous, intradermal and intramuscular.
- the complex according to the present invention; the cell, such as antigen-presenting cell, loaded with the complex according to the present invention; the inventive composition; the inventive pharmaceutical composition or the inventive vaccine may also be preferably administered via topical, intratumoral, intradermal, subcutaneous, intramuscular, intranasal, or intranodal route.
- the complex according to the present invention; the cell, such as antigen-presenting cell, loaded with the complex according to the present invention; the inventive composition; the inventive pharmaceutical composition or the inventive vaccine may also be administered in the form of an implant, which allows slow release of the compositions as well as a slow controlled i.v. infusion.
- the complex according to the present invention; the cell, such as antigen-presenting cell, loaded with the complex according to the present invention; the inventive composition; the inventive pharmaceutical composition or the inventive vaccine may be administered subcutaneously.
- the administration of complex according to the present invention; the cell, such as antigen-presenting cell, loaded with the complex according to the present invention; the inventive composition; the inventive pharmaceutical composition or the inventive vaccine may require multiple successive injections.
- the administration may be repeated at least two times, for example once as primary immunization injections and, later, as booster injections.
- the complex according to the present invention; the cell, such as antigen-presenting cell, loaded with the complex according to the present invention; the inventive composition; the inventive pharmaceutical composition or the inventive vaccine may be administered repeatedly or continuously.
- the complex according to the present invention; the cell, such as antigen-presenting cell, loaded with the complex according to the present invention; the inventive composition; the inventive pharmaceutical composition or the inventive vaccine may be administered repeatedly or continuously for a period of at least 1, 2, 3, or 4 weeks; 2, 3, 4, 5, 6, 8, 10, or 12 months; or 2, 3, 4, or 5 years.
- the cell penetrating peptide and the at least one cargo molecule e.g. at least one antigen or antigenic epitope and a TLR peptide agonist as described herein, composing the complex according to the present invention may be contained in separate compositions which are mixed just before administration or which are administered simultaneously to the subject in need thereof.
- the complex according to the present invention; the cell, such as antigen-presenting cell, loaded with the complex according to the present invention; the inventive composition; the inventive pharmaceutical composition or the inventive vaccine may be administered directly to a patient using the administration routes as described above, in particular for pharmaceutical compositions.
- the complex according to the present invention; the cell, such as antigen-presenting cell, loaded with the complex according to the present invention; the inventive composition; the inventive pharmaceutical composition or the inventive vaccine may be administered to a patient using an ex vivo approach, e.g. by introducing the pharmaceutical composition, the vaccine or the inventive transporter cargo conjugate molecule as defined above into cells, preferably autologous cells, i.e. cells derived from the patient to be treated, and transplanting these cells into the site of the patient to be treated, optionally subsequent to storing and/or culturing these cells prior to treatment.
- the dosage administered, as single or multiple doses, to an individual will vary depending upon a variety of factors, including pharmacokinetic properties, subject conditions and characteristics (sex, age, body weight, health, size), extent of symptoms, concurrent treatments, frequency of treatment and the effect desired.
- the therapeutically effective dose of a complex according to the present invention is from about 0.01 mg to 5 mg per injection, in particular from about 0.1 mg to 2 mg per injection, or from about 0.01 nmol to 1 mmol per injection, in particular from 1 nmol to 1 mmol per injection, preferably from 1 pmol to 1 mmol per injection.
- the therapeutically effective dose of an antigen presenting cell loaded with a complex according to the present invention is from about 0.2 million cells to 2 million cells per injection.
- the administration of the complex according to the present invention; the cell, such as antigen-presenting cell, loaded with the complex according to the present invention; the inventive composition; the inventive pharmaceutical composition or the inventive vaccine in the methods and uses according to the invention can be carried out alone or in combination with a co-agent useful for treating and/or stabilizing the disease or disorder to be treated or repressed.
- the administration of the pharmaceutical compositions in the methods and uses according to the invention can be carried out in combination with substances used in conventional chemotherapy directed against solid tumors and for control of establishment of metastases or any other molecule that act by triggering programmed cell death e.g. for example a co-agent selected from Tumor Necrosis Family Members including, but not limited, to Fas Ligand and tumor necrosis factor (TNF)-related apoptosis inducing (TRAIL) ligand.
- TNF tumor necrosis factor
- TRAIL tumor necrosis factor
- the administration of the complex according to the present invention; the cell, such as antigen-presenting cell, loaded with the complex according to the present invention; the inventive composition; the inventive pharmaceutical composition or the inventive vaccine in the methods and uses according to the present invention can be carried out in parallel of radiotherapy.
- the invention encompasses the administration of the complex according to the present invention; the cell, such as antigen-presenting cell, loaded with the complex according to the present invention; the inventive composition; the inventive pharmaceutical composition or the inventive vaccine, wherein it is administered to a subject prior to, simultaneously or sequentially with other therapeutic regimens or co-agents useful for treating, and/or stabilizing a cancer and/or preventing cancer relapsing (e.g. multiple drug regimens), in a therapeutically effective amount.
- Said complex, cell, composition, vaccine or pharmaceutical composition, that is administered simultaneously with said co-agents can be administered in the same or different composition(s) and by the same or different route(s) of administration.
- Said other therapeutic regimens or co-agents may be selected from the group consisting of radiation therapy, chemotherapy, surgery, targeted therapy (including small molecules, peptides and monoclonal antibodies), and anti-angiogenic therapy.
- Anti-angiogenic therapy is defined herein as the administration of an agent that directly or indirectly targets tumor-associated vasculature.
- the present invention provides a pharmaceutical composition
- a pharmaceutical composition comprising a complex of the invention or a cell of the invention, in particular an antigen-presenting cell of the invention, combined with at least one co-agent useful for treating and/or stabilizing a cancer and/or preventing a cancer relapsing, and at least one pharmaceutically acceptable carrier.
- the complex according to the present invention; the cell, such as antigen-presenting cell, loaded with the complex according to the present invention; the inventive composition; the inventive pharmaceutical composition or the inventive vaccine can be administered after surgery where solid tumors have been removed as a prophylaxis against relapsing and/or metastases.
- the administration of the imaging or diagnosis composition in the methods and uses according to the invention can be carried out alone or in combination with a co-agent useful for imaging and/or diagnosing the suspected disease or disorder.
- the present invention can be applied to any subject suffering from any disease or disorder, depending on the specificity in particular of the at least one antigen or antigenic epitope comprised by the complex according to the present invention.
- the therapeutic effect of said complex may be to elicit an immune response directed against said antigens or antigenic epitopes, in particular a response that is dependent on CD4 + helper T cells and/or CD8 + cytotoxic T cells and/or that is restricted by MHC class I molecules and/or MHC class II molecules.
- subjects according to the invention are subjects suffering from a cancer, for instance from a cancer of the brain, colon, head or neck, or from a cervical cancer. More preferably, subjects according to the invention are subjects suffering from a brain cancer including glioma.
- subjects according to the invention have been subjected to a surgical removal of a tumor.
- subjects according to the invention are subjects suffering from an infectious disease.
- FIG. 1 shows a schematic overview (A) and the amino acid sequences (B) for the different ZEBRA CPP truncations (Z12, Z13, Z14, Z15, Z16, Z17, Z18, Z19 and Z20), which were designed and synthesized as described in Example 1. Numbers at the beginning and at the end of each ZEBRA truncation refer to the corresponding amino acid position in ZEBRA.
- FIG. 2 shows for Example 2 the identification of the best Zebra CPP truncations in vitro (proliferation assay) and in vivo (CD8 T cell immune response after vaccination).
- A BMDCs were loaded 4 h with 300 nM of each Zebra CPP truncation (Z13 to Z20) conjugated to OVACD8 epitope, then washed and incubated o.n. with 100 ng/ml of LPS. Efficient MHC class I-restricted processing and presentation was monitored after 4 days with CFSE-labeled na ⁇ ve OVA 257-264 -specific CD8 + T cells from OT-1 T cell receptor (TCR) transgenic mice. Data from one experiment representative of two independent experiments.
- mice were vaccinated by s.c. injection (right flank) at wk0, and wk2 with 10 nmoles of each Zebra CPP truncation (Z12 to Z20) conjugated to OVACD8 epitope with 100 pg of anti-CD40. Mice were also injected with 50 ⁇ g of Hiltonol i.m. (right hind leg). Mice were bled 1 wk after the 2 nd vaccination for assessing OVA 257-264 -specific CD8 T cells.
- FIG. 3 shows for Example 3 the comparison of the transduction capacity of (A) Z13, (B) Z14, (C) Z15 and (D) Z18 Zebra CPP truncations. Transduction was assessed in cells with high phagocytosis capacity (dendritic cells of human and mice origin) and in cells with poor phagocytosis capacity (T cells from human, K562, or mouse, EL4, origin).
- FIG. 4 shows for Example 4 the in vitro epitope presentation (MHC I and MHC II) assay.
- BMDCs were loaded 4 h with 300nM of the different Zebra CPP truncation conjugated to both ovalbumin CD8 and CD4 epitopes (Z13OVACD8CD4, Z15OVACD8CD4 and Z18OVACD8CD4), then washed and incubated o.n. with 100 ng/ml of LPS.
- Efficient MHC class I or class II-restricted presentation was monitored after 4 days with CFSE-labeled na ⁇ ve OVA 257-264 -specific CD8 + T cells from OT-1 T cell receptor (TCR) transgenic mice OT1 cells (A) or CFSE-labeled na ⁇ ve OVA 323-339 -specific CD + T cells from OT-2 T cell TCR transgenic mice respectively.
- TCR OT-1 T cell receptor
- A CFSE-labeled na ⁇ ve OVA 323-339 -specific CD + T cells from OT-2 T cell TCR transgenic mice respectively.
- BMDCs were pulsed for 1 h with 5 uM peptide. Data from one experiment representative of three independent experiments.
- FIG. 5 shows for Example 5 the in vitro epitope presentation (MHC I) assay by human dendritic cells.
- Human monocyte-derived DCs were loaded with 1 ⁇ M of scramble-MART1, Z13-MART1, Z14-MART1, Z15-MART1 or Z18-MART1 for 4 h, wash and then incubated o.n. at 37° C.
- Specific TCR-transfected T cells were then added to DCs and incubated for 5 h with monensin and brefeldinA before intracellular FACS staining for CD107, IFN- ⁇ and TNF- ⁇ .
- FIG. 6 shows for Example 6 CD8 and CD4 T cell immune responses elicited by vaccination with Zebra CPP truncations combined to TLR3 agonist (Hiltonol).
- Mice were vaccinated three times (wk0, wk2 and wk9) by s.c. injection (right flank) of 10 nmoles of OVACD8CD4 (the cargo without Zebra CPP truncation), Z13OVACD8CD4, Z14OVACD8CD4, Z15OVACD8CD4, Z18OVACD8CD4 and i.m. injection of 50 ⁇ g of Hiltonol (right hind leg).
- Elispot assay was performed on spleen cells for detecting IFN-y-producing OVA 257-264 -specific CD8 T cells (A) and OVA 323-339 -specific CD4 T cells (B). *, p ⁇ 0.05; **, p ⁇ 0.01.
- FIG. 7 shows for Example 6 CD8 and CD4 T cell immune responses elicited by vaccination with Zebra CPP truncations combined to TLR2 agonist (Pam3CSK4).
- Mice were vaccinated three times (wk0, wk2 and wk9) by s.c. injection (right flank) of 10 nmoles of OVACD8CD4 (the cargo without Zebra CPP truncation), Z13OVACD8CD4, Z14OVACD8CD4, Z15OVACD8CD4 or Z18OVACD8CD4 and 20 ⁇ g of Pam3CSK4.
- Elispot assay was performed on spleen cells for detecting IFN- ⁇ -producing OVA 257-264 -specific CD8 T cells (A) and OVA 323-339 -specific CD4 T cells (B). *, p ⁇ 0.05; **, p ⁇ 0.01.
- FIG. 8 shows for Example 6 CD8 and CD4 T cell immune responses elicited by vaccination with Zebra CPP truncations combined to TLR4 agonist (MPLA).
- Mice were vaccinated three times (wk0, wk2 and wk9) by s.c. injection (right flank) of 10 nmoles of Z13OVACD8CD4, Z15OVACD8CD4 or Z18OVACD8CD4 and 20 ⁇ g of MPLA.
- Elispot assay was performed on spleen cells for detecting IFN- ⁇ -producing OVA 257-264 -specific CD8 T cells (A) and OVA 323-339 -specific CD4 T cells (B).
- A IFN- ⁇ -producing OVA 257-264 -specific CD8 T cells
- B OVA 323-339 -specific CD4 T cells
- FIG. 9 shows for Example 6 that Z18 did not elicit self antigen-specific CD8 T cell responses, whereas Z13 and Z14 were able to promote high self antigen-specific CD8 immune responses.
- the constructs were tested in combination with Hiltonol (A) and MPLA (B). Briefly, Mice were vaccinated three times (wk0, wk2 and wk9) by s.c. injection (right flank) of 10 nmol of Z13OVACD4gp1 00CD8, Z14OVACD4gp1 00CD8, Z18OVACD4gp100CD8 and i.m. injection of 50 pg of Hiltonol (right hind leg) or s.c. injection of 20 ⁇ g of MPLA. One week after the last vaccination, spleen cells were restimulated in vitro for 7 days with gp100CD8 peptide and stained as described in Example 6.
- FIG. 10 shows for Example 7 the therapeutic effect of Zebra CPP truncations on tumor growth.
- C57BL/6 mice were implanted s.c. with 3 ⁇ 10 5 EG7-OVA tumor cells in the left flank and vaccinated three times (d5, d13 and d21) by s.c. injection of 10nmoles of Z-truncOVACD8CD4 peptides and 20 ⁇ g of MPLA in the right flank. Tumor size was measured with a caliper.
- A, C and E tumor growth (mean of 7 mice per group ⁇ SEM).
- FIG. 11 shows for Example 8 the effect of complexes having different CPPs on CD8 T cells in spleen (A), draining lymph nodes (B) and bone marrow (C).
- C57BL/6 mice were vaccinated five times (Wk0, Wk2, Wk4, Wk6 and Wk8) s.c. (right flank) with 2 nmol of Z13Mad5Anaxa or Z14Mad5Anaxa.
- mice were euthanized, organs recovered and multimer staining was performed.
- FIG. 12 shows for Example 8 the effect of complexes having different CPPs on T cells in spleen (CD8 T cell response (A) and CD4 T cell response (B)).
- C57BL/6 mice were vaccinated five times (Wk0, Wk2, Wk4, Wk6 and Wk8) s.c. (right flank) with 2 nmol of Z13Mad5Anaxa or Z14Mad5Anaxa.
- Elispot assay was performed on spleen cells stimulated with SIINFEKL OVACD8 peptide.
- Elispot assay was performed on spleen cells stimulated with OVACD4 peptide.
- FIG. 13 shows for Example 8 the effect of complexes having different CPPs on CD8 T cell effector function.
- C57BL/6 mice were vaccinated five times (Wk0, Wk2, Wk4, Wk6 and Wk8) s.c. (right flank) with 2 nmol of Z13Mad5Anaxa or Z14Mad5Anaxa.
- intracellular staining was performed on spleen cells stimulated with SIINFEKL OVACD8 peptide.
- FIG. 14 shows for Example 9 the effect of complexes having different CPPs on tumor growth (A) and survival rates (B).
- C57BL/6 mice were implanted s.c. with 3 ⁇ 10 5 EG7-OVA tumor cells in the left flank and vaccinated twice (d5 and d13) by s.c. injection of 0.5 nmol of Z13Mad5Anaxa or Z14Mad5Anaxa in the right flank.
- A Tumor growth of 7 mice per group (mean ⁇ SEM); *, p ⁇ 0.05; ****, p ⁇ 0.0001 (2-way Anova test at day 28).
- ZEBRA CPP truncations were designed and synthesized as shown in FIG. 1 .
- peptides were synthesized on an ABI 433 synthesizer customized to perform Boc chemistry with in situ neutralization as already described (Hartley (2004), Proc. Natl. Acad.
- KRYKNRVASRKCRAKFKQLLQHYREVAAAKSSENDRLRLLLK Z13 (SEQ ID NO: 1) KRYKNRVASRKSRAKFKQLLQHYREVAAAKSSENDRLRLLLK Z14: (SEQ ID NO: 21) KRYKNRVASRKSRAKFKQLLQHYREVAAAK Z15: (SEQ ID NO: 22) KRYKNRVASRKSRAKFK Z16: (SEQ ID NO: 23) QHYREVAAAKSSEND Z17: (SEQ ID NO: 24) QLLQHYREVAAAK Z18: (SEQ ID NO: 25) REVAAAKSSENDRLRLLLK Z19: (SEQ ID NO: 26) KRYKNRVA Z20: (SEQ ID NO: 27) VASRKSRAKFK
- the objective of this study was to select the best ZEBRA CPP truncations in vitro and in vivo from the different ZEBRA CPP truncations designed and synthesized in Example 1.
- each Zebra CPP truncation (Z12 to Z20) was conjugated to the OVACD8 epitope. Accordingly, the following fusion peptides/fusion proteins were synthesized as described in Example 1:
- OVACD8 Sequence [SEQ ID NO: 37] EQLESIINFEKLTEWT
- BMDCs bone marrow derived dendritic cells
- BMDCs were loaded with 0.3 ⁇ M of each Zebra CPP truncation (Z13 to Z20) conjugated to OVACD8 epitope as described above for 4 hours at 37° C., washed 3 times, then matured overnight at 37° C. with 100 ng/ml LPS (from Salmonella abortus, equi S-form, Enzo Life Sciences).
- Antigen-loaded mature BMDC were then mixed at a ratio of 1:10 with OT-1 T cell receptor (TCR) transgenic mice splenocytes that had been stained with 10 ⁇ M 5-(and 6) Carboxyfluorescein diacetate succinimidyl ester (CFSE) (Life Technologies).
- mice were assigned to nine different groups (Z12 to Z20, respectively). Each group of mice was vaccinated by subcutaneous injection of 10 nmol of one selected Zebra CPP truncation (one selected from Z12 to Z20) conjugated to OVACD8 epitope as described above with 100 ⁇ g of anti-CD40 at week0 and week2. Mice were also injected with 50 ⁇ g of Hiltonol i.m. (right hind leg). Mice were bled 1 wk after the 2 nd vaccination in order to assess OVA 257-264 -specific CD8 T cells. Results are shown in FIG. 2B .
- Z13, Z14, Z15 and Z18 fluorescein-conjugated constructs were synthesized.
- 5-(and-6)-carboxyfluorescein mixtureed isomers; e.g. ThermoFisher Scientific catalogue no.
- Z13OVACD8 SEQ ID NO: 29
- Z14OVACD8 SEQ ID NO: 30
- Z15OVACD8 SEQ ID NO: 31
- Z18OVACD8 SEQ ID NO: 34
- fluorescein-conjugated constructs (Z13OVACD8FAM, Z14OVACD8FAM, Z15OVACD8FAM and Z18OVACD8FAM) were tested for their ability to transduce different human and mouse cell types, in particular (i) cells with high phagocytosis capacity, namely dendritic cells (DCs) of human (BMDCs) and mice origin (mo-DCs), and (ii) cells with poor phagocytosis capacity, namely T cells from human, K562, or mouse, EL4, origin).
- the EL-4 thymoma cell line was maintained in complete RPMI 1640 medium.
- the K562 cell line was maintained in complete Iscove's modified Dulbecco's medium.
- BMDC, mo-DCs, EL-4 or K562 cells were incubated for 4 h at 37° C. with the fluorescein-conjugated constructs as described above (Z13OVACD8FAM, Z14OVACD8FAM, Z15OVACD8FAM or Z18OVACD8FAM).
- Z13OVACD8FAM, Z14OVACD8FAM, Z15OVACD8FAM or Z18OVACD8FAM For removal of membrane bound peptide prior to cell transduction, a 30s wash with an acidic buffer (0.2 M Glycine, 0.15 M NaCl, pH 3) was performed. Cells were then analyzed by flow cytometry (FACS). Results are shown in FIG. 3 .
- Transduction efficacy was different depending on the cell type. Z13 and Z14 were rapidly entering in the majority of the cells. In contrast, the kinetic of transduction for Z15 and Z18 was slower. Overall, transduction efficacy was higher in human DCs, which might be correlated to phagocytic activity. However, high transduction was also observed in EL4 cells. All the peptides showed a modest transduction in dendritic cells of murine origin. For all cell types, Z18 exhibited however a lower transduction efficacy compared to other ZEBRA CPP truncations.
- antigenic cargoes were produced that included both CD8 and CD4 T cell epitopes from OVA, and conjugated to Z13, Z15 and Z18. Accordingly, the following constructs (Z13OVACD8CD4, Z15OVACD8CD4 and Z18OVACD8CD4) were synthesized:
- Z13OVACD8CD4 Sequence: [SEQ ID NO: 42] KRYKNRVASRKSRAKFKQLLQHYREVAAAKSSENDRLRLLLKEQLESIIN FEKLTEWTESLKISQAVHAAHAEINEAGREVVG Z15OVACD8CD4 Sequence: [SEQ ID NO: 43] KRYKNRVASRKSRAKFKEQLESIINFEKLTEWTESLKISQAVHAAHAEIN EAGREVVG Z18OVACD8CD4 Sequence: [SEQ ID NO: 44] REVAAAKSSENDRLRLLLKEQLESIINFEKLTEWTESLKISQAVHAAHAE INEAGREVVG
- CD8 T cell epitopes Processing and presentation of the CD8 and CD4 T cell epitopes were monitored, as described in Example 2 for CD8 T cell epitopes, by measuring the in vitro proliferation of na ⁇ ve OT-1 T cells (CD8 T cell epitopes; FIG. 4A ) and OVA 323-339 -specific CD4 + T cells from OT-2 T cell TCR transgenic mice, respectively ( FIG. 4B ).
- OT-2 T cell TCR transgenic mice express TCR specific for MHC class II restricted OVA 323-339 . Results are shown in FIG. 4A (CD8) and 4B (CD4).
- constructs (Z13, Z14, Z15, and Z18 CPPs conjugated to the HLA-A2 epitope of the tumor associated antigen (TAA) MART1) were assessed for their capacity to promote epitope presentation on MHC class I by human DCs.
- DCs from an HLA-A2+ donor were prepared from elutriated monocytes, cultured in CelIGro DC medium (CellGenix, Freiburg, Germany) with granulocyte-macrophage colony-stimulating factor (GM-CSF; 2500 U/ml) (Leucomax; Schering-Plough, Kenilworth, N.J.) and interleukin-4 (IL-4; 1000 U/ml) (CellGenix).
- GM-CSF granulocyte-macrophage colony-stimulating factor
- IL-4 interleukin-4
- the immature DCs were matured with cytokines: IL-1 ⁇ (10 ng/ml), IL-6 (1000 U/ml), tumor necrosis factor ⁇ (TNF ⁇ ; 10 ng/ml) (all from CellGenix) and prostaglandin E 2 (1 ⁇ g/ml) (Sigma-Aldrich).
- DCs were rested in CellGro DC medium for 2 hours and loaded with 1 ⁇ M Scramble-MART1, Z13-MART1, Z14-MART1, Z15-MART-1 or Z18-MART1 for 4 hrs at 37° C. before being washed once and plated at 300 000 cells per well in round-bottomed 96-well plates.
- Non-peptide loaded DCs were used as a negative control.
- T cells were expanded from peripheral blood mononuclear cells using Dynabeads ClinExVivo CD3/CD28 (Life Technologies, Oslo, Norway). Expanded T cells (day 10 post activation) were transfected with the DMFS TCR specific for MART1 by mRNA electroporation.
- T cells were co-incubated with DCs at a ratio of 1:2 for 5 hours in the presence of GolgiPlug and GolgiStop (both BD Biosciences) before intracellular staining was performed using the following antibodies after FcR blocking; CD4 (RPAT4), CD8 (RPAT8), CD107a (H4A3) (BD Biosciences), IFN- ⁇ (4S.B3) and TNF- ⁇ (MAb11) (BD Biosciences), all from eBioscience except where noted. Fixation and permabilization was performed using the PerFix kit from Beckman Coulter according to manufacturer's instructions. Cells were analysed using an LSR II flow cytometer (BD Biosciences) and results were processed with Kaluza (Beckman Coulter) software. All conditions were tested in duplicate, and the experiment was repeated up to three times.
- Z13, Z14, Z15 and Z18 conjugated to antigenic cargo containing both CD8 and CD4 T cell epitopes from OVA was synthesized.
- Z14 the construct was as follows:
- OVACD8CD4 Sequence [SEQ ID NO: 50] EQLESIINFEKLTEWTESLKISQAVHAAHAEINEAGREVVG
- mice were vaccinated three times (wk0, wk2 and wk9) by s.c. injection of 10 nmol of OVACD8CD4 (the cargo without Zebra CPP truncation; as described above), Z13OVACD8CD4, Z14OVACD8CD4, Z15OVACD8CD4, Z18OVACD8CD4 (as described in Examples 4 and 6) and i.m. injection of 50 ⁇ g of Hiltonol.
- OVACD8CD4 the cargo without Zebra CPP truncation; as described above
- Z13OVACD8CD4, Z14OVACD8CD4, Z15OVACD8CD4, Z18OVACD8CD4 as described in Examples 4 and 6
- i.m. injection of 50 ⁇ g of Hiltonol i.m.
- mice were bled for assessing OVA 257-264 -specific CD8 T cells by FACS MHC-peptide multimer staining and elispot analysis.
- the enzyme-linked immunospot (ELISPOT) assay for detection of peptide-specific gamma interferon (IFN- ⁇ )-secreting T cells was performed essentially as described previously (Miyahira (1995), J. Immunol. Methods, 181, 45-54)
- splenocytes were incubated o.n. in ELISPOT plates in the presence or absence of 5 ⁇ M of OVA 257-264 or OVA 323-339 .
- the number of peptide-specific IFN- ⁇ -producing cells was calculated by subtracting the number of IFN- ⁇ -secreting cells cultured without peptide to that obtained with cells cultured with peptide. Results are shown in FIG. 6B .
- mice were vaccinated three times (wk0, wk2 and wk9) by s.c. injection of 10 nmol of OVACD8CD4 (the cargo without Zebra CPP truncation; as described above), Z13OVACD8CD4, Z14OVACD8CD4, Z15OVACD8CD4, Z18OVACD8CD4 (as described in Examples 4 and 6) and of 20 ⁇ g of Pam3CSK4.
- OVACD8CD4 the cargo without Zebra CPP truncation; as described above
- Z13OVACD8CD4, Z14OVACD8CD4, Z15OVACD8CD4, Z18OVACD8CD4 as described in Examples 4 and 6
- 20 ⁇ g of Pam3CSK4 20 ⁇ g
- mice were vaccinated three times (wk0, wk2 and wk9) by s.c. injection of 10 nmol of OVACD8CD4 (the cargo without Zebra CPP truncation; as described above), Z13OVACD8CD4, Z14OVACD8CD4, Z15OVACD8CD4, Z18OVACD8CD4 (as described in Examples 4 and 6) and of 20 ⁇ g of MPLA.
- OVACD8CD4 the cargo without Zebra CPP truncation; as described above
- Z13OVACD8CD4, Z14OVACD8CD4, Z15OVACD8CD4, Z18OVACD8CD4 as described in Examples 4 and 6
- MPLA adjuvant a TLR4 agonist
- mice were vaccinated three times (wk0, wk2 and wk9) by s.c. injection (right flank) of 10 nmol of Z13OVACD4gp100CD8, Z14OVACD4gp100CD8, Z18OVACD4gp100CD8 and i.m. injection of 50 ⁇ g of Hiltonol (right hind leg) or s.c. injection of 20 ⁇ g of MPLA.
- spleen cells were restimulated in vitro for 7 days with gp100CD8 peptide and stained as follow.
- CD4 RMA4-4
- CD8 53-6.7
- CD11b M1/70
- CD19 6D5
- Dead cells were identified with LIVE/DEAD yellow fluorescent reactive dye (L34959) from Life Technologies and were excluded from analyses.
- MHC-peptide multimers were from Immudex (Copenhagen, Denmark).
- Multimer gating strategy used a dump gate (CD4, CD11b, CD19) and excluded dead cells. Results are shown in FIG. 9 .
- mice were vaccinated three times (namely, at d5, d13 and d21 after tumor implantation) by s.c. injection of either 10 nmol of Z13OVACD8CD4, Z14OVACD8CD4, Z15OVACD8CD4 or Z18OVACD8CD4 and 20 ⁇ g of MPLA in the right flank. Tumor size was measured with a caliper.
- Results are shown in FIG. 10 . These results show that vaccination with all of the constructs reduce tumor volume and increase survival time. However, those effects were only slight with constructs with Z15 and Z18, but much more pronounced and highly significant for constructs with Z13 and Z14. Thus, Z13 and Z14 are superior to Z15 and Z18.
- Example 7 Based on the results of Example 7, the best ZEBRA CPP truncations Z13 and Z14 were selected for further investigation, namely in a complex according to the present invention. To this end, two fusion proteins “Z13Mad5Anaxa” and “Z14Mad5Anaxa” were designed and synthesized. The two fusion proteins differed only in the cell penetrating peptides (Z13 or Z14).
- Both fusion proteins comprise—in addition to the CPP (Z13 or Z14)-(i) the protein “MAD5”, which contains various epitopes of different antigens, namely OVACD4, gp100CD8, EalphaCD4 and OVACD8 epitopes, and (ii) the TLR2 peptide agonist “Anaxa”.
- C57BL/6 mice were assigned to three different groups (3-4 mice per group): naive, Z13Mad5Anaxa or Z14Mad5Anaxa.
- mice of the Z13Mad5Anaxa group and of the Z14Mad5Anaxa group were vaccinated five times (Week1, Week2, Week4, Week6 and Week8) s.c. with 2 nmol of either Z13Mad5Anaxa or Z14Mad5Anaxa.
- mice vaccinated with Z13Mad5Anaxa or with Z14Mad5Anaxa showed a similar increase in multimer-positive cells, in particular in the spleen and bone marrow as well as a slight increase in draining lymph nodes.
- mice vaccinated with Z13Mad5Anaxa showed a significant increase in IFN- ⁇ producing cells compared to na ⁇ ve mice.
- Mice vaccinated with Z14Mad5Anaxa showed also an increase in IFN- ⁇ producing cells compared to na ⁇ ve mice, however, the increase was not significant.
- OVACD4 Sequence [SEQ ID NO: 52] ISQAVHAAHAEINEAGR
- mice vaccinated with Z13Mad5Anaxa showed a highly significant increase in IFN- ⁇ producing cells compared to na ⁇ ve mice.
- Mice vaccinated with Z14Mad5Anaxa showed also an increase in IFN- ⁇ producing cells compared to na ⁇ ve mice, however, again the increase was not significant.
- mice intracellular staining was performed on spleen cells stimulated with SIINFEKL OVACD8 peptide (SEQ ID NO: 37) to identify CD107a + IFN- ⁇ + TNF- ⁇ + cells. Results are shown in FIG. 13 . Mice vaccinated with Z13Mad5Anaxa or with Z14Mad5Anaxa showed a similar increase in CD107a + IFN- ⁇ + TNF- ⁇ + cells.
- mice were implanted s.c. with 3 ⁇ 10 5 EG7-OVA tumor cells in the left flank and assigned to three different groups (na ⁇ ve, Z13Mad5Anaxa and Z14Mad5Anaxa). Mice were vaccinated twice at d5 and d13 after tumor implantation by s.c. injection of either 0.5 nmol of Z13Mad5Anaxa or Z14Mad5Anaxa in the right flank.
- Results are shown in FIG. 14 .
- Vaccination with Z13Mad5Anaxa or with Z14Mad5Anaxa resulted in significantly decreased tumor volumes compared to control mice ( FIG. 14A ) as well as to significantly increased survival rates compared to control mice ( FIG. 14B ).
- Those results indicate that both complexes, Z13Mad5Anaxa and Z14Mad5Anaxa, are able to significantly decrease tumor growth and to significantly prolong survival.
- the significance was considerably more pronounced with Z13Mad5Anaxa than with Z14Mad5Anaxa (cf. FIG. 14A and B).
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Epidemiology (AREA)
- Medicinal Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Pharmacology & Pharmacy (AREA)
- Immunology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Organic Chemistry (AREA)
- Cell Biology (AREA)
- Gastroenterology & Hepatology (AREA)
- Molecular Biology (AREA)
- Zoology (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Microbiology (AREA)
- Oncology (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Mycology (AREA)
- Toxicology (AREA)
- Biomedical Technology (AREA)
- Inorganic Chemistry (AREA)
- Neurosurgery (AREA)
- Neurology (AREA)
- Biotechnology (AREA)
- Wood Science & Technology (AREA)
- General Engineering & Computer Science (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
Applications Claiming Priority (5)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
EPPCT/EP2015/000580 | 2015-03-16 | ||
EP2015000580 | 2015-03-16 | ||
EP2015002244 | 2015-11-09 | ||
EPPCT/EP2015/002244 | 2015-11-09 | ||
PCT/EP2015/002598 WO2016146143A1 (en) | 2015-03-16 | 2015-12-22 | Cell penetrating peptides and complexes comprising the same |
Publications (1)
Publication Number | Publication Date |
---|---|
US20180133327A1 true US20180133327A1 (en) | 2018-05-17 |
Family
ID=55066559
Family Applications (7)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US15/557,653 Abandoned US20180133327A1 (en) | 2015-03-16 | 2015-12-22 | Cell Penetrating Peptides and Complexes Comprising the Same |
US15/557,651 Abandoned US20180133339A1 (en) | 2015-03-16 | 2016-03-16 | A Novel Complex Comprising A Cell Penetrating Peptide, A Cargo And A TLR Peptide Agonist For Treatment Of Glioblastoma |
US15/557,649 Abandoned US20180133338A1 (en) | 2015-03-16 | 2016-03-16 | A Novel Complex Comprising A Cell Penetrating Peptide, A Cargo And A TLR Peptide Agonist For Treatment Of Colorectal Cancer |
US15/557,647 Abandoned US20180133295A1 (en) | 2015-03-16 | 2016-03-16 | A Novel Complex Comprising A Cell Penetrating Peptide, A Cargo And A TLR Peptide Agonist |
US17/396,351 Active US12178788B2 (en) | 2015-03-16 | 2021-08-06 | Complex comprising a cell penetrating peptide, a cargo and a TLR peptide agonist |
US17/397,447 Active 2036-06-19 US12220450B2 (en) | 2015-03-16 | 2021-08-09 | Complex comprising a cell penetrating peptide, a cargo and a TLR peptide agonist for treatment of colorectal cancer |
US17/558,906 Pending US20220175933A1 (en) | 2015-03-16 | 2021-12-22 | Novel Complex Comprising A Cell Penetrating Peptide, A Cargo And A TLR Peptide Agonist For Treatment Of Glioblastoma |
Family Applications After (6)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US15/557,651 Abandoned US20180133339A1 (en) | 2015-03-16 | 2016-03-16 | A Novel Complex Comprising A Cell Penetrating Peptide, A Cargo And A TLR Peptide Agonist For Treatment Of Glioblastoma |
US15/557,649 Abandoned US20180133338A1 (en) | 2015-03-16 | 2016-03-16 | A Novel Complex Comprising A Cell Penetrating Peptide, A Cargo And A TLR Peptide Agonist For Treatment Of Colorectal Cancer |
US15/557,647 Abandoned US20180133295A1 (en) | 2015-03-16 | 2016-03-16 | A Novel Complex Comprising A Cell Penetrating Peptide, A Cargo And A TLR Peptide Agonist |
US17/396,351 Active US12178788B2 (en) | 2015-03-16 | 2021-08-06 | Complex comprising a cell penetrating peptide, a cargo and a TLR peptide agonist |
US17/397,447 Active 2036-06-19 US12220450B2 (en) | 2015-03-16 | 2021-08-09 | Complex comprising a cell penetrating peptide, a cargo and a TLR peptide agonist for treatment of colorectal cancer |
US17/558,906 Pending US20220175933A1 (en) | 2015-03-16 | 2021-12-22 | Novel Complex Comprising A Cell Penetrating Peptide, A Cargo And A TLR Peptide Agonist For Treatment Of Glioblastoma |
Country Status (24)
Cited By (7)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20210290727A1 (en) * | 2018-08-01 | 2021-09-23 | University Of Maryland, Baltimore | MODULATION OF mTORCI ACTIVITY AND AUTOPHAGY VIA CIB2-RHEB INTERACTION |
WO2022053703A1 (en) | 2020-09-14 | 2022-03-17 | Boehringer Ingelheim International Gmbh | Heterologous prime boost vaccine |
US11338027B2 (en) | 2016-09-21 | 2022-05-24 | Amal Therapeutics Sa | Fusion comprising a cell penetrating peptide, a multi epitope and a TLR peptide agonist for treatment of cancer |
US11339190B2 (en) | 2020-04-21 | 2022-05-24 | Rush University Medical Center | Peptides for the treatment of covid-19 |
US11667678B2 (en) | 2019-04-21 | 2023-06-06 | Rush University Medical Center | Peptides for the treatment of COVID-19 |
US12178788B2 (en) | 2015-03-16 | 2024-12-31 | Amal Therapeutics Sa | Complex comprising a cell penetrating peptide, a cargo and a TLR peptide agonist |
US12214048B2 (en) | 2016-03-16 | 2025-02-04 | Amal Therapeutics Sa | Combination of an immune checkpoint modulator and a complex comprising a cell penetrating peptide, a cargo and a TLR peptide agonist for use in medicine |
Families Citing this family (54)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2017106332A1 (en) | 2015-12-14 | 2017-06-22 | X4 Pharmaceuticals, Inc. | Methods for treating cancer |
CN109069426B (zh) | 2015-12-14 | 2021-10-29 | X4 制药有限公司 | 治疗癌症的方法 |
EP3393468B1 (en) | 2015-12-22 | 2022-09-14 | X4 Pharmaceuticals, Inc. | Methods for treating immunodeficiency disease |
CN109153722A (zh) | 2016-04-08 | 2019-01-04 | X4 制药有限公司 | 用于治疗癌症的方法 |
CN116554168A (zh) | 2016-06-21 | 2023-08-08 | X4 制药有限公司 | Cxcr4抑制剂及其用途 |
EP3471726A4 (en) | 2016-06-21 | 2019-10-09 | X4 Pharmaceuticals, Inc. | CXCR4 INHIBITORS AND USES THEREOF |
EP3472129A4 (en) | 2016-06-21 | 2019-12-04 | X4 Pharmaceuticals, Inc. | CXCR4 INHIBITORS AND USES THEREOF |
US11478538B2 (en) * | 2016-10-07 | 2022-10-25 | Enterome S.A. | Immunogenic compounds for cancer therapy |
AU2017339577B2 (en) | 2016-10-07 | 2021-12-02 | Enterome S.A. | Immunogenic compounds for cancer therapy |
WO2018065628A2 (en) | 2016-10-07 | 2018-04-12 | Enterome | Microbiota sequence variants of tumor-related antigenic epitopes |
AU2017343779A1 (en) * | 2016-10-13 | 2019-04-04 | Dana-Farber Cancer Institute, Inc. | Compositions and methods for predicting response and resistance to CTLA4 blockade in melanoma using a gene expression signature |
KR101875055B1 (ko) * | 2016-10-19 | 2018-07-06 | 연세대학교 원주산학협력단 | 융합 단백질 및 그의 용도 |
KR102007203B1 (ko) * | 2016-10-20 | 2019-08-05 | 연세대학교 원주산학협력단 | 융합 단백질 및 그의 용도 |
EP3532505A4 (en) * | 2016-10-25 | 2019-12-25 | Urogen Pharma Ltd. | BODY CAVES IMMUNODULATING TREATMENTS |
CA3052803A1 (en) * | 2017-02-07 | 2018-08-16 | Nantcell, Inc. | Maximizing t-cell memory and compositions and methods therefor |
IL269830B2 (en) | 2017-04-04 | 2024-01-01 | Avidea Tech Inc | Peptide-based vaccines, methods of manufacturing, and uses thereof for inducing an immune response |
US12121573B2 (en) | 2019-07-14 | 2024-10-22 | Tianxin Wang | Methods and agents including STING agonist to treat tumor |
US11433128B2 (en) * | 2017-04-07 | 2022-09-06 | Tianxin Wang | Cell surface anchoring antigen conjugates to treat cancer |
WO2018197926A1 (en) * | 2017-04-26 | 2018-11-01 | Robert Penchovsky | Methods for creating novel antibacterial agents using chimeric antisense oligonucleotides |
WO2018237158A1 (en) * | 2017-06-21 | 2018-12-27 | X4 Pharmaceuticals, Inc. | METHODS FOR THE TREATMENT OF CANCER |
WO2019134018A1 (en) * | 2018-01-05 | 2019-07-11 | Telethon Kids Institute | Vaccine conjugates and uses thereof |
CN111918668A (zh) * | 2018-02-16 | 2020-11-10 | 王天欣 | 治疗肿瘤细胞和癌症的方法和药剂 |
FI3773689T3 (fi) * | 2018-04-11 | 2023-01-31 | Antigeenisiä peptidejä syövän ehkäisyyn ja hoitoon | |
JP7370598B2 (ja) * | 2018-05-02 | 2023-10-30 | 国立大学法人 新潟大学 | ペプチド及びその使用 |
EP3566718A1 (en) | 2018-05-07 | 2019-11-13 | Universitätsmedizin der Johannes Gutenberg-Universität Mainz | A pharmazeutical combination (treg depleting agent, checkpoint inhibitor, tlr9 agonist) for use in the treatment of cancer |
JP2021530218A (ja) | 2018-07-11 | 2021-11-11 | ザ ブリガム アンド ウィメンズ ホスピタル インコーポレイテッドThe Brigham and Women’s Hospital, Inc. | 血液脳関門を超える薬剤の送達のための方法および組成物 |
US10548889B1 (en) | 2018-08-31 | 2020-02-04 | X4 Pharmaceuticals, Inc. | Compositions of CXCR4 inhibitors and methods of preparation and use |
US20220127373A1 (en) * | 2018-11-08 | 2022-04-28 | The Regents Of The University Of California | Systems and methods for targeting cancer cells |
JP7520003B2 (ja) | 2018-11-16 | 2024-07-22 | ブリストル-マイヤーズ スクイブ カンパニー | 抗nkg2a抗体およびその使用 |
WO2020130548A1 (ko) * | 2018-12-19 | 2020-06-25 | 한국화학연구원 | 인간 쥐피에이티씨에치4 단백질 유래 세포막 투과 도메인 |
KR102351041B1 (ko) | 2018-12-19 | 2022-01-13 | 한국화학연구원 | 인간 lrrc24 단백질 유래 세포막 투과 도메인 |
WO2020130546A1 (ko) * | 2018-12-19 | 2020-06-25 | 한국화학연구원 | 인간 씨엘케이2 단백질 유래 세포막 투과 도메인 |
WO2020130547A1 (ko) * | 2018-12-19 | 2020-06-25 | 한국화학연구원 | 인간 엘알알씨24 단백질 유래 세포막 투과 도메인 |
WO2020146906A2 (en) * | 2019-01-12 | 2020-07-16 | The Methodist Hospital | Self-assembled peptide nanoparticle and use thereof |
CN109859795A (zh) * | 2019-02-20 | 2019-06-07 | 成都分迪科技有限公司 | 泛素化降解目标蛋白质的数据库 |
US20220184087A1 (en) * | 2019-03-28 | 2022-06-16 | The Penn State Research Foundation | Methods and compositions relating to treatment of cancer |
BR112021022458A2 (pt) | 2019-05-10 | 2021-12-28 | Univ California | Células pluripotentes modificadas ou uma célula derivada das mesmas, método de transplantar uma célula, método de tratamento de uma doença em um paciente em necessidade de células transplantadas, método para gerar uma célula pluripotente modificada, método para gerar uma célula hipoimunogênica pluripotente, e método de transplante de uma célula pluripotente hipoimunogênica (hip) ou célula derivada da mesma |
EP3827840A1 (en) * | 2019-11-29 | 2021-06-02 | Academisch Ziekenhuis Leiden h.o.d.n. LUMC | Teipp peptide variant and uses thereof |
JP2023510784A (ja) * | 2020-01-10 | 2023-03-15 | ザ ブリガム アンド ウィメンズ ホスピタル インコーポレイテッド | 脳腫瘍を処置するための血液脳関門を横断する免疫療法剤を送達するための方法および組成物 |
CN115515585A (zh) | 2020-03-10 | 2022-12-23 | X4 制药有限公司 | 用于治疗中性粒细胞减少症的方法 |
KR102484312B1 (ko) * | 2020-05-14 | 2023-01-02 | 한국화학연구원 | 고효능 사스 코로나바이러스 2 항원 및 이를 포함하는 백신 조성물 |
CN116249555A (zh) | 2020-05-19 | 2023-06-09 | 勃林格殷格翰国际有限公司 | 用于癌症治疗的结合分子 |
KR102720967B1 (ko) * | 2020-06-04 | 2024-10-23 | 가톨릭대학교 산학협력단 | 플라젤린으로부터 유도된 tlr5 작용제를 유효성분으로 포함하는 면역관문억제제의 항암 효과 증진용 약학 조성물 |
US20230233656A1 (en) * | 2020-06-26 | 2023-07-27 | National Breast Cancer Coalition | Breast Cancer Vaccine |
KR102556731B1 (ko) * | 2020-09-29 | 2023-07-21 | 주식회사 젠센 | 단백질 수송 도메인, 이를 포함하는 융합 화합물 및 이 융합 화합물을 포함하는 약학 조성물 |
JP2023545178A (ja) * | 2020-10-14 | 2023-10-26 | ベーリンガー インゲルハイム インターナショナル ゲゼルシャフト ミット ベシュレンクテル ハフツング | Stingアゴニストと、細胞透過性ペプチド、カーゴ、及びtlrペプチドアゴニストを含む複合体との組合せ |
WO2022087018A1 (en) * | 2020-10-19 | 2022-04-28 | G1 Therapeutics, Inc. | Improved fluorouracil-based multi-agent chemotherapy for treatment of metastatic colorectal cancer |
CN113817677B (zh) * | 2021-09-29 | 2023-08-18 | 四川大学 | 泛酸或其衍生物与α-D-葡萄糖-1,6-二磷酸或其衍生物在促进DC迁移中的用途 |
WO2023059687A1 (en) * | 2021-10-06 | 2023-04-13 | Whispergenics, Inc. | Triple drug combination (metformin, simvastatin, digoxin) for targeted treatment of cancers |
CR20240374A (es) | 2022-03-16 | 2024-10-22 | Boehringer Ingelheim Int | Antígenos tumorales, compuestos que comprenden los antígenos tumorales kras, tpx2 o aurka y usos de los mismos |
WO2023200796A1 (en) * | 2022-04-13 | 2023-10-19 | The Regents Of The University Of California | Immune cell inhibition by immune checkpoint engagers |
FR3143031A1 (fr) * | 2022-12-08 | 2024-06-14 | Université Grenoble Alpes | Nouveaux peptides et leur utilisation en tant que transporteurs pour l’internalisation de molécules d’intérêt dans des cellules cibles |
WO2024197792A1 (en) * | 2023-03-31 | 2024-10-03 | Beijing University Of Chinese Medicine | A complex comprising a cell penetrating peptide and a copi sorting inhibitor and uses thereof |
CN119925590A (zh) * | 2025-04-08 | 2025-05-06 | 北京华诺泰生物医药科技有限公司 | 一种mpl复合佐剂及其制备方法和应用 |
Citations (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2014041505A1 (en) * | 2012-09-13 | 2014-03-20 | Universite De Geneve | Cell penetrating peptides |
WO2015069932A1 (en) * | 2013-11-06 | 2015-05-14 | Solstice Biologics, Ltd. | Polynucleotide constructs having disulfide groups |
US20180133339A1 (en) * | 2015-03-16 | 2018-05-17 | Amal Therapeutics Sa | A Novel Complex Comprising A Cell Penetrating Peptide, A Cargo And A TLR Peptide Agonist For Treatment Of Glioblastoma |
US10206986B2 (en) * | 2013-11-13 | 2019-02-19 | Regents Of The University Of Minnesota | Annexin II variant compositions and methods |
US20190175748A1 (en) * | 2016-03-16 | 2019-06-13 | Amal Therapeutics Sa | Combination of an immune checkpoint modulator and a complex comprising a cell penetrating peptide, a cargo and a tlr peptide agonist for use in medicine |
Family Cites Families (89)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5851795A (en) | 1991-06-27 | 1998-12-22 | Bristol-Myers Squibb Company | Soluble CTLA4 molecules and uses thereof |
US6479055B1 (en) | 1993-06-07 | 2002-11-12 | Trimeris, Inc. | Methods for inhibition of membrane fusion-associated events, including respiratory syncytial virus transmission |
FR2728904B1 (fr) | 1995-01-04 | 1997-03-14 | Pasteur Institut | Reactif peptidique permettant de detecter une infection primaire a virus d'epstein-barr par recherche des anticorps correspondants, et procede d'utilisation de ce reactif |
US6051227A (en) | 1995-07-25 | 2000-04-18 | The Regents Of The University Of California, Office Of Technology Transfer | Blockade of T lymphocyte down-regulation associated with CTLA-4 signaling |
US5811097A (en) | 1995-07-25 | 1998-09-22 | The Regents Of The University Of California | Blockade of T lymphocyte down-regulation associated with CTLA-4 signaling |
US5855887A (en) | 1995-07-25 | 1999-01-05 | The Regents Of The University Of California | Blockade of lymphocyte down-regulation associated with CTLA-4 signaling |
AU6703198A (en) | 1997-03-21 | 1998-10-20 | Brigham And Women's Hospital | Immunotherapeutic ctla-4 binding peptides |
US6258782B1 (en) | 1998-05-20 | 2001-07-10 | Trimeris, Inc. | Hybrid polypeptides with enhanced pharmacokinetic properties |
US7109003B2 (en) | 1998-12-23 | 2006-09-19 | Abgenix, Inc. | Methods for expressing and recovering human monoclonal antibodies to CTLA-4 |
US6682736B1 (en) | 1998-12-23 | 2004-01-27 | Abgenix, Inc. | Human monoclonal antibodies to CTLA-4 |
EP2112166B1 (en) | 1998-12-23 | 2018-11-21 | Pfizer Inc. | Human monoclonal antibodies to ctla-4 |
US6750008B1 (en) | 1999-07-09 | 2004-06-15 | Trimeris, Inc. | Methods and compositions for inhibition of membrane fusion-associated events, including HIV transmission |
US7605238B2 (en) | 1999-08-24 | 2009-10-20 | Medarex, Inc. | Human CTLA-4 antibodies and their uses |
ATE354655T1 (de) | 1999-08-24 | 2007-03-15 | Medarex Inc | Humane antikörper gegen ctla-4 und deren verwendungen |
US7034121B2 (en) | 2000-01-27 | 2006-04-25 | Genetics Institue, Llc | Antibodies against CTLA4 |
KR100848973B1 (ko) | 2000-02-23 | 2008-07-30 | 글락소스미스클라인 바이오로지칼즈 에스.에이. | 종양 특이적 동물 단백질 |
US7229960B2 (en) | 2000-11-03 | 2007-06-12 | University Of Vermont And State Agricultural College | Methods and compositions for inhibiting GRB7 |
US20060222656A1 (en) | 2005-04-01 | 2006-10-05 | University Of Maryland, Baltimore | MAGE-A3/HPV 16 peptide vaccines for head and neck cancer |
AUPR593101A0 (en) | 2001-06-26 | 2001-07-19 | Council Of The Queensland Institute Of Medical Research, The | Cytomegalovirus t cell epitopes |
US7892559B2 (en) | 2002-01-30 | 2011-02-22 | Survac Aps | Survivin-derived peptides and use thereof |
GB0218821D0 (en) | 2002-08-13 | 2002-09-18 | Glaxosmithkline Biolog Sa | Novel compositions |
EP1558648B1 (en) | 2002-10-17 | 2012-01-11 | Genmab A/S | Human monoclonal antibodies against cd20 |
ATE552011T1 (de) * | 2003-10-15 | 2012-04-15 | Ist Superiore Sanita | Kolorektal-karzinom-antigen |
EP1768698A4 (en) | 2004-06-17 | 2009-01-28 | Medimmune Inc | IMMUNOGENIC COMPOSITIONS COMPRISING HMGB1 POLYPEPTIDES |
SI2287195T1 (sl) | 2004-07-01 | 2019-08-30 | Novo Nordisk A/S | Pan-kir2dl nk-receptor protitelesa in njihova uporaba pri diagnostiki in terapiji |
US20120052080A1 (en) | 2004-09-21 | 2012-03-01 | University Of Pittsburgh - Of The Commonwealth System Of Higher Education | Interleukin-13 receptor alpha 2 peptide-based brain cancer vaccines |
WO2006081826A2 (en) * | 2005-02-04 | 2006-08-10 | Survac Aps | Survivin peptide vaccine |
ES2291071B1 (es) | 2005-06-13 | 2009-03-16 | Proyecto De Biomedicina Cima, S.L. | Agentes y metodos basados en el uso del dominio eda de la fibronectina. |
JP5623747B2 (ja) | 2006-12-27 | 2014-11-12 | エモリー ユニバーシティ | 感染症および腫瘍を処置するための組成物および方法 |
EP1987839A1 (en) | 2007-04-30 | 2008-11-05 | I.N.S.E.R.M. Institut National de la Sante et de la Recherche Medicale | Cytotoxic anti-LAG-3 monoclonal antibody and its use in the treatment or prevention of organ transplant rejection and autoimmune disease |
EP2170959B1 (en) | 2007-06-18 | 2013-10-02 | Merck Sharp & Dohme B.V. | Antibodies to human programmed death receptor pd-1 |
SI2660248T1 (sl) * | 2007-07-27 | 2015-10-30 | Immatics Biotechnologies Gmbh | Nova imunoterapija proti možganskim tumorjem |
KR20100063048A (ko) | 2007-07-31 | 2010-06-10 | 더 존스 홉킨스 유니버시티 | 신생물성 또는 감염성 장애의 면역예방 또는 면역치료를 위한 폴리펩티드-핵산 접합체 |
EP2044949A1 (en) | 2007-10-05 | 2009-04-08 | Immutep | Use of recombinant lag-3 or the derivatives thereof for eliciting monocyte immune response |
WO2009130618A2 (en) * | 2008-04-25 | 2009-10-29 | Institute For Systems Biology | Flagellin polypeptide vaccines |
EP2119726B2 (en) | 2008-05-14 | 2017-11-29 | Immatics Biotechnologies GmbH | Novel and powerful MHC-class II peptides derived from survivin and neurocan |
EP4218806A1 (en) | 2008-06-20 | 2023-08-02 | Duke University | Compositions and kits for eliciting an immune response |
AR072999A1 (es) | 2008-08-11 | 2010-10-06 | Medarex Inc | Anticuerpos humanos que se unen al gen 3 de activacion linfocitaria (lag-3) y los usos de estos |
KR101040281B1 (ko) | 2008-08-22 | 2011-06-10 | 가톨릭대학교 산학협력단 | Tat-항원 융합단백질과 아쥬번트를 포함하는 백신 조성물 |
US8074880B2 (en) | 2008-12-01 | 2011-12-13 | Research In Motion Limited | Method, system and mobile device employing enhanced fingerprint authentication |
MY188826A (en) | 2008-12-09 | 2022-01-06 | Genentech Inc | Anti-pd-l1 antibodies and their use to enhance t-cell function |
EP2408473B1 (en) | 2009-03-16 | 2016-03-16 | McMaster University | Vaccination methods |
EP2435469A1 (en) | 2009-05-27 | 2012-04-04 | GlaxoSmithKline Biologicals S.A. | Casb7439 constructs |
MX2012001417A (es) | 2009-07-31 | 2012-07-03 | Organon Nv | Anticuerpos completamente humanos para atenuante de linfocitos b y t (btla). |
CA2772204A1 (en) | 2009-08-31 | 2011-03-03 | Amplimmune, Inc. | Methods and compositions for the inhibition of transplant rejection |
WO2011029980A1 (es) * | 2009-09-11 | 2011-03-17 | Proyecto De Biomedicina Cima, S.L. | Composiciones terapéuticas para el tratamiento de enfermedades causadas por hpv |
US9127077B2 (en) | 2009-09-23 | 2015-09-08 | L'universite Paris Descartes | Polypeptides and nucleic acids for treating ErbB2-dependent cancers |
RS56469B1 (sr) | 2009-11-24 | 2018-01-31 | Medimmune Ltd | Ciljano vezujući agensi usmereni na b7-h1 |
WO2011101332A1 (en) | 2010-02-16 | 2011-08-25 | Proyecto De Biomedicina Cima, S.L. | Compositions based on the fibronectin extracellular domain a for the treatment of melanoma |
PH12012501751A1 (en) | 2010-03-04 | 2012-11-12 | Macrogenics Inc | Antibodies reactive with b7-h3, immunologically active fragments thereof and uses thereof |
EP2563399B1 (fr) | 2010-04-26 | 2014-06-11 | Université Joseph Fourier | Utilisation de peptides comme transporteurs destines a l'internalisation de molecules d'interet dans des cellules cibles |
US9314516B2 (en) | 2010-05-04 | 2016-04-19 | Cassian Yee | Conditional superagonist CTL ligands for the promotion of tumor-specific CTL responses |
US8968746B2 (en) | 2010-07-30 | 2015-03-03 | Curevac Gmbh | Complexation of nucleic acids with disulfide-crosslinked cationic components for transfection and immunostimulation |
AR082980A1 (es) * | 2010-09-14 | 2013-01-23 | Council Scient Ind Res | Inmunogeno sintetico util para generar inmunidad y proteccion contra patogenos a largo plazo |
US9555074B2 (en) * | 2010-10-08 | 2017-01-31 | Regents Of The University Of Minnesota | Annexin II compositions |
KR101760464B1 (ko) * | 2010-10-13 | 2017-07-24 | 사회복지법인 삼성생명공익재단 | 교모세포종의 진단 또는 예후 예측용 바이오 마커 및 그 용도 |
AU2012205681B2 (en) | 2011-01-10 | 2016-07-28 | Cleveland Biolabs, Inc. | Use of toll-like receptor agonist for treating cancer |
US9187534B2 (en) | 2011-03-11 | 2015-11-17 | Universite De Geneve | Multi-epitopic vaccine |
US8795678B2 (en) * | 2011-05-13 | 2014-08-05 | Academia Sinica | TLR-2 agonists and methods of use thereof |
US8841418B2 (en) | 2011-07-01 | 2014-09-23 | Cellerant Therapeutics, Inc. | Antibodies that specifically bind to TIM3 |
US8819679B2 (en) | 2011-07-28 | 2014-08-26 | International Business Machines Corporation | Methods and systems for on-boarding applications to a cloud |
AU2012296613B2 (en) | 2011-08-15 | 2016-05-12 | Amplimmune, Inc. | Anti-B7-H4 antibodies and their uses |
WO2013067492A1 (en) | 2011-11-03 | 2013-05-10 | The Trustees Of The University Of Pennsylvania | Isolated b7-h4 specific compositions and methods of use thereof |
HK1202252A1 (en) * | 2011-11-16 | 2015-09-25 | Amgen Inc. | Methods of treating epidermal growth factor deletion mutant viii related disorders |
WO2013113326A1 (en) | 2012-01-31 | 2013-08-08 | Curevac Gmbh | Pharmaceutical composition comprising a polymeric carrier cargo complex and at least one protein or peptide antigen |
US9597393B2 (en) * | 2012-02-09 | 2017-03-21 | Av Therapeutics, Inc. | Synthetic toll-like receptor-4 (TLR-4) agonist peptides |
CN104487083B (zh) | 2012-07-13 | 2018-11-20 | S-目标疗法有限公司 | 免疫调节疫苗 |
WO2014165101A1 (en) * | 2013-03-13 | 2014-10-09 | California Stem Cell, Inc. | Individualized high purity colon carcinoma stem cells, methods and use of the same |
CA2884707C (en) | 2012-09-21 | 2019-03-19 | Lewis Bender | Method of treating cancer |
WO2014070663A1 (en) * | 2012-10-29 | 2014-05-08 | Anderson David E | Compositions and methods for diagnosis and treatment of malignant gliomas |
MX2016008771A (es) * | 2014-01-02 | 2016-12-20 | Memorial Sloan Kettering Cancer Center | Determinantes de respuesta del cancer a la inmunoterapia. |
CA2950960A1 (en) * | 2014-06-06 | 2015-12-10 | Solstice Biologics, Ltd. | Polynucleotide constructs having bioreversible and non-bioreversible groups |
CN107109362A (zh) | 2014-10-31 | 2017-08-29 | 麻省理工学院 | 递送生物分子至免疫细胞 |
SG10201914022QA (en) | 2014-11-13 | 2020-03-30 | Univ Johns Hopkins | Checkpoint blockade and microsatellite instability |
BR102015025502B1 (pt) | 2015-04-30 | 2022-06-21 | Aegerion Pharmaceuticals, Inc | Composição de lomitapida, tablete, produto de lomitapida, métodos para analisar uma composição de amostra de lomitapida e para determinar uma quantidade de uma impureza em uma amostra da composição |
CN107709908A (zh) | 2015-06-29 | 2018-02-16 | 松下知识产权经营株式会社 | 冷藏库 |
GB201520592D0 (en) | 2015-11-23 | 2016-01-06 | Immunocore Ltd & Adaptimmune Ltd | Peptides |
US10570377B2 (en) | 2016-01-08 | 2020-02-25 | Replimune Limited | Oncolytic virus strain |
US20190022203A1 (en) | 2016-01-11 | 2019-01-24 | Turnstone Limited Partnership | Oncolytic virus and checkpoint inhibitor combination therapy |
KR20190038480A (ko) | 2016-05-09 | 2019-04-08 | 턴스톤 리미티드 파트너쉽 | 프라임:부스트 병용 요법제 |
PL417980A1 (pl) | 2016-07-16 | 2018-01-29 | Univ Warszawski | Nowe fosfotriazolowe analogi kapu końca 5' mRNA, kompozycja je zawierająca, cząsteczka RNA je zawierająca, ich zastosowania i sposób syntezy cząsteczki RNA, białka i peptydu |
WO2018053508A1 (en) | 2016-09-19 | 2018-03-22 | The University Of North Carolina At Chapel Hill | Methods and compositions for inducing an immune response |
IL265479B (en) | 2016-09-21 | 2022-09-01 | Amal Therapeutics Sa | Fusion comprising a cell penetrating peptide, a multi epitope and a tlr peptide agonist for treatment of cancer |
CN118370809A (zh) | 2017-04-03 | 2024-07-23 | 百欧恩泰美国公司 | 蛋白质抗原及其用途 |
US20220211815A1 (en) | 2018-02-02 | 2022-07-07 | Novartis Ag | Combination therapy for the treatment of cancer |
JP2021529173A (ja) | 2018-06-20 | 2021-10-28 | イエール ユニバーシティ | Rig−iアゴニストおよびそれを使用した処置 |
WO2020010451A1 (en) | 2018-07-10 | 2020-01-16 | Trillium Therapeutics Inc. | Heteroaromatic-fused imidazolyl amides, compositions and uses thereof as sting agonists |
IL300060A (en) | 2020-09-14 | 2023-03-01 | Boehringer Ingelheim Int | Heterologous primary boost vaccine |
JP2023545178A (ja) | 2020-10-14 | 2023-10-26 | ベーリンガー インゲルハイム インターナショナル ゲゼルシャフト ミット ベシュレンクテル ハフツング | Stingアゴニストと、細胞透過性ペプチド、カーゴ、及びtlrペプチドアゴニストを含む複合体との組合せ |
-
2015
- 2015-12-22 US US15/557,653 patent/US20180133327A1/en not_active Abandoned
- 2015-12-22 WO PCT/EP2015/002598 patent/WO2016146143A1/en active Application Filing
-
2016
- 2016-03-16 NZ NZ733762A patent/NZ733762A/en unknown
- 2016-03-16 HU HUE19219165A patent/HUE066851T2/hu unknown
- 2016-03-16 ES ES16711529T patent/ES2781454T3/es active Active
- 2016-03-16 CN CN201680015946.2A patent/CN107428845A/zh active Pending
- 2016-03-16 CA CA2973757A patent/CA2973757A1/en active Pending
- 2016-03-16 WO PCT/EP2016/000473 patent/WO2016146262A1/en active Application Filing
- 2016-03-16 US US15/557,651 patent/US20180133339A1/en not_active Abandoned
- 2016-03-16 EP EP16711529.4A patent/EP3270955B1/en active Active
- 2016-03-16 PL PL16713731T patent/PL3270957T3/pl unknown
- 2016-03-16 HR HRP20200491TT patent/HRP20200491T1/hr unknown
- 2016-03-16 DK DK16713731.4T patent/DK3270957T3/da active
- 2016-03-16 US US15/557,649 patent/US20180133338A1/en not_active Abandoned
- 2016-03-16 WO PCT/EP2016/000472 patent/WO2016146261A1/en active Application Filing
- 2016-03-16 DK DK16711529.4T patent/DK3270955T3/da active
- 2016-03-16 LT LTEP16711529.4T patent/LT3270955T/lt unknown
- 2016-03-16 SI SI201630654T patent/SI3270955T1/sl unknown
- 2016-03-16 AU AU2016232656A patent/AU2016232656A1/en not_active Abandoned
- 2016-03-16 DK DK19219165.8T patent/DK3693009T3/da active
- 2016-03-16 RS RS20200337A patent/RS60089B1/sr unknown
- 2016-03-16 MX MX2017011796A patent/MX2017011796A/es unknown
- 2016-03-16 EP EP16711528.6A patent/EP3270954A1/en active Pending
- 2016-03-16 PL PL19219165.8T patent/PL3693009T3/pl unknown
- 2016-03-16 AU AU2016232659A patent/AU2016232659B2/en active Active
- 2016-03-16 HU HUE16711529A patent/HUE048807T2/hu unknown
- 2016-03-16 JP JP2017567526A patent/JP6862369B2/ja active Active
- 2016-03-16 AU AU2016232657A patent/AU2016232657B9/en active Active
- 2016-03-16 KR KR1020177029623A patent/KR102212451B1/ko active Active
- 2016-03-16 HU HUE16713731A patent/HUE048808T2/hu unknown
- 2016-03-16 ES ES19219165T patent/ES2978792T3/es active Active
- 2016-03-16 WO PCT/EP2016/000471 patent/WO2016146260A1/en active Application Filing
- 2016-03-16 JP JP2017567525A patent/JP6882207B2/ja active Active
- 2016-03-16 CA CA2973747A patent/CA2973747A1/en active Pending
- 2016-03-16 PL PL16711529T patent/PL3270955T3/pl unknown
- 2016-03-16 EA EA201792045A patent/EA038049B1/ru unknown
- 2016-03-16 EP EP19219165.8A patent/EP3693009B1/en active Active
- 2016-03-16 KR KR1020217003158A patent/KR102386172B1/ko active Active
- 2016-03-16 EP EP16713731.4A patent/EP3270957B1/en active Active
- 2016-03-16 PT PT167115294T patent/PT3270955T/pt unknown
- 2016-03-16 PT PT167137314T patent/PT3270957T/pt unknown
- 2016-03-16 US US15/557,647 patent/US20180133295A1/en not_active Abandoned
- 2016-03-16 ES ES16713731T patent/ES2781455T3/es active Active
- 2016-03-16 JP JP2017567527A patent/JP6993240B2/ja active Active
- 2016-03-16 CA CA2973770A patent/CA2973770A1/en active Pending
- 2016-03-16 WO PCT/EP2016/000470 patent/WO2016146259A1/en active Application Filing
-
2017
- 2017-07-11 IL IL253416A patent/IL253416B/en unknown
- 2017-07-14 PH PH12017501287A patent/PH12017501287A1/en unknown
- 2017-09-15 CL CL2017002345A patent/CL2017002345A1/es unknown
-
2020
- 2020-04-07 CY CY20201100327T patent/CY1122953T1/el unknown
-
2021
- 2021-03-31 JP JP2021059082A patent/JP7179896B2/ja active Active
- 2021-05-06 JP JP2021078278A patent/JP7190528B2/ja active Active
- 2021-08-01 IL IL285273A patent/IL285273B/en unknown
- 2021-08-06 US US17/396,351 patent/US12178788B2/en active Active
- 2021-08-09 US US17/397,447 patent/US12220450B2/en active Active
- 2021-08-18 AU AU2021218097A patent/AU2021218097B2/en active Active
- 2021-12-09 AU AU2021282506A patent/AU2021282506B2/en active Active
- 2021-12-22 US US17/558,906 patent/US20220175933A1/en active Pending
Patent Citations (7)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2014041505A1 (en) * | 2012-09-13 | 2014-03-20 | Universite De Geneve | Cell penetrating peptides |
WO2015069932A1 (en) * | 2013-11-06 | 2015-05-14 | Solstice Biologics, Ltd. | Polynucleotide constructs having disulfide groups |
US10206986B2 (en) * | 2013-11-13 | 2019-02-19 | Regents Of The University Of Minnesota | Annexin II variant compositions and methods |
US20180133339A1 (en) * | 2015-03-16 | 2018-05-17 | Amal Therapeutics Sa | A Novel Complex Comprising A Cell Penetrating Peptide, A Cargo And A TLR Peptide Agonist For Treatment Of Glioblastoma |
US20180133338A1 (en) * | 2015-03-16 | 2018-05-17 | Amal Therapeutics Sa | A Novel Complex Comprising A Cell Penetrating Peptide, A Cargo And A TLR Peptide Agonist For Treatment Of Colorectal Cancer |
US20180133295A1 (en) * | 2015-03-16 | 2018-05-17 | Amal Therapeutics Sa | A Novel Complex Comprising A Cell Penetrating Peptide, A Cargo And A TLR Peptide Agonist |
US20190175748A1 (en) * | 2016-03-16 | 2019-06-13 | Amal Therapeutics Sa | Combination of an immune checkpoint modulator and a complex comprising a cell penetrating peptide, a cargo and a tlr peptide agonist for use in medicine |
Non-Patent Citations (2)
Title |
---|
cited in the IDS received on 9/12/17 * |
effective filing date of 11/6/13 * |
Cited By (9)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US12178788B2 (en) | 2015-03-16 | 2024-12-31 | Amal Therapeutics Sa | Complex comprising a cell penetrating peptide, a cargo and a TLR peptide agonist |
US12220450B2 (en) | 2015-03-16 | 2025-02-11 | Amal Therapeutics Sa | Complex comprising a cell penetrating peptide, a cargo and a TLR peptide agonist for treatment of colorectal cancer |
US12214048B2 (en) | 2016-03-16 | 2025-02-04 | Amal Therapeutics Sa | Combination of an immune checkpoint modulator and a complex comprising a cell penetrating peptide, a cargo and a TLR peptide agonist for use in medicine |
US11338027B2 (en) | 2016-09-21 | 2022-05-24 | Amal Therapeutics Sa | Fusion comprising a cell penetrating peptide, a multi epitope and a TLR peptide agonist for treatment of cancer |
US12220387B2 (en) | 2016-09-21 | 2025-02-11 | Amal Therapeutics Sa | Fusion comprising a cell penetrating peptide, a multi epitope and a TLR peptide agonist for treatment of cancer |
US20210290727A1 (en) * | 2018-08-01 | 2021-09-23 | University Of Maryland, Baltimore | MODULATION OF mTORCI ACTIVITY AND AUTOPHAGY VIA CIB2-RHEB INTERACTION |
US11667678B2 (en) | 2019-04-21 | 2023-06-06 | Rush University Medical Center | Peptides for the treatment of COVID-19 |
US11339190B2 (en) | 2020-04-21 | 2022-05-24 | Rush University Medical Center | Peptides for the treatment of covid-19 |
WO2022053703A1 (en) | 2020-09-14 | 2022-03-17 | Boehringer Ingelheim International Gmbh | Heterologous prime boost vaccine |
Also Published As
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US12178788B2 (en) | Complex comprising a cell penetrating peptide, a cargo and a TLR peptide agonist | |
US12220387B2 (en) | Fusion comprising a cell penetrating peptide, a multi epitope and a TLR peptide agonist for treatment of cancer | |
US12214048B2 (en) | Combination of an immune checkpoint modulator and a complex comprising a cell penetrating peptide, a cargo and a TLR peptide agonist for use in medicine | |
BR112017015906B1 (pt) | Complexo compreendendo um peptídeo de penetração celular, uma carga e um agonista de peptídeo tlr, seu método de preparação, composição, composição farmacêutica e kit | |
BR122021025869B1 (pt) | Uso de um complexo compreendendo um peptídeo de penetração celular, uma carga e um agonista de peptídeo tlr | |
EA049338B1 (ru) | Новый комплекс, содержащий проникающий в клетку пептид, карго-молекулу и пептидный агонист tlr |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AS | Assignment |
Owner name: AMAL THERAPEUTICS SA, SWITZERLAND Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:DEROUAZI, MADIHA;REEL/FRAME:043587/0304 Effective date: 20170817 |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: FINAL REJECTION MAILED |
|
STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |