US20160176962A1 - Combination Therapy For Treatment Of Disease - Google Patents

Combination Therapy For Treatment Of Disease Download PDF

Info

Publication number
US20160176962A1
US20160176962A1 US14/928,271 US201514928271A US2016176962A1 US 20160176962 A1 US20160176962 A1 US 20160176962A1 US 201514928271 A US201514928271 A US 201514928271A US 2016176962 A1 US2016176962 A1 US 2016176962A1
Authority
US
United States
Prior art keywords
antibody
seq
agent
pathway inhibitor
antagonist
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
US14/928,271
Other languages
English (en)
Inventor
Christopher Lamond Murriel
Timothy Charles Hoey
Austin L. Gurney
Julie Michelle Roda
Minu K. Srivastava
Inkyung Park
Jakob Dupont
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Mereo Biopharma 5 Inc
Original Assignee
Oncomed Pharmaceuticals Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Oncomed Pharmaceuticals Inc filed Critical Oncomed Pharmaceuticals Inc
Priority to US14/928,271 priority Critical patent/US20160176962A1/en
Publication of US20160176962A1 publication Critical patent/US20160176962A1/en
Assigned to ONCOMED PHARMACEUTICALS, INC. reassignment ONCOMED PHARMACEUTICALS, INC. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: RODA, Julie Michelle, DUPONT, JAKOB, HOEY, TIMOTHY CHARLES, SRIVASTAVA, Minu K., MURRIEL, Christopher Lamond, PARK, Inkyung, GURNEY, AUSTIN L.
Priority to US15/889,532 priority patent/US11046760B2/en
Priority to US17/330,716 priority patent/US20210403553A1/en
Priority to US18/758,255 priority patent/US20250179169A1/en
Abandoned legal-status Critical Current

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/28Compounds containing heavy metals
    • A61K31/282Platinum compounds
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/495Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
    • A61K31/505Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
    • A61K31/519Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim ortho- or peri-condensed with heterocyclic rings
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/39558Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2827Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against B7 molecules, e.g. CD80, CD86
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/113Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/113Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
    • C12N15/1136Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing against growth factors, growth regulators, cytokines, lymphokines or hormones
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • A61K2039/507Comprising a combination of two or more separate antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/57Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
    • A61K2039/572Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 cytotoxic response
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/475Growth factors; Growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/22Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against growth factors ; against growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity

Definitions

  • the present invention provides methods comprising combination therapy for modulating immune responses and treating cancer and other diseases.
  • the present invention provides Notch pathway inhibitors, including DLL4 antagonists and Notch receptor antagonists, in combination with at least one additional immunotherapeutic agent for the treatment of cancer.
  • Cancer is one of the leading causes of death in the developed world, with over one million people diagnosed with cancer and 500,000 deaths per year in the United States alone. Overall it is estimated that more than 1 in 3 people will develop some form of cancer during their lifetime. There are more than 200 different types of cancer, four of which—breast, lung, colorectal, and prostate—account for over half of all new cases (Siegel et al., 2012, CA: Cancer J. Clin., 62:10-29).
  • Signaling pathways connect extracellular signals to the nucleus leading to expression of genes that directly or indirectly control cell growth, differentiation, survival, and death. In a wide variety of cancers, signaling pathways are dysregulated and may be linked to tumor initiation and/or progression. Signaling pathways implicated in human oncogenesis include, but are not limited to, the Wnt pathway, the Ras-Raf-MEK-ERK or MAPK pathway, the PI3K-AKT pathway, the CDKN2A/CDK4 pathway, the Bcl-2/TP53 pathway, and the Notch pathway.
  • the Notch pathway is involved in multiple aspects of vascular development including proliferation, migration, smooth muscle differentiation, angiogenesis, and arterial-venous differentiation (Iso et al., 2003 , Arterioscler. Thromb. Vasc. Biol., 23:543).
  • the Notch receptor ligand DLL4 (Delta-like ligand 4) is an important component of the Notch pathway and plays a role in angiogenesis.
  • Blocking Notch pathway signaling such as by an anti-DLL4 antibody, has been shown to reduce tumor growth by multiple different mechanisms (Ridgway et al., 2006 , Nature, 444:1083-87; Noguera-Troise et al., Nature, 444:1032-37; Hoey et al., 2009 , Cell Stem Cell, 5:168-77).
  • DLL4 blocking antibodies have been reported to result in endothelial cell proliferation and the development of blood vessels, however, these blood vessels lack a functional lumen.
  • This dysangiogenic effect has been reported to block tumor growth by promoting the development of non-functional blood vessels (Ridgway et al., 2006 , Nature, 444:1083-87; Noguera-Troise et al., Nature, 444:1032-37; Scehnet et al., 2007 , Blood, 109:4753-60). Additionally, DLL4 blocking antibodies have been shown to inhibit tumor growth by reducing the proliferation of tumor cells and reducing cancer stem cell frequency.
  • DLL4 is required for the self-renewal of CSCs and maintains these cells in an undifferentiated state (Hoey et al., 2009 , Cell Stem Cell, 5:168-77).
  • blockade of DLL4 signaling by anti-human DLL4 antibodies can result in endothelial hypertrophy and the creation of non-functional microvessels. Consequently, even in the presence of tumor angiogenic factors, blockade of DLL4 signaling through administration of anti-human DLL4 antibodies can result in dysangiogenesis which inhibits the ability of the tumor to induce the functional blood vessel formation needed to support growth of the tumor.
  • the basis for immunotherapy is the manipulation and/or modulation of the immune system, including both innate immune responses and adaptive immune responses.
  • the general aim of immunotherapy is to treat diseases by controlling the immune response to a “foreign agent”, for example a pathogen or a tumor cell.
  • immunotherapy is used to treat autoimmune diseases which may arise from an abnormal immune response against proteins, molecules, and/or tissues normally present in the body Immunotherapy may include methods to induce or enhance specific immune responses or to inhibit or reduce specific immune responses.
  • the immune system is a highly complex system made up of a great number of cell types, including but not limited to, T-cells, B-cells, natural killer cells, antigen-presenting cells, dendritic cells, monocytes, granulocytes, and macrophages. These cells possess complex and subtle systems for controlling their interactions and responses.
  • the cells utilize both activating and inhibitory mechanisms and feedback loops to keep responses in check and not allow negative consequences of an uncontrolled immune response (e.g., autoimmune diseases).
  • an immune response is initiated through antigen recognition by the T-cell receptor (TCR) and is regulated by a balance between stimulatory and inhibitory signals (i.e., immune checkpoints).
  • TCR T-cell receptor
  • immune checkpoints are necessary to maintain a balance between activating and inhibitory signals and to ensure the development of an effective immune response while safeguarding against the development of autoimmunity or damage to tissues when the immune system is responding to a foreign or pathogenic agent.
  • An important immune checkpoint receptor is CTLA-4 which is expressed on T-cells and is highly expressed on regulatory T-cells (Tregs). CTLA-4 is considered to act as an inhibitory molecule or an immune response “brake” and primarily regulates the amplitude of T-cell activation.
  • CTLA-4 counteracts the activity of the co-stimulatory receptor, CD28, which acts in concert with the TCR to activate T-cells.
  • CTLA-4 and CD28 share identical ligands or counter-receptors, B7-1 (CD80) and B7-2 (CD86) and the balance of the immune response probably involves competition of CTLA-4 and CD28 for binding to the ligands.
  • Another important immune checkpoint receptor is PD-1 which is expressed on T-cells after activation, is highly expressed on Tregs, and is expressed on other activated cells including B-cells and natural killer (NK) cells. Similar to CTLA-4, PD-1 is considered to act as an inhibitory molecule and a “brake” on the immune response.
  • PD-L1 also known as B7-H1 and CD274
  • PD-L2 also known as B7-DC and CD273
  • cancer immunosurveillance is based on the theory that the immune system can recognize tumor cells, mount an immune response, and suppress the development and/or progression of a tumor.
  • many cancerous cells have developed mechanisms to evade the immune system which can allow for uninhibited growth of tumors.
  • Immune checkpoints can be dysregulated by tumors and may be manipulated by tumors to be used as an immune resistance mechanism.
  • Cancer immunotherapy focuses on the development of agents that can activate and/or boost the immune system to achieve a more effective response to inhibiting tumor growth and/or killing tumor cells.
  • the present invention provides methods of treating diseases such as cancer, wherein the methods comprise administering to a subject in need thereof a Notch pathway inhibitor (e.g., a DLL4 antagonist or a Notch receptor antagonist) in combination with a second agent, wherein the second agent is an immunotherapeutic agent.
  • a Notch pathway inhibitor e.g., a DLL4 antagonist or a Notch receptor antagonist
  • the second agent is an immunotherapeutic agent.
  • Combination therapy with at least two therapeutic agents often uses agents that work by different mechanisms of action, and/or target different pathways and may result in additive or synergetic effects.
  • Combination therapy may allow for a lower dose of each agent than used in monotherapy, thereby reducing toxic side effects and/or increasing the therapeutic index of the agent(s).
  • Combination therapy may decrease the likelihood that resistance to an agent will develop.
  • Combination therapy may allow one agent to sensitize tumor cells (including cancer stem cells) to enhanced activity by a second agent.
  • Combination therapy comprising an immunotherapeutic agent may allow one agent to enhance the immune response to a tumor or tumor cells while the second agent may be effective at killing tumor cells more directly.
  • the order and/or timing of the administration of each therapeutic agent may affect the overall efficacy of a drug combination.
  • DLL4 antagonists include but are not limited to, antibodies and other polypeptides that bind DLL4, small molecules that bind DLL4, and soluble Notch proteins.
  • DLL4 antagonist as used herein includes bispecific antibodies, heterodimeric bispecific molecules, homodimeric bispecific molecules, and/or bifunctional molecules comprising an anti-DLL4 antibody and an immunotherapeutic agent.
  • Notch receptor antagonists include but are not limited to, antibodies and other polypeptides that bind Notch1, Notch2, Notch3, and/or Notch4, small molecules that bind Notch1, Notch2, Notch3, and/or Notch4, and soluble Notch ligands (DLL1, DLL3, DLL4, Jag1 and Jag2).
  • Notch receptor antagonist as used herein includes bispecific antibodies, heterodimeric bispecific molecules, homodimeric bispecific molecules, and/or bifunctional molecules comprising an anti-Notch antibody and an immunotherapeutic agent.
  • the invention provides immunotherapeutic agents, including but not limited to, a modulator of PD-1 activity, a modulator of PD-L1 activity, a modulator of PD-L2 activity, a modulator of CTLA-4 activity, a modulator of CD28 activity, a modulator of CD80 activity, a modulator of CD86 activity, a modulator of 4-1BB activity, an modulator of OX40 activity, a modulator of KIR activity, a modulator of Tim-3 activity, a modulator of LAG3 activity, a modulator of CD27 activity, a modulator of CD40 activity, a modulator of GITR activity, a modulator of TIGIT activity, a modulator of CD20 activity, a modulator of CD96 activity, a modulator of IDO1 activity, a cytokine, a chemokine, an interferon, an interleukin, a lymphokine, a member of the tumor necrosis factor (TNF) family, and an immunostimulatory oligon
  • compositions comprising a Notch pathway inhibitor (e.g., a DLL4 antagonist or a Notch receptor antagonist) and/or at least one additional immunotherapeutic agent are provided.
  • a Notch pathway inhibitor e.g., a DLL4 antagonist or a Notch receptor antagonist
  • additional immunotherapeutic agent e.g., a DLL4 antagonist or a Notch receptor antagonist
  • Pharmaceutical compositions comprising the Notch pathway inhibitors and/or the immunotherapeutic agents are provided.
  • Personalized medicine strategies may include treatment regimens that are based upon biomarkers, including prognostic markers, pharmacodynamics markers, and predictive markers.
  • predictive biomarkers assess the likelihood that a tumor or cancer will be responsive to or sensitive to a specific therapeutic agent or a combination of agents, and may allow for the identification and/or the selection of patients most likely to benefit from the use of that agent or agents.
  • the invention provides the use of PD-L1 as a predictive biomarker for responsiveness to treatment with a Notch pathway inhibitor in combination with an immunotherapeutic agent.
  • the invention provides methods of inhibiting tumor growth.
  • a method comprises contacting tumor cells with an effective amount of a Notch pathway inhibitor in combination with an effective amount of a second agent, wherein the second agent is an immunotherapeutic agent.
  • the method may be in vivo or in vitro.
  • the tumor is in a subject, and contacting tumor cells with the Notch pathway inhibitor and the immunotherapeutic agent comprises administering a therapeutically effective amount of each of the agents to the subject.
  • a method of inhibiting tumor growth comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor and a therapeutically effective amount of a second agent, wherein the Notch pathway inhibitor is a DLL4 antagonist and the second agent is an immunotherapeutic agent.
  • a method of inhibiting tumor growth comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor and a therapeutically effective amount of a second agent, wherein the Notch pathway inhibitor is a Notch receptor antagonist and the second agent is an immunotherapeutic agent.
  • the invention provides a method of treating cancer.
  • a method of treating cancer comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor in combination with a therapeutically effective amount of a second agent, wherein the second agent is an immunotherapeutic agent.
  • a method of treating cancer comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor and a therapeutically effective amount of a second agent, wherein the Notch pathway inhibitor is a DLL4 antagonist and the second agent is an immunotherapeutic agent.
  • a method of treating cancer comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor and a therapeutically effective amount of a second agent, wherein the Notch pathway inhibitor is a Notch receptor antagonist and the second agent is an immunotherapeutic agent.
  • the invention provides a method of.
  • a method of modulating the immune response comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor in combination with a therapeutically effective amount of a second agent, wherein the second agent is an immunotherapeutic agent.
  • the immune response is an anti-tumor response.
  • the immune response is enhanced, increased, activated, and/or induced.
  • the modulation of the immune response comprises an increased Th1-type response.
  • the modulation of the immune response comprises a decreased Th2-type response.
  • the modulation of the immune response comprises an decreased Th17-type response.
  • the invention provides a method of inhibiting the activity of regulatory T-cells (Tregs).
  • a method of inhibiting the activity of Tregs comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor in combination with a therapeutically effective amount of a second agent, wherein the second agent is an immunotherapeutic agent.
  • a method of inhibiting the activity of Tregs comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor and a therapeutically effective amount of a second agent, wherein the Notch pathway inhibitor is a DLL4 antagonist and the second agent is an immunotherapeutic agent.
  • a method of inhibiting the activity of Tregs comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor and a therapeutically effective amount of a second agent, wherein the Notch pathway inhibitor is a Notch receptor antagonist and the second agent is an immunotherapeutic agent.
  • the inhibition of Treg activity comprises inhibiting the suppression of immune responses.
  • the inhibition of Treg activity results in the inhibition of suppression of immune responses.
  • the invention provides a method of inhibiting the activity of myeloid-derived suppressor cells (MDSCs).
  • a method of inhibiting the activity of MDSCs comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor in combination with a therapeutically effective amount of a second agent, wherein the second agent is an immunotherapeutic agent.
  • a method of inhibiting the activity of MDSCs comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor and a therapeutically effective amount of a second agent, wherein the Notch pathway inhibitor is a DLL4 antagonist and the second agent is an immunotherapeutic agent.
  • a method of inhibiting the activity of MDSCs comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor and a therapeutically effective amount of a second agent, wherein the Notch pathway inhibitor is a Notch receptor antagonist and the second agent is an immunotherapeutic agent.
  • the inhibition of MDSC activity comprises inhibiting the suppression of immune responses.
  • the inhibition of MDSC activity results in the inhibition of suppression of immune responses.
  • the invention provides a method of enhancing the antigen-specific memory response to a tumor.
  • a method of enhancing the antigen-specific memory response to a tumor comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor in combination with a therapeutically effective amount of a second agent, wherein the second agent is an immunotherapeutic agent.
  • a method of enhancing the antigen-specific memory response to a tumor comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor and a therapeutically effective amount of a second agent, wherein the Notch pathway inhibitor is a DLL4 antagonist and the second agent is an immunotherapeutic agent.
  • a method of enhancing the antigen-specific memory response to a tumor comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor and a therapeutically effective amount of a second agent, wherein the Notch pathway inhibitor is a Notch receptor antagonist and the second agent is an immunotherapeutic agent.
  • the invention provides a method of activating or enhancing a persistent or long-term immune response to a tumor.
  • a method of activating or enhancing a persistent immune response to a tumor comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor in combination with a therapeutically effective amount of a second agent, wherein the second agent is an immunotherapeutic agent.
  • a method of activating or enhancing a persistent immune response to a tumor comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor and a therapeutically effective amount of a second agent, wherein the Notch pathway inhibitor is a DLL4 antagonist and the second agent is an immunotherapeutic agent.
  • a method of activating or enhancing a persistent immune response to a tumor comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor and a therapeutically effective amount of a second agent, wherein the Notch pathway inhibitor is a Notch receptor antagonist and the second agent is an immunotherapeutic agent.
  • the invention provides a method of inducing a persistent or long-term immunity which inhibits tumor relapse or tumor regrowth.
  • a method of inducing a persistent immunity which inhibits tumor relapse or tumor regrowth comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor in combination with a therapeutically effective amount of a second agent, wherein the second agent is an immunotherapeutic agent.
  • a method of inducing a persistent immunity which inhibits tumor relapse or tumor regrowth comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor and a therapeutically effective amount of a second agent, wherein the Notch pathway inhibitor is a DLL4 antagonist and the second agent is an immunotherapeutic agent.
  • a method of inducing a persistent immunity which inhibits tumor relapse or tumor regrowth comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor and a therapeutically effective amount of a second agent, wherein the Notch pathway inhibitor is a Notch receptor antagonist and the second agent is an immunotherapeutic agent.
  • the invention provides a method to increase the efficacy of an immune checkpoint modulator.
  • a method to increase the efficacy of an immune checkpoint modulator comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor in combination with a therapeutically effective amount of an immune checkpoint modulator.
  • a method to increase the efficacy of an immune checkpoint modulator comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor and a therapeutically effective amount of an immune checkpoint modulator, wherein the Notch pathway inhibitor is a DLL4 antagonist.
  • a method to increase the efficacy of an immune checkpoint modulator comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor and a therapeutically effective amount of an immune checkpoint modulator, wherein the Notch pathway inhibitor is a Notch receptor antagonist.
  • the immune checkpoint modulator is an immune checkpoint inhibitor.
  • the immune checkpoint modulator is an immune checkpoint enhancer or stimulator.
  • the invention provides a method of reducing or preventing metastasis in a subject.
  • a method of reducing or preventing metastasis in a subject comprises administering to the subject a therapeutically effective amount of a Notch pathway inhibitor and a therapeutically effective amount of a second agent, wherein the second agent is an immunotherapeutic agent.
  • a method of reducing or preventing metastasis in a subject comprises administering to the subject a therapeutically effective amount of a Notch pathway inhibitor and a therapeutically effective amount of an immunotherapeutic agent, wherein the Notch pathway inhibitor is a DLL4 antagonist.
  • a method of reducing or preventing metastasis in a subject comprises administering to the subject a therapeutically effective amount of a Notch pathway inhibitor and a therapeutically effective amount of an immunotherapeutic agent, wherein the Notch pathway inhibitor is a Notch receptor antagonist.
  • the invention provides a method of enhancing treatment for a subject who is being treated with an immune checkpoint inhibitor, the method comprising administering to the subject a therapeutically effective amount of a Notch pathway inhibitor.
  • the Notch pathway inhibitor is a DLL4 antagonist.
  • the Notch pathway inhibitor is a Notch receptor antagonist.
  • the invention provides a method of enhancing or inducing an anti-tumor immune response in a subject, the method comprising administering to the subject a therapeutically effective amount of a Notch pathway inhibitor.
  • the Notch pathway inhibitor is a DLL4 antagonist.
  • the Notch pathway inhibitor is a Notch receptor antagonist.
  • the invention provides a method of identifying a human tumor likely to be responsive to treatment with a Notch pathway inhibitor in combination with a second agent, wherein the second agent is an immunotherapeutic agent, the method comprising determining the expression level of PD-L1 in a sample obtained from the tumor.
  • a method of identifying a human tumor likely to be responsive to combination treatment with a Notch pathway inhibitor and an immunotherapeutic agent comprises: a) obtaining a sample of the human tumor; b) measuring the expression level of PD-L1 in the sample; and c) identifying the tumor as likely to be responsive or non-responsive to combination treatment with a Notch pathway inhibitor and an immunotherapeutic agent based upon the expression level of PD-L1.
  • the invention provides a method of determining the responsiveness (or sensitivity) of a human tumor to treatment with a Notch pathway inhibitor in combination with a second agent, wherein the second agent is an immunotherapeutic agent, the method comprising: (a) obtaining a sample of the human tumor; (b) measuring the expression level of PD-L1 in the sample; and (c) determining the responsiveness of the tumor to treatment based upon the expression level of PD-L1.
  • the method comprises determining the responsiveness or sensitivity of a human tumor to treatment with a DLL4 antagonist in combination with at least one additional therapeutic agent.
  • the method comprises determining the responsiveness or sensitivity of a human tumor to treatment with a Notch receptor antagonist in combination with at least one additional therapeutic agent.
  • the invention provides a method of identifying a patient with cancer who is likely to respond to treatment with a Notch pathway inhibitor in combination with a second agent, wherein the second agent is an immunotherapeutic agent, the method comprising: (a) obtaining a sample from the patient; (b) measuring the expression level of PD-L1 in the sample; and (c) identifying the patient who is likely to respond to treatment based upon the expression level of PD-L1.
  • the sample is a tumor sample.
  • the sample is a blood or plasma sample.
  • the method comprises identifying a patient with cancer who is likely to respond to treatment with a Notch pathway inhibitor and an immunotherapeutic agent in combination with at least one additional therapeutic agent.
  • the invention provides a method of selecting a subject with a tumor for treatment with a Notch pathway inhibitor in combination with a second agent, wherein the second agent is an immunotherapeutic agent, the method comprising: a) determining the expression level of PD-L1 in a sample obtained from the subject; b) identifying the tumor as likely to be responsive or non-responsive to treatment with the Notch pathway inhibitor and the immunotherapeutic agent based upon the expression level of PD-L1; and c) selecting the subject for treatment if the tumor is identified as likely to be responsive to treatment.
  • the sample is a tumor sample.
  • the sample is a blood or plasma sample.
  • the invention provides a method of treating cancer in a patient, comprising: (a) identifying if the patient is likely to respond to treatment with a Notch pathway inhibitor in combination with a second agent, wherein the second agent is an immunotherapeutic agent, wherein the identification comprises: (i) obtaining a sample from the patient; (ii) measuring the expression level of PD-L1 in the sample; and (iii) identifying the patient who is likely to respond to treatment based upon the expression level of PD-L1; and (b) administering to the patient who is likely to response to treatment an effective amount of the Notch pathway inhibitor in combination with the immunotherapeutic agent.
  • the sample is a tumor sample.
  • the sample is a blood or plasma sample.
  • the method comprises identifying if the patient is likely to respond to treatment with a Notch pathway inhibitor in combination with a chemotherapeutic agent. In some embodiments, the method comprises administering to the patient the Notch pathway inhibitor and immunotherapeutic agent in combination with at least one additional therapeutic agent (e.g., a chemotherapeutic agent).
  • the invention provides a method of treating cancer in a patient, comprising: administering to the patient an effective amount of a Notch pathway inhibitor in combination with a second agent, wherein the second agent is an immunotherapeutic agent; wherein the patient is predicted to respond to treatment with a Notch pathway inhibitor and/or immunotherapeutic agent based upon the expression level of PD-L1 in a sample from the patient.
  • the sample is a tumor sample.
  • the sample is a blood or plasma sample.
  • the patient is predicted to respond to treatment with a Notch pathway inhibitor and immunotherapeutic agent in combination with a chemotherapeutic agent.
  • the method comprises administering to the patient the Notch pathway inhibitor and immunotherapeutic agent in combination with at least one additional therapeutic agent (e.g., a chemotherapeutic agent).
  • the invention provides a method for increasing the likelihood of effective treatment with a Notch pathway inhibitor in combination with a second agent, wherein the second agent is an immunotherapeutic agent, comprising: (a) identifying if a patient has a tumor that is likely to respond to treatment with a Notch pathway inhibitor and/or immunotherapeutic agent, wherein the identification comprises: (i) obtaining a sample from the patient; (ii) measuring the expression level of PD-L1 in the sample; and (iii) identifying the patient who is likely to respond to treatment based upon the expression level of the PD-L1; and (b) administering an effective amount of the Notch pathway inhibitor in combination with the immunotherapeutic agent to the patient.
  • the sample is a tumor sample.
  • the sample is a blood or plasma sample.
  • the method comprises identifying if a patient has a tumor that is likely to respond to treatment with a Notch pathway inhibitor in combination with a chemotherapeutic agent.
  • the method comprises administering to the patient the Notch pathway inhibitor and the immunotherapeutic agent in combination with at least one additional therapeutic agent (e.g., a chemotherapeutic agent).
  • the invention provides a method for increasing the likelihood of effective treatment with a Notch pathway inhibitor in combination with a second agent, wherein the second agent is an immunotherapeutic agent, comprising: administering an effective amount of a Notch pathway inhibitor and/or immunotherapeutic agent to a patient; wherein the patient is identified as likely to respond to treatment with the Notch pathway inhibitor and/or the immunotherapeutic agent based upon the expression level of PD-L1 in a sample.
  • the sample is a tumor sample.
  • the sample is a blood or plasma sample.
  • the patient is identified as likely to respond to treatment with a Notch pathway inhibitor in combination with a chemotherapeutic agent.
  • the method comprises administering to the patient the Notch pathway inhibitor and the immunotherapeutic agent in combination with at least one additional therapeutic agent (e.g., a chemotherapeutic agent).
  • the Notch pathway inhibitor is a DLL4 antagonist.
  • the DLL4 antagonist is an antibody that specifically binds human DLL4.
  • the antibody specifically binds the extracellular domain of human DLL4.
  • the antibody specifically binds an epitope within amino acids 27-217 of the extracellular domain of human DLL4 (SEQ ID NO:17).
  • the DLL4 antagonist binds an epitope comprising amino acids 66-73 (QAVVSPGP, SEQ ID NO:18) of human DLL4.
  • the DLL4 antagonist binds an epitope comprising amino acids 139-146 (LISKIAIQ, SEQ ID NO:19) of human DLL4. In some embodiments, the DLL4 antagonist binds an epitope comprising amino acids 66-73 (QAVVSPGP, SEQ ID NO:18) and amino acids 139-146 (LISKIAIQ, SEQ ID NO:19) of human DLL4. In some embodiments, the DLL4 antagonist binds human DLL4 with a dissociation constant (K D ) of about 10 nM to about 0.1 nM.
  • K D dissociation constant
  • the DLL4 antagonist is an antibody which comprises a heavy chain CDR1 comprising TAYYIH (SEQ ID NO:1), a heavy chain CDR2 comprising YISCYNGATNYNQKFKG (SEQ ID NO:2), YISSYNGATNYNQKFKG (SEQ ID NO:3), or YISVYNGATNYNQKFKG (SEQ ID NO:4), and a heavy chain CDR3 comprising RDYDYDVGMDY (SEQ ID NO:5); and/or a light chain CDR1 comprising RASESVDNYGISFMK (SEQ ID NO:6), a light chain CDR2 comprising AASNQGS (SEQ ID NO:7), and a light chain CDR3 comprising QQSKEVPWTFGG (SEQ ID NO:8).
  • a heavy chain CDR1 comprising TAYYIH (SEQ ID NO:1)
  • a heavy chain CDR2 comprising YISCYNGATNYNQKFKG (SEQ ID
  • the DLL4 antagonist is an antibody which comprises a heavy chain CDR1 comprising TAYYIH (SEQ ID NO:1), a heavy chain CDR2 comprising YISSYNGATNYNQKFKG (SEQ ID NO:3), and a heavy chain CDR3 comprising RDYDYDVGMDY (SEQ ID NO:5); and a light chain CDR1 comprising RASESVDNYGISFMK (SEQ ID NO:6), a light chain CDR2 comprising AASNQGS (SEQ ID NO:7), and a light chain CDR3 comprising QQSKEVPWTFGG (SEQ ID NO:8).
  • the DLL4 antagonist is an antibody comprising a heavy chain variable region having at least about 90%, at least about 95% or 100% sequence identity to SEQ ID NO:9, SEQ ID NO:10 or SEQ ID NO:11, and/or a light chain variable region having at least about 90%, at least about 95% or 100% sequence identity to SEQ ID NO:12.
  • the DLL4 antagonist is an antibody which comprises a heavy chain variable region comprising SEQ ID NO:10 and a light chain variable region comprising SEQ ID NO:12.
  • the DLL4 antagonist is the antibody encoded by the plasmid having ATCC deposit no. PTA-8425 which was deposited with the American Type Culture Collection (ATCC), at 10801 University Boulevard, Manassas, Va., 20110, under the conditions of the Budapest Treaty on May 10, 2007.
  • the DLL4 antagonist is the antibody encoded by the plasmid DNA having ATCC deposit no. PTA-8427 which was deposited with the ATCC under the conditions of the Budapest Treaty on May 10, 2007.
  • the DLL4 antagonist is an antibody comprising the CDRs of the antibody produced by the hybridoma having ATCC deposit no. PTA-8670 which was deposited with the ATCC under the conditions of the Budapest Treaty on Sep. 28, 2007.
  • the anti-DLL4 antibody is demcizumab (OMP-h21M18).
  • the DLL4 antagonist is a bispecific antibody which comprises a first antigen-binding site that specifically binds human VEGF, and a second antigen-binding site that specifically binds human DLL4, wherein the first antigen-binding site comprises a heavy chain CDR1 comprising NYWMH (SEQ ID NO:20), a heavy chain CDR2 comprising DINPSNGRTSYKEKFKR (SEQ ID NO:21), and a heavy chain CDR3 comprising HYDDKYYPLMDY (SEQ ID NO:22); wherein the second antigen-binding site comprises a heavy chain CDR1 comprising TAYYIH (SEQ ID NO:1), a heavy chain CDR2 comprising YISNYNRATNYNQKFKG (SEQ ID NO:25), and a heavy chain CDR3 comprising RDYDYDVGMDY (SEQ ID NO:5); and wherein both the first and second antigen-binding sites comprise a light chain CDR1 comprising RASESV
  • the DLL4 antagonist is a bispecific antibody which comprises a first heavy chain variable region of SEQ ID NO:30; a second heavy chain variable region of SEQ ID NO:29; and a first and a second light chain variable region of SEQ ID NO:12.
  • the DLL4 antagonist is a bispecific antibody which comprises a first heavy chain of SEQ ID NO:32; a second heavy chain of SEQ ID NO:31; and a first and a second light chain of SEQ ID NO:33.
  • the DLL4 antagonist is OMP-305B83.
  • the Notch pathway inhibitor is a Notch receptor antagonist.
  • the Notch receptor antagonist is an antibody that specifically binds human Notch2 and/or Notch3. In some embodiments, the antibody specifically binds the extracellular domain of human Notch2 and/or Notch3.
  • the Notch receptor antagonist is an antibody that specifically binds the extracellular domain of human Notch2 and/or Notch3 and comprises a heavy chain CDR1 comprising SSSGMS (SEQ ID NO:34), a heavy chain CDR2 comprising VIASSGSNTYYADSVKG (SEQ ID NO:35), and a heavy chain CDR3 comprising SIFYTT (SEQ ID NO:36), and/or a light chain CDR1 comprising RASQSVRSNYLA (SEQ ID NO:37), a light chain CDR2 comprising GASSRAT (SEQ ID NO:38), and a light chain CDR3 comprising QQYSNFPI (SEQ ID NO:39).
  • the Notch2/3 antagonist is an antibody which comprises a heavy chain CDR1 comprising SSSGMS (SEQ ID NO:34), a heavy chain CDR2 comprising VIASSGSNTYYADSVKG (SEQ ID NO:35), and a heavy chain CDR3 comprising SIFYTT (SEQ ID NO:36), and a light chain CDR1 comprising RASQSVRSNYLA (SEQ ID NO:37), a light chain CDR2 comprising GASSRAT (SEQ ID NO:38), and a light chain CDR3 comprising QQYSNFPI (SEQ ID NO:39).
  • the Notch receptor antagonist is an antibody comprising a heavy chain variable region having at least about 90%, at least about 95% or 100% sequence identity to SEQ ID NO:40, and/or a light chain variable region having at least about 90%, at least about 95% or 100% sequence identity to SEQ ID NO:41.
  • the Notch receptor antagonist is an antibody which comprises a heavy chain variable region comprising SEQ ID NO:40 and a light chain variable region comprising SEQ ID NO:41.
  • the Notch receptor antagonist is the antibody encoded by the plasmid DNA having ATCC deposit no. PTA-10170 which was deposited with the American Type Culture Collection (ATCC), at 10801 University Boulevard, Manassas, Va., 20110, under the conditions of the Budapest Treaty on Jul. 6, 2009.
  • the Notch receptor antagonist is the anti-Notch2/3 antibody tarextumab (OMP-59R5).
  • the Notch receptor antagonist is an antibody that specifically binds human Notch1.
  • the antibody specifically binds a non-ligand binding membrane proximal region of the extracellular domain of Notch1.
  • the antibody that specifically binds Notch1 comprises a heavy chain CDR1 comprising RGYWIE (SEQ ID NO:46), a heavy chain CDR2 comprising QILPGTGRTNYNEKFKG (SEQ ID NO:47), and a heavy chain CDR3 comprising FDGNYGYYAMDY (SEQ ID NO:48), and/or a light chain CDR1 comprising RSSTGAVTTSNYAN (SEQ ID NO:49), a light chain CDR2 comprising GTNNRAP (SEQ ID NO:50), and a light chain CDR3 comprising ALWYSNHWVFGGGTKL (SEQ ID NO:51).
  • the Notch receptor antagonist is an antibody which comprises a heavy chain CDR1 comprising RGYWIE (SEQ ID NO:46), a heavy chain CDR2 comprising QILPGTGRTNYNEKFKG (SEQ ID NO:47), and a heavy chain CDR3 comprising FDGNYGYYAMDY (SEQ ID NO:48), and a light chain CDR1 comprising RSSTGAVTTSNYAN (SEQ ID NO:49), a light chain CDR2 comprising GTNNRAP (SEQ ID NO:50), and a light chain CDR3 comprising ALWYSNHWVFGGGTKL (SEQ ID NO:51).
  • the Notch receptor antagonist is an antibody comprising a heavy chain variable region having at least about 90%, at least about 95% or 100% sequence identity to SEQ ID NO:52, and/or a light chain variable region having at least about 90%, at least about 95% or 100% sequence identity to SEQ ID NO:53.
  • the Notch receptor antagonist is an antibody which comprises a heavy chain variable region comprising SEQ ID NO:52 and a light chain variable region comprising SEQ ID NO:53.
  • the Notch receptor antagonist is the antibody encoded by the plasmid DNA having ATCC deposit no. PTA-9549 which was deposited with the American Type Culture Collection (ATCC), at 10801 University Boulevard, Manassas, Va., 20110, under the conditions of the Budapest Treaty on Oct. 15, 2008.
  • the Notch receptor antagonist is the anti-Notch1 antibody brontictuzumab (OMP-h52M51).
  • the Notch pathway inhibitor is an antibody.
  • the Notch pathway inhibitor is an antibody that specifically binds human DLL4.
  • the Notch pathway inhibitor is an antibody that specifically binds human Notch2 and/or Notch3.
  • the Notch pathway inhibitor is an antibody that specifically binds human Notch1.
  • the antibody is a recombinant antibody.
  • the antibody is a monoclonal antibody, a chimeric antibody, a humanized antibody, or a human antibody.
  • the antibody is an antibody fragment comprising an antigen-binding site.
  • the antibody or antibody fragment is monovalent, monospecific, bivalent, bispecific, or multispecific.
  • the antibody is an IgG1 antibody.
  • the antibody is an IgG2 antibody.
  • the antibody is an IgG4 antibody.
  • the antibody or antibody fragment is part of a bispecific agent.
  • the antibody or antibody fragment is part of a heterodimeric bispecific molecule.
  • the antibody or antibody fragment is part of a homodimeric bispecific molecule.
  • the antibody or antibody fragment is isolated. In other embodiments, the antibody or antibody fragment is substantially pure.
  • the immunotherapeutic agent is an agent that modulates immune responses.
  • the immunotherapeutic agent is an agent that enhances anti-tumor immune responses.
  • the immunotherapeutic agent is an agent that increases cell-mediated immunity.
  • the immunotherapeutic agent is an agent that increases T-cell activity.
  • the immunotherapeutic agent is an agent that increases cytolytic T-cell (CTL) activity.
  • the immunotherapeutic agent is an agent that increases NK cell activity.
  • the immunotherapeutic agent is an agent that inhibits suppression of an immune response.
  • the immunotherapeutic agent is an agent that inhibits suppressor cells or suppressor cell activity. In some embodiments, the immunotherapeutic agent is an agent that inhibits Treg activity. In some embodiments, the immunotherapeutic agent is an agent that inhibits MDSC activity. In some embodiments, the immunotherapeutic agent is an agent that inhibits the activity of inhibitory immune checkpoint receptors. In some embodiments, the immunotherapeutic agent is an agent that inhibits the activity of PD-1. In some embodiments, the immunotherapeutic agent is an agent that inhibits the activity of PD-L1 and/or PD-L2. In some embodiments, the immunotherapeutic agent is an agent that inhibits the activity of CTLA-4.
  • the immunotherapeutic agent is an agent that inhibits the activity of CD80 and/or CD86. In some embodiments, the immunotherapeutic agent is an agent that inhibits the activity of TIGIT. In some embodiments, the immunotherapeutic agent is an agent that inhibits the activity of KIR. In some embodiments, the immunotherapeutic agent is an agent that inhibits the activity of IDO1. In some embodiments, the immunotherapeutic agent is an agent that enhances or stimulates the activity of activating immune checkpoint receptors. In some embodiments, the immunotherapeutic agent is an agent that enhances or stimulates the activity of GITR. In some embodiments, the immunotherapeutic agent is an agent that enhances or stimulates the activity of OX40. In some embodiments, the immunotherapeutic agent is an agent that enhances or stimulates the activity of CD40.
  • the immunotherapeutic agent is a PD-1 antagonist, a PD-L1 antagonist, a PD-L2 antagonist, a CTLA-4 antagonist, a CD80 antagonist, a CD86 antagonist, a TIGIT antagonist, a KIR antagonist, a Tim-3 antagonist, a LAG3 antagonist, a CD96 antagonist, a CD20 antagonist, or an IDO1 antagonist.
  • the PD-1 antagonist is an antibody that specifically binds PD-1.
  • the antibody that binds PD-1 is pembrolizumab (KEYTRUDA; MK-3475), pidilizumab (CT-011), or nivolumab (OPDIVO; BMS-936558).
  • the PD-L1 antagonist is an antibody that specifically binds PD-L1.
  • the antibody that binds PD-L1 is RG7446 (MPDL3280A), durvalumab (MEDI4736), or BMS-936559.
  • the CTLA-4 antagonist is an antibody that specifically binds CTLA-4.
  • the antibody that binds CTLA-4 is ipilimumab (YERVOY) or tremelimumab (CP-675,206).
  • the KIR antagonist is an antibody that specifically binds KIR.
  • the antibody that binds KIR is lirilumab.
  • the immunotherapeutic agent is a CD28 agonist, a 4-1BB agonist, an OX40 agonist, a CD27 agonist, a CD80 agonist, a CD86 agonist, a CD40 agonist, or a GITR agonist.
  • the immunotherapeutic agent is a cytokine.
  • the cytokine is a chemokine, an interferon, an interleukin, lymphokine, or a member of the tumor necrosis factor family.
  • the cytokine is IL-2, IL-15, or interferon-gamma.
  • a method comprises administering at least one additional therapeutic agent.
  • the at least one additional therapeutic agent is a chemotherapeutic agent.
  • a method comprises administering an antibody that specifically binds human DLL4 in combination with an antibody that specifically binds human PD-1.
  • a method comprises administering demcizumab in combination with pembrolizumab.
  • a method comprises administering demcizumab in combination with pembrolizumab and at least one chemotherapeutic agent.
  • a method comprises administering demcizumab in combination with pembrolizumab, carboplatin, and pemetrexed.
  • a method comprises administering a bispecific antibody that specifically binds human DLL4 and human VEGF in combination with an antibody that specifically binds human PD-1. In some embodiments, a method comprises administering OMP-305B83 in combination with pembrolizumab. In some embodiments, a method comprises administering OMP-305B83 in combination with pembrolizumab and at least one chemotherapeutic agent. In some embodiments, a method comprises administering OMP-305B83 in combination with pembrolizumab, carboplatin, and pemetrexed.
  • the cancer is a cancer selected from the group consisting of lung cancer, pancreatic cancer, breast cancer, colon cancer, colorectal cancer, melanoma, gastrointestinal cancer, gastric cancer, renal cancer, ovarian cancer, liver cancer, endometrial cancer, kidney cancer, prostate cancer, thyroid cancer, neuroblastoma, glioma, glioblastoma, glioblastoma multiforme, cervical cancer, stomach cancer, bladder cancer, head and neck cancer, and hepatoma.
  • the cancer is lung cancer.
  • a cancer or cancer cell expresses PD-L1.
  • a cancer or cancer cell over-expresses PD-L1. In some embodiments, a cancer or cancer cell expresses PD-L2. In some embodiments, a cancer or cancer cell over-expresses PD-L2. In some embodiments, a cancer or cancer cell has an increased level of PD-L1 expression as compared to a pre-determined level of PD-L1 expression.
  • the tumor is a tumor selected from the group consisting of lung tumor, pancreatic tumor, breast tumor, colon tumor, colorectal tumor, melanoma, gastrointestinal tumor, gastric tumor, renal tumor, ovarian tumor, liver tumor, endometrial tumor, kidney tumor, prostate tumor, thyroid tumor, neuroblastoma, glioma, glioblastoma, glioblastoma multiforme, cervical tumor, stomach tumor, bladder tumor, head and neck tumor, and hepatoma.
  • the tumor is a lung tumor.
  • a tumor expresses PD-L1.
  • a tumor over-expresses PD-L1. In some embodiments, a tumor expresses PD-L2. In some embodiments, a tumor over-expresses PD-L2. In some embodiments, a tumor has an increased level of PD-L1 expression as compared to a pre-determined level of PD-L1 expression.
  • the methods further comprise administering at least one additional therapeutic agent.
  • the additional therapeutic agent is a chemotherapeutic agent.
  • the additional therapeutic agent is an antibody.
  • a method comprises obtaining a sample from the subject or patient.
  • the sample is a biopsy sample.
  • the sample is from a tumor.
  • the sample comprises tumor cells, tumor infiltrating immune cells, stromal cells, and any combinations thereof.
  • the sample is a formalin-fixed paraffin embedded (FFPE) sample.
  • the sample is archival, fresh, or frozen tissue.
  • the sample is blood or plasma.
  • the expression level of PD-L1 in the sample is compared to a pre-determined expression level of PD-L1.
  • the pre-determined expression level of PD-L1 expression is an expression level of PD-L1 in a reference sample, a reference tumor sample, a reference normal tissue sample, a series of reference tumor samples, or a series of reference normal tissue samples.
  • the expression level of PD-L1 is determined using an immunohistochemistry (IHC) assay.
  • the expression level of PD-L1 is determined using an assay which comprises an H-score evaluation.
  • the expression level of PD-L1 is determined using an ELISA.
  • the expression level of PD-L1 is determined using an antibody that specifically binds PD-L1.
  • PD-L1 is detected on tumor cells.
  • PD-L1 is detected on tumor infiltrating immune cells. In some embodiments, the expression level of PD-L1 is determined using a PCR-based assay. In some embodiments, PD-L1 is detected in a cell lysate.
  • compositions which comprise a Notch pathway inhibitor (e.g., a DLL4 antagonist or a Notch receptor antagonist) described herein and a pharmaceutically acceptable vehicle used in combination with pharmaceutical compositions which comprise an immunotherapeutic agent described herein and a pharmaceutically acceptable vehicle.
  • a Notch pathway inhibitor e.g., a DLL4 antagonist or a Notch receptor antagonist
  • the present invention encompasses not only the entire group listed as a whole, but also each member of the group individually and all possible subgroups of the main group, and also the main group absent one or more of the group members.
  • the present invention also envisages the explicit exclusion of one or more of any of the group members in the claimed invention.
  • FIGS. 1A and 1B Effect of anti-DLL4 antibody on PD-1 expression in cells from CT26.WT tumors.
  • FIG. 1A PD-1 level in tumor cell lysates from mice treated with anti-mDLL4 antibody 21R30, SIRP ⁇ -Fc protein, or control.
  • FIG. 1B A representative Western blot analysis from four individual tumors of each treatment group.
  • FIGS. 2A, 2B, and 2C Inhibition of tumor growth.
  • FIG. 2A and FIG. 2B CT26.WT tumor cells were injected subcutaneously into Balb/C mice. Mice were treated with anti-mDLL4 antibody 21R30 (- ⁇ -), mIL-2-Fc (- ⁇ -), a combination of anti-mDLL4 antibody 21R30 and mIL-2-Fc (—X—), or a control (- ⁇ -). Data is shown as tumor volume (mm 3 ) over days post-treatment.
  • FIG. 2C KP_LUN01 tumor cells were injected subcutaneously into Balb/C mice.
  • mice were treated with anti-mDLL4 antibody 21R30 (- ⁇ -), mIL-2-Fc (- ⁇ -), a combination of anti-mDLL4 antibody 21R30 and mIL-2-Fc (—X—), or a control (- ⁇ -). Data is shown as tumor volume (mm 3 ) over days post-treatment.
  • FIGS. 3A, 3B, and 3C NK cell cytotoxicity assays.
  • FIG. 3A and FIG. 3B Cells were harvested from the spleens of CT26.WT-tumor bearing mice treated with anti-mDLL4 antibody 21R30, mIL-2-Fc, a combination of anti-mDLL4 antibody 21R30 and mIL-2-Fc, or a control.
  • Target cells YAC-1 cells or CT26.WT cells
  • FIG. 3C Cells were harvested from the spleens of KP_LUN01-tumor bearing mice treated with anti-mDLL4 antibody 21R30, mIL-2-Fc, a combination of anti-mDLL4 antibody 21R30 and mIL-2-Fc, or a control.
  • Target cells YAC-1 cells
  • YAC-1 cells were labeled with 10 ⁇ M calcein AM and mixed with the splenocytes at an effector:target ratio of 25:1.
  • Supernatants were harvested and calcein release was quantified on a fluorometer at an excitation of 485 nm and an emission of 535 nm.
  • FIGS. 4A and 4B T-cell cytotoxicity assays.
  • FIG. 4A Cells were harvested from the spleens of CT26.WT-tumor bearing mice treated with anti-mDLL4 antibody 21R30, mIL-2-Fc, a combination of anti-mDLL4 antibody 21R30 and mIL-2-Fc, or a control. The splenocytes were stimulated with the AH-1 peptide. Target cells (CT26.WT cells) were labeled with 10 ⁇ M calcein AM and mixed with the stimulated splenocytes.
  • FIG. 4B Cells were harvested from the spleens of KP_LUN01-tumor bearing mice treated with anti-mDLL4 antibody 21R30, mIL-2-Fc, a combination of anti-mDLL4 antibody 21R30 and mIL-2-Fc, or a control.
  • the splenocytes were stimulated with mitomycin-treated KP_LUN01 cells.
  • Target cells were labeled with 10 ⁇ M calcein AM and mixed with the stimulated splenocytes.
  • Supernatants were harvested and calcein release was quantified on a fluorometer at an excitation of 485 nm and an emission of 535 nm.
  • FIG. 5 ELISpot assay for IFN-gamma.
  • Cells were harvested from the spleens of CT26.WT-tumor bearing mice treated with anti-mDLL4 antibody 21R30, mIL-2-Fc, a combination of anti-mDLL4 antibody 21R30 and mIL-2-Fc, or a control. The number of cells producing IFN-gamma is shown.
  • FIG. 6 CD45 + PD-1 + cells in CT26.WT tumors. Tumors were harvested from mice treated with anti-mDLL4 antibody 21R30, mIL-2-Fc, a combination of anti-mDLL4 antibody 21R30 and mIL-2-Fc, or a control and single cell suspensions were prepared. Cells were analyzed for CD45 expression and PD-1 expression by FACS analysis.
  • FIGS. 7A, 7B and 7C Inhibition of CT26.WT tumor growth.
  • FIG. 7A CT26.WT tumor cells were injected subcutaneously into Balb/C mice. Mice were treated with anti-mDLL4 antibody 21R30 (- ⁇ -), an anti-PD-L1 antibody (—X—), an anti-CTLA-4 antibody (- ⁇ -), a combination of anti-mDLL4 antibody 21R30 and an anti-CTLA-4 antibody (—X—), a combination of anti-mDLL4 antibody 21R30 and an anti-PD-L1 antibody (- ⁇ -), or a control (- ⁇ -). Data is shown as tumor volume (mm 3 ) over days post-treatment.
  • FIGS. 7B and 7C Results from individual mice from each treatment group.
  • FIGS. 8A and 8B Inhibition of CT26.WT tumor growth.
  • FIG. 8A CT26.WT tumor cells were injected subcutaneously into Balb/C mice. Mice were treated with anti-mDLL4 antibody 21R30 (- ⁇ -), an anti-PD-1 antibody (- ⁇ -), a combination of anti-mDLL4 antibody 21R30 and an anti-PD-1 antibody (- ⁇ -), or a control (- ⁇ -). Data is shown as tumor volume (mm 3 ) over days post-cell injection.
  • FIG. 8B Results from individual mice from each treatment group.
  • FIG. 9 CT26.WT tumor growth in treated mice after rechallenge with tumor.
  • Mice previously treated with anti-PD-1 antibody (- ⁇ -) or a combination of anti-mDLL4 antibody 21R30 and an anti-PD-1 antibody (- ⁇ -) whose tumors had regressed to undetectable levels were rechallenged with CT26.WT tumor cells.
  • Data is shown as tumor volume (mm 3 ) over days post-rechallenge.
  • FIGS. 10A, 10B, 10C, and 10D ELISpot and ELISA assays.
  • Cells were harvested from the spleens of CT26.WT-tumor bearing mice treated with anti-mDLL4 antibody 21R30, an anti-PD-1 antibody, a combination of anti-mDLL4 antibody 21R30 and an anti-PD-1 antibody, or a control antibody.
  • FIG. 10A The number of cells producing IFN-gamma is shown.
  • FIG. 10B The number of cells producing IL-2 is shown.
  • FIG. 10C The number of cells producing IL-17 is shown.
  • FIG. 10D The amount of IL-6 produced is shown.
  • FIG. 11 FACS analysis of myeloid-derived suppressor cells and activated myeloid cells.
  • FIG. 12 FACS analysis of memory T-cells.
  • FIG. 13 Regulatory T-cell (Treg) assay.
  • FIG. 14 CD8 + T-cell cytotoxicity assay.
  • FIGS. 15A and 15B Inhibition of CT26.WT tumor growth and inhibition of Renca tumor growth.
  • FIG. 15A CT26.WT tumor cells were injected subcutaneously into Balb/C mice. Mice were treated with an anti-PD-1 antibody (- ⁇ -), a combination of anti-mDLL4 antibody 21R30 and an anti-mVEGF antibody (- ⁇ -), a combination of anti-mDLL4 antibody 21R30, an anti-mVEGF antibody, and an anti-PD-1 antibody (—X—), or a control (- ⁇ -). Data is shown as tumor volume (mm 3 ) over days post-cell injection.
  • FIG. 15B Renca tumor cells were injected subcutaneously into Balb/C mice.
  • mice were treated with an anti-PD-1 antibody (- ⁇ -), a combination of anti-mDLL4 antibody 21R50 and anti-mVEGF antibody B20 (—X—), a combination of anti-mDLL4 antibody 21R50, anti-mVEGF antibody B20, and an anti-PD-1 antibody (- ⁇ -), or a control (- ⁇ -).
  • Data is shown as tumor volume (mm 3 ) over days post-cell injection.
  • FIG. 16 FACS analysis of central memory CD4+ and CD8+ T-cells.
  • FIGS. 17A and 17B Cytokine expression at tumor site.
  • FIG. 18 Inhibition of CT26.WT tumor growth.
  • CT26.WT tumor cells were injected subcutaneously into Balb/C mice. Mice were treated with anti-Notch2/3 antibody 59R5 (- ⁇ -), an anti-PD-1 antibody (- ⁇ -), a combination of anti-Notch2/3 antibody 59R5 and an anti-PD-1 antibody (- ⁇ -), or a control (- ⁇ -). Data is shown as tumor volume (mm 3 ) over days post-cell injection.
  • the present invention provides methods of modulating immune responses, particularly anti-tumor immune responses, methods of inhibiting tumor growth, and methods of treating cancer.
  • the methods provided herein comprise administering to a subject a therapeutically effective amount of a Notch pathway inhibitor in combination with a therapeutically effective amount of a second agent, wherein the second agent is an immunotherapeutic agent.
  • the Notch pathway inhibitor is a DLL4 antagonist.
  • the Notch pathway inhibitor is an antibody that specifically binds human DLL4.
  • the Notch pathway inhibitor is a Notch receptor antagonist.
  • the Notch pathway inhibitor is an antibody that specifically binds human Notch2 and/or Notch3.
  • the Notch pathway inhibitor is an antibody that specifically binds human Notch1.
  • the immunotherapeutic agent includes but is not limited to, a modulator of PD-1 activity, a modulator of PD-L1 activity, a modulator of PD-L2 activity, a modulator of CTLA-4 activity, a modulator of CD28 activity, a modulator of CD80 activity, a modulator of CD86 activity, a modulator of 4-1BB activity, an modulator of OX40 activity, a modulator of KIR activity, a modulator of Tim-3 activity, a modulator of LAG3 activity, a modulator of CD27 activity, a modulator of CD40 activity, a modulator of GITR activity, a modulator of TIGIT activity, a modulator of CD20 activity, a modulator of CD96 activity, a modulator of IDO1 activity, a cytokine, a chemokine, an interferon, an interleukin, a lymphokine,
  • the invention also provides methods of identifying a tumor likely to be responsive to treatment with a Notch pathway inhibitor in combination with an immunotherapeutic agent, the method comprising determining the expression level of PD-L1 in a sample obtained from the tumor.
  • the invention provides methods of selecting a subject or patient for treatment with a Notch pathway inhibitor in combination with an immunotherapeutic agent, the method comprising determining the expression level of PD-L1 in a sample obtained from the subject.
  • antagonists refer to any molecule that partially or fully blocks, inhibits, reduces, or neutralizes a biological activity of a target and/or signaling pathway.
  • antagonists include any molecule that partially or fully blocks, inhibits, reduces, or neutralizes the activity of a protein.
  • Suitable antagonist molecules include, but are not limited to, antagonist antibodies, antibody fragments, soluble receptors, and small molecules.
  • agonist and “agonistic” as used herein refer to or describe an agent that is capable of, directly or indirectly, substantially inducing, activating, promoting, increasing, or enhancing the biological activity of a target and/or a signaling pathway.
  • agonist is used herein to include any agent that partially or fully induces, activates, promotes, increases, or enhances the activity of a protein. Suitable agonists specifically include, but are not limited to, agonist antibodies or fragments thereof, soluble receptors, other fusion proteins, and small molecules.
  • biomarker may include but is not limited to, nucleic acids and proteins, and variants and fragments thereof.
  • a biomarker may include DNA comprising the entire or partial nucleic acid sequence encoding the biomarker, or the complement of such a sequence.
  • Biomarker nucleic acids useful in the invention are considered to include both DNA and RNA comprising the entire or partial sequence of any of the nucleic acid sequences of interest.
  • Biomarker proteins are considered to comprise the entire or partial amino acid sequence of any of the biomarker proteins or polypeptides.
  • antibody refers to an immunoglobulin molecule that recognizes and specifically binds a target, such as a protein, polypeptide, peptide, carbohydrate, polynucleotide, lipid, or combinations of the foregoing, through at least one antigen-binding site within the variable region of the immunoglobulin molecule.
  • the term encompasses intact polyclonal antibodies, intact monoclonal antibodies, antibody fragments comprising an antigen-binding site (such as Fab, Fab′, F(ab′)2, and Fv fragments), single chain Fv (scFv) antibodies, multispecific antibodies such as bispecific antibodies, monospecific antibodies, monovalent antibodies, chimeric antibodies, humanized antibodies, human antibodies, fusion proteins comprising an antigen-binding site of an antibody, and any other modified immunoglobulin molecule comprising an antigen-binding site as long as the antibodies exhibit the desired biological activity.
  • an antigen-binding site such as Fab, Fab′, F(ab′)2, and Fv fragments
  • scFv single chain Fv antibodies
  • multispecific antibodies such as bispecific antibodies, monospecific antibodies, monovalent antibodies, chimeric antibodies, humanized antibodies, human antibodies, fusion proteins comprising an antigen-binding site of an antibody, and any other modified immunoglobulin molecule comprising an antigen-binding site as long as the antibodies
  • An antibody can be any of the five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, or subclasses (isotypes) thereof (e.g., IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2), based on the identity of their heavy-chain constant domains referred to as alpha, delta, epsilon, gamma, and mu, respectively.
  • the different classes of immunoglobulins have different and well-characterized subunit structures and three-dimensional configurations.
  • Antibodies can be naked or conjugated to other molecules, including but not limited to, toxins and radioisotopes.
  • antibody fragment refers to a portion of an intact antibody and generally includes the antigenic determining variable region or antigen-binding site of an intact antibody.
  • antibody fragments include, but are not limited to, Fab, Fab′, F(ab′)2, and Fv fragments, linear antibodies, single chain antibodies, and multispecific antibodies formed from antibody fragments.
  • Antibody fragment as used herein comprises at least one antigen-binding site or epitope-binding site.
  • variable region of an antibody refers to the variable region of the antibody light chain, or the variable region of the antibody heavy chain, either alone or in combination.
  • the variable region of the heavy or light chain generally consists of four framework regions connected by three complementarity determining regions (CDRs), also known as “hypervariable regions”.
  • CDRs complementarity determining regions
  • the CDRs in each chain are held together in close proximity by the framework regions and, with the CDRs from the other chain, contribute to the formation of the antigen-binding site of the antibody.
  • CDRs There are at least two techniques for determining CDRs: (1) an approach based on cross-species sequence variability (i.e., Kabat et al., 1991 , Sequences of Proteins of Immunological Interest, 5 th Edition , National Institutes of Health, Bethesda Md.), and (2) an approach based on crystallographic studies of antigen-antibody complexes (Al-Lazikani et al., 1997 , J. Mol. Biol., 273:927-948). Combinations of these two approaches are sometimes used in the art to determine CDRs.
  • the term “monoclonal antibody” as used herein refers to a homogenous antibody population involved in the highly specific recognition and binding of a single antigenic determinant or epitope. This is in contrast to polyclonal antibodies that typically include a mixture of different antibodies directed against different antigenic determinants.
  • the term “monoclonal antibody” encompasses both intact and full-length antibodies as well as antibody fragments (e.g., Fab, Fab′, F(ab′)2, Fv), single chain (scFv) antibodies, fusion proteins comprising an antibody portion, and any other modified immunoglobulin molecule comprising at least one antigen-binding site.
  • “monoclonal antibody” refers to such antibodies made by any number of techniques, including but not limited to, hybridoma production, phage selection, recombinant expression, and transgenic animals.
  • humanized antibody refers to antibodies that are specific immunoglobulin chains, chimeric immunoglobulins, or fragments thereof that contain minimal non-human sequences.
  • humanized antibodies are human immunoglobulins in which amino acid residues of the CDRs are replaced by amino acid residues from the CDRs of a non-human species (e.g., mouse, rat, rabbit, or hamster) that have the desired specificity, affinity, and/or binding capability.
  • human antibody refers to an antibody produced by a human or an antibody having an amino acid sequence corresponding to an antibody produced by a human made using any of the techniques known in the art.
  • chimeric antibody refers to an antibody wherein the amino acid sequence of the immunoglobulin molecule is derived from two or more species.
  • the variable region of both light and heavy chains corresponds to the variable region of antibodies derived from one species of mammals (e.g., mouse, rat, rabbit, etc.) with the desired specificity, affinity, and/or binding capability, while the constant regions are homologous to the sequences in antibodies derived from another species (usually human).
  • affinity-matured antibody refers to an antibody with one or more alterations in one or more CDRs that result in an improvement in the affinity of the antibody for antigen, compared to a parent antibody that does not possess those alterations(s). In some instances, alterations are made in the framework regions. Preferred affinity-matured antibodies will have nanomolar or even picomolar affinities for the target antigen. Affinity-matured antibodies are produced by procedures known in the art including heavy chain and light chain variable region shuffling, random mutagenesis of CDR and/or framework residues, or site-directed mutagenesis of CDR and/or framework residues.
  • epitopes and “antigenic determinant” are used interchangeably herein and refer to that portion of an antigen capable of being recognized and specifically bound by a particular antibody.
  • the antigen is a polypeptide
  • epitopes can be formed both from contiguous amino acids and non-contiguous amino acids juxtaposed by tertiary folding of a protein.
  • Epitopes formed from contiguous amino acids also referred to as linear epitopes
  • epitopes formed by tertiary folding also referred to as conformational epitopes
  • An epitope typically includes at least 3, and more usually, at least 5, or 8-10 amino acids in a unique spatial conformation.
  • selectively binds or “specifically binds” as used herein mean that a binding agent or an antibody reacts or associates more frequently, more rapidly, with greater duration, with greater affinity, or with some combination of the above to the epitope, protein, or target molecule than with alternative substances, including unrelated or related proteins.
  • specifically binds means, for instance, that an antibody binds a target with a K D of about 0.1 mM or less, but more usually less than about 1 ⁇ M.
  • “specifically binds” means that an antibody binds a target with a K D of at least about 0.1 ⁇ M or less, at least about 0.01 ⁇ M or less, or at least about 1 nM or less. Because of the sequence identity between homologous proteins in different species, specific binding can include an antibody that recognizes a protein in more than one species. Likewise, because of homology within certain regions of polypeptide sequences of different proteins, specific binding can include an antibody (or other polypeptide or binding agent) that recognizes more than one protein. It is understood that, in certain embodiments, an antibody or binding agent that specifically binds a first target may or may not specifically bind a second target.
  • an antibody may, in certain embodiments, specifically bind more than one target.
  • multiple targets may be bound by the same antigen-binding site on the antibody.
  • an antibody may, in certain instances, comprise two identical antigen-binding sites, each of which specifically binds the same epitope on two or more proteins.
  • an antibody may be bispecific and comprise at least two antigen-binding sites with differing specificities. Generally, but not necessarily, reference to binding means specific binding.
  • soluble receptor refers to an extracellular fragment (or a portion thereof) of a receptor protein preceding the first transmembrane domain of the receptor that can be secreted from a cell in soluble form.
  • polypeptide and “peptide” and “protein” are used interchangeably herein and refer to polymers of amino acids of any length.
  • the polymer may be linear or branched, it may comprise modified amino acids, and it may be interrupted by non-amino acids.
  • the terms also encompass an amino acid polymer that has been modified naturally or by intervention; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation or modification, such as conjugation with a labeling component.
  • polypeptides containing one or more analogs of an amino acid including, for example, unnatural amino acids
  • the polypeptides of this invention may be based upon antibodies, in certain embodiments, the polypeptides can occur as single chains or associated chains.
  • amino acid refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function similarly to the naturally occurring amino acids.
  • Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, gamma-carboxyglutamate, and O-phosphoserine.
  • amino acid analog refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, e.g., an alpha carbon that is bound to an hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs can have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid.
  • amino acid mimetic refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that function similarly to a naturally occurring amino acid.
  • nucleotide and “nucleic acid” and “nucleotide sequence” are used interchangeably herein and refer to polymers of nucleotides of any length, and include DNA and RNA.
  • the nucleotides can be deoxyribonucleotides, ribonucleotides, modified nucleotides or bases, and/or their analogs, or any substrate that can be incorporated into a polymer by DNA or RNA polymerase.
  • nucleic acids or polypeptides refer to two or more sequences or subsequences that are the same or have a specified percentage of nucleotides or amino acid residues that are the same, when compared and aligned (introducing gaps, if necessary) for maximum correspondence, not considering any conservative amino acid substitutions as part of the sequence identity.
  • the percent identity may be measured using sequence comparison software or algorithms or by visual inspection. Various algorithms and software that may be used to obtain alignments of amino acid or nucleotide sequences are well-known in the art.
  • two nucleic acids or polypeptides of the invention are substantially identical, meaning they have at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, and in some embodiments at least 95%, 96%, 97%, 98%, 99% nucleotide or amino acid residue identity, when compared and aligned for maximum correspondence, as measured using a sequence comparison algorithm or by visual inspection.
  • identity exists over a region of the sequences that is at least about 10, at least about 20, at least about 40-60, at least about 60-80 nucleotides or amino acid residues in length or any integral value therebetween. In some embodiments, identity exists over a longer region than 60-80 nucleotides or amino acid residues, such as at least about 80-100 nucleotides or amino acid residues, and in some embodiments the sequences are substantially identical over the full length of the sequences being compared, such as the coding region of a nucleotide sequence.
  • conservative amino acid substitution refers to a substitution in which one amino acid residue is replaced with another amino acid residue having a similar side chain.
  • Families of amino acid residues having similar side chains have been defined in the art, including basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), non-polar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
  • basic side chains e
  • substitution of a phenylalanine for a tyrosine is a conservative substitution.
  • conservative substitutions in the sequences of the polypeptides and antibodies of the invention do not abrogate the binding of the polypeptide or antibody containing the amino acid sequence to the antigen(s).
  • Methods of identifying amino acid conservative substitutions which do not eliminate antigen binding are well-known in the art.
  • vector means a construct, which is capable of delivering, and usually expressing, one or more gene(s) or sequence(s) of interest in a host cell.
  • vectors include, but are not limited to, viral vectors, naked DNA or RNA expression vectors, plasmid, cosmid, or phage vectors, DNA or RNA expression vectors associated with cationic condensing agents, and DNA or RNA expression vectors encapsulated in liposomes.
  • a polypeptide, antibody, polynucleotide, vector, cell, or composition which is “isolated” is a polypeptide, antibody, polynucleotide, vector, cell, or composition which is in a form not found in nature.
  • Isolated polypeptides, antibodies, polynucleotides, vectors, cells, or compositions include those which have been purified to a degree that they are no longer in a form in which they are found in nature.
  • a polypeptide, antibody, polynucleotide, vector, cell, or composition which is isolated is substantially pure.
  • substantially pure refers to material which is at least 50% pure (i.e., free from contaminants), at least 90% pure, at least 95% pure, at least 98% pure, or at least 99% pure.
  • cancer and “cancerous” as used herein refer to or describe the physiological condition in mammals in which a population of cells is characterized by unregulated cell growth.
  • examples of cancer include, but are not limited to, carcinoma, blastoma, sarcoma, and hematologic cancers such as lymphoma and leukemia.
  • proliferative disorder and “proliferative disease” as used herein refer to disorders associated with abnormal cell proliferation such as cancer.
  • tumor and “neoplasm” as used herein refer to any mass of tissue that results from excessive cell growth or proliferation, either benign (non-cancerous) or malignant (cancerous), including pre-cancerous lesions.
  • metalastasis refers to the process by which a cancer spreads or transfers from the site of origin to other regions of the body with the development of a similar cancerous lesion at the new location.
  • a “metastatic” or “metastasizing” cell is generally one that loses adhesive contacts with neighboring cells and migrates from the primary site of disease to invade neighboring tissue sites.
  • cancer stem cell and “CSC” and “tumor stem cell” and “tumor initiating cell” are used interchangeably herein and refer to cells from a cancer or tumor that: (1) have extensive proliferative capacity; 2) are capable of asymmetric cell division to generate one or more types of differentiated cell progeny wherein the differentiated cells have reduced proliferative or developmental potential; and (3) are capable of symmetric cell divisions for self-renewal or self-maintenance.
  • CSC cancer stem cell
  • tumor stem cell undergo self-renewal versus differentiation in a chaotic manner to form tumors with abnormal cell types that can change over time as mutations occur.
  • cancer cell and “tumor cell” as used herein refer to the total population of cells derived from a cancer or tumor or pre-cancerous lesion, including both non-tumorigenic cells, which comprise the bulk of the cancer cell population, and tumorigenic cells (cancer stem cells).
  • cancer stem cells tumorigenic cells
  • subject refers to any animal (e.g., a mammal), including, but not limited to, humans, non-human primates, canines, felines, rodents, and the like, which is to be the recipient of a particular treatment.
  • subject and patient are used interchangeably herein in reference to a human subject.
  • pharmaceutically acceptable refers to an agent, compound, molecule, etc. approved or approvable by a regulatory agency of the Federal government, a state government, and/or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in animals, including humans.
  • phrases “pharmaceutically acceptable excipient, carrier or adjuvant” and “acceptable pharmaceutical carrier” refer to an excipient, carrier, or adjuvant that can be administered to a subject, together with a therapeutic agent, and which does not destroy the pharmacological activity thereof and is nontoxic when administered in doses sufficient to deliver a therapeutic effect.
  • pharmaceutically acceptable excipient, carrier, or adjuvant to be an inactive ingredient of any formulation or pharmaceutical composition.
  • an effective amount and “therapeutically effective amount” and “therapeutic effect” as used herein refer to an amount of a binding agent, an antibody, a polypeptide, a polynucleotide, a small molecule, or other therapeutic agent effective to “treat” a disease or disorder in a subject or mammal.
  • the therapeutically effective amount of an agent has a therapeutic effect and as such can boost the immune response, boost the anti-tumor response, increase cytolytic activity of immune cells, reduce the number of cancer cells; decrease tumorigenicity, tumorigenic frequency, or tumorigenic capacity; reduce the number or frequency of cancer stem cells; reduce tumor size; reduce the cancer cell population; inhibit and/or stop cancer cell infiltration into peripheral organs including, for example, the spread of cancer into soft tissue and bone; inhibit and stop tumor or cancer cell metastasis; inhibit and/or stop tumor or cancer cell growth; relieve to some extent one or more of the symptoms associated with the cancer; reduce morbidity and mortality; improve quality of life; or a combination of such effects.
  • an agent prevents growth and/or kills existing cancer cells, it can be referred to as cytostatic and/or cytotoxic.
  • treating and “treatment” and “to treat” and “alleviating” and “to alleviate” refer to both 1) therapeutic measures that cure, slow down, lessen symptoms of, and/or halt progression of a diagnosed pathologic condition or disorder and 2) prophylactic or preventative measures that prevent or slow the development of a targeted pathologic condition or disorder.
  • those in need of treatment include those who already have a disorder; those prone to have a disorder; and those in whom a disorder is to be prevented.
  • a subject is successfully “treated” according to the methods of the present invention if the patient shows one or more of the following: an increased immune response, an increased anti-tumor response, increased cytolytic activity of immune cells, increased killing of tumor cells by immune cells, a reduction in the number of or complete absence of cancer cells; a reduction in tumor size; inhibition of or an absence of cancer cell infiltration into peripheral organs including the spread of cancer cells into soft tissue and bone; inhibition of or an absence of tumor or cancer cell metastasis; inhibition or an absence of cancer growth; inhibition or an absence of tumor growth; relief of one or more symptoms associated with the specific cancer; reduced morbidity and mortality; improvement in quality of life; reduction in tumorigenicity; reduction in the number or frequency of cancer stem cells; or some combination of effects.
  • a Notch pathway inhibitor described herein in combination with a second agent, wherein the second agent is an immunotherapeutic agent is useful in a variety of applications including, but not limited to, therapeutic treatment methods, such as immunotherapy for cancer.
  • the combination of a Notch pathway inhibitor (e.g., a DLL4 antagonist or a Notch receptor antagonist) with a second agent, wherein the second agent is an immunotherapeutic agent is useful for activating, promoting, increasing, and/or enhancing an immune response, inhibiting tumor growth, reducing tumor volume, increasing tumor cell apoptosis, and/or reducing the tumorigenicity of a tumor.
  • the methods of use may be in vitro, ex vivo, or in vivo methods.
  • the combination of a Notch pathway inhibitor (e.g., a DLL4 antagonist or a Notch receptor antagonist) with an immunotherapeutic agent acts as an agonist of an immune response.
  • the combination of a Notch pathway inhibitor (e.g., a DLL4 antagonist or a Notch receptor antagonist) with an immunotherapeutic agent acts as an enhancer, activator, or stimulator of an immune response.
  • the combination of a Notch pathway inhibitor (e.g., a DLL4 antagonist or a Notch receptor antagonist) with an immunotherapeutic agent acts as an agonist of an anti-tumor immune response.
  • the combination of a Notch pathway inhibitor (e.g., a DLL4 antagonist or Notch receptor antagonist) with an immunotherapeutic agent works as an antagonist of the PD-1/PD-L1 pathway.
  • the combination of a Notch pathway inhibitor (e.g., a DLL4 antagonist or a Notch receptor antagonist) with an immunotherapeutic agent works as an antagonist of PD-1 or PD-1 activity.
  • the combination of a Notch pathway inhibitor (e.g., a DLL4 antagonist or a Notch receptor antagonist) with an immunotherapeutic agent works as an antagonist of PD-L1 or PD-L1 activity.
  • the combination of a Notch pathway inhibitor (e.g., a DLL4 antagonist or a Notch receptor antagonist) with an immunotherapeutic agent works as an antagonist of the CTLA-4 pathway.
  • the combination of a Notch pathway inhibitor (e.g., a DLL4 antagonist or a Notch receptor antagonist) with an immunotherapeutic agent works as an antagonist of CTLA-4 or CTLA-4 activity.
  • the combination of a Notch pathway inhibitor (e.g., a DLL4 antagonist or a Notch receptor antagonist) with an immunotherapeutic agent works as an antagonist of Tim-3 or Tim-3 activity.
  • the combination of a Notch pathway inhibitor (e.g., a DLL4 antagonist or a Notch receptor antagonist) with an immunotherapeutic agent works as an antagonist of LAG3 or LAG3 activity.
  • the combination of a Notch pathway inhibitor (e.g., a DLL4 antagonist or a Notch receptor antagonist) with an immunotherapeutic agent works as an antagonist of TIGIT or TIGIT activity.
  • the combination of a Notch pathway inhibitor (e.g., a DLL4 antagonist or a Notch receptor antagonist) with an immunotherapeutic agent works as an antagonist of KIR or KIR activity.
  • the combination of a Notch pathway inhibitor (e.g., a DLL4 antagonist or a Notch receptor antagonist) with an immunotherapeutic agent works as an agonist of the CTLA-4/CD28 pathway.
  • the combination of a Notch pathway inhibitor (e.g., a DLL4 antagonist or a Notch receptor antagonist) with an immunotherapeutic agent works as an agonist of CD28 or CD28 activity.
  • the combination of a Notch pathway inhibitor (e.g., a DLL4 antagonist or a Notch receptor antagonist) with an immunotherapeutic agent works as an agonist of 4-1BB or 4-1BB activity.
  • the combination of a Notch pathway inhibitor (e.g., a DLL4 antagonist or a Notch receptor antagonist) with an immunotherapeutic agent works as an agonist of OX40 or OX40 activity.
  • the combination of a Notch pathway inhibitor (e.g., a DLL4 antagonist or a Notch receptor antagonist) with an immunotherapeutic agent works as an agonist of GITR or GITR activity.
  • the combination of a Notch pathway inhibitor (e.g., a DLL4 antagonist or a Notch receptor antagonist) with an immunotherapeutic agent works as an agonist of CD40 or CD40 activity.
  • a method of inhibiting tumor growth comprises contacting tumor cells with an effective amount of a Notch pathway inhibitor in combination with an effective amount of a second agent, wherein the second agent is an immunotherapeutic agent.
  • the method may be in vivo or in vitro.
  • the tumor is in a subject, and contacting tumor cells with the Notch pathway inhibitor and the immunotherapeutic agent comprises administering a therapeutically effective amount of each of the agents to the subject.
  • a method of inhibiting tumor growth comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor and a therapeutically effective amount of a second agent, wherein the Notch pathway inhibitor is a DLL4 antagonist and the second agent is an immunotherapeutic agent.
  • a method of inhibiting tumor growth comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor and a therapeutically effective amount of a second agent, wherein the Notch pathway inhibitor is a Notch receptor antagonist and the second agent is an immunotherapeutic agent.
  • the Notch pathway inhibitor and the immunotherapeutic agent inhibit tumor growth by inhibiting or suppressing Treg activity.
  • the Notch pathway inhibitor and the immunotherapeutic agent inhibit tumor growth by inhibiting or suppressing MDSC activity.
  • the Notch pathway inhibitor and the immunotherapeutic agent inhibit tumor growth by increasing cytolytic cell activity.
  • the Notch pathway inhibitor and the immunotherapeutic agent inhibit tumor growth by increasing CD8+ cytolytic T-cell activity.
  • the Notch pathway inhibitor and the immunotherapeutic agent inhibit tumor growth by increasing NK cell activity. In some embodiments, the Notch pathway inhibitor and the immunotherapeutic agent inhibit tumor growth by decreasing PD-1 expression on T-cells. In some embodiments, the Notch pathway inhibitor and the immunotherapeutic agent inhibit tumor growth by decreasing the number or percentage of PD-1 expressing T-cells. In some embodiments, the Notch pathway inhibitor and the immunotherapeutic agent inhibit tumor growth by decreasing the number or percentage of MDSCs. In some embodiments, the Notch pathway inhibitor and the immunotherapeutic agent inhibit tumor growth by increasing the number or percentage of activated myeloid cells. In some embodiments, the Notch pathway inhibitor and the immunotherapeutic agent inhibit tumor growth by increasing the number or percentage of memory T-cells.
  • the Notch pathway inhibitor and the immunotherapeutic agent inhibit tumor growth by increasing or enhancing Th1-type immune responses. In some embodiments, the Notch pathway inhibitor and the immunotherapeutic agent inhibit tumor growth by increasing IFN-gamma production. In some embodiments, the Notch pathway inhibitor and the immunotherapeutic agent inhibit tumor growth by increasing IL-2 production. In some embodiments, the Notch pathway inhibitor and the immunotherapeutic agent inhibit tumor growth by decreasing or inhibiting Th17 immune responses. In some embodiments, the Notch pathway inhibitor and the immunotherapeutic agent inhibit tumor growth by decreasing IL-17 production. In some embodiments, the Notch pathway inhibitor and the immunotherapeutic agent inhibit tumor growth by decreasing or inhibiting Th2-type immune responses.
  • the Notch pathway inhibitor and the immunotherapeutic agent inhibit tumor growth by decreasing IL-6 production.
  • the Notch pathway inhibitor is a DLL4 antagonist.
  • a DLL4 antagonist is an anti-DLL4 antibody.
  • the Notch pathway inhibitor is a Notch receptor antagonist.
  • a Notch receptor antagonist is an anti-Notch2/3 antibody.
  • a Notch receptor antagonist is an anti-Notch1 antibody.
  • a method of treating cancer comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor in combination with a therapeutically effective amount of a second agent, wherein the second agent is an immunotherapeutic agent.
  • a method of treating cancer comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor and a therapeutically effective amount of a second agent, wherein the Notch pathway inhibitor is a DLL4 antagonist and the second agent is an immunotherapeutic agent.
  • a method of treating cancer comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor and a therapeutically effective amount of a second agent, wherein the Notch pathway inhibitor is a Notch receptor antagonist and the second agent is an immunotherapeutic agent.
  • the Notch pathway inhibitor and the immunotherapeutic agent treat cancer by inhibiting or suppressing Treg activity.
  • the Notch pathway inhibitor and the immunotherapeutic agent treat cancer by inhibiting or suppressing MDSC activity.
  • the Notch pathway inhibitor and the immunotherapeutic agent treat cancer by increasing cytolytic cell activity.
  • the Notch pathway inhibitor and the immunotherapeutic agent treat cancer by increasing NK cell activity.
  • the Notch pathway inhibitor and the immunotherapeutic agent treat cancer by increasing cytolytic T-cell activity. In some embodiments, the Notch pathway inhibitor and the immunotherapeutic agent treat cancer by increasing CD8+ cytolytic T-cell activity. In some embodiments, the Notch pathway inhibitor and the immunotherapeutic agent treat cancer by decreasing PD-1 expression on T-cells. In some embodiments, the Notch pathway inhibitor and the immunotherapeutic agent treat cancer by decreasing the number or percentage of PD-1 expressing T-cells. In some embodiments, the Notch pathway inhibitor and the immunotherapeutic agent treat cancer by decreasing the number or percentage of MDSCs. In some embodiments, the Notch pathway inhibitor and the immunotherapeutic agent treat cancer by increasing the number or percentage of activated myeloid cells.
  • the Notch pathway inhibitor and the immunotherapeutic agent treat cancer by increasing the number or percentage of memory T-cells. In some embodiments, the Notch pathway inhibitor and the immunotherapeutic agent treat cancer by increasing Th1-type immune responses. In some embodiments, the Notch pathway inhibitor and the immunotherapeutic agent treat cancer by increasing IFN-gamma production. In some embodiments, the Notch pathway inhibitor and the immunotherapeutic agent treat cancer by increasing IL-2 production. In some embodiments, the Notch pathway inhibitor and the immunotherapeutic agent treat cancer by decreasing IL-17 production. In some embodiments, the Notch pathway inhibitor and the immunotherapeutic agent treat cancer by decreasing IL-6 production. In some embodiments, the Notch pathway inhibitor is a DLL4 antagonist.
  • a DLL4 antagonist is an anti-DLL4 antibody.
  • the Notch pathway inhibitor is a Notch receptor antagonist.
  • a Notch receptor antagonist is an anti-Notch2/3 antibody.
  • a Notch receptor antagonist is an anti-Notch1 antibody.
  • a method of cancer immunotherapy comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor in combination with a therapeutically effective amount of a second agent, wherein the second agent is an immunotherapeutic agent, and wherein the combination results in enhanced therapeutic efficacy as compared to administration of either agent alone.
  • the Notch pathway inhibitor is a DLL4 antagonist.
  • the DLL4 antagonist is an anti-DLL4 antibody.
  • the Notch pathway inhibitor is a Notch receptor antagonist.
  • the Notch receptor antagonist is an anti-Notch2/3 antibody.
  • the Notch receptor antagonist is an anti-Notch1 antibody.
  • a method of inhibiting the activity of Tregs comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor in combination with a therapeutically effective amount of a second agent, wherein the second agent is an immunotherapeutic agent.
  • a method of inhibiting the activity of Tregs comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor and a therapeutically effective amount of a second agent, wherein the Notch pathway inhibitor is a DLL4 antagonist and the second agent is an immunotherapeutic agent.
  • a method of inhibiting the activity of Tregs comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor and a therapeutically effective amount of a second agent, wherein the Notch pathway inhibitor is a Notch receptor antagonist and the second agent is an immunotherapeutic agent.
  • a DLL4 antagonist is an anti-DLL4 antibody.
  • a Notch receptor antagonist is an anti-Notch2/3 antibody.
  • a Notch receptor antagonist is an anti-Notch1 antibody.
  • a method of inhibiting the suppression of immune responses by Tregs comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor in combination with a therapeutically effective amount of a second agent, wherein the second agent is an immunotherapeutic agent.
  • a method of inhibiting the suppression of immune responses by Tregs comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor and a therapeutically effective amount of a second agent, wherein the Notch pathway inhibitor is a DLL4 antagonist and the second agent is an immunotherapeutic agent.
  • a method of inhibiting the suppression of immune responses by Tregs comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor and a therapeutically effective amount of a second agent, wherein the Notch pathway inhibitor is a Notch receptor antagonist and the second agent is an immunotherapeutic agent.
  • a DLL4 antagonist is an anti-DLL4 antibody.
  • a Notch receptor antagonist is an anti-Notch2/3 antibody.
  • a Notch receptor antagonist is an anti-Notch1 antibody.
  • a method of inhibiting the activity of MDSCs comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor in combination with a therapeutically effective amount of a second agent, wherein the second agent is an immunotherapeutic agent.
  • a method of inhibiting the activity of MDSCs comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor and a therapeutically effective amount of a second agent, wherein the Notch pathway inhibitor is a DLL4 antagonist and the second agent is an immunotherapeutic agent.
  • a method of inhibiting the activity of MDSCs comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor and a therapeutically effective amount of a second agent, wherein the Notch pathway inhibitor is a Notch receptor antagonist and the second agent is an immunotherapeutic agent.
  • a DLL4 antagonist is an anti-DLL4 antibody.
  • a Notch receptor antagonist is an anti-Notch2/3 antibody.
  • a Notch receptor antagonist is an anti-Notch1 antibody.
  • a method of inhibiting the suppression of immune responses by MDSCs comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor in combination with a therapeutically effective amount of a second agent, wherein the second agent is an immunotherapeutic agent.
  • a method of inhibiting the suppression of immune responses by MDSCs comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor and a therapeutically effective amount of a second agent, wherein the Notch pathway inhibitor is a DLL4 antagonist and the second agent is an immunotherapeutic agent.
  • a method of inhibiting the suppression of immune responses by MDSCs comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor and a therapeutically effective amount of a second agent, wherein the Notch pathway inhibitor is a Notch receptor antagonist and the second agent is an immunotherapeutic agent.
  • a DLL4 antagonist is an anti-DLL4 antibody.
  • a Notch receptor antagonist is an anti-Notch2/3 antibody.
  • a Notch receptor antagonist is an anti-Notch1 antibody.
  • a method of enhancing the antigen-specific memory response to a tumor comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor in combination with a therapeutically effective amount of a second agent, wherein the second agent is an immunotherapeutic agent.
  • a method of enhancing the antigen-specific memory response to a tumor comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor and a therapeutically effective amount of a second agent, wherein the Notch pathway inhibitor is a DLL4 antagonist and the second agent is an immunotherapeutic agent.
  • a method of enhancing the antigen-specific memory response to a tumor comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor and a therapeutically effective amount of a second agent, wherein the Notch pathway inhibitor is a Notch receptor antagonist and the second agent is an immunotherapeutic agent.
  • a DLL4 antagonist is an anti-DLL4 antibody.
  • a Notch receptor antagonist is an anti-Notch2/3 antibody.
  • a Notch receptor antagonist is an anti-Notch1 antibody.
  • a method of activating or enhancing a persistent or long-term immune response to a tumor comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor in combination with a therapeutically effective amount of a second agent, wherein the second agent is an immunotherapeutic agent.
  • a method of activating or enhancing a persistent immune response to a tumor comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor and a therapeutically effective amount of a second agent, wherein the Notch pathway inhibitor is a DLL4 antagonist and the second agent is an immunotherapeutic agent.
  • a method of activating or enhancing a persistent immune response to a tumor comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor and a therapeutically effective amount of a second agent, wherein the Notch pathway inhibitor is a Notch receptor antagonist and the second agent is an immunotherapeutic agent.
  • a DLL4 antagonist is an anti-DLL4 antibody.
  • a Notch receptor antagonist is an anti-Notch2/3 antibody.
  • a Notch receptor antagonist is an anti-Notch1 antibody.
  • a method of inducing a persistent or long-term immunity which inhibits tumor relapse or tumor regrowth comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor in combination with a therapeutically effective amount of a second agent, wherein the second agent is an immunotherapeutic agent.
  • a method of inducing a persistent immunity which inhibits tumor relapse or tumor regrowth comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor and a therapeutically effective amount of a second agent, wherein the Notch pathway inhibitor is a DLL4 antagonist and the second agent is an immunotherapeutic agent.
  • a method of inducing a persistent immunity which inhibits tumor relapse or tumor regrowth comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor and a therapeutically effective amount of a second agent, wherein the Notch pathway inhibitor is a Notch receptor antagonist and the second agent is an immunotherapeutic agent.
  • a DLL4 antagonist is an anti-DLL4 antibody.
  • a Notch receptor antagonist is an anti-Notch2/3 antibody.
  • a Notch receptor antagonist is an anti-Notch1 antibody.
  • a method of inhibiting tumor relapse or tumor regrowth comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor in combination with a therapeutically effective amount of a second agent, wherein the second agent is an immunotherapeutic agent.
  • a method of inhibiting tumor relapse or tumor regrowth comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor and a therapeutically effective amount of a second agent, wherein the Notch pathway inhibitor is a DLL4 antagonist and the second agent is an immunotherapeutic agent.
  • a method of inhibiting tumor relapse or tumor regrowth comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor and a therapeutically effective amount of a second agent, wherein the Notch pathway inhibitor is a Notch receptor antagonist and the second agent is an immunotherapeutic agent.
  • a DLL4 antagonist is an anti-DLL4 antibody.
  • a Notch receptor antagonist is an anti-Notch2/3 antibody.
  • a Notch receptor antagonist is an anti-Notch1 antibody.
  • a method to increase the efficacy of an immune checkpoint modulator comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor in combination with a therapeutically effective amount of an immune checkpoint modulator.
  • a method to increase the efficacy of an immune checkpoint inhibitor comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor and a therapeutically effective amount of an immune checkpoint modulator, wherein the Notch pathway inhibitor is a DLL4 antagonist.
  • a method to increase the efficacy of an immune checkpoint inhibitor comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor and a therapeutically effective amount of an immune checkpoint modulator, wherein the Notch pathway inhibitor is a Notch receptor antagonist.
  • the immune checkpoint modulator is an immune checkpoint inhibitor.
  • the immune checkpoint modulator is an immune checkpoint enhancer or stimulator.
  • a DLL4 antagonist is an anti-DLL4 antibody.
  • a Notch receptor antagonist is an anti-Notch2/3 antibody.
  • a Notch receptor antagonist is an anti-Notch1 antibody.
  • a method of enhancing treatment for a subject who is being treated with an immune checkpoint modulator comprises administering to the subject a therapeutically effective amount of a Notch pathway inhibitor. In some embodiments, a method of enhancing treatment for a subject who is being treated with an immune checkpoint modulator comprises administering to the subject a therapeutically effective amount of a DLL4 antagonist. In certain embodiments, a method of enhancing treatment for a subject who is being treated with an immune checkpoint modulator comprises administering to the subject a therapeutically effective amount of a Notch receptor antagonist.
  • the immune checkpoint modulator is an immune checkpoint inhibitor. In some embodiments, the immune checkpoint inhibitor is a PD-1 antagonist.
  • the immune checkpoint inhibitor is an antibody that specifically binds PD-1. In some embodiments, the immune checkpoint inhibitor is a PD-L1 antagonist. In some embodiments, immune checkpoint inhibitor is an antibody that specifically binds PD-L1. In some embodiments, the immune checkpoint inhibitor is a CTLA-4 antagonist. In some embodiments, the immune checkpoint inhibitor is an antibody that specifically binds CTLA-4. In some embodiments, a DLL4 antagonist is an anti-DLL4 antibody. In some embodiments, a Notch receptor antagonist is an anti-Notch2/3 antibody. In some embodiments, a Notch receptor antagonist is an anti-Notch1 antibody.
  • the method of inhibiting tumor growth comprises contacting the tumor or tumor cells with a Notch pathway inhibitor (e.g., a DLL4 antagonist or a Notch receptor antagonist) and an immunotherapeutic agent in vivo.
  • a Notch pathway inhibitor and an immunotherapeutic agent is undertaken in an animal model.
  • a Notch pathway inhibitor and an immunotherapeutic agent may be administered to mice which have tumors.
  • a Notch pathway inhibitor and an immunotherapeutic agent increases, promotes, and/or enhances the activity of immune cells in the mice.
  • a Notch pathway inhibitor and an immunotherapeutic agent are administered to an animal to inhibit growth of tumors.
  • a Notch pathway inhibitor and an immunotherapeutic agent are administered at the same time or shortly after introduction of tumor cells into the animal (preventative model). In some embodiments, a Notch pathway inhibitor and an immunotherapeutic agent are administered after the tumor cells have become established and grown to a tumor of specific size (therapeutic model).
  • a method of inhibiting growth of a tumor comprises administering to a subject a therapeutically effective amount of a Notch pathway inhibitor (e.g., a DLL4 antagonist or a Notch receptor antagonist) and a therapeutically effective amount of an immunotherapeutic agent.
  • a Notch pathway inhibitor e.g., a DLL4 antagonist or a Notch receptor antagonist
  • an immunotherapeutic agent e.g., a DLL4 antagonist or a Notch receptor antagonist
  • the subject is a human.
  • the subject has a tumor or has had a tumor which was removed.
  • the tumor comprises cancer stem cells.
  • the frequency of cancer stem cells in the tumor is reduced by administration of the Notch pathway inhibitor.
  • the invention also provides a method of reducing or preventing metastasis in a subject comprising administering to the subject a therapeutically effective amount of a Notch pathway inhibitor and a therapeutically effective amount of an immunotherapeutic agent.
  • the Notch pathway inhibitor is a DLL4 antagonist.
  • the Notch pathway inhibitor is a Notch receptor antagonist.
  • the reduction or prevention of metastasis comprises inhibiting invasiveness of a tumor.
  • the subject is a human.
  • the subject has a tumor or has had a tumor removed.
  • a DLL4 antagonist is an anti-DLL4 antibody.
  • a Notch receptor antagonist is an anti-Notch2/3 antibody.
  • a Notch receptor antagonist is an anti-Notch1 antibody.
  • the invention provides a method of reducing the tumorigenicity of a tumor in a subject, comprising administering to a subject a therapeutically effective amount of a Notch pathway inhibitor and a therapeutically effective amount of an immunotherapeutic agent.
  • the Notch pathway inhibitor is a DLL4 antagonist.
  • the Notch pathway inhibitor is a Notch receptor antagonist.
  • the tumor comprises cancer stem cells.
  • the tumorigenicity of a tumor is reduced by reducing the frequency of cancer stem cells in the tumor.
  • the frequency of cancer stem cells in the tumor is reduced by administration of the Notch pathway inhibitor.
  • the tumorigenicity of the tumor is reduced by inducing apoptosis of the tumor cells. In some embodiments, the tumorigenicity of the tumor is reduced by increasing apoptosis of the tumor cells.
  • a DLL4 antagonist is an anti-DLL4 antibody.
  • a Notch receptor antagonist is an anti-Notch2/3 antibody. In some embodiments, a Notch receptor antagonist is an anti-Notch1 antibody.
  • the invention also provides a method of reducing cancer stem cell frequency in a tumor comprising cancer stem cells, the method comprising administering to a subject a therapeutically effective amount of a Notch pathway inhibitor and a therapeutically effective amount of an immunotherapeutic agent.
  • the Notch pathway inhibitor is a DLL4 antagonist.
  • the Notch pathway inhibitor is a Notch receptor antagonist.
  • a DLL4 antagonist is an anti-DLL4 antibody.
  • a Notch receptor antagonist is an anti-Notch2/3 antibody.
  • a Notch receptor antagonist is an anti-Notch1 antibody.
  • the Notch pathway inhibitor in combination with an immunotherapeutic agent is capable of reducing the tumorigenicity of a tumor comprising cancer stem cells in an animal model, such as a mouse model.
  • the number or frequency of cancer stem cells in a treated tumor is reduced by at least about two-fold, about three-fold, about five-fold, about ten-fold, about 50-fold, about 100-fold, or about 1000-fold as compared to the number or frequency of cancer stem cells in an untreated tumor.
  • the reduction in the number or frequency of cancer stem cells is determined by limiting dilution assay using an animal model.
  • the Notch pathway inhibitor augments the activity of the immunotherapeutic agent. In some embodiments, the Notch pathway inhibitor augments the activity of the immunotherapeutic agent in a subject that has not been previously treated with the immunotherapeutic agent. In some embodiments, the Notch pathway inhibitor augments the activity of the immunotherapeutic agent in a subject that has been previously treated with the immunotherapeutic agent. In some embodiments, a DLL4 antagonist augments the activity of an anti-PD-1 antibody. In some embodiments, a DLL4 antagonist augments the activity of an anti-PD-L1 antibody. In some embodiments, a Notch receptor antagonist augments the activity of an anti-PD-1 antibody. In some embodiments, a Notch receptor antagonist augments the activity of an anti-PD-L1 antibody.
  • the Notch pathway inhibitor augments the activity of the immunotherapeutic agent in a subject that has been previously treated with the immunotherapeutic agent, wherein the subject has become insensitive or resistant to the immunotherapeutic agent.
  • the Notch pathway inhibitor restores a subject's sensitivity to the activity of the immunotherapeutic agent.
  • a DLL4 antagonist restores a subject's sensitivity to an anti-PD-1 antibody.
  • a DLL4 antagonist restores a subject's sensitivity to an anti-PD-L1 antibody.
  • a Notch receptor antagonist restores a subject's sensitivity to an anti-PD-1 antibody.
  • a Notch receptor restores a subject's sensitivity to an anti-PD-L1 antibody.
  • the Notch pathway inhibitor increases a subject's sensitivity to the activity of the immunotherapeutic agent. In some embodiments, the Notch pathway inhibitor increases a subject's sensitivity to the activity of the immunotherapeutic agent, wherein the subject has been found to be insensitive to the immunotherapeutic agent.
  • the invention also provides a method of identifying a human tumor likely to be responsive to treatment with a Notch pathway inhibitor in combination with a second agent, wherein the second agent is an immunotherapeutic agent, the method comprising determining the expression level of PD-L1 in a sample obtained from the tumor.
  • a method of identifying a human tumor likely to be responsive to combination treatment with a Notch pathway inhibitor and an immunotherapeutic agent comprises: a) obtaining a sample of the human tumor; b) measuring the expression level of PD-L1 in the sample; and c) identifying the tumor as likely to be responsive or non-responsive to combination treatment with a Notch pathway inhibitor and an immunotherapeutic agent based upon the expression level of PD-L1 in the sample.
  • the invention also provides a method of determining the responsiveness (or sensitivity) of a human tumor to treatment with a Notch pathway inhibitor in combination with a second agent, wherein the second agent is an immunotherapeutic agent, the method comprising: (a) obtaining a sample of the human tumor; (b) measuring the expression level of PD-L1 in the sample; and (c) determining the responsiveness of the tumor to treatment based upon the expression level of PD-L1.
  • the method comprises determining the responsiveness or sensitivity of a human tumor to treatment with a DLL4 antagonist.
  • the method comprises determining the responsiveness or sensitivity of a human tumor to treatment with a DLL4 antagonist in combination with at least one additional therapeutic agent (e.g., a chemotherapeutic agent). In some embodiments, the method comprises determining the responsiveness or sensitivity of a human tumor to treatment with a Notch receptor antagonist. In some embodiments, the method comprises determining the responsiveness or sensitivity of a human tumor to treatment with a Notch receptor antagonist in combination with at least one additional therapeutic agent (e.g., a chemotherapeutic agent).
  • additional therapeutic agent e.g., a chemotherapeutic agent
  • the invention also provides a method of identifying a patient with cancer who is likely to respond to treatment with a Notch pathway inhibitor in combination with a second agent, wherein the second agent is an immunotherapeutic agent, the method comprising: (a) obtaining a sample from the patient; (b) measuring the expression level of PD-L1 in the sample; and (c) identifying the patient who is likely to respond to treatment based upon the expression level of PD-L1.
  • the sample is a tumor sample.
  • the sample is a blood or plasma sample.
  • the method comprises identifying a patient with cancer who is likely to respond to treatment with a Notch pathway inhibitor and an immunotherapeutic agent in combination with at least one additional therapeutic agent.
  • the invention also provides a method of selecting a subject with a tumor for treatment with a Notch pathway inhibitor in combination with a second agent, wherein the second agent is an immunotherapeutic agent, the method comprising: a) determining the expression level of PD-L1 in a sample obtained from the subject; b) identifying the tumor as likely to be responsive or non-responsive to treatment with the Notch pathway inhibitor and the immunotherapeutic agent based upon the expression level of PD-L1 in the sample; and c) selecting the subject for treatment if the tumor is identified as likely to be responsive to treatment.
  • the sample is a tumor sample.
  • the sample is a blood or plasma sample.
  • the method further comprises administering an effective amount of a Notch pathway inhibitor in combination with an effective amount of an immunotherapeutic agent to the subject.
  • the invention also provides a method of treating cancer in a patient, comprising: (a) identifying if the patient is likely to respond to treatment with a Notch pathway inhibitor in combination with a second agent, wherein the second agent is an immunotherapeutic agent, wherein the identification comprises: (i) obtaining a sample from the patient; (ii) measuring the expression level of PD-L1 in the sample; and (iii) identifying the patient who is likely to respond to treatment based upon the expression level of PD-L1; and (b) administering to the patient who is likely to response to treatment an effective amount of the Notch pathway inhibitor in combination with the immunotherapeutic agent.
  • the sample is a tumor sample.
  • the sample is a blood or plasma sample.
  • the method comprises identifying if the patient is likely to respond to treatment with a Notch pathway inhibitor in combination with an additional therapeutic agent. In some embodiments, the method comprises administering to the patient the Notch pathway inhibitor and immunotherapeutic agent in combination with at least one additional therapeutic agent.
  • the invention also provides a method of treating cancer in a patient, comprising: administering an effective amount of a Notch pathway inhibitor in combination with a second agent, wherein the second agent is an immunotherapeutic agent to the patient; wherein the patient is predicted to respond to treatment with a Notch pathway inhibitor and/or immunotherapeutic agent based upon expression level of PD-L1 in a sample from the patient.
  • the sample is a tumor sample.
  • the sample is a blood or plasma sample.
  • the patient is predicted to respond to treatment with a Notch pathway inhibitor and immunotherapeutic agent in combination with a chemotherapeutic agent.
  • the method comprises administering to the patient the Notch pathway inhibitor and immunotherapeutic agent in combination with at least one additional therapeutic agent.
  • the invention also provides a method for increasing the likelihood of effective treatment with a Notch pathway inhibitor in combination with a second agent, wherein the second agent is an immunotherapeutic agent, comprising: (a) identifying if a patient has a tumor that is likely to respond to treatment with a Notch pathway inhibitor and/or immunotherapeutic agent, wherein the identification comprises: (i) obtaining a sample from the patient; (ii) measuring the expression level of PD-L1 in the sample; and (iii) identifying the patient who is likely to respond to treatment based upon the expression level of the PD-L1; and (b) administering an effective amount of the Notch pathway inhibitor in combination with the immunotherapeutic agent to the patient.
  • the sample is a tumor sample.
  • the sample is a blood or plasma sample.
  • the method comprises identifying if a patient has a tumor that is likely to respond to treatment with a Notch pathway inhibitor in combination with a chemotherapeutic agent. In some embodiments, the method comprises administering to the patient the Notch pathway inhibitor and the immunotherapeutic agent in combination with at least one additional therapeutic agent.
  • the invention also provides a method for increasing the likelihood of effective treatment with a Notch pathway inhibitor in combination with a second agent, wherein the second agent is an immunotherapeutic agent, comprising: administering an effective amount of a Notch pathway inhibitor and/or immunotherapeutic agent to a patient; wherein the patient is identified as likely to respond to treatment with the Notch pathway inhibitor and/or the immunotherapeutic agent based upon expression level of PD-L1 in a sample.
  • the sample is a tumor sample.
  • the sample is a blood or plasma sample.
  • the patient is identified as likely to respond to treatment with a Notch pathway inhibitor in combination with a chemotherapeutic agent.
  • the method comprises administering to the patient the Notch pathway inhibitor and the immunotherapeutic agent in combination with at least one additional therapeutic agent.
  • the sample is a biopsy sample.
  • the sample is a blood or plasma sample.
  • the sample is a tumor sample.
  • the sample comprises tumor cells, tumor infiltrating immune cells, stromal cells, and any combination thereof.
  • the sample is a formalin-fixed paraffin embedded (FFPE) sample.
  • the sample is archival, fresh, or frozen tissue.
  • the expression level of PD-L1 in the sample is compared to a pre-determined expression level of PD-L1.
  • the pre-determined expression level of PD-L1 expression is an expression level of PD-L1 in a reference tumor sample, a reference normal tissue sample, a series of reference tumor samples, or a series of reference normal tissue samples.
  • the expression level of PD-L1 is determined using an immunohistochemistry (IHC) assay.
  • the expression level of PD-L1 is determined using an assay which comprises an H-score evaluation.
  • the expression level of PD-L1 is determined using an ELISA.
  • the expression level of PD-L1 is determined using a PCR-based assay.
  • the expression level of PD-L1 is determined using an antibody that specifically binds PD-L1.
  • the antibody that specifically binds human PD-L1 is a polyclonal antibody, a monoclonal antibody, a recombinant antibody, a chimeric antibody, a humanized antibody, a human antibody, a mouse antibody, a rabbit antibody, a rat antibody, or an antibody fragment comprising an antigen-binding site.
  • PD-L1 is detected on tumor cells. In some embodiments, PD-L1 is detected on tumor infiltrating immune cells. In some embodiments, the tumor infiltrating immune cells are lymphocytes. In some embodiments, the tumor infiltrating immune cells are T-cells. In some embodiments, PD-L1 is detected on antigen-presenting cells (APCs). In some embodiments, PD-L1 is detected on macrophages and/or dendritic cells. In some embodiments, the APCs, macrophages, and/or dendritic cells are within the tumor microenvironment.
  • APCs antigen-presenting cells
  • the tumor is a tumor selected from the group consisting of lung tumor, pancreatic tumor, breast tumor, colon tumor, colorectal tumor, melanoma, gastrointestinal tumor, gastric tumor, renal tumor, ovarian tumor, liver tumor, endometrial tumor, kidney tumor, prostate tumor, thyroid tumor, neuroblastoma, glioma, glioblastoma, glioblastoma multiforme, cervical tumor, stomach tumor, bladder tumor, head and neck tumor, and hepatoma.
  • the tumor is a breast tumor.
  • the tumor is a breast tumor is a triple negative breast tumor.
  • the tumor is an ovarian tumor.
  • the tumor is a lung tumor.
  • the lung tumor is a non-small cell lung tumor.
  • the lung tumor is a small cell lung tumor.
  • the tumor is a pancreatic tumor.
  • the tumor is a kidney tumor.
  • the kidney tumor is a renal cell carcinoma.
  • the tumor expresses PD-L1.
  • the tumor over-expresses PD-L1.
  • the tumor expresses PD-L2.
  • the tumor over-expresses PD-L2.
  • the tumor has an increased level of PD-L1 expression as compared to a pre-determined level.
  • the “pre-determined level” of PD-L1 expression is the amount of PD-L1 expression in a normal immune cell. In some embodiments, the “pre-determined level” of PD-L1 expression is the amount of PD-L1 expression in a normal tissue. In some embodiments, the “pre-determined level” of PD-L1 expression is the amount of PD-L1 expression in a similar tumor type. In some embodiments, the “pre-determined level” of PD-L1 expression is the amount of PD-L1 expression in a mixture of tumor types.
  • the cancer is a cancer selected from the group consisting of lung cancer, pancreatic cancer, breast cancer, colon cancer, colorectal cancer, melanoma, gastrointestinal cancer, gastric cancer, renal cancer, ovarian cancer, liver cancer, endometrial cancer, kidney cancer, prostate cancer, thyroid cancer, neuroblastoma, glioma, glioblastoma, glioblastoma multiforme, cervical cancer, stomach cancer, bladder cancer, head and neck cancer, and hepatoma.
  • the cancer is lung cancer.
  • the cancer is ovarian cancer.
  • the Notch pathway inhibitor is an antibody.
  • the antibody is a monoclonal antibody.
  • the antibody is a humanized antibody.
  • the antibody is a recombinant antibody, a chimeric antibody, a human antibody, or an antibody fragment comprising an antigen-binding site.
  • the antibody is a monospecific antibody.
  • the antibody is a bispecific antibody.
  • the antibody is an IgG1 antibody.
  • the antibody is an IgG2 antibody.
  • the antibody is an IgG4 antibody.
  • the Notch pathway inhibitor is a DLL4 antagonist. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human DLL4. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds the extracellular domain of human DLL4. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds an epitope within amino acids 27-217 of the extracellular domain of human DLL4 (SEQ ID NO:17). In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds within the N-terminal region of human DLL4 (SEQ ID NO:14).
  • the Notch pathway inhibitor is an antibody that specifically binds an epitope comprising amino acids 66-73 (QAVVSPGP, SEQ ID NO:18) of human DLL4. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds an epitope comprising amino acids 139-146 (LISKIAIQ, SEQ ID NO:19) of human DLL4. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds an epitope comprising amino acids 66-73 (QAVVSPGP, SEQ ID NO:18) and amino acids 139-146 (LISKIAIQ, SEQ ID NO:19) of human DLL4. In some embodiments, the Notch pathway inhibitor is an antibody that binds human DLL4 with a dissociation constant (K D ) of about 10 nM to about 0.1 nM.
  • K D dissociation constant
  • the Notch pathway inhibitor is an antibody that specifically binds human DLL4, wherein the antibody comprises a heavy chain CDR1 comprising TAYYIH (SEQ ID NO:1), a heavy chain CDR2 comprising YISCYNGATNYNQKFKG (SEQ ID NO:2), YISSYNGATNYNQKFKG (SEQ ID NO:3), or YISVYNGATNYNQKFKG (SEQ ID NO:4), and a heavy chain CDR3 comprising RDYDYDVGMDY (SEQ ID NO:5), and/or a light chain CDR1 comprising RASESVDNYGISFMK (SEQ ID NO:6), a light chain CDR2 comprising AASNQGS (SEQ ID NO:7), and a light chain CDR3 comprising QQSKEVPWTFGG (SEQ ID NO:8).
  • TAYYIH SEQ ID NO:1
  • a heavy chain CDR2 comprising YISCYNGATNYNQKFKG (S
  • the Notch pathway inhibitor is an antibody that specifically binds human DLL4, wherein the antibody comprises a heavy chain CDR1 comprising TAYYIH (SEQ ID NO:1), a heavy chain CDR2 comprising YISSYNGATNYNQKFKG (SEQ ID NO:3), and a heavy chain CDR3 comprising RDYDYDVGMDY (SEQ ID NO:5), and a light chain CDR1 comprising RASESVDNYGISFMK (SEQ ID NO:6), a light chain CDR2 comprising AASNQGS (SEQ ID NO:7), and a light chain CDR3 comprising QQSKEVPWTFGG (SEQ ID NO:8).
  • the antibody comprises a heavy chain CDR1 comprising TAYYIH (SEQ ID NO:1), a heavy chain CDR2 comprising YISSYNGATNYNQKFKG (SEQ ID NO:3), and a heavy chain CDR3 comprising RDYDYDVGMDY (SEQ ID NO:5), and
  • the Notch pathway inhibitor is an antibody that specifically binds human DLL4, wherein the antibody comprises a heavy chain CDR1 comprising TAYYIH (SEQ ID NO:1), a heavy chain CDR2 comprising YISSYNGATNYNQKFKG (SEQ ID NO:3), and a heavy chain CDR3 comprising RDYDYDVGMDY (SEQ ID NO:5), and a light chain CDR1 comprising RASESVDNYGISFMK (SEQ ID NO:6), a light chain CDR2 comprising AASNQGS (SEQ ID NO:7), and a light chain CDR3 comprising QQSKEVPWTFGG (SEQ ID NO:8) and is administered in combination with an immunotherapeutic agent.
  • the immunotherapeutic agent is an antibody that specifically binds PD-1.
  • the immunotherapeutic agent is an antibody that specifically binds PD-L1.
  • the Notch pathway inhibitor is an antibody that specifically binds human DLL4, wherein the antibody comprises a heavy chain variable region having at least about 90%, at least about 95% or 100% sequence identity to SEQ ID NO:9, SEQ ID NO:10, or SEQ ID NO:11; and/or a light chain variable region having at least about 90%, at least about 95% or 100% sequence identity to SEQ ID NO:12.
  • the DLL4 antagonist is an antibody which comprises a heavy chain variable region having at least about 90%, at least about 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:10 and a light chain variable region having at least about 90%, at least about 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:12.
  • the DLL4 antagonist is an antibody which comprises a heavy chain variable region comprising SEQ ID NO:10 and a light chain variable region comprising SEQ ID NO:12.
  • the Notch pathway inhibitor is a bispecific antibody, wherein the bispecific antibody comprises: a) a first antigen-binding site that specifically binds human VEGF, and b) a second antigen-binding site that specifically binds human DLL4, wherein the first antigen-binding site comprises a heavy chain CDR1 comprising NYWMH (SEQ ID NO:20), a heavy chain CDR2 comprising DINPSNGRTSYKEKFKR (SEQ ID NO:21), and a heavy chain CDR3 comprising HYDDKYYPLMDY (SEQ ID NO:22); wherein the second antigen-binding site comprises a heavy chain CDR1 comprising TAYYIH (SEQ ID NO:1), a heavy chain CDR2 comprising YISNYNRATNYNQKFKG (SEQ ID NO:25), and a heavy chain CDR3 comprising RDYDYDVGMDY (SEQ ID NO:5); and wherein both the first and second antigen-binding site comprises a heavy
  • the Notch pathway inhibitor is a bispecific antibody, wherein the bispecific antibody comprises: a) a first antigen-binding site that specifically binds human VEGF, and b) a second antigen-binding site that specifically binds human DLL4, wherein the first antigen-binding site comprises a heavy chain CDR1 comprising NYWMH (SEQ ID NO:20), a heavy chain CDR2 comprising DINPSNGRTSYKEKFKR (SEQ ID NO:21), and a heavy chain CDR3 comprising HYDDKYYPLMDY (SEQ ID NO:22); wherein the second antigen-binding site comprises a heavy chain CDR1 comprising TAYYIH (SEQ ID NO:1), a heavy chain CDR2 comprising YISNYNRATNYNQKFKG (SEQ ID NO:25), and a heavy chain CDR3 comprising RDYDYDVGMDY (SEQ ID NO:5); and wherein both the first and second antigen-binding site comprises a heavy
  • the Notch pathway inhibitor is a bispecific antibody, wherein the bispecific antibody comprises a first antigen-binding site that specifically binds human VEGF, and a second antigen-binding site that specifically binds human DLL4, wherein the first antigen-binding site comprises a first heavy chain variable region of SEQ ID NO:30, the second antigen-binding site comprises a second heavy chain variable region of SEQ ID NO:29; and wherein the first and the second antigen-binding site comprises a first and a second light chain variable region of SEQ ID NO:12.
  • the Notch pathway inhibitor is bispecific antibody 305B83.
  • the Notch pathway inhibitor is an antibody that specifically binds human DLL4 and the immunotherapeutic agent is a PD-1 antagonist. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human DLL4 and the immunotherapeutic agent is a PD-L1 antagonist. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human DLL4 and the immunotherapeutic agent is a PD-L2 antagonist. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human DLL4 and the immunotherapeutic agent is a CTLA-4 antagonist. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human DLL4 and the immunotherapeutic agent is a CD80 antagonist.
  • the Notch pathway inhibitor is an antibody that specifically binds human DLL4 and the immunotherapeutic agent is a CD86 antagonist. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human DLL4 and the immunotherapeutic agent is a KIR antagonist. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human DLL4 and the immunotherapeutic agent is a Tim-3 antagonist. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human DLL4 and the immunotherapeutic agent is a LAG3 antagonist. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human DLL4 and the immunotherapeutic agent is a TIGIT antagonist.
  • the Notch pathway inhibitor is an antibody that specifically binds human DLL4 and the immunotherapeutic agent is a CD96 antagonist. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human DLL4 and the immunotherapeutic agent is an IDO1 antagonist. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human DLL4 and the immunotherapeutic agent is a CD28 agonist. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human DLL4 and the immunotherapeutic agent is a 4-1BB agonist. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human DLL4 and the immunotherapeutic agent is an OX40 agonist.
  • the Notch pathway inhibitor is an antibody that specifically binds human DLL4 and the immunotherapeutic agent is a CD27 agonist. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human DLL4 and the immunotherapeutic agent is a CD80 agonist. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human DLL4 and the immunotherapeutic agent is a CD86 agonist. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human DLL4 and the immunotherapeutic agent is a CD40 agonist. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human DLL4 and the immunotherapeutic agent is a GITR agonist.
  • the Notch pathway inhibitor is an antibody that specifically binds human DLL4 and the immunotherapeutic agent is a cytokine. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human DLL4 and the immunotherapeutic agent is an interferon. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human DLL4 and the immunotherapeutic agent is a lymphokine.
  • the Notch pathway inhibitor is a Notch receptor antagonist.
  • the Notch receptor antagonist is an antibody that specifically binds human Notch1, Notch2, and/or Notch3.
  • the Notch receptor antagonist is an antibody that specifically binds human Notch1.
  • the Notch receptor antagonist is an antibody that specifically binds human Notch2 and/or Notch3.
  • the Notch receptor antagonist is an antibody that specifically binds human Notch2 and Notch3.
  • the Notch receptor antagonist is an antibody that specifically binds the extracellular domain of human Notch2 and/or Notch3, wherein the antibody comprises a heavy chain CDR1 comprising SSSGMS (SEQ ID NO:34), a heavy chain CDR2 comprising VIASSGSNTYYADSVKG (SEQ ID NO:35), and a heavy chain CDR3 comprising SIFYTT (SEQ ID NO:36), and/or a light chain CDR1 comprising RASQSVRSNYLA (SEQ ID NO:37), a light chain CDR2 comprising GASSRAT (SEQ ID NO:38), and a light chain CDR3 comprising QQYSNFPI (SEQ ID NO:39).
  • the antibody comprises a heavy chain CDR1 comprising SSSGMS (SEQ ID NO:34), a heavy chain CDR2 comprising VIASSGSNTYYADSVKG (SEQ ID NO:35), and a heavy chain CDR3 comprising SIFYTT (SEQ ID NO:36), and/or a light chain
  • the antibody comprises a heavy chain CDR1 comprising SSSGMS (SEQ ID NO:34), a heavy chain CDR2 comprising VIASSGSNTYYADSVKG (SEQ ID NO:35), and a heavy chain CDR3 comprising SIFYTT (SEQ ID NO:36); and a light chain CDR1 comprising RASQSVRSNYLA (SEQ ID NO:37), a light chain CDR2 comprising GASSRAT (SEQ ID NO:38), and a light chain CDR3 comprising QQYSNFPI (SEQ ID NO:39).
  • the Notch receptor antagonist is an antibody that specifically binds human Notch2 and/or Notch3, wherein the antibody comprises a heavy chain CDR1 comprising SSSGMS (SEQ ID NO:34), a heavy chain CDR2 comprising VIASSGSNTYYADSVKG (SEQ ID NO:35), and a heavy chain CDR3 comprising SIFYTT (SEQ ID NO:36); and/or a light chain CDR1 comprising RASQSVRSNYLA (SEQ ID NO:37), a light chain CDR2 comprising GASSRAT (SEQ ID NO:38), and a light chain CDR3 comprising QQYSNFPI (SEQ ID NO:39) and is administered in combination with an immunotherapeutic agent.
  • the immunotherapeutic agent is an antibody that specifically binds PD-1.
  • the immunotherapeutic agent is an antibody that specifically binds PD-L1.
  • the Notch receptor antagonist is an antibody that specifically binds human Notch2 and/or Notch3, wherein the antibody comprises a heavy chain variable region having at least about 90%, at least about 95% or 100% sequence identity to SEQ ID NO:40 and/or a light chain variable region having at least about 90%, at least about 95% or 100% sequence identity to SEQ ID NO:41.
  • the Notch receptor antagonist is an antibody which comprises a heavy chain variable region having at least about 90%, at least about 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:40 and a light chain variable region having at least about 90%, at least about 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:41.
  • the Notch receptor antagonist is an antibody which comprises a heavy chain variable region comprising SEQ ID NO:40 and a light chain variable region comprising SEQ ID NO:41.
  • the Notch pathway inhibitor is antibody tarextumab (OMP-59R5).
  • the Notch pathway inhibitor is an antibody that specifically binds human Notch2 and/or Notch3 and the immunotherapeutic agent is a PD-1 antagonist. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human Notch2 and/or Notch3 and the immunotherapeutic agent is a PD-L1 antagonist. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human Notch2 and/or Notch3 and the immunotherapeutic agent is a PD-L2 antagonist. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human Notch2 and/or Notch3 and the immunotherapeutic agent is a CTLA-4 antagonist.
  • the Notch pathway inhibitor is an antibody that specifically binds human Notch2 and/or Notch3 and the immunotherapeutic agent is a CD80 antagonist. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human Notch2 and/or Notch3 and the immunotherapeutic agent is a CD86 antagonist. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human Notch2 and/or Notch3 and the immunotherapeutic agent is a KIR antagonist. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human Notch2 and/or Notch3 and the immunotherapeutic agent is a Tim-3 antagonist.
  • the Notch pathway inhibitor is an antibody that specifically binds human Notch2 and/or Notch3 and the immunotherapeutic agent is a LAG3 antagonist. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human Notch2 and/or Notch3 and the immunotherapeutic agent is a TIGIT antagonist. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human Notch2 and/or Notch3 and the immunotherapeutic agent is a CD96 antagonist. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human Notch2 and/or Notch3 and the immunotherapeutic agent is an IDO1 antagonist.
  • the Notch pathway inhibitor is an antibody that specifically binds human Notch2 and/or Notch3 and the immunotherapeutic agent is a CD28 agonist. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human Notch2 and/or Notch3 and the immunotherapeutic agent is a 4-1BB agonist. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human Notch2 and/or Notch3 and the immunotherapeutic agent is an OX40 agonist. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human Notch2 and/or Notch3 and the immunotherapeutic agent is a CD27 agonist.
  • the Notch pathway inhibitor is an antibody that specifically binds human Notch2 and/or Notch3 and the immunotherapeutic agent is a CD80 agonist. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human Notch2 and/or Notch3 and the immunotherapeutic agent is a CD86 agonist. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human Notch2 and/or Notch3 and the immunotherapeutic agent is a CD40 agonist. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human Notch2 and/or Notch3 and the immunotherapeutic agent is a GITR agonist.
  • the Notch pathway inhibitor is an antibody that specifically binds human Notch2 and/or Notch3 and the immunotherapeutic agent is a cytokine. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human Notch2 and/or Notch3 and the immunotherapeutic agent is an interferon. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human Notch2 and/or Notch3 and the immunotherapeutic agent is a lymphokine.
  • the Notch receptor antagonist is an antibody that specifically binds human Notch1, wherein the antibody comprises a heavy chain CDR1 comprising RGYWIE (SEQ ID NO:46), a heavy chain CDR2 comprising QILPGTGRTNYNEKFKG (SEQ ID NO:47), and a heavy chain CDR3 comprising FDGNYGYYAMDY (SEQ ID NO:48), and/or a light chain CDR1 comprising RSSTGAVTTSNYAN (SEQ ID NO:49), a light chain CDR2 comprising GTNNRAP (SEQ ID NO:50), and a light chain CDR3 comprising ALWYSNHWVFGGGTKL (SEQ ID NO:51).
  • the antibody comprises a heavy chain CDR1 comprising RGYWIE (SEQ ID NO:46), a heavy chain CDR2 comprising QILPGTGRTNYNEKFKG (SEQ ID NO:47), and a heavy chain CDR3 comprising FDGNYGYYAMDY (SEQ ID NO:48),
  • the antibody comprises a heavy chain CDR1 comprising RGYWIE (SEQ ID NO:46), a heavy chain CDR2 comprising QILPGTGRTNYNEKFKG (SEQ ID NO:47), and a heavy chain CDR3 comprising FDGNYGYYAMDY (SEQ ID NO:48), and a light chain CDR1 comprising RSSTGAVTTSNYAN (SEQ ID NO:49), a light chain CDR2 comprising GTNNRAP (SEQ ID NO:50), and a light chain CDR3 comprising ALWYSNHWVFGGGTKL (SEQ ID NO:51).
  • the Notch receptor antagonist is an antibody that specifically binds human Notch1, wherein the antibody comprises a heavy chain CDR1 comprising RGYWIE (SEQ ID NO:46), a heavy chain CDR2 comprising QILPGTGRTNYNEKFKG (SEQ ID NO:47), and a heavy chain CDR3 comprising FDGNYGYYAMDY (SEQ ID NO:48), and a light chain CDR1 comprising RSSTGAVTTSNYAN (SEQ ID NO:49), a light chain CDR2 comprising GTNNRAP (SEQ ID NO:50), and a light chain CDR3 comprising ALWYSNHWVFGGGTKL (SEQ ID NO:51) and is administered in combination with an immunotherapeutic agent.
  • the immunotherapeutic agent is an antibody that specifically binds PD-1.
  • the immunotherapeutic agent is an antibody that specifically binds PD-L1.
  • the Notch receptor antagonist is an antibody that specifically binds human Notch1, wherein the antibody comprises a heavy chain variable region having at least about 90%, at least about 95% or 100% sequence identity to SEQ ID NO:52 and/or a light chain variable region having at least about 90%, at least about 95% or 100% sequence identity to SEQ ID NO:53.
  • the Notch receptor antagonist is an antibody which comprises a heavy chain variable region having at least about 90%, at least about 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:52, and a light chain variable region having at least about 90%, at least about 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:53.
  • the Notch receptor antagonist is an antibody which comprises a heavy chain variable region comprising SEQ ID NO:52 and a light chain variable region comprising SEQ ID NO:53.
  • the Notch pathway inhibitor is antibody brontictuzumab (OMP-52M51).
  • the Notch pathway inhibitor is an antibody that specifically binds human Notch1 and the immunotherapeutic agent is a PD-1 antagonist. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human Notch1 and the immunotherapeutic agent is a PD-L1 antagonist. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human Notch1 and the immunotherapeutic agent is a PD-L2 antagonist. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human Notch1 and the immunotherapeutic agent is a CTLA-4 antagonist. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human Notch1 and the immunotherapeutic agent is a CD80 antagonist.
  • the Notch pathway inhibitor is an antibody that specifically binds human Notch1 and the immunotherapeutic agent is a CD86 antagonist. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human Notch1 and the immunotherapeutic agent is a KIR antagonist. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human Notch1 and the immunotherapeutic agent is a Tim-3 antagonist. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human Notch2 and/or Notch3 and the immunotherapeutic agent is a LAG3 antagonist. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human Notch1 and the immunotherapeutic agent is a TIGIT antagonist.
  • the Notch pathway inhibitor is an antibody that specifically binds human Notch1 and the immunotherapeutic agent is a CD96 antagonist. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human Notch1 and the immunotherapeutic agent is an IDO1 antagonist. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human Notch1 and the immunotherapeutic agent is a CD28 agonist. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human Notch1 and the immunotherapeutic agent is a 4-1BB agonist. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human Notch1 and the immunotherapeutic agent is an OX40 agonist.
  • the Notch pathway inhibitor is an antibody that specifically binds human Notch1 and the immunotherapeutic agent is a CD27 agonist. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human Notch1 and the immunotherapeutic agent is a CD80 agonist. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human Notch1 and the immunotherapeutic agent is a CD86 agonist. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human Notch1 and the immunotherapeutic agent is a CD40 agonist. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human Notch1 and the immunotherapeutic agent is a GITR agonist.
  • the Notch pathway inhibitor is an antibody that specifically binds human Notch1 and the immunotherapeutic agent is a cytokine. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human Notch1 and the immunotherapeutic agent is an interferon. In some embodiments, the Notch pathway inhibitor is an antibody that specifically binds human Notch1 and the immunotherapeutic agent is a lymphokine.
  • compositions comprising Notch pathway inhibitors and compositions comprising immunotherapeutic agents.
  • a composition comprises a DLL4 antagonist described herein.
  • a composition comprises an antibody that specifically binds DLL4 described herein.
  • a composition comprises a Notch receptor antagonist described herein.
  • a composition comprises an antibody that specifically binds Notch2 and/or Notch3 described herein.
  • a composition comprises an antibody that specifically binds Notch1 described herein.
  • a composition comprises an immunotherapeutic agent described herein.
  • a composition is a pharmaceutical composition comprising a Notch pathway inhibitor and a pharmaceutically acceptable vehicle.
  • a composition is a pharmaceutical composition comprising an immunotherapeutic agent and a pharmaceutically acceptable vehicle.
  • the pharmaceutical compositions find use in modulating immune responses in human patients, particularly immune responses to tumors.
  • the pharmaceutical compositions find use in inhibiting tumor cell growth in human patients.
  • the pharmaceutical compositions find use in treating cancer in human patients.
  • the pharmaceutical compositions find use in any of the methods described herein.
  • a Notch pathway inhibitor described herein finds use in the manufacture of a medicament for the treatment of cancer in combination with at least one immunotherapeutic agent.
  • a DLL4 antagonist described herein finds use in the manufacture of a medicament for the treatment of cancer in combination with at least one immunotherapeutic agent.
  • a Notch receptor antagonist described herein finds use in the manufacture of a medicament for the treatment of cancer in combination with at least one immunotherapeutic agent.
  • Formulations and/or pharmaceutical compositions are prepared for storage and use by combining a therapeutic agent of the present invention with a pharmaceutically acceptable carrier, excipient, and/or stabilizer as a sterile lyophilized powder, aqueous solution, etc. ( Remington: The Science and Practice of Pharmacy, 22 nd Edition, 2012, Pharmaceutical Press, London). Those of skill in the art generally consider pharmaceutically acceptable carriers, excipients, and/or stabilizers to be inactive ingredients of a formulation or pharmaceutical composition.
  • Suitable carriers, excipients, or stabilizers comprise nontoxic buffers such as phosphate, citrate, and other organic acids; salts such as sodium chloride; antioxidants including ascorbic acid and methionine; preservatives (e.g. octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride; benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens, such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight polypeptides (such as less than about 10 amino acid residues); proteins such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine,
  • the therapeutic formulation can be in unit dosage form.
  • Such formulations include tablets, pills, capsules, powders, granules, solutions or suspensions in water or non-aqueous media, or suppositories for oral, parenteral, or rectal administration or for administration by inhalation.
  • solid compositions such as tablets the principal active ingredient is mixed with a pharmaceutical carrier.
  • pharmaceutical carriers are considered to be inactive ingredients of a formulation or composition.
  • Conventional tableting ingredients include corn starch, lactose, sucrose, sorbitol, talc, stearic acid, magnesium stearate, dicalcium phosphate or gums, and other diluents (e.g.
  • a solid pre-formulation composition containing a homogeneous mixture of a compound of the present invention, or a non-toxic pharmaceutically acceptable salt thereof.
  • the solid pre-formulation composition is then subdivided into unit dosage forms of the type described above.
  • the tablets, pills, etc., of the novel composition can be coated or otherwise compounded to provide a dosage form affording the advantage of prolonged action.
  • the tablet or pill can comprise an inner composition covered by an outer component.
  • the two components can be separated by an enteric layer that serves to resist disintegration and permits the inner component to pass intact through the stomach or to be delayed in release.
  • enteric layers or coatings including a number of polymeric acids and mixtures of polymeric acids with such materials as shellac, cetyl alcohol and cellulose acetate.
  • compositions may include the Notch pathway inhibitors and/or the immunotherapeutic agents of the present invention complexed with liposomes.
  • Liposomes can be generated by the reverse phase evaporation with a lipid composition comprising phosphatidylcholine, cholesterol, and PEG-derivatized phosphatidylethanolamine (PEG-PE). Liposomes are extruded through filters of defined pore size to yield liposomes with the desired diameter.
  • the Notch pathway inhibitors and/or immunotherapeutic agents can also be entrapped in microcapsules.
  • microcapsules are prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nanoparticles and nanocapsules) or in macroemulsions as described in Remington: The Science and Practice of Pharmacy, 22 nd Edition, 2012, Pharmaceutical Press, London.
  • sustained-release preparations comprising Notch pathway inhibitors and/or immunotherapeutic agents can be prepared.
  • Suitable examples of sustained-release preparations include semi-permeable matrices of solid hydrophobic polymers containing the agent, which matrices are in the form of shaped articles (e.g., films or microcapsules).
  • sustained-release matrices include polyesters, hydrogels such as poly(2-hydroxyethyl-methacrylate) or poly(vinylalcohol), polylactides, copolymers of L-glutamic acid and 7 ethyl-L-glutamate, non-degradable ethylene-vinyl acetate, degradable lactic acid-glycolic acid copolymers such as the LUPRON DEPOTTM (injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate), sucrose acetate isobutyrate, and poly-D-( ⁇ )-3-hydroxybutyric acid.
  • polyesters such as poly(2-hydroxyethyl-methacrylate) or poly(vinylalcohol)
  • polylactides copolymers of L-glutamic acid and 7 ethyl-L-glutamate
  • non-degradable ethylene-vinyl acetate non-degradable ethylene-vin
  • the Notch pathway inhibitors and immunotherapeutic agents are administered as appropriate pharmaceutical compositions to a human patient according to known methods.
  • the pharmaceutical compositions can be administered in any number of ways for either local or systemic treatment. Suitable methods of administration include, but are not limited to, intravenous (administration as a bolus or by continuous infusion over a period of time), intraarterial, intramuscular (injection or infusion), intratumoral, intraperitoneal, intracerobrospinal, subcutaneous, intra-articular, intrasynovial, intracranial (e.g., intrathecal or intraventricular), or oral.
  • administration can be topical, (e.g., transdermal patches, ointments, lotions, creams, gels, drops, suppositories, sprays, liquids and powders) or pulmonary (e.g., by inhalation or insufflation of powders or aerosols, including by nebulizer; intratracheal, intranasal, epidermal and transdermal).
  • topical e.g., transdermal patches, ointments, lotions, creams, gels, drops, suppositories, sprays, liquids and powders
  • pulmonary e.g., by inhalation or insufflation of powders or aerosols, including by nebulizer; intratracheal, intranasal, epidermal and transdermal.
  • the appropriate dosage(s) of a Notch pathway inhibitor in combination with an immunotherapeutic agent of the present invention depends on the type of disease to be treated, the severity and course of the disease, the responsiveness of the disease, whether the inhibitors are administered for therapeutic or preventative purposes, previous therapy, the patient's clinical history, and so on, all at the discretion of the treating physician.
  • the Notch pathway inhibitor can be administered one time or as a series of treatments spread over several days to several months, or until a cure is effected or a diminution of the disease state is achieved (e.g., reduction in tumor size).
  • the immunotherapeutic agent can be administered one time or as a series of treatments spread over several days to several months, or until a cure is effected or a diminution of the disease state is achieved (e.g., reduction in tumor size).
  • Optimal dosing schedules for each agent can be calculated from measurements of drug accumulation in the body of the patient and will vary depending on the relative potency of an individual agent. The administering physician can determine optimum dosages, dosing methodologies, and repetition rates.
  • combined administration includes co-administration in a single pharmaceutical formulation. In some embodiments, combined administration includes using separate formulations and consecutive administration in either order but generally within a time period such that all active agents can exert their biological activities simultaneously. In some embodiments, combined administration includes using separate formulations and a staggered dosing regimen. In some embodiments, combined administration includes using separate formulations and administration in a specific order. In some embodiments, combined administration includes using separate formulations and administration of the agents in a specific order and in a staggered dosing regimen.
  • dosage of a Notch pathway inhibitor is from about 0.01 ⁇ g to about 100 mg/kg of body weight, from about 0.1 ⁇ g to about 100 mg/kg of body weight, from about 1 ⁇ g to about 100 mg/kg of body weight, from about 1 mg to about 100 mg/kg of body weight, about 1 mg to about 80 mg/kg of body weight from about 10 mg to about 100 mg/kg of body weight, from about 10 mg to about 75 mg/kg of body weight, or from about 10 mg to about 50 mg/kg of body weight.
  • the dosage of the Notch pathway inhibitor is from about 0.01 mg to about 10 mg/kg of body weight. In certain embodiments, the dosage of the Notch pathway inhibitor is from about 0.01 mg to about 5 mg/kg of body weight.
  • the dosage of the Notch pathway inhibitor is from about 0.05 mg to about 5 mg/kg of body weight. In certain embodiments, the dosage of the Notch pathway inhibitor is from about 0.1 mg to about 20 mg/kg of body weight. In certain embodiments, the dosage of the Notch pathway inhibitor is from about 0.5 mg to about 10 mg/kg of body weight. In some embodiments, the Notch pathway inhibitor is administered to the subject at a dosage of about 2 mg/kg to about 15 mg/kg. In some embodiments, the Notch pathway inhibitor is administered to the subject at a dosage of about 5 mg/kg to about 15 mg/kg. In certain embodiments, the Notch pathway inhibitor is administered once or more daily, weekly, monthly, or yearly. In certain embodiments, the Notch pathway inhibitor is administered once every week. In certain embodiments, the Notch pathway inhibitor is administered once every two weeks. In certain embodiments, the Notch pathway inhibitor is administered once every three weeks. In certain embodiments, the Notch pathway inhibitor is administered once every four weeks.
  • dosage of an immunotherapeutic agent is from about 0.01 ⁇ g to about 100 mg/kg of body weight, from about 0.1 ⁇ g to about 100 mg/kg of body weight, from about 1 ⁇ g to about 100 mg/kg of body weight, from about 1 mg to about 100 mg/kg of body weight, about 1 mg to about 80 mg/kg of body weight from about 10 mg to about 100 mg/kg of body weight, from about 10 mg to about 75 mg/kg of body weight, or from about 10 mg to about 50 mg/kg of body weight.
  • the dosage of an immunotherapeutic agent is from about 0.01 mg to about 10 mg/kg of body weight. In certain embodiments, the dosage of an immunotherapeutic agent is from about 0.01 mg to about 5 mg/kg of body weight.
  • the dosage of an immunotherapeutic agent is from about 0.05 mg to about 10 mg/kg of body weight. In certain embodiments, the dosage of an immunotherapeutic agent is from about 0.1 mg to about 20 mg/kg of body weight. In some embodiments, an immunotherapeutic agent is administered to the subject at a dosage of about 2 mg/kg to about 15 mg/kg. In some embodiments, the Notch pathway inhibitor is administered to the subject at a dosage of about 5 mg/kg to about 15 mg/kg. In certain embodiments, an immunotherapeutic agent is administered once or more daily, weekly, monthly, or yearly. In certain embodiments, an immunotherapeutic agent is administered twice a week. In certain embodiments, an immunotherapeutic agent is administered once every week. In certain embodiments, an immunotherapeutic agent is administered once every two weeks. In certain embodiments, an immunotherapeutic agent is administered once every three weeks. In certain embodiments, an immunotherapeutic agent is administered once every four weeks.
  • dosage of an immunotherapeutic agent is determined by what is considered “standard-of-care” for a particular agent by those of skill in the art (e.g., treating physicians).
  • an inhibitor may be administered at an initial higher “loading” dose, followed by one or more lower doses.
  • the frequency of administration may also change.
  • a dosing regimen may comprise administering an initial dose, followed by additional doses (or “maintenance” doses) once a week, once every two weeks, once every three weeks, or once every month.
  • a dosing regimen may comprise administering an initial loading dose, followed by a weekly maintenance dose of, for example, one-half of the initial dose.
  • a dosing regimen may comprise administering an initial loading dose, followed by maintenance doses of, for example one-half of the initial dose every other week.
  • a dosing regimen may comprise administering three initial doses for 3 weeks, followed by maintenance doses of, for example, the same amount every other week.
  • any therapeutic agent may lead to side effects and/or toxicities.
  • the side effects and/or toxicities are so severe as to preclude administration of the particular agent at a therapeutically effective dose.
  • drug therapy must be discontinued, and other agents may be tried.
  • many agents in the same therapeutic class often display similar side effects and/or toxicities, meaning that the patient either has to stop therapy, or if possible, suffer from the unpleasant side effects associated with the therapeutic agent.
  • the present invention provides methods of treating cancer in a subject comprising using a dosing strategy for administering two or more agents that may reduce side effects and/or toxicities associated with administration of a Notch pathway inhibitor and/or an immunotherapeutic agent.
  • a method for treating cancer in a human subject comprises administering to the subject a therapeutically effective dose of a Notch pathway inhibitor in combination with a therapeutically effective dose of an immunotherapeutic agent, wherein one or both of the inhibitors are administered according to an intermittent dosing strategy.
  • the intermittent dosing strategy comprises administering an initial dose of a Notch pathway inhibitor to the subject, and administering subsequent doses of the Notch pathway inhibitor about once every 2 weeks.
  • the intermittent dosing strategy comprises administering an initial dose of a Notch pathway inhibitor to the subject, and administering subsequent doses of the Notch pathway inhibitor about once every 3 weeks. In some embodiments, the intermittent dosing strategy comprises administering an initial dose of a Notch pathway inhibitor to the subject, and administering subsequent doses of the Notch pathway inhibitor about once every 4 weeks. In some embodiments, the Notch pathway inhibitor is administered using an intermittent dosing strategy and the immunotherapeutic agent is administered once a week, once every two weeks, or once every three weeks.
  • Combination therapy with two or more therapeutic agents often uses agents that work by different mechanisms of action, although this is not required. Combination therapy using agents with different mechanisms of action may result in additive or synergetic effects. Combination therapy may allow for a lower dose of each agent than is used in monotherapy, thereby reducing toxic side effects and/or increasing the therapeutic index of the agent(s). Combination therapy may decrease the likelihood that resistant cancer cells will develop. Combination therapy comprising an immunotherapeutic agent may allow one agent to enhance the immune response to a tumor or tumor cells while the second agent may be effective at killing tumor cells more directly.
  • the combination of a Notch pathway inhibitor and an immunotherapeutic agent results in additive or synergetic results.
  • the combination therapy results in an increase in the therapeutic index of the Notch pathway inhibitor.
  • the combination therapy results in an increase in the therapeutic index of the immunotherapeutic agent.
  • the combination therapy results in a decrease in the toxicity and/or side effects of the Notch pathway inhibitor.
  • the combination therapy results in a decrease in the toxicity and/or side effects of the immunotherapeutic agent.
  • the treating physician can estimate repetition rates for dosing based on measured residence times and concentrations of the drug in bodily fluids or tissues.
  • the progress of therapy can be monitored by conventional techniques and assays.
  • treatment methods may further comprise administering at least one additional therapeutic agent prior to, concurrently with, and/or subsequently to administration of the Notch pathway inhibitor and/or the immunotherapeutic agent.
  • the additional therapeutic agent(s) will be administered substantially simultaneously or concurrently with the Notch pathway inhibitor or the immunotherapeutic agent.
  • a subject may be given the Notch pathway inhibitor and the immunotherapeutic agent while undergoing a course of treatment with the additional therapeutic agent (e.g., a chemotherapeutic agent).
  • the Notch pathway inhibitor and the immunotherapeutic agent will be administered within 1 year of the treatment with the additional therapeutic agent.
  • the Notch pathway inhibitor and the immunotherapeutic agent will be administered within 10, 8, 6, 4, or 2 months of any treatment with the additional therapeutic agent.
  • the Notch pathway inhibitor and the immunotherapeutic agent will be administered within 4, 3, 2, or 1 week of any treatment with the additional therapeutic agent.
  • the Notch pathway inhibitor and the immunotherapeutic agent will be administered within 5, 4, 3, 2, or 1 days of any treatment with the additional therapeutic agent. It will further be appreciated that the agents or treatment may be administered to the subject within a matter of hours or minutes (i.e., substantially simultaneously) with the Notch pathway inhibitor or the immunotherapeutic agent.
  • Therapeutic agents that may be administered in combination with a Notch pathway inhibitor and an immunotherapeutic agent include chemotherapeutic agents.
  • the method or treatment involves the administration of a Notch pathway inhibitor and immunotherapeutic agent of the present invention in combination with a chemotherapeutic agent or cocktail of multiple different chemotherapeutic agents.
  • Treatment with a Notch pathway inhibitor and immunotherapeutic agent can occur prior to, concurrently with, or subsequent to administration of chemotherapies.
  • Preparation and dosing schedules for such chemotherapeutic agents can be used according to manufacturers' instructions or as determined empirically by the skilled practitioner. Preparation and dosing schedules for such chemotherapy are also described in Chemotherapy Service, 1992, M. C. Perry, Editor, Williams & Wilkins, Baltimore, Md.
  • Chemotherapeutic agents useful in the instant invention include, but are not limited to, alkylating agents such as thiotepa and cyclosphosphamide; alkyl sulfonates such as busulfan, improsulfan, and piposulfan; aziridines such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylamelamines including altretamine, triethylenemelamine, trietylenephosphoramide, triethylenethiophosphaoramide and trimethylolomelamime; nitrogen mustards such as chlorambucil, chlornaphazine, cholophosphamide, estramustine, ifosfamide, mechlorethamine, mechlorethamine oxide hydrochloride, melphalan, novembichin, phenesterine, prednimustine, trofosfamide, uracil mustard; nitrosureas
  • Chemotherapeutic agents also include anti-hormonal agents that act to regulate or inhibit hormone action on tumors such as anti-estrogens including for example tamoxifen, raloxifene, aromatase inhibiting 4(5)-imidazoles, 4-hydroxytamoxifen, trioxifene, keoxifene, LY117018, onapristone, and toremifene; and antiandrogens such as flutamide, nilutamide, bicalutamide, leuprolide, and goserelin; and pharmaceutically acceptable salts, acids or derivatives of any of the above.
  • anti-estrogens including for example tamoxifen, raloxifene, aromatase inhibiting 4(5)-imidazoles, 4-hydroxytamoxifen, trioxifene, keoxifene, LY117018, onapristone, and toremifene
  • antiandrogens such as flutamide, nil
  • the chemotherapeutic agent is a topoisomerase inhibitor.
  • Topoisomerase inhibitors are chemotherapy agents that interfere with the action of a topoisomerase enzyme (e.g., topoisomerase I or II).
  • Topoisomerase inhibitors include, but are not limited to, doxorubicin HCl, daunorubicin citrate, mitoxantrone HCl, actinomycin D, etoposide, topotecan HCl, teniposide (VM-26), and irinotecan.
  • the chemotherapeutic agent is an anti-metabolite.
  • An anti-metabolite is a chemical with a structure that is similar to a metabolite required for normal biochemical reactions, yet different enough to interfere with one or more normal functions of cells, such as cell division.
  • Anti-metabolites include, but are not limited to, gemcitabine, fluorouracil, capecitabine, methotrexate sodium, ralitrexed, pemetrexed, tegafur, cytosine arabinoside, thioguanine, 5-azacytidine, 6-mercaptopurine, azathioprine, 6-thioguanine, pentostatin, fludarabine phosphate, and cladribine, as well as pharmaceutically acceptable salts, acids, or derivatives of any of these.
  • the chemotherapeutic agent is an antimitotic agent, including, but not limited to, agents that bind tubulin.
  • the agent is a taxane.
  • the agent is paclitaxel or docetaxel, or a pharmaceutically acceptable salt, acid, or derivative of paclitaxel or docetaxel.
  • the agent is paclitaxel (TAXOL), docetaxel (TAXOTERE), albumin-bound paclitaxel (nab-paclitaxel; ABRAXANE), DHA-paclitaxel, or PG-paclitaxel.
  • the antimitotic agent comprises a vinca alkaloid, such as vincristine, vinblastine, vinorelbine, or vindesine, or pharmaceutically acceptable salts, acids, or derivatives thereof.
  • the antimitotic agent is an inhibitor of kinesin Eg5 or an inhibitor of a mitotic kinase such as Aurora A or Plk1.
  • a DLL4 antagonist is administered in combination with an immune checkpoint inhibitor and at least one chemotherapeutic agent.
  • an anti-DLL4 antibody is administered in combination with an anti-PD-1 antibody and at least one chemotherapeutic agent.
  • demcizumab is administered in combination with pembrolizumab and at least one chemotherapeutic agent.
  • demcizumab is administered in combination with pembrolizumab, carboplatin, and pemetrexed.
  • demcizumab is administered in combination with pembrolizumab, carboplatin, and pemetrexed for the treatment of lung cancer.
  • demcizumab is administered in combination with pembrolizumab, carboplatin, and pemetrexed for the treatment of NSCLC. In some embodiments, demcizumab is administered in combination with nivolumab and at least one chemotherapeutic agent. In some embodiments, demcizumab is administered in combination with nivolumab, carboplatin, and pemetrexed. In some embodiments, demcizumab is administered in combination with nivolumab, carboplatin, and pemetrexed for the treatment of lung cancer. In some embodiments, demcizumab is administered in combination with nivolumab, carboplatin, and pemetrexed for the treatment of NSCLC.
  • an additional therapeutic agent that may be administered in combination with a Notch pathway inhibitor and an immunotherapeutic agent is an agent such as a small molecule.
  • treatment can involve the combined administration of a Notch pathway inhibitor and an immunotherapeutic agent with a small molecule that acts as an inhibitor against tumor-associated proteins including, but not limited to, EGFR, HER2 (ErbB2), and/or VEGF.
  • a Notch pathway inhibitor and an immunotherapeutic agent are administered in combination with a protein kinase inhibitor selected from the group consisting of: gefitinib (IRESSA), erlotinib (TARCEVA), sunitinib (SUTENT), lapatanib, vandetanib (ZACTIMA), AEE788, CI-1033, cediranib (RECENTIN), sorafenib (NEXAVAR), mereletinib (AZD9291), and pazopanib (GW786034B).
  • a protein kinase inhibitor selected from the group consisting of: gefitinib (IRESSA), erlotinib (TARCEVA), sunitinib (SUTENT), lapatanib, vandetanib (ZACTIMA), AEE788, CI-1033, cediranib (RECENTIN), sorafenib (NEXAVAR), mereletinib (AZD9291), and pazopanib (GW786034B
  • an additional therapeutic agent comprises a biological molecule, such as an antibody.
  • treatment can involve the combined administration of a Notch pathway inhibitor and an immunotherapeutic agent with antibodies against tumor-associated proteins including, but not limited to, antibodies that bind EGFR, HER2/ErbB2, and/or VEGF.
  • the additional therapeutic agent is an antibody specific for a cancer stem cell marker.
  • the additional therapeutic agent is an antibody that inhibits a cancer stem cell pathway.
  • the additional therapeutic agent is an antibody that is an angiogenesis inhibitor (e.g., an anti-VEGF or VEGF receptor antibody).
  • the additional therapeutic agent is bevacizumab (AVASTIN), ramucirumab, trastuzumab (HERCEPTIN), pertuzumab (OMNITARG), panitumumab (VECTIBIX), nimotuzumab, zalutumumab, or cetuximab (ERBITUX).
  • treatment can involve the combined administration of a Notch pathway inhibitor and an immunotherapeutic agent with other biologic molecules, such as one or more cytokines (e.g., lymphokines, interleukins, tumor necrosis factors, and/or growth factors) or can be accompanied by surgical removal of tumors, removal of cancer cells, or any other therapy deemed necessary by a treating physician.
  • cytokines e.g., lymphokines, interleukins, tumor necrosis factors, and/or growth factors
  • treatment can involve the combined administration of a Notch pathway inhibitor and an immunotherapeutic agent with a growth factor selected from the group consisting of, but not limited to: adrenomedullin (AM), angiopoietin (Ang), BMPs, BDNF, EGF, erythropoietin (EPO), FGF, GDNF, G-CSF, GM-CSF, GDF9, HGF, HDGF, IGF, migration-stimulating factor, myostatin (GDF-8), NGF, neurotrophins, PDGF, thrombopoietin, TGF- ⁇ , TGF- ⁇ , TNF- ⁇ , VEGF, P1GF, IL-1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-12, IL-15, and IL-18.
  • a growth factor selected from the group consisting of, but not limited to: adrenomedullin (AM), angiopoietin
  • treatment can involve the combined administration of a Notch pathway inhibitor and an immunotherapeutic agent with radiation therapy.
  • Treatment with a Notch pathway inhibitor and an immunotherapeutic agent can occur prior to, concurrently with, or subsequent to administration of radiation therapy. Dosing schedules for such radiation therapy can be determined by the skilled medical practitioner.
  • the present invention provides Notch pathway inhibitors described herein for use in methods of modulating immune responses, in methods of inhibiting tumor growth, and/or in methods of treating cancer, in combination with a second agent, wherein the second agent is an immunotherapeutic agent.
  • the Notch pathway inhibitor is a DLL4 antagonist.
  • the DLL4 antagonists can be referred to herein as “DLL4-binding agents”.
  • the DLL4-binding agent specifically binds human DLL4.
  • the DLL4-binding agent specifically binds at least one additional target or antigen.
  • the DLL4-binding agent is a polypeptide.
  • the DLL4-binding agent is an antibody.
  • the DLL4-binding agent is a bispecific antibody.
  • the DLL4-binding agent is a heterodimeric bispecific molecule.
  • the DLL4-binding agent is a homodimeric bispecific molecule.
  • the DLL4-binding agent is a bifunctional molecule comprising a DLL4-binding agent and an immunotherapeutic agent.
  • the DLL4 antagonist specifically binds the extracellular domain of human DLL4.
  • the DLL4 antagonist is an antibody.
  • the DLL4 antagonist specifically binds an epitope within amino acids 27-217 of the extracellular domain of human DLL4 (SEQ ID NO:17).
  • the DLL4 antagonist specifically binds within the N-terminal region of human DLL4 (SEQ ID NO:14).
  • the DLL4 antagonist binds an epitope comprising amino acids 66-73 (QAVVSPGP; SEQ ID NO:18) of human DLL4.
  • the DLL4 antagonist binds an epitope comprising amino acids 139-146 (LISKIAIQ; SEQ ID NO:19) of human DLL4. In some embodiments, the DLL4 antagonist binds an epitope comprising amino acids 66-73 (QAVVSPGP; SEQ ID NO:18) and amino acids 139-146 (LISKIAIQ; SEQ ID NO:19) of human DLL4.
  • the DLL4 antagonist (e.g., an antibody) binds human DLL4 with a dissociation constant (K D ) of about 1 ⁇ M or less, about 100 nM or less, about 40 nM or less, about 20 nM or less, about 10 nM or less, or about 1 nM or less. In certain embodiments, the DLL4 antagonist binds human DLL4 with a K D of about 40 nM or less, about 20 nM or less, about 10 nM or less, or about 1 nM or less. In certain embodiments, the DLL4 antagonist binds human DLL4 with a K D of about 1 nM.
  • K D dissociation constant
  • the DLL4 antagonist binds human DLL4 with a K D of about 0.8 nM. In certain embodiments, the DLL4 antagonist binds human DLL4 with a K D of about 0.6 nM. In certain embodiments, the DLL4 antagonist binds human DLL4 with a K D of about 0.5 nM. In certain embodiments, the DLL4 antagonist binds human DLL4 with a K D of about 0.4 nM. In some embodiments, the K D is measured by surface plasmon resonance.
  • the dissociation constant of the antagonist to DLL4 is the dissociation constant determined using a DLL4 fusion protein comprising a DLL4 extracellular domain (e.g., a DLL4 ECD-Fc fusion protein) immobilized on a Biacore chip.
  • a DLL4 fusion protein comprising a DLL4 extracellular domain (e.g., a DLL4 ECD-Fc fusion protein) immobilized on a Biacore chip.
  • the DLL4 antagonist (e.g., an antibody) binds DLL4 with a half maximal effective concentration (EC 50 ) of about 1 ⁇ M or less, about 100 nM or less, about 40 nM or less, about 20 nM or less, about 10 nM or less, or about 1 nM or less. In certain embodiments, the DLL4 antagonist binds human DLL4 with an EC 50 of about 40 nM or less, about 20 nM or less, about 10 nM or less, or about 1 nM or less.
  • EC 50 half maximal effective concentration
  • the Notch pathway inhibitor is a Notch receptor antagonist.
  • the Notch receptor antagonists can be referred to herein as “Notch-binding agents”.
  • the Notch-binding agent specifically binds human Notch1, Notch2, and/or Notch3.
  • the Notch-binding agent in addition to specifically binding at least one Notch receptor, specifically binds at least one additional target or antigen.
  • the Notch-binding agent is a polypeptide.
  • the Notch-binding agent is an antibody.
  • the Notch-binding agent is a bispecific antibody.
  • the Notch-binding agent is a heterodimeric bispecific molecule.
  • the Notch-binding agent is a homodimeric bispecific molecule.
  • the Notch-binding agent is a bifunctional molecule comprising a Notch-binding agent and an immunotherapeutic agent.
  • the Notch receptor antagonist specifically binds human Notch1, Notch2, and/or Notch3. In certain embodiments, the Notch receptor antagonist specifically binds human Notch1. In certain embodiments, the Notch receptor antagonist specifically binds human Notch2 and/or Notch3. In certain embodiments, the Notch receptor antagonist specifically binds human Notch2 and Notch3. In some embodiments, the Notch receptor antagonist is an antibody.
  • the Notch receptor antagonist (e.g., an antibody) binds one or more human Notch receptors with a dissociation constant (K D ) of about 1 ⁇ M or less, about 100 nM or less, about 40 nM or less, about 20 nM or less, about 10 nM or less, or about 1 nM or less. In certain embodiments, the Notch receptor antagonist binds one or more human Notch receptors with a K D of about 40 nM or less, about 20 nM or less, about 10 nM or less, or about 1 nM or less. In certain embodiments, the Notch receptor antagonist binds one or more human Notch receptors with a K D of about 1 nM.
  • K D dissociation constant
  • the Notch receptor antagonist binds one or more human Notch receptors with a K D of about 0.8 nM. In certain embodiments, the Notch receptor antagonist binds one or more human Notch receptors with a K D of about 0.6 nM. In certain embodiments, the Notch receptor antagonist binds one or more human Notch receptors with a K D of about 0.5 nM. In certain embodiments, the Notch receptor antagonist binds one or more human Notch receptors with a K D of about 0.4 nM. In some embodiments, the K D is measured by surface plasmon resonance.
  • the dissociation constant of the antagonist or antibody to one or more human Notch receptors is the dissociation constant determined using a Notch receptor fusion protein comprising a Notch receptor extracellular domain (e.g., a Notch2 ECD-Fc fusion protein) immobilized on a Biacore chip.
  • a Notch receptor fusion protein comprising a Notch receptor extracellular domain (e.g., a Notch2 ECD-Fc fusion protein) immobilized on a Biacore chip.
  • the Notch receptor antagonist (e.g., an antibody) binds one or more human Notch receptors with a half maximal effective concentration (EC 50 ) of about 1 ⁇ M or less, about 100 nM or less, about 40 nM or less, about 20 nM or less, about 10 nM or less, or about 1 nM or less. In certain embodiments, the Notch receptor antagonist binds one or more human Notch receptors with an EC 50 of about 40 nM or less, about 20 nM or less, about 10 nM or less, or about 1 nM or less.
  • EC 50 half maximal effective concentration
  • the Notch pathway inhibitor is a polypeptide. In certain embodiments, the Notch pathway inhibitor is an antibody. In certain embodiments, the antibody is an IgG antibody. In some embodiments, the antibody is an IgG1 antibody. In some embodiments, the antibody is an IgG2 antibody. In some embodiments, the antibody is an IgG4 antibody. In certain embodiments, the antibody is a monoclonal antibody. In some embodiments, the antibody is a bispecific antibody. In certain embodiments, the antibody is a humanized antibody. In certain embodiments, the antibody is a human antibody. In certain embodiments, the antibody is an antibody fragment comprising an antigen-binding site.
  • the Notch pathway inhibitors (e.g., antibodies) of the present invention can be assayed for specific binding by any method known in the art.
  • the immunoassays which can be used include, but are not limited to, competitive and non-competitive assay systems using techniques such as Biacore analysis, FACS analysis, immunofluorescence, immunocytochemistry, Western blot analysis, radioimmunoassay, ELISA, “sandwich” immunoassay, immunoprecipitation assay, precipitation reaction, gel diffusion precipitin reaction, immunodiffusion assay, agglutination assay, complement-fixation assay, immunoradiometric assay, fluorescent immunoassay, and protein A immunoassay.
  • a DLL4 antagonist e.g., an antibody
  • An ELISA assay comprises preparing DLL4 antigen, coating wells of a 96 well microtiter plate with antigen, adding to the wells the DLL4 antagonist or antibody conjugated to a detectable compound such as an enzymatic substrate (e.g., horseradish peroxidase or alkaline phosphatase), incubating for a period of time and detecting the presence of the binding agent or antibody.
  • an enzymatic substrate e.g., horseradish peroxidase or alkaline phosphatase
  • the DLL4 antagonist or antibody is not conjugated to a detectable compound, but instead a second conjugated antibody that recognizes the DLL4 antagonist or antibody is added to the well.
  • the DLL4 antagonist or antibody instead of coating the well with DLL4 antigen, can be coated on the well, antigen is added to the coated well and then a second antibody conjugated to a detectable compound is added.
  • the specific binding of a DLL4 antagonist (e.g., an antibody) to human DLL4 may be determined using FACS.
  • a FACS screening assay may comprise generating a cDNA construct that expresses an antigen as a fusion protein, transfecting the construct into cells, expressing the antigen on the surface of the cells, mixing the DLL4 antagonist with the transfected cells, and incubating for a period of time.
  • the cells bound by the DLL4 antagonist may be identified by using a secondary antibody conjugated to a detectable compound (e.g., PE-conjugated anti-Fc antibody) and a flow cytometer.
  • a detectable compound e.g., PE-conjugated anti-Fc antibody
  • a competitive binding assay is a radioimmunoassay comprising the incubation of labeled antigen (e.g., 3 H or 125 I), or fragment or variant thereof, with the agent of interest in the presence of increasing amounts of unlabeled antigen followed by the detection of the agent bound to the labeled antigen.
  • labeled antigen e.g., 3 H or 125 I
  • the affinity of the agent for the antigen and the on-off rates can be determined from the data by Scatchard plot analysis.
  • Biacore kinetic analysis is used to determine the binding affinities and on-off rates of antagonists or binding agents.
  • Biacore kinetic analysis comprises analyzing the binding and dissociation of binding agents from antigens (e.g., DLL4 or Notch proteins) that have been immobilized on the surface of a Biacore chip.
  • Biacore kinetic analyses can be used to study binding of different binding agents in qualitative epitope competition binding assays.
  • a method comprises a Notch pathway inhibitor that is a DLL4-binding agent.
  • the DLL4-binding agent is a DLL4 antagonist.
  • the DLL4 antagonist is an antibody that specifically binds human DLL4.
  • the DLL4 antagonist is an antibody that specifically binds the extracellular domain of human DLL4.
  • the antibody that specifically binds the extracellular domain of human DLL4 comprises a heavy chain CDR1 comprising TAYYIH (SEQ ID NO:1), a heavy chain CDR2 comprising YISCYNGATNYNQKFKG (SEQ ID NO:2), YISSYNGATNYNQKFKG (SEQ ID NO:3), or YISVYNGATNYNQKFKG (SEQ ID NO:4), and a heavy chain CDR3 comprising RDYDYDVGMDY (SEQ ID NO:5).
  • the antibody further comprises a light chain CDR1 comprising RASESVDNYGISFMK (SEQ ID NO:6), a light chain CDR2 comprising AASNQGS (SEQ ID NO:7), and a light chain CDR3 comprising QQSKEVPWTFGG (SEQ ID NO:8).
  • the antibody comprises a light chain CDR1 comprising RASESVDNYGISFMK (SEQ ID NO:6), a light chain CDR2 comprising AASNQGS (SEQ ID NO:7), and a light chain CDR3 comprising QQSKEVPWTFGG (SEQ ID NO:8).
  • the DLL4 antagonist is an antibody which comprises a heavy chain CDR1 comprising TAYYIH (SEQ ID NO:1), a heavy chain CDR2 comprising YISSYNGATNYNQKFKG (SEQ ID NO:3), and a heavy chain CDR3 comprising RDYDYDVGMDY (SEQ ID NO:5); and a light chain CDR1 comprising RASESVDNYGISFMK (SEQ ID NO:6), a light chain CDR2 comprising AASNQGS (SEQ ID NO:7), and a light chain CDR3 comprising QQSKEVPWTFGG (SEQ ID NO:8).
  • a method comprises an antibody that specifically binds the extracellular domain of human DLL4, wherein the antibody comprises a heavy chain variable region having at least about 80% sequence identity to SEQ ID NO:9, SEQ ID NO:10, or SEQ ID NO:11, and/or a light chain variable region having at least 80% sequence identity to SEQ ID NO:12.
  • the antibody comprises a heavy chain variable region having at least about 85%, at least about 90%, at least about 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:9, SEQ ID NO:10, or SEQ ID NO:11.
  • the antibody comprises a light chain variable region having at least about 85%, at least about 90%, at least about 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:12. In certain embodiments, the antibody comprises a heavy chain variable region having at least about 95% sequence identity to SEQ ID NO:9 and/or a light chain variable region having at least about 95% sequence identity to SEQ ID NO:12. In certain embodiments, the antibody comprises a heavy chain variable region comprising SEQ ID NO:9, and/or a light chain variable region comprising SEQ ID NO:12. In certain embodiments, the antibody comprises a heavy chain variable region comprising SEQ ID NO:9 and a light chain variable region comprising SEQ ID NO:12.
  • the antibody comprises a heavy chain variable region having at least about 95% sequence identity to SEQ ID NO:10 and/or a light chain variable region having at least about 95% sequence identity to SEQ ID NO:12. In certain embodiments, the antibody comprises a heavy chain variable region comprising SEQ ID NO:10 and/or a light chain variable region comprising SEQ ID NO:12. In certain embodiments, the antibody comprises a heavy chain variable region comprising SEQ ID NO:10 and a light chain variable region comprising SEQ ID NO:12. In certain embodiments, the antibody comprises a heavy chain variable region having at least about 95% sequence identity to SEQ ID NO:11 and/or a light chain variable region having at least about 95% sequence identity to SEQ ID NO:12.
  • the antibody comprises a heavy chain variable region comprising SEQ ID NO:11 and/or a light chain variable region comprising SEQ ID NO:12. In certain embodiments, the antibody comprises a heavy chain variable region comprising SEQ ID NO:11 and a light chain variable region comprising SEQ ID NO:12.
  • a method comprises the antibody produced by the hybridoma deposited with the American Type Culture Collection (ATCC), at 10801 University Boulevard, Manassas, Va., 20110, under the conditions of the Budapest Treaty on Sep. 28, 2007 and having ATCC deposit number PTA-8670, also known as murine 21M18.
  • ATCC American Type Culture Collection
  • the murine 21M18 antibody is described in detail in U.S. Pat. No. 7,750,124, filed Sep. 28, 2007.
  • a method comprises an antibody comprising the heavy chain CDRs and light chain CDRs of the antibody produced by the hybridoma deposited with ATCC on Sep. 28, 2007 and having ATCC deposit number PTA-8670.
  • a method comprises an antibody comprising the heavy chain variable region and the light chain variable region encoded by the plasmid DNA deposited with ATCC at 10801 University Boulevard, Manassas, Va., 20110, under the conditions of the Budapest Treaty on May 10, 2007, and having ATCC deposit number PTA-8425.
  • a method comprises the antibody encoded by the plasmid DNA deposited with ATCC on May 10, 2007, having ATCC deposit number PTA-8425, also known as 21M18 H7L2 and OMP-21M18.
  • the OMP-21M18 antibody is described in detail in U.S. Pat. No. 7,750,124, filed Sep. 28, 2007. This antibody is also known as demcizumab.
  • a Notch pathway inhibitor is a polypeptide.
  • the polypeptides include, but are not limited to, antibodies that specifically bind human DLL4.
  • a polypeptide comprises one, two, three, four, five, and/or six of the CDRs of demcizumab (OMP-21M18).
  • a polypeptide comprises CDRs with up to four (i.e., 0, 1, 2, 3, or 4) amino acid substitutions per CDR.
  • the heavy chain CDR(s) are contained within a heavy chain variable region.
  • the light chain CDR(s) are contained within a light chain variable region.
  • a Notch pathway inhibitor comprises a polypeptide comprising a sequence selected from the group consisting of: SEQ ID NO:9, SEQ ID NO:10, SEQ ID NO:11, and SEQ ID NO:12.
  • a Notch pathway inhibitor comprises the heavy chain variable region and light chain variable region of demcizumab. In certain embodiments, a Notch pathway inhibitor comprises the heavy chain and light chain of the demcizumab (with or without the leader sequence). In certain embodiments, a Notch pathway inhibitor comprises, consists essentially of, or consists of, demcizumab.
  • a method comprises a DLL4 antagonist (e.g., antibody) that competes for specific binding to human DLL4 with an antibody that comprises a heavy chain variable region comprising SEQ ID NO:10 and a light chain variable region comprising SEQ ID NO:12.
  • the DLL4 antagonist competes with demcizumab for specific binding to human DLL4.
  • the DLL4 antagonist e.g., an antibody
  • the DLL4 antagonist competes with demcizumab for specific binding to human DLL4 in an in vitro competitive binding assay.
  • a method comprises a DLL4 antagonist (e.g., an antibody) that binds the same epitope, or essentially the same epitope, on human DLL4 as an antibody of the invention.
  • a DLL4 antagonist is an antibody that binds an epitope on human DLL4 that overlaps with the epitope on DLL4 bound by an antibody of the invention.
  • the DLL4 antagonist e.g., an antibody
  • the DLL4 antagonist is an antibody that binds an epitope on human DLL4 that overlaps with the epitope on DLL4 bound by demcizumab.
  • a method comprises a Notch pathway inhibitor that is a Notch-binding agent.
  • the Notch-binding agent is a Notch receptor antagonist.
  • the Notch receptor antagonist is an antibody that specifically binds human Notch2 and/or Notch3.
  • the Notch receptor antagonist is an antibody that specifically binds the extracellular domain of human Notch2 and/or Notch3.
  • the antibody that specifically binds the extracellular domain of human Notch2 and/or Notch3 comprises a heavy chain CDR1 comprising SSSGMS (SEQ ID NO:34), a heavy chain CDR2 comprising VIASSGSNTYYADSVKG (SEQ ID NO:35), and a heavy chain CDR3 comprising SIFYTT (SEQ ID NO:36).
  • the antibody further comprises a light chain CDR1 comprising RASQSVRSNYLA (SEQ ID NO:37), a light chain CDR2 comprising GASSRAT (SEQ ID NO:38), and a light chain CDR3 comprising QQYSNFPI (SEQ ID NO:39).
  • the antibody comprises a light chain CDR1 comprising RASQSVRSNYLA (SEQ ID NO:37), a light chain CDR2 comprising GASSRAT (SEQ ID NO:38), and a light chain CDR3 comprising QQYSNFPI (SEQ ID NO:39).
  • the Notch receptor antagonist is an antibody which comprises a heavy chain CDR1 comprising SSSGMS (SEQ ID NO:34), a heavy chain CDR2 comprising VIASSGSNTYYADSVKG (SEQ ID NO:35), and a heavy chain CDR3 comprising SIFYTT (SEQ ID NO:36); and a light chain CDR1 comprising RASQSVRSNYLA (SEQ ID NO:37), a light chain CDR2 comprising GASSRAT (SEQ ID NO:38), and a light chain CDR3 comprising QQYSNFPI (SEQ ID NO:39).
  • a method comprises an antibody that specifically binds the extracellular domain of human Notch2 and/or Notch3, wherein the antibody comprises a heavy chain variable region having at least about 80% sequence identity to SEQ ID NO:40 and/or a light chain variable region having at least 80% sequence identity to SEQ ID NO:41.
  • the antibody comprises a heavy chain variable region having at least about 85%, at least about 90%, at least about 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:40.
  • the antibody comprises a light chain variable region having at least about 85%, at least about 90%, at least about 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:41. In certain embodiments, the antibody comprises a heavy chain variable region having at least about 95% sequence identity to SEQ ID NO:40 and/or a light chain variable region having at least about 95% sequence identity to SEQ ID NO:41. In certain embodiments, the antibody comprises a heavy chain variable region comprising SEQ ID NO:40 and/or a light chain variable region comprising SEQ ID NO:41. In certain embodiments, the antibody comprises a heavy chain variable region comprising SEQ ID NO:40 and a light chain variable region comprising SEQ ID NO:41.
  • a method comprises an antibody comprising the heavy chain variable region and the light chain variable region encoded by the plasmid DNA deposited with ATCC at 10801 University Boulevard, Manassas, Va., 20110, under the conditions of the Budapest Treaty on Jul. 6, 2009, and having ATCC deposit number PTA-10170, also known as 59R5 and OMP-59R5.
  • the OMP-59R5 antibody is described in detail in U.S. Pat. No. 8,226,943, filed Jul. 8, 2009. This antibody is also known as tarextumab.
  • the Notch receptor antagonist is an antibody that specifically binds human Notch1.
  • the Notch receptor antagonist is an antibody that specifically binds a non-ligand binding membrane proximal region of the extracellular domain of human Notch1.
  • the antibody that specifically binds human Notch1 comprises a heavy chain CDR1 comprising RGYWIE (SEQ ID NO:46), a heavy chain CDR2 comprising QILPGTGRTNYNEKFKG (SEQ ID NO:47), and a heavy chain CDR3 comprising FDGNYGYYAMDY (SEQ ID NO:48).
  • the antibody further comprises a light chain CDR1 comprising RSSTGAVTTSNYAN (SEQ ID NO:49), a light chain CDR2 comprising GTNNRAP (SEQ ID NO:50), and a light chain CDR3 comprising ALWYSNHWVFGGGTKL (SEQ ID NO:51).
  • the antibody comprises a light chain CDR1 comprising RSSTGAVTTSNYAN (SEQ ID NO:49), a light chain CDR2 comprising GTNNRAP (SEQ ID NO:50), and a light chain CDR3 comprising ALWYSNHWVFGGGTKL (SEQ ID NO:51).
  • the Notch receptor antagonist is an antibody which comprises a heavy chain CDR1 comprising RGYWIE (SEQ ID NO:46), a heavy chain CDR2 comprising QILPGTGRTNYNEKFKG (SEQ ID NO:47), and a heavy chain CDR3 comprising FDGNYGYYAMDY (SEQ ID NO:48); and a light chain CDR1 comprising RSSTGAVTTSNYAN (SEQ ID NO:49), a light chain CDR2 comprising GTNNRAP (SEQ ID NO:50), and a light chain CDR3 comprising ALWYSNHWVFGGGTKL (SEQ ID NO:51).
  • a method comprises an antibody that specifically binds human Notch1, wherein the antibody comprises a heavy chain variable region having at least about 80% sequence identity to SEQ ID NO:52 and/or a light chain variable region having at least 80% sequence identity to SEQ ID NO:53.
  • the antibody comprises a heavy chain variable region having at least about 85%, at least about 90%, at least about 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:52.
  • the antibody comprises a light chain variable region having at least about 85%, at least about 90%, at least about 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:53.
  • the antibody comprises a heavy chain variable region having at least about 95% sequence identity to SEQ ID NO:52 and/or a light chain variable region having at least about 95% sequence identity to SEQ ID NO:53. In certain embodiments, the antibody comprises a heavy chain variable region comprising SEQ ID NO:52 and/or a light chain variable region comprising SEQ ID NO:53. In certain embodiments, the antibody comprises a heavy chain variable region comprising SEQ ID NO:52 and a light chain variable region comprising SEQ ID NO:53.
  • a method comprises an antibody comprising the heavy chain CDRs and light chain CDRs of the antibody produced by the hybridoma deposited with the American Type Culture Collection (ATCC), at 10801 University Boulevard, Manassas, Va., 20110, under the conditions of the Budapest Treaty on Aug. 7, 2008 and having ATCC deposit number PTA-9405, also known as murine 52M51.
  • ATCC American Type Culture Collection
  • the murine 52M51 antibody is described in detail in U.S. Pat. No. 8,435,513, filed Jul. 8, 2009.
  • a method comprises an antibody comprising the heavy chain variable region and the light chain variable region encoded by the plasmid DNA deposited with ATCC at 10801 University Boulevard, Manassas, Va., 20110, under the conditions of the Budapest Treaty on Oct. 15, 2008, and having ATCC deposit number PTA-9549, also known as 52M51-H4L3 and OMP-h52M51.
  • the OMP-h52M51 antibody is described in detail in U.S. Pat. No. 8,435,513, filed Jul. 8, 2009. This antibody is also known as brontictuzumab.
  • a Notch pathway inhibitor is a polypeptide.
  • the polypeptides include, but are not limited to, antibodies that specifically bind human Notch2 and/or Notch3, and antibodies that specifically bind human Notch1.
  • a polypeptide comprises one, two, three, four, five, and/or six of the CDRs of tarextumab (OMP-59R5).
  • a polypeptide comprises one, two, three, four, five, and/or six of the CDRs of brontictuzumab (OMP-h52M51).
  • a polypeptide comprises CDRs with up to four (i.e., 0, 1, 2, 3, or 4) amino acid substitutions per CDR.
  • the heavy chain CDR(s) are contained within a heavy chain variable region.
  • the light chain CDR(s) are contained within a light chain variable region.
  • a Notch pathway inhibitor comprises a polypeptide comprising a sequence of SEQ ID NO:40 and/or SEQ ID NO:41.
  • a Notch pathway inhibitor comprises the heavy chain variable region and light chain variable region of tarextumab. In certain embodiments, a Notch pathway inhibitor comprises the heavy chain and light chain of the tarextumab (with or without the leader sequence). In certain embodiments, a Notch pathway inhibitor comprises, consists essentially of, or consists of, tarextumab.
  • a method comprises a Notch receptor antagonist (e.g., antibody) that competes for specific binding to human Notch2 and/or Notch3 with an antibody that comprises a heavy chain variable region comprising SEQ ID NO:40 and a light chain variable region comprising SEQ ID NO:41.
  • the Notch receptor antagonist competes with tarextumab for specific binding to human Notch2 and/or Notch3.
  • the Notch receptor antagonist e.g., an antibody
  • a method comprises a Notch receptor antagonist (e.g., an antibody) that binds the same epitope, or essentially the same epitope, on human Notch2 and/or Notch3 as an antibody of the invention.
  • a Notch receptor antagonist is an antibody that binds an epitope on human Notch2 and/or Notch3 that overlaps with the epitope on Notch2 and/or Notch3 bound by an antibody of the invention.
  • the Notch receptor antagonist e.g., an antibody
  • the Notch receptor antagonist binds the same epitope or essentially the same epitope on human Notch2 and/or Notch3 as tarextumab.
  • the Notch receptor antagonist is an antibody that binds an epitope on human Notch2 and/or Notch3 that overlaps with the epitope on Notch2 and/or Notch3 bound by tarextumab.
  • a Notch pathway inhibitor comprises a polypeptide comprising a sequence of SEQ ID NO:52 and/or SEQ ID NO:53.
  • a Notch pathway inhibitor comprises the heavy chain variable region and light chain variable region of brontictuzumab. In certain embodiments, a Notch pathway inhibitor comprises the heavy chain and light chain of the brontictuzumab (with or without the leader sequence). In certain embodiments, a Notch pathway inhibitor comprises, consists essentially of, or consists of, brontictuzumab.
  • a method comprises a Notch receptor antagonist (e.g., antibody) that competes for specific binding to human Notch1 with an antibody that comprises a heavy chain variable region comprising SEQ ID NO:52 and a light chain variable region comprising SEQ ID NO:53.
  • the Notch receptor antagonist competes with brontictuzumab for specific binding to human Notch1.
  • the Notch receptor antagonist (e.g., an antibody) competes with brontictuzumab for specific binding to human Notch1 in an in vitro competitive binding assay.
  • a method comprises a Notch receptor antagonist (e.g., an antibody) that binds the same epitope, or essentially the same epitope, on human Notch1 as an antibody of the invention.
  • a Notch receptor antagonist is an antibody that binds an epitope on human Notch1 that overlaps with the epitope on Notch1 bound by an antibody of the invention.
  • the Notch receptor antagonist e.g., an antibody
  • the Notch receptor antagonist is an antibody that binds an epitope on human Notch1 that overlaps with the epitope on Notch1 bound by brontictuzumab.
  • the Notch pathway inhibitor is a polyclonal antibody.
  • Polyclonal antibodies can be prepared by any known method.
  • polyclonal antibodies are raised by immunizing an animal (e.g., a rabbit, rat, mouse, goat, donkey) by multiple subcutaneous or intraperitoneal injections of the relevant antigen (e.g., a purified peptide fragment, full-length recombinant protein, or fusion protein).
  • the antigen can be optionally conjugated to a carrier such as keyhole limpet hemocyanin (KLH) or serum albumin.
  • KLH keyhole limpet hemocyanin
  • the antigen (with or without a carrier protein) is diluted in sterile saline and usually combined with an adjuvant (e.g., Complete or Incomplete Freund's Adjuvant) to form a stable emulsion.
  • an adjuvant e.g., Complete or Incomplete Freund's Adjuvant
  • polyclonal antibodies are recovered from blood and/or ascites of the immunized animal.
  • the polyclonal antibodies can be purified from serum or ascites according to standard methods in the art including, but not limited to, affinity chromatography, ion-exchange chromatography, gel electrophoresis, and dialysis.
  • the Notch pathway inhibitor is a monoclonal antibody.
  • Monoclonal antibodies can be prepared using hybridoma methods known to one of skill in the art. In some embodiments, using the hybridoma method, a mouse, hamster, rat, or other appropriate host animal, is immunized as described above to elicit from lymphocytes the production of antibodies that will specifically bind the immunizing antigen. In some embodiments, lymphocytes can be immunized in vitro. In some embodiments, the immunizing antigen can be a human protein or a portion thereof. In some embodiments, the immunizing antigen can be a mouse protein or a portion thereof.
  • lymphocytes are isolated and fused with a suitable myeloma cell line using, for example, polyethylene glycol, to form hybridoma cells that can then be selected away from unfused lymphocytes and myeloma cells.
  • Hybridomas that produce monoclonal antibodies directed specifically against a chosen antigen may be identified by a variety of methods including, but not limited to, immunoprecipitation, immunoblotting, and in vitro binding assay (e.g., flow cytometry, FACS, ELISA, and radioimmunoassay).
  • the hybridomas can be propagated either in in vitro culture using standard methods or in vivo as ascites tumors in an animal.
  • the monoclonal antibodies can be purified from the culture medium or ascites fluid according to standard methods in the art including, but not limited to, affinity chromatography, ion-exchange chromatography, gel electrophoresis, and dialysis.
  • monoclonal antibodies can be made using recombinant DNA techniques known to one skilled in the art.
  • the polynucleotides encoding a monoclonal antibody are isolated from mature B-cells or hybridoma cells, such as by RT-PCR using oligonucleotide primers that specifically amplify genes encoding the heavy and light chains of the antibody, and their sequence is determined using conventional techniques.
  • the isolated polynucleotides encoding the heavy and light chains are then cloned into suitable expression vectors which produce the monoclonal antibodies when transfected into host cells such as E.
  • recombinant monoclonal antibodies, or fragments thereof can be isolated from phage display libraries.
  • the polynucleotide(s) encoding a monoclonal antibody can be further modified in a number of different manners using recombinant DNA technology to generate alternative antibodies.
  • the constant domains of the light and heavy chains of, for example, a mouse monoclonal antibody can be substituted for those regions of, for example, a human antibody to generate a chimeric antibody, or for a non-immunoglobulin polypeptide to generate a fusion antibody.
  • the constant regions are truncated or removed to generate the desired antibody fragment of a monoclonal antibody.
  • site-directed or high-density mutagenesis of the variable region can be used to optimize specificity, affinity, etc. of a monoclonal antibody.
  • the Notch pathway inhibitor is a humanized antibody.
  • humanized antibodies are human immunoglobulins in which amino acid residues within the CDRs are replaced by amino acid residues from CDRs of a non-human species (e.g., mouse, rat, rabbit, hamster, etc.) that have the desired specificity, affinity, and/or binding capability using methods known to one skilled in the art.
  • the framework region amino acid residues of a human immunoglobulin are replaced with corresponding amino acid residues in an antibody from a non-human species.
  • the humanized antibody can be further modified by the substitution of additional amino acid residues either in the framework region and/or within the replaced non-human residues to further refine and optimize antibody specificity, affinity, and/or capability.
  • the humanized antibody will comprise variable domain regions containing all, or substantially all, of the CDRs that correspond to the non-human immunoglobulin whereas all, or substantially all, of the framework regions are those of a human immunoglobulin sequence.
  • the humanized antibody can also comprise at least a portion of an immunoglobulin constant region or domain (Fc), typically that of a human immunoglobulin.
  • Fc immunoglobulin constant region or domain
  • such humanized antibodies are used therapeutically because they may reduce antigenicity and HAMA (human anti-mouse antibody) responses when administered to a human subject.
  • the Notch pathway inhibitor is a human antibody.
  • Human antibodies can be directly prepared using various techniques known in the art.
  • immortalized human B lymphocytes immunized in vitro or isolated from an immunized individual that produces an antibody directed against a target antigen can be generated.
  • the human antibody can be selected from a phage library, where that phage library expresses human antibodies.
  • phage display technology can be used to produce human antibodies and antibody fragments in vitro, from immunoglobulin variable domain gene repertoires from unimmunized donors. Techniques for the generation and use of antibody phage libraries are well-known in the art and antibody phage libraries are commercially available. Affinity maturation strategies including, but not limited to, chain shuffling and site-directed mutagenesis, are known in the art and may be employed to generate high affinity human antibodies.
  • human antibodies can be made in transgenic mice that contain human immunoglobulin loci. These mice are capable, upon immunization, of producing the full repertoire of human antibodies in the absence of endogenous immunoglobulin production.
  • bispecific antibodies specifically recognizes human DLL4 or a human Notch receptor.
  • Bispecific antibodies are capable of specifically recognizing and binding at least two different epitopes.
  • the different epitopes can either be within the same molecule (e.g., two different epitopes on human DLL4) or on different molecules (e.g., one epitope on DLL4 and a different epitope on a second protein).
  • the bispecific antibody is a monoclonal human or a humanized antibody.
  • the bispecific antibody comprises an intact antibody.
  • the bispecific antibody is an antibody fragment.
  • the antibody is multispecific.
  • the antibody can specifically recognize and bind a first antigen target (e.g., DLL4 or a Notch receptor) as well as a second antigen target (e.g., CD2, CD3, CD28, CD80 or CD86) or a Fc receptor (e.g., CD64, CD32, or CD16).
  • a first antigen target e.g., DLL4 or a Notch receptor
  • a second antigen target e.g., CD2, CD3, CD28, CD80 or CD86
  • a Fc receptor e.g., CD64, CD32, or CD16
  • the antibody can be used to direct cytotoxic agents to cells which express a particular target antigen.
  • These antibodies possess an antigen-binding arm and an arm which binds a cytotoxic agent or a radionuclide chelator, such as EOTUBE, DPTA, DOTA, or TETA. Techniques for making bispecific or multispecific antibodies are known by those skilled in the art.
  • the methods of the invention comprise a DLL4 antagonist which is a bispecific antibody that specifically binds human DLL4 and human VEGF.
  • the bispecific antibody comprises: a) a first antigen-binding site that specifically binds human VEGF, and b) a second antigen-binding site that specifically binds human DLL4, wherein the first antigen-binding site comprises a heavy chain CDR1 comprising NYWMH (SEQ ID NO:20), a heavy chain CDR2 comprising DINPSNGRTSYKEKFKR (SEQ ID NO:21), and a heavy chain CDR3 comprising HYDDKYYPLMDY (SEQ ID NO:22); wherein the second antigen-binding site comprises a heavy chain CDR1 comprising TAYYIH (SEQ ID NO:1), a heavy chain CDR2 comprising YIX 1 X 2 YX 3 X 4 ATNYNQKFKG (SEQ ID NO:26), wherein
  • the bispecific antibody comprises: a) a first antigen-binding site that specifically binds human VEGF, and b) a second antigen-binding site that specifically binds human DLL4, wherein the first antigen-binding site comprises a heavy chain CDR1 comprising NYWMH (SEQ ID NO:20), a heavy chain CDR2 comprising DINPSNGRTSYKEKFKR (SEQ ID NO:21), and a heavy chain CDR3 comprising HYDDKYYPLMDY (SEQ ID NO:22); wherein the second antigen-binding site comprises a heavy chain CDR1 comprising TAYYIH (SEQ ID NO:1), a heavy chain CDR2 comprising YIANYNRATNYNQKFKG (SEQ ID NO:24), and a heavy chain CDR3 comprising RDYDYDVGMDY (SEQ ID NO:5); and wherein both the first and second antigen-binding sites comprise a light chain CDR1 comprising RASESVD
  • the bispecific antibody comprises: a) a first antigen-binding site that specifically binds human VEGF, and b) a second antigen-binding site that specifically binds human DLL4, wherein the first antigen-binding site comprises a heavy chain CDR1 comprising NYWMH (SEQ ID NO:20), a heavy chain CDR2 comprising DINPSNGRTSYKEKFKR (SEQ ID NO:21), and a heavy chain CDR3 comprising HYDDKYYPLMDY (SEQ ID NO:22); wherein the second antigen-binding site comprises a heavy chain CDR1 comprising TAYYIH (SEQ ID NO:1), a heavy chain CDR2 comprising YISSYNGATNYNQKFKG (SEQ ID NO:3), and a heavy chain CDR3 comprising RDYDYDVGMDY (SEQ ID NO:5); and wherein both the first and second antigen-binding sites comprise a light chain CDR1 comprising RASESVD
  • the a bispecific antibody comprises: a) a first antigen-binding site that specifically binds human VEGF, and b) a second antigen-binding site that specifically binds human DLL4, wherein the first antigen-binding site comprises a heavy chain CDR1 comprising NYWMH (SEQ ID NO:20), a heavy chain CDR2 comprising DINPSNGRTSYKEKFKR (SEQ ID NO:21), and a heavy chain CDR3 comprising HYDDKYYPLMDY (SEQ ID NO:22); wherein the second antigen-binding site comprises a heavy chain CDR1 comprising TAYYIH (SEQ ID NO:1), a heavy chain CDR2 comprising YIAGYKDATNYNQKFKG (SEQ ID NO:23), and a heavy chain CDR3 comprising RDYDYDVGMDY (SEQ ID NO:5); and wherein both the first and second antigen-binding sites comprise a light chain CDR1 comprising
  • the bispecific antibody comprises: a) a first antigen-binding site that specifically binds human VEGF, and b) a second antigen-binding site that specifically binds human DLL4, wherein the first antigen-binding site comprises a heavy chain CDR1 comprising NYWMH (SEQ ID NO:20), a heavy chain CDR2 comprising DINPSNGRTSYKEKFKR (SEQ ID NO:21), and a heavy chain CDR3 comprising HYDDKYYPLMDY (SEQ ID NO:22); wherein the second antigen-binding site comprises a heavy chain CDR1 comprising TAYYIH (SEQ ID NO:1), a heavy chain CDR2 comprising YISNYNRATNYNQKFKG (SEQ ID NO:25), and a heavy chain CDR3 comprising RDYDYDVGMDY (SEQ ID NO:5); and wherein both the first and second antigen-binding sites comprise a light chain CDR1 comprising RASESVD
  • the methods of the invention comprise a bispecific antibody that comprises a first antigen-binding site that specifically binds human VEGF, and a second antigen-binding site that specifically binds human DLL4, wherein the first antigen-binding site comprises a first heavy chain variable region of SEQ ID NO:30, the second antigen-binding site comprises a second heavy chain variable region of SEQ ID NO:29; and wherein the first and the second antigen-binding site comprises a first and a second light chain variable region of SEQ ID NO:12.
  • the methods of the invention comprise a bispecific antibody that specifically binds human VEGF and specifically binds human DLL4, wherein the antibody comprises a first heavy chain of SEQ ID NO:32 and a second heavy chain of SEQ ID NO:31; and a first and a second light chain of SEQ ID NO:33.
  • the bispecific antibody specifically binds DLL4, as well as VEGF.
  • the bispecific antibody is a bispecific antibody disclosed in U.S. patent application Ser. No. 13/625,417, filed on Sep. 24, 2012.
  • the anti-VEGF/DLL4 bispecific antibody is 219R45-MB-21M18, 219R45-MB-21R79, 219R45-MB-21R75, or 219R45-MB-21R83 (also referred to as 305B83 or OMP-305B83) as disclosed in U.S. patent application Ser. No. 13/625,417, filed on Sep. 24, 2012.
  • the bispecific antibody is OMP-305B83.
  • the bispecific antibody specifically binds DLL4 and specifically binds PD-1. In some embodiments, the bispecific antibody specifically binds DLL4 and specifically binds PD-L1.
  • the antibodies (or other polypeptides) described herein may be monospecific.
  • each of the one or more antigen-binding sites that an antibody contains is capable of binding (or binds) a homologous epitope on different proteins.
  • the Notch pathway inhibitor is an antibody fragment comprising an antigen-binding site.
  • Antibody fragments may have different functions or capabilities than intact antibodies; for example, antibody fragments can have increased tumor penetration.
  • Various techniques are known for the production of antibody fragments including, but not limited to, proteolytic digestion of intact antibodies.
  • antibody fragments include a F(ab′)2 fragment produced by pepsin digestion of an antibody molecule.
  • antibody fragments include a Fab fragment generated by reducing the disulfide bridges of an F(ab′)2 fragment.
  • antibody fragments include a Fab fragment generated by the treatment of the antibody molecule with papain and a reducing agent.
  • antibody fragments are produced recombinantly.
  • antibody fragments include Fv or single chain Fv (scFv) fragments.
  • Fab, Fv, and scFv antibody fragments can be expressed in and secreted from E. coli or other host cells, allowing for the production of large amounts of these fragments.
  • antibody fragments are isolated from antibody phage libraries as discussed herein. For example, methods can be used for the construction of Fab expression libraries to allow rapid and effective identification of monoclonal Fab fragments with the desired specificity for DLL4 or a Notch receptor or derivatives, fragments, analogs or homologs thereof.
  • antibody fragments are linear antibody fragments.
  • antibody fragments are monospecific or bispecific.
  • the Notch pathway inhibitor is a scFv.
  • Various techniques can be used for the production of single-chain antibodies specific to human DLL4 or to a human Notch receptor.
  • an antibody can further be desirable, especially in the case of antibody fragments, to modify an antibody in order to increase its serum half-life. This can be achieved, for example, by incorporation of a salvage receptor binding epitope into the antibody fragment by mutation of the appropriate region in the antibody fragment or by incorporating the epitope into a peptide tag that is then fused to the antibody fragment at either end or in the middle (e.g., by DNA or peptide synthesis). In some embodiments, an antibody is modified to decrease its serum half-life.
  • the invention also encompasses Notch pathway inhibitors that are bispecific and/or bifunctional molecules.
  • the bispecific and/or bifunctional molecules are heterodimeric molecules.
  • the bispecific and/or bifunctional molecules are homodimeric molecules.
  • the homodimeric molecules are polypeptides.
  • the heterodimeric molecules are polypeptides.
  • the homodimeric molecule comprises two identical polypeptides.
  • the heterodimeric molecule comprises two non-identical polypeptides.
  • a heterodimeric molecule is capable of binding at least two targets, e.g., a bispecific agent.
  • the targets may be, for example, two different proteins on a single cell or two different proteins on two separate cells.
  • the term “arm” may be used herein to describe the structure of a homodimeric molecule, a heterodimeric molecule, and/or a bispecific antibody.
  • one “arm” may comprise an antigen-binding site from an antibody.
  • one “arm” may comprise a binding portion of a receptor.
  • a homodimeric bispecific molecule comprises two identical arms.
  • a heterodimeric bispecific molecule comprises two different arms.
  • a heterodimeric bispecific molecule can be a bispecific antibody.
  • a heterodimeric bispecific molecule comprises a first arm which binds DLL4 and a second arm that comprises an immunotherapeutic agent.
  • the immunotherapeutic agent is an agonist of a target.
  • the immunotherapeutic agent is an antagonist of a target.
  • the immunotherapeutic agent is a lymphokine or a cytokine.
  • the immunotherapeutic agent is an immunoadhesion.
  • the immunotherapeutic agent is selected from the group consisting of, but not limited to, granulocyte-macrophage colony stimulating factor (GM-CSF), macrophage colony stimulating factor (M-CSF), granulocyte colony stimulating factor (G-CSF), interleukin 3 (IL-3), interleukin 12 (IL-12), interleukin 1 (IL-1), interleukin 2 (IL-2), B7-1 (CD80), B7-2 (CD86), 4-1BB ligand, GITRL, OX40 ligand, CD40L, anti-CD3 antibody, anti-CTLA-4 antibody, anti-OX40 antibody, anti-GITR antibody, anti-TIGIT antibody, anti-PD1 antibody, anti-PD-L1 antibody, anti-LAG-3 antibody, and anti-TIM-3 antibody.
  • GM-CSF granulocyte-macrophage colony stimulating factor
  • M-CSF macrophage colony stimulating factor
  • G-CSF granulocyte colony stimulating factor
  • IL-3 interle
  • the heterodimeric bispecific molecule comprises a first arm which binds DLL4 and a second arm which binds PD-1. In some embodiments, the heterodimeric bispecific molecule comprises a first arm which binds DLL4 and a second arm which binds PD-L1. In some embodiments, the heterodimeric bispecific molecule comprises a first arm which binds DLL4 and a second arm which binds CTLA-4. In some embodiments, the heterodimeric bispecific molecule comprises a first arm which binds DLL4 and a second arm which binds TIGIT.
  • the heterodimeric bispecific molecule comprises a first arm which binds DLL4 and a second arm which binds GITR. In some embodiments, the heterodimeric bispecific molecule comprises a first arm which binds DLL4 and a second arm which binds OX40. In some embodiments, the heterodimeric bispecific molecule comprises a first arm which binds DLL4 and a second arm which binds CD40. In some embodiments, the heterodimeric bispecific molecule comprises a first arm which binds DLL4 and a second arm binds LAG-3.
  • a heterodimeric bispecific molecule comprises a first arm which binds a Notch receptor and a second arm that comprises an immunotherapeutic agent.
  • the immunotherapeutic agent is an agonist of a target.
  • the immunotherapeutic agent is an antagonist of a target.
  • the immunotherapeutic agent is a lymphokine or a cytokine.
  • the immunotherapeutic agent is an immunoadhesion.
  • the immunotherapeutic agent is selected from the group consisting of, but not limited to, granulocyte-macrophage colony stimulating factor (GM-CSF), macrophage colony stimulating factor (M-CSF), granulocyte colony stimulating factor (G-CSF), interleukin 3 (IL-3), interleukin 12 (IL-12), interleukin 1 (IL-1), interleukin 2 (IL-2), B7-1 (CD80), B7-2 (CD86), 4-1BB ligand, GITRL, OX40 ligand, CD40L, anti-CD3 antibody, anti-CTLA-4 antibody, anti-OX40 antibody, anti-GITR antibody, anti-TIGIT antibody, anti-PD1 antibody, anti-PD-L1 antibody, anti-LAG-3 antibody, and anti-TIM-3 antibody.
  • GM-CSF granulocyte-macrophage colony stimulating factor
  • M-CSF macrophage colony stimulating factor
  • G-CSF granulocyte colony stimulating factor
  • IL-3 interle
  • the heterodimeric bispecific molecule comprises a first arm which binds a Notch receptor and a second arm which binds PD-1. In some embodiments, the heterodimeric bispecific molecule comprises a first arm which binds a Notch receptor and a second arm which binds PD-L1. In some embodiments, the heterodimeric bispecific molecule comprises a first arm which binds a Notch receptor and a second arm which binds CTLA-4. In some embodiments, the heterodimeric bispecific molecule comprises a first arm which binds a Notch receptor and a second arm which binds TIGIT.
  • the heterodimeric bispecific molecule comprises a first arm which binds a Notch receptor and a second arm which binds GITR. In some embodiments, the heterodimeric bispecific molecule comprises a first arm which binds a Notch receptor and a second arm which binds OX40. In some embodiments, the heterodimeric bispecific molecule comprises a first arm which binds a Notch receptor and a second arm which binds CD40. In some embodiments, the heterodimeric bispecific molecule comprises a first arm which binds a Notch receptor and a second arm binds LAG-3.
  • the heterodimeric bispecific agent comprises two arms, wherein each arm comprises a human CH3 domain, wherein each CH3 domain is modified to promote formation of heterodimers.
  • the first and second CH3 domains are modified using a knobs-into-holes technique.
  • the first and second CD3 domains are modified based upon electrostatic effects.
  • Heteroconjugate antibodies are also within the scope of the present invention.
  • Heteroconjugate antibodies are composed of two covalently joined antibodies. Such antibodies have, for example, been proposed to target immune cells to unwanted cells.
  • the heteroconjugate antibodies can be prepared in vitro using known methods in synthetic protein chemistry, including those involving crosslinking agents.
  • immunotoxins can be constructed using a disulfide exchange reaction or by forming a thioether bond. Examples of suitable reagents for this purpose include iminothiolate and methyl-4-mercaptobutyrimidate.
  • modified antibodies can comprise any type of variable region that provides for the association of the antibody with the target (i.e., human DLL4 or a Notch receptor).
  • the variable region may comprise or be derived from any type of mammal that can be induced to mount a humoral response and generate immunoglobulins against the desired tumor-associated antigen.
  • the variable region of the modified antibodies can be, for example, of human, murine, non-human primate (e.g. cynomolgus monkeys, macaques, etc.) or rabbit origin.
  • both the variable and constant regions of the modified immunoglobulins are human.
  • variable regions of compatible antibodies can be engineered or specifically tailored to improve the binding properties or reduce the immunogenicity of the molecule.
  • variable regions useful in the present invention can be humanized or otherwise altered through the inclusion of imported amino acid sequences.
  • variable domains in both the heavy and light chains are altered by at least partial replacement of one or more CDRs and, if necessary, by partial framework region replacement and sequence modification and/or alteration.
  • the CDRs may be derived from an antibody of the same class or even subclass as the antibody from which the framework regions are derived, it is envisaged that the CDRs will be derived preferably from an antibody from a different species. It may not be necessary to replace all of the CDRs with all of the CDRs from the donor variable region to transfer the antigen binding capacity of one variable domain to another. Rather, it may only be necessary to transfer those amino acid residues that are necessary to maintain the activity of the antigen-binding site.
  • the modified antibodies of this invention will comprise antibodies (e.g., full-length antibodies or immunoreactive fragments thereof) in which at least a fraction of one or more of the constant region domains has been deleted or otherwise altered so as to provide desired biochemical characteristics such as increased tumor localization and/or increased serum half-life when compared with an antibody of approximately the same immunogenicity comprising a native or unaltered constant region.
  • the constant region of the modified antibodies will comprise a human constant region.
  • Modifications to the constant region compatible with this invention comprise additions, deletions or substitutions of one or more amino acids in one or more domains.
  • the modified antibodies disclosed herein may comprise alterations or modifications to one or more of the three heavy chain constant domains (CH1, CH2 or CH3) and/or to the light chain constant domain (CL).
  • one or more domains are partially or entirely deleted from the constant regions of the modified antibodies.
  • the modified antibodies will comprise domain deleted constructs or variants wherein the entire CH2 domain has been removed ( ⁇ CH2 constructs).
  • the omitted constant region domain is replaced by a short amino acid spacer (e.g., 10 amino acid residues) that provides some of the molecular flexibility typically imparted by the absent constant region.
  • the modified antibodies are engineered to fuse the CH3 domain directly to the hinge region of the antibody.
  • a peptide spacer is inserted between the hinge region and the modified CH2 and/or CH3 domains.
  • constructs may be expressed wherein the CH2 domain has been deleted and the remaining CH3 domain (modified or unmodified) is joined to the hinge region with a 5-20 amino acid spacer.
  • a spacer may be added to ensure that the regulatory elements of the constant domain remain free and accessible or that the hinge region remains flexible.
  • amino acid spacers may, in some cases, prove to be immunogenic and elicit an unwanted immune response against the construct. Accordingly, in certain embodiments, any spacer added to the construct will be relatively non-immunogenic so as to maintain the desired biological qualities of the modified antibodies.
  • the modified antibodies may have only a partial deletion of a constant domain or substitution of a few or even a single amino acid.
  • the mutation of a single amino acid in selected areas of the CH2 domain may be enough to substantially reduce Fc binding and thereby increase cancer cell localization and/or tumor penetration.
  • Such partial deletions of the constant regions may improve selected characteristics of the antibody (serum half-life) while leaving other desirable functions associated with the subject constant region domain intact.
  • the constant regions of the disclosed antibodies may be modified through the mutation or substitution of one or more amino acids that enhances the profile of the resulting construct.
  • the modified antibodies comprise the addition of one or more amino acids to the constant region to enhance desirable characteristics such as decreasing or increasing effector function or provide for more cytotoxin or carbohydrate attachment sites.
  • the constant region mediates several effector functions. For example, binding of the C1 component of complement to the Fc region of IgG or IgM antibodies (bound to antigen) activates the complement system. Activation of complement is important in the opsonization and lysis of cell pathogens. The activation of complement also stimulates the inflammatory response and can also be involved in autoimmune hypersensitivity.
  • the Fc region of an antibody can bind a cell expressing a Fc receptor (FcR).
  • Fc receptors There are a number of Fc receptors which are specific for different classes of antibody, including IgG (gamma receptors), IgE (epsilon receptors), IgA (alpha receptors) and IgM (mu receptors).
  • Binding of antibody to Fc receptors on cell surfaces triggers a number of important and diverse biological responses including engulfment and destruction of antibody-coated particles, clearance of immune complexes, lysis of antibody-coated target cells by killer cells, release of inflammatory mediators, placental transfer, and control of immunoglobulin production.
  • the Notch pathway inhibitors are antibodies that provide for altered effector functions. These altered effector functions may affect the biological profile of the administered antibody.
  • the deletion or inactivation (through point mutations or other means) of a constant region domain may reduce Fc receptor binding of the circulating modified antibody (e.g., anti-DLL4 antibody or anti-Notch receptor antibody) thereby increasing cancer cell localization and/or tumor penetration.
  • the constant region modifications increase or reduce the serum half-life of the antibody.
  • the constant region is modified to eliminate disulfide linkages or oligosaccharide moieties. Modifications to the constant region in accordance with this invention may easily be made using well known biochemical or molecular engineering techniques well within the purview of the skilled artisan.
  • a Notch pathway inhibitor is an antibody that does not have one or more effector functions.
  • the antibody has no ADCC activity, and/or no CDC activity.
  • the antibody does not bind an Fc receptor, and/or complement factors.
  • the antibody has no effector function.
  • the present invention further embraces variants and equivalents which are substantially homologous to the chimeric, humanized, and human antibodies, or antibody fragments thereof, set forth herein. These can contain, for example, conservative substitution mutations.
  • the antibodies described herein are isolated. In certain embodiments, the antibodies described herein are substantially pure.
  • the Notch pathway inhibitors are polypeptides.
  • the polypeptides can be recombinant polypeptides, natural polypeptides, or synthetic polypeptides comprising an antibody, or fragment thereof, that bind human DLL4 or bind one or more human Notch receptors. It will be recognized in the art that some amino acid sequences of the invention can be varied without significant effect on the structure or function of the protein.
  • the invention further includes variations of the polypeptides which show substantial activity or which include regions of an antibody, or fragment thereof, against human DLL4 or one or more human Notch receptors.
  • amino acid sequence variations of DLL4-binding polypeptides or Notch-binding polypeptides include deletions, insertions, inversions, repeats, and/or other types of substitutions.
  • polypeptides, analogs and variants thereof can be further modified to contain additional chemical moieties not normally part of the polypeptide.
  • the derivatized moieties can improve the solubility, the biological half-life, and/or absorption of the polypeptide.
  • the moieties can also reduce or eliminate any undesirable side effects of the polypeptides and variants.
  • An overview for chemical moieties can be found in Remington: The Science and Practice of Pharmacy, 22 nd Edition, 2012, Pharmaceutical Press, London.
  • the isolated polypeptides described herein can be produced by any suitable method known in the art. Such methods range from direct protein synthesis methods to constructing a DNA sequence encoding polypeptide sequences and expressing those sequences in a suitable host.
  • a DNA sequence is constructed using recombinant technology by isolating or synthesizing a DNA sequence encoding a wild-type protein of interest.
  • the sequence can be mutagenized by site-specific mutagenesis to provide functional analogs thereof.
  • a DNA sequence encoding a polypeptide of interest may be constructed by chemical synthesis using an oligonucleotide synthesizer. Oligonucleotides can be designed based on the amino acid sequence of the desired polypeptide and selecting those codons that are favored in the host cell in which the recombinant polypeptide of interest will be produced. Standard methods can be applied to synthesize a polynucleotide sequence encoding an isolated polypeptide of interest. For example, a complete amino acid sequence can be used to construct a back-translated gene. Further, a DNA oligomer containing a nucleotide sequence coding for the particular isolated polypeptide can be synthesized. For example, several small oligonucleotides coding for portions of the desired polypeptide can be synthesized and then ligated. The individual oligonucleotides typically contain 5′ or 3′ overhangs for complementary assembly.
  • the polynucleotide sequences encoding a particular polypeptide of interest can be inserted into an expression vector and operatively linked to an expression control sequence appropriate for expression of the protein in a desired host. Proper assembly can be confirmed by nucleotide sequencing, restriction enzyme mapping, and/or expression of a biologically active polypeptide in a suitable host. As is well-known in the art, in order to obtain high expression levels of a transfected gene in a host, the gene must be operatively linked to transcriptional and translational expression control sequences that are functional in the chosen expression host.
  • recombinant expression vectors are used to amplify and express polypeptides (e.g., antibodies), or fragments thereof, which bind human DLL4 or one or more human Notch receptors.
  • polypeptides e.g., antibodies
  • recombinant expression vectors can be replicable DNA constructs which have synthetic or cDNA-derived DNA fragments encoding a polypeptide chain of an anti-DLL4 antibody or fragment thereof, operatively linked to suitable transcriptional and/or translational regulatory elements derived from mammalian, microbial, viral or insect genes.
  • a transcriptional unit generally comprises an assembly of (1) a genetic element or elements having a regulatory role in gene expression, for example, transcriptional promoters or enhancers, (2) a structural or coding sequence which is transcribed into mRNA and translated into protein, and (3) appropriate transcription and translation initiation and termination sequences. Regulatory elements can include an operator sequence to control transcription. The ability to replicate in a host, usually conferred by an origin of replication, and a selection gene to facilitate recognition of transformants can additionally be incorporated. DNA regions are “operatively linked” when they are functionally related to each other.
  • DNA for a signal peptide is operatively linked to DNA for a polypeptide if it is expressed as a precursor which participates in the secretion of the polypeptide; a promoter is operatively linked to a coding sequence if it controls the transcription of the sequence; or a ribosome binding site is operatively linked to a coding sequence if it is positioned so as to permit translation.
  • structural elements intended for use in yeast expression systems include a leader sequence enabling extracellular secretion of translated protein by a host yeast cell.
  • recombinant protein is expressed without a leader or transport sequence, it can include an N-terminal methionine residue. This residue can optionally be subsequently cleaved from the expressed recombinant protein to provide a final product.
  • Useful expression vectors for eukaryotic hosts include, for example, vectors comprising expression control sequences from SV40, bovine papilloma virus, adenovirus, and cytomegalovirus.
  • Useful expression vectors for bacterial hosts include known bacterial plasmids, such as plasmids from E. coli , including pCR1, pBR322, pMB9 and their derivatives, and wider host range plasmids, such as M13 and other filamentous single-stranded DNA phages.
  • Suitable host cells for expression of a polypeptide include prokaryotes, yeast cells, insect cells, or higher eukaryotic cells.
  • Prokaryotes include gram-negative or gram-positive organisms, for example E. coli or Bacillus .
  • Higher eukaryotic cells include established cell lines of mammalian origin as described below. Cell-free translation systems may also be employed. Appropriate cloning and expression vectors for use with bacterial, fungal, yeast, and mammalian cellular hosts are known to those skilled in the art.
  • mammalian host cell lines include COS-7 (monkey kidney-derived), L-929 (murine fibroblast-derived), C127 (murine mammary tumor-derived), 3T3 (murine fibroblast-derived), CHO (Chinese hamster ovary-derived), HeLa (human cervical cancer-derived), BHK (hamster kidney fibroblast-derived), HEK-293 (human embryonic kidney-derived) cell lines and variants thereof.
  • Mammalian expression vectors can comprise non-transcribed elements such as an origin of replication, a suitable promoter and enhancer linked to the gene to be expressed, and other 5′ or 3′ flanking non-transcribed sequences, and 5′ or 3′ non-translated sequences, such as necessary ribosome binding sites, a polyadenylation site, splice donor and acceptor sites, and transcriptional termination sequences.
  • non-transcribed elements such as an origin of replication, a suitable promoter and enhancer linked to the gene to be expressed, and other 5′ or 3′ flanking non-transcribed sequences, and 5′ or 3′ non-translated sequences, such as necessary ribosome binding sites, a polyadenylation site, splice donor and acceptor sites, and transcriptional termination sequences.
  • insect cell culture systems e.g., baculovirus
  • Baculovirus systems for production of heterologous proteins in insect cells are well-known to those of skill in the art.
  • the present invention provides cells comprising a Notch pathway inhibitor described herein.
  • the cells produce the Notch pathway inhibitors (e.g., antibodies) described herein.
  • the cells produce an antibody.
  • the cells produce demcizumab.
  • the cells produce OMP-305B83.
  • the cells produce tarextumab.
  • the cells produce brontictuzumab.
  • the proteins produced by a transformed host can be purified according to any suitable method.
  • Standard methods include chromatography (e.g., ion exchange, affinity, and sizing column chromatography), centrifugation, differential solubility, or by any other standard technique for protein purification.
  • Affinity tags such as hexa-histidine, maltose binding domain, influenza coat sequence, and glutathione-S-transferase can be attached to the protein to allow easy purification by passage over an appropriate affinity column.
  • Isolated proteins can also be physically characterized using such techniques as proteolysis, mass spectrometry (MS), nuclear magnetic resonance (NMR), high performance liquid chromatography (HPLC), and x-ray crystallography.
  • supernatants from expression systems which secrete recombinant protein into culture media can be first concentrated using a commercially available protein concentration filter, for example, an Amicon or Millipore Pellicon ultrafiltration unit. Following the concentration step, the concentrate can be applied to a suitable purification matrix.
  • a suitable purification matrix for example, an anion exchange resin can be employed, for example, a matrix or substrate having pendant diethylaminoethyl (DEAE) groups.
  • the matrices can be acrylamide, agarose, dextran, cellulose, or other types commonly employed in protein purification.
  • a cation exchange step can be employed.
  • Suitable cation exchangers include various insoluble matrices comprising sulfopropyl or carboxymethyl groups.
  • a hydroxyapatite media can be employed, including but not limited to, ceramic hydroxyapatite (CHT).
  • CHT ceramic hydroxyapatite
  • one or more reverse-phase HPLC steps employing hydrophobic RP-HPLC media, e.g., silica gel having pendant methyl or other aliphatic groups can be employed to further purify a binding agent.
  • hydrophobic RP-HPLC media e.g., silica gel having pendant methyl or other aliphatic groups
  • Some or all of the foregoing purification steps, in various combinations, can also be employed to provide a homogeneous recombinant protein.
  • recombinant protein produced in bacterial culture can be isolated, for example, by initial extraction from cell pellets, followed by one or more concentration, salting-out, aqueous ion exchange, or size exclusion chromatography steps. HPLC can be employed for final purification steps.
  • Microbial cells employed in expression of a recombinant protein can be disrupted by any convenient method, including freeze-thaw cycling, sonication, mechanical disruption, or use of cell lysing agents.
  • the Notch pathway inhibitor is a small molecule.
  • the Notch pathway inhibitor can be used in any one of a number of conjugated (i.e. an immunoconjugate or radioconjugate) or non-conjugated forms.
  • conjugated i.e. an immunoconjugate or radioconjugate
  • non-conjugated forms i.e. antibodies can be used in a non-conjugated form to harness the subject's natural defense mechanisms including complement-dependent cytotoxicity and antibody dependent cellular toxicity to eliminate the malignant or cancer cells.
  • the Notch pathway inhibitor is conjugated to a cytotoxic agent.
  • the cytotoxic agent is a chemotherapeutic agent including, but not limited to, methotrexate, adriamicin, doxorubicin, melphalan, mitomycin C, chlorambucil, daunorubicin or other intercalating agents.
  • the cytotoxic agent is an enzymatically active toxin of bacterial, fungal, plant, or animal origin, or fragments thereof, including, but not limited to, diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain, ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAPII, and PAP-S), Momordica charantia inhibitor, curcin, crotin, Sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin, and the tricothecenes.
  • diphtheria A chain nonbinding active fragments of diphtheria toxin
  • exotoxin A chain ricin A chain
  • abrin A chain abrin A chain
  • modeccin A chain alpha-s
  • the cytotoxic agent is a radioisotope to produce a radioconjugate or a radioconjugated antibody.
  • a radionuclides are available for the production of radioconjugated antibodies including, but not limited to, 90 Y, 125 I, 131 I, 123 I, 111 In, 131 In, 105 Rh, 153 Sm, 67 Cu, 67 Ga, 166 Ho, 177 Lu, 186 Re, 188 Re and 212 Bi.
  • conjugates of an antibody and one or more small molecule toxins such as a calicheamicin, maytansinoids, a trichothene, and CC 1065, and the derivatives of these toxins that have toxin activity, can be produced.
  • small molecule toxins such as a calicheamicin, maytansinoids, a trichothene, and CC 1065, and the derivatives of these toxins that have toxin activity
  • conjugates of an antibody and a cytotoxic agent are made using a variety of bifunctional protein-coupling agents such as N-succinimidyl-3-(2-pyridyidithiol) propionate (SPDP), iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipimidate HCL), active esters (such as disuccinimidyl suberate), aldehydes (such as glutareldehyde), bis-azido compounds (such as bis(p-azidobenzoyl) hexanediamine), bis-diazonium derivatives (such as bis-(p-diazoniumbenzoyl)-ethylenediamine), diisocyanates (such as toluene 2,6-diisocyanate), and bis-active fluorine compounds (such as 1,5-difluoro-2,4-dinitrobenzene).
  • SPDP N-succinimidyl-3-
  • the Notch pathway inhibitor (e.g., antibody) is an antagonist of DLL4. In certain embodiments, the Notch pathway inhibitor inhibits activity of DLL4. In certain embodiments, the Notch pathway inhibitor inhibits at least about 10%, at least about 20%, at least about 30%, at least about 50%, at least about 75%, at least about 90%, or about 100% of the activity of DLL4.
  • the Notch pathway inhibitor (e.g., antibody) inhibits binding of DLL4 to an appropriate receptor.
  • the Notch pathway inhibitor inhibits binding of DLL4 to one or more human Notch proteins.
  • the one or more human Notch proteins are selected from the group consisting of: Notch1, Notch2, Notch3, and Notch4.
  • the inhibition of binding of DLL4 to a Notch protein by a Notch pathway inhibitor is at least about 10%, at least about 25%, at least about 50%, at least about 75%, at least about 90%, or at least about 95%.
  • a Notch pathway inhibitor that inhibits binding of DLL4 to a Notch protein also inhibits Notch pathway signaling.
  • a Notch pathway inhibitor that inhibits human Notch pathway signaling is demcizumab.
  • the Notch pathway inhibitor (e.g., antibody) is an antagonist of one or more Notch receptors. In certain embodiments, the Notch pathway inhibitor inhibits activity of Notch1, Notch2, and/or Notch3. In certain embodiments, the Notch pathway inhibitor inhibits at least about 10%, at least about 20%, at least about 30%, at least about 50%, at least about 75%, at least about 90%, or about 100% of the activity of Notch1, Notch2, and/or Notch3.
  • the Notch pathway inhibitor (e.g., antibody) inhibits binding of a Notch receptor to an appropriate ligand. In certain embodiments, the Notch pathway inhibitor inhibits binding of a Notch receptor to one or more human Notch ligands. In some embodiments, the one or more human Notch ligands are selected from the group consisting of: DLL1, DLL3, DLL4, JAG1, and JAG2. In certain embodiments, the inhibition of binding of a Notch receptor to a Notch ligand by a Notch pathway inhibitor is at least about 10%, at least about 25%, at least about 50%, at least about 75%, at least about 90%, or at least about 95%.
  • a Notch pathway inhibitor that inhibits binding of a Notch receptor to a Notch ligand also inhibits Notch pathway signaling.
  • a Notch pathway inhibitor that inhibits human Notch pathway signaling is tarextumab.
  • a Notch pathway inhibitor that inhibits human Notch pathway signaling is brontictuzumab.
  • a Notch pathway inhibitor has one or more of the following effects: inhibit proliferation of tumor cells, inhibit tumor growth, reduce the frequency of cancer stem cells in a tumor, reduce the tumorigenicity of a tumor, reduce the tumorigenicity of a tumor by reducing the frequency of cancer stem cells in the tumor, trigger cell death of tumor cells, induce cells in a tumor to differentiate, differentiate tumorigenic cells to a non-tumorigenic state, induce expression of differentiation markers in the tumor cells, prevent metastasis of tumor cells, decrease survival of tumor cells, or modulate an immune response.
  • a Notch pathway inhibitor is capable of reducing the tumorigenicity of a tumor.
  • a Notch pathway inhibitor is capable of reducing the tumorigenicity of a tumor comprising cancer stem cells in an animal model, such as a mouse model.
  • the number or frequency of cancer stem cells in a tumor is reduced by at least about two-fold, about three-fold, about five-fold, about ten-fold, about 50-fold, about 100-fold, or about 1000-fold.
  • the reduction in the number or frequency of cancer stem cells is determined by limiting dilution assay using an animal model.
  • the Notch pathway inhibitors described herein are active in vivo for at least 1 hour, at least about 2 hours, at least about 5 hours, at least about 10 hours, at least about 24 hours, at least about 2 days, at least about 3 days, at least about 1 week, or at least about 2 weeks.
  • the Notch pathway inhibitor is an IgG (e.g., IgG1 or IgG2) antibody that is active in vivo for at least 1 hour, at least about 2 hours, at least about 5 hours, at least about 10 hours, at least about 24 hours, at least about 2 days, at least about 3 days, at least about 1 week, or at least about 2 weeks.
  • the Notch pathway inhibitor is a fusion protein that is active in vivo for at least 1 hour, at least about 2 hours, at least about 5 hours, at least about 10 hours, at least about 24 hours, at least about 2 days, at least about 3 days, at least about 1 week, or at least about 2 weeks.
  • the Notch pathway inhibitors described herein have a circulating half-life in mice, cynomolgus monkeys, or humans of at least about 5 hours, at least about 10 hours, at least about 24 hours, at least about 2 days, at least about 3 days, at least about 1 week, or at least about 2 weeks.
  • the Notch pathway inhibitor is an IgG (e.g., IgG1, IgG2, or IgG4) antibody that has a circulating half-life in mice, cynomolgus monkeys, or humans of at least about 5 hours, at least about 10 hours, at least about 24 hours, at least about 2 days, at least about 3 days, at least about 1 week, or at least about 2 weeks.
  • the Notch pathway inhibitor is a fusion protein that has a circulating half-life in mice, cynomolgus monkeys, or humans of at least about 5 hours, at least about 10 hours, at least about 24 hours, at least about 2 days, at least about 3 days, at least about 1 week, or at least about 2 weeks.
  • Methods of increasing (or decreasing) the half-life of agents such as polypeptides and antibodies are known in the art.
  • known methods of increasing the circulating half-life of IgG antibodies include the introduction of mutations in the Fc region which increase the pH-dependent binding of the antibody to the neonatal Fc receptor (FcRn).
  • FcRn neonatal Fc receptor
  • Known methods of increasing the circulating half-life of antibody fragments lacking the Fc region include such techniques as PEGylation.
  • a immunotherapeutic agent is selected from the group consisting of: a modulator of PD-1 activity, a modulator of PD-L1 activity, a modulator of PD-L2 activity, a modulator of CTLA-4 activity, a modulator of CD28 activity, a modulator of CD80 activity, a modulator of CD86 activity, a modulator of 4-1BB activity, an modulator of OX40 activity, a modulator of KIR activity, a modulator of Tim-3 activity, a modulator of LAG3 activity, a modulator of CD27 activity, a modulator of CD40 activity, a modulator of GITR activity, a modulator of TIGIT activity, a modulator of CD20 activity, a modulator of CD96 activity, a modulator of IDO1 activity, a cytokine
  • an immunotherapeutic agent is selected from the group consisting of: a PD-1 antagonist, a PD-L1 antagonist, a PD-L2 antagonist, a CTLA-4 antagonist, a CD80 antagonist, a CD86 antagonist, a KIR antagonist, a Tim-3 antagonist, a LAG3 antagonist, a TIGIT antagonist, a CD20 antagonist, a CD96 antagonist, an IDO1 antagonist, and/or a KIR antagonist.
  • an immunotherapeutic agent is selected from the group consisting of: a CD28 agonist, a 4-1BB agonist, an OX40 agonist, a CD27 agonist, a CD80 agonist, a CD86 agonist, a CD40 agonist, and a GITR agonist.
  • an immunotherapeutic agent includes, but is not limited to, cytokines such as chemokines, interferons, interleukins, lymphokines, and members of the tumor necrosis factor (TNF) family.
  • an immunotherapeutic agent includes immunostimulatory oligonucleotides, such as CpG dinucleotides.
  • a immunotherapeutic agent includes, but is not limited to, anti-PD-1 antibodies, anti-PD-L1 antibodies, anti-PD-L2 antibodies, anti-CTLA-4 antibodies, anti-CD28 antibodies, anti-CD80 antibodies, anti-CD86 antibodies, anti-4-1BB antibodies, anti-OX40 antibodies, anti-KIR antibodies, anti-Tim-3 antibodies, anti-LAG3 antibodies, anti-CD27 antibodies, anti-CD40 antibodies, anti-GITR antibodies, anti-TIGIT antibodies, anti-CD20 antibodies, anti-CD96 antibodies, and anti-IDO1 antibodies.
  • a PD-1 antagonist is an antibody that specifically binds PD-1.
  • the antibody that binds PD-1 is pembrolizumab (KEYTRUDA, MK-3475), pidilizumab (CT-011), nivolumab (OPDIVO, BMS-936558, MDX-1106), MEDI0680 (AMP-514), REGN2810, BGB-A317, PDR-001, or STI-A1110.
  • the antibody that binds PD-1 is described in PCT Publication WO 2014/179664, for example, an antibody identified as APE2058, APE1922, APE1923, APE1924, APE 1950, or APE1963, or an antibody comprising the CDR regions of any of these antibodies.
  • a PD-1 antagonist is a fusion protein that comprises the extracellular domain of PD-L1 or PD-L2, for example, AMP-224.
  • a PD-1 antagonist is a peptide inhibitor, for example, AUNP-12.
  • a PD-L1 antagonist is an antibody that specifically binds PD-L1.
  • the antibody that binds PD-L1 is atezolizumab (RG7446, MPDL3280A), durvalumab (MEDI4736), BMS-936559 (MDX-1105), avelumab (MSB-0010718C), KD033, the antibody portion of KD033, or STI-A1014.
  • the antibody that binds PD-L1 is described in PCT Publication WO 2014/055897, for example, Ab-14, Ab-16, Ab-30, Ab-31, Ab-42, Ab-50, Ab-52, or Ab-55, or an antibody that comprises the CDR regions of any of these antibodies.
  • a CTLA-4 antagonist is an antibody that specifically binds CTLA-4.
  • the antibody that binds CTLA-4 is ipilimumab (YERVOY) or tremelimumab (CP-675,206).
  • a CTLA-4 antagonist is a CTLA-4 fusion protein or a soluble CTLA-4 receptor, for example, KAHR-102.
  • a KIR antagonist is an antibody that specifically binds KIR.
  • the antibody that binds KIR is lirilumab.
  • a LAG3 antagonist is an antibody that specifically binds LAG3.
  • the antibody that binds LAG3 is IMP701, IMP731, BMS-986016, LAG525, and GSK2831781.
  • a LAG3 antagonist is a LAG3 fusion protein or a soluble LAG3 receptor, for example, IMP321.
  • an IDO1 antagonist is indoximad (NLG-9189), epacadostat (INCB024360), or NLGO919.
  • an immunotherapeutic agent is a CD28 agonist, a 4-1BB agonist, an OX40 agonist, a CD27 agonist, a CD80 agonist, a CD86 agonist, a CD40 agonist, or a GITR agonist.
  • an OX40 agonist comprises an OX40 ligand, or an OX40-binding portion thereof.
  • an OX40 agonist is MEDI6383.
  • the OX40 agonist is an antibody that specifically binds OX40.
  • the antibody that binds OX40 is MEDI6469, MEDI0562, or MOXR0916 (RG7888).
  • the antibody that binds OX40 is described in PCT Publication WO 2012/027328, for example, antibody mouse 119-122, Ch119-122, Hu199-122, or 106-222, or an antibody that comprises the CDR regions of any of these antibodies.
  • an OX40 agonist is a vector (e.g., an expression vector or virus, such as an adenovirus) capable of expressing OX40 ligand.
  • the OX40L-expressing vector is Delta-24-RGDOX or DNX2401.
  • a 4-1BB (CD137) agonist is a binding molecule, such as an anticalin.
  • the anticalin is PRS-343.
  • a 4-1BB agonist is an antibody that specifically binds 4-1BB.
  • antibody that binds 4-1BB is PF-2566 (PF-05082566) or urelumab (BMS-663513).
  • a CD27 agonist is an antibody that specifically binds CD27.
  • the antibody that binds CD27 is varlilumab (CDX-1127).
  • a GITR agonist comprises a GITR ligand or a GITR-binding portion thereof.
  • a GITR agonist is an antibody that specifically binds GITR.
  • the antibody that binds GITR is TRX518, MK-4166, or INBRX-110.
  • the murine colon carcinoma CT26.WT was obtained from ATCC.
  • CT26.WT cells were injected subcutaneously into the rear flanks of 6-8 week old Balb/C mice. Tumors were allowed to grow until they reached an average size of 200 mm 3 .
  • the agents were administered by injection into the intraperitoneal cavity.
  • Fourteen days after the initial dose the tumors were harvested and total protein was isolated from individual mice using tissue extraction buffer (Life Technologies). Proteins (20 ⁇ g) were resolved by SDS-PAGE gel electrophoresis, and Western blot analysis was performed using an anti-PD-1 antibody.
  • FIG. 1A shows a representative Western blot analysis from four individual tumors of each treatment group.
  • PD-1 programmed cell death protein 1
  • T-cells T-cells
  • B-cells B-cells
  • NK cells NK cells
  • macrophages PD-1-binding protein 1
  • PD-1 is not expressed on the surface of tumor cells, these results suggest that treatment with anti-DLL4 antibodies may be directly or indirectly affecting the expression of PD-1 on tumor-associated immune cells. This suggests that anti-DLL4 antibodies or other DLL4 antagonists could potentially inhibit or block the suppressive activity of PD-1-expressing cells and enhance anti-tumor immune responses.
  • anti-mDLL4 antibody 21R30 and mIL-2-Fc both inhibited CT26.WT tumor growth as single agents as compared to control. Furthermore, a combination of the anti-mDLL4 antibody and mIL-2-Fc inhibited tumor growth to a greater extent than either agent alone.
  • CT26.WT cells were injected subcutaneously into the rear flanks of 6-8 week old Balb/C mice, but tumors were allowed to grow to an average tumor volume of 400 mm 3 .
  • Agents were administered by intraperitoneal injection. Tumor growth was monitored and tumor volumes measured using electronic calipers at the indicated time points. The data are expressed as average tumor volume ⁇ SEM.
  • a mouse model of non-small cell lung cancer (NSCLC) was established at OncoMed and herein is referred to as KP_LUN01. This tumor line was observed to have a poorly differentiated morphology, have a very short tumor latency in vivo, and to be highly metastatic.
  • Murine lung tumor KP_LUN01 cells (50,000 cells) were injected subcutaneously into the flanks of 6-8 week old C57BL/6J mice (Day 0). Tumors were allowed to grow for 8 days to an average tumor volume of 100 mm 3 .
  • anti-mDLL4 antibody 21R30 and mIL-2-Fc inhibited the growth of the KP_LUN01 tumors as single agents as compared to control.
  • the combination of anti-mDLL4 antibody 21R30 and mIL2-Fc had a greater effect on inhibiting the growth of KP_LUN01 tumors than either agent alone or the control.
  • NK natural killer
  • the mouse lymphoblast cell line YAC-1 and the mouse colon carcinoma cell line CT26.WT were cultured in RPMI 1640 culture medium (Gibco/Life Technologies, Grand Island, N.Y.) supplemented with 10% (v/v) fetal bovine serum (FBS), 2 mM L-glutamine, 100 U/ml penicillin, and 100 ⁇ g/ml streptomycin (Gibco) at 37° C. in a humidified atmosphere of 5% CO2.
  • FBS fetal bovine serum
  • YAC-1 cells are known to be sensitive to NK cell activity and are a good target for NK cell assays.
  • Cells were harvested from the spleens of the CT26.WT tumor-bearing mice described above in Example 2. Cells were plated in 96-well V-bottom plates in RPMI 1640 culture medium (Gibco/Life Technologies, Grand Island, N.Y.) supplemented with 10% (v/v) fetal bovine serum (FBS), 2 mM L-glutamine, 100 U/ml penicillin, and 100 ⁇ g/ml streptomycin (Gibco). Target cells (YAC-1 or CT26.WT) were labeled with 10 ⁇ M calcein AM (Life Technologies) for 1 hour at 37° C. and then combined with the splenocytes at an effector:target ratio of 25:1.
  • FBS fetal bovine serum
  • Target cells YAC-1 or CT26.WT
  • % lysis 100 ⁇ (ER-SR)/(MR-SR), where ER, SR, and MR represent experimental, spontaneous, and maximum calcein release, respectively.
  • Spontaneous release is the fluorescence emitted by target cells incubated in media alone (i.e., in the absence of effector cells), while maximum release is determined by lysing target cells with an equal volume of 10% SDS.
  • NK cells from CT26.WT tumor-bearing mice demonstrated an increased ability to kill YAC-1 and CT26.WT target cells when the mice had been treated with mIL-2-Fc. Treatment with anti-mDLL4 antibody appeared to have no effect on NK cytotoxicity in this experiment, either alone or in combination with mIL-2 ( FIGS. 3A and 3B ).
  • NK cells from KP_LUN01 tumor-bearing mice demonstrated an increased ability to kill YAC-1 target cells when the mice had been treated with anti-mDLL4 antibody 21R30 or mIL-2-Fc as single agents. There was no increase in NK activity when the agents were combined ( FIG. 3C ).
  • T-cell cytotoxicity assays cells were harvested from the spleens of CT26.WT tumor-bearing mice after treatment and cultured in media supplemented with 30 IU/mL recombinant murine IL-2 (Peprotech, Rocky Hill, N.J.) and 0.1 ⁇ g/ml AH-1 peptide (Anaspec, Fremont, Calif.).
  • the sequence of this peptide is the H2-L d -restricted epitope (amino acids 6-14) of the gp70 envelope protein of an ecotropic murine leukemia provirus endogenous to the CT26.WT cell line.
  • the splenocytes were cultured for 5 days at 37° C., harvested, counted, and used in cytotoxicity assays as described above, with CT26.WT tumor cells as targets.
  • the effector CD8 + phenotype of the cells was confirmed by FACS analysis after peptide/IL-2 stimulation (data not shown).
  • CD8 + cytotoxic cells from CT26.WT tumor-bearing mice demonstrated an increased ability to kill CT26.WT target cells when the mice had been treated with anti-mDLL4 antibody as compared to cells from mice treated with control.
  • CD8 + cells from tumor-bearing mice treated with mIL-2-Fc also showed an increased ability to kill target cells as compared to control, although the effect was not as strong as with the anti-mDLL4 antibody.
  • cells from mice treated with a combination of an anti-mDLL4 antibody and mIL-2-Fc had a greater ability to kill target cells than either treatment alone.
  • KP_LUN01 tumor cells were used as stimulators.
  • KP_LUN01 cells were treated with 25 ⁇ g/ml mitomycin C (Sigma-Aldrich) for 30 minutes at 37° C., washed, and resuspended at 10 7 cells/ml in RPMI-1640 media containing 10% FCS, 2 mM L-glutamine, and antibiotics.
  • Splenocytes were co-cultured with the mitomycin-treated KP_LUN01 cells at a ratio of 20:1, incubated for 7 days at 37° C., harvested, counted, and used in cytotoxicity assays as described above.
  • Calcein AM-labeled KP_LUN01 tumor cells were used as targets at an effector:target ratio of 12.5:1. Calcein release was determined after 4 hours and specific lysis was calculated as described above.
  • CD8 + cytotoxic T-cells from KP_LUN01 tumor-bearing mice demonstrated an increased ability to kill KP_LUN01 target cells when the mice had been treated with anti-mDLL4 antibody.
  • CD8 + T-cells from tumor-bearing mice treated with mIL-2-Fc showed only a slight increase in cytolytic activity as compared to cells from mice treated with the control.
  • Cells from mice treated with a combination of an anti-mDLL4 antibody and mIL-2-Fc had a significantly greater ability to kill target cells than either treatment alone.
  • ELISpot is a highly sensitive immunoassay for the detection of cytokine-secreting cells.
  • an ELISpot assay employs a capture antibody specific for a desired cytokine, pre-coated onto the wells of a microplate. Stimulated cells are aliquoted into the wells and the immobilized antibody in the immediate vicinity of any cytokine-secreting cell binds the secreted cytokine. Standard wash steps and incubation with appropriate detection reagents follow. For example, a biotinylated detection antibody followed by streptavidin conjugated to alkaline-phosphatase and a colored substrate solution is commonly used. A colored precipitate forms at the sites of cytokine localization and appears as a spot, with each individual spot representing an individual cytokine-secreting cell. The spots may be counted with an automated reader system or manually using a microscope.
  • Interferon (IFN)-gamma secreting cells were detected using a mouse IFN-gamma ELISpot kit (mouse IFN-gamma ELISpot PLUS kit, Mabtech, Cincinnati, Ohio). Cells were isolated from the spleens of CT26.WT tumor-bearing mice treated with anti-mDLL4 antibody 21R30 and/or mIL-2-Fc, as described above in Example 2. Splenocytes from each mouse (2 ⁇ 10 5 cells/well) were plated onto the provided plates, which were pre-coated with a capture antibody specific for murine IFN-gamma. The cells were cultured in the presence or the absence of a tumor specific CD8 + T-cell peptide (AH-1) and incubated for 48 hours.
  • AH-1 tumor specific CD8 + T-cell peptide
  • tumor-specific IFN-gamma-secreting CD8 + T-cells were increased in mice treated with mIL-2-Fc as a single agent.
  • a modest but detectable increase in IFN-gamma-producing CD8 + T-cells was also observed in mice treated with anti-mDLL4 antibody 21R30.
  • tumor-specific IFN-gamma-secreting CD8 + T-cells from mice treated with a combination of anti-mDLL4 antibody and mIL-2-Fc were increased to a greater extent than with either agent alone.
  • the inventors further investigated the effect that treatment by a DLL4 antagonist either as a single agent or in combination with an immunotherapeutic agent had on immune checkpoint receptors, such as PD-1, on immune cells.
  • CT26.WT cells were injected subcutaneously into the flanks of 6-8 week old Balb/C mice. Tumors were allowed to grow until they reached an average size of 100 mm 3 .
  • the anti-mDLL4 antibody was dosed weekly at 30 mg/kg and the mIL-2-Fc was dosed for 5 days each week at 1 mg/kg. Administration was by injection into the intraperitoneal cavity. Twenty-one days after tumor cell injection and 15 days after the initial treatment, tumors were harvested and single cell suspensions were prepared.
  • FACS Fluorescent activated cell sorting analysis
  • CD45 is exclusively expressed on hematolymphoid cells and has been referred to as a “common leukocyte antigen”. It is expressed at high levels on the cell surface of all nucleated hematopoietic cells and their precursors, therefore this protein can be used to detected tumor-associated immune cells.
  • PD-1 is a protein on the cell surface of immune cells generally involved in suppressing immune responses.
  • the percentage of CD45 + cells and CD45 + PD-1 + cells in tumors from treated mice is shown in FIG. 6 .
  • the percentage of CD45 + cells was increased in tumors from mice treated with mIL-2-Fc, although there was a high level of variability between individual mice.
  • the percentage of CD45 + PD-1 + cells was reduced in tumors from mice treated with anti-mDLL4 antibody and from mice treated with mIL-2-Fc.
  • CT26.WT cells were injected subcutaneously into the flanks of 6-8 week old Balb/C mice. Tumors were allowed to grow to an average tumor volume of 100 mm 3 .
  • Agents were administered by intraperitoneal injection. Tumor growth was monitored and tumor volumes measured using electronic calipers at the indicated time points. The data are expressed as average tumor volume ⁇ SEM.
  • anti-mDLL4 antibody inhibited CT26.WT tumor growth to a similar extent as anti-mPD-L1 or anti-mCTLA-4 antibodies.
  • the combination therapies were not detectably better than the single agents.
  • the combination of anti-mDLL4 antibody 21R30 in combination with either anti-mCLTA-4 antibody or anti-mPD-L1 antibody appeared to have a greater inhibitory effect on tumor growth in more individual mice than when the antibodies were used as single agents ( FIGS. 7B and 7C ).
  • DLL4 antagonist can enhance, and may synergize with, immune checkpoint inhibitors, such as anti-CTLA-4 and anti-PD-L1 antibodies to further inhibit tumor growth.
  • mice with palpable tumors were treated with an anti-mPD-1 antibody (250 ⁇ g/mouse), anti-mDLL4 antibody 21R30 (20 mg/kg), a combination of anti-mPD-1 antibody and anti-mDLL4 antibody 21R30, or the same amount of an isotype control antibody.
  • Mice were administered the antibodies twice a week for 3 weeks by intraperitoneal injection. Tumor growth was monitored and tumor volumes were measured with electronic calipers at the indicated time points. Data are expressed as mean ⁇ S.E.M.
  • One method of evaluating the presence and/or functionally of an anti-tumor memory cell population is to re-challenge previously treated mice with fresh tumor cells.
  • Mice whose tumors had regressed completely and were undetectable at least 85 days after the first tumor injection were re-challenged with CT26.WT tumor cells (20,000 cells).
  • the mice subjected to tumor re-challenge had received a last treatment dose 66 days prior to re-challenge.
  • mice from each group which had developed no tumors upon first re-challenge were re-challenged for a second time with 50,000 CT26.WT cells (2.5 times the number of cells of initial dose).
  • CT26.WT cells 5 na ⁇ ve mice were injected with CT26.WT cells with the same number of CT26.WT cells (50,000 cells/mouse).
  • all 5 mice in the control group developed large tumors and were euthanized at Day 21.
  • Small tumors (average 56 mm 3 ) grew in 3 of the 5 mice that had been originally treated with anti-mPD-1 antibody.
  • No tumors grew in the mice that had been originally treated with a combination of anti-DLL4 antibody and anti-mPD-1 antibody.
  • mice appeared to be strongly protected from re-challenge with the CT26.WT tumor cells. These results suggest the existence of immunogenic memory after treatment with a combination of anti-mDLL4 and anti-mPD-1 antibodies.
  • IFN-gamma secreting cells were detected using a mouse IFN-gamma ELISpot kit (MabTech).
  • Splenocytes (5 ⁇ 10 5 /well) from each mouse in each treatment group were dispensed into a 96 well plate coated with an antibody specific for mouse IFN-gamma.
  • the cells were cultured in the presence or the absence of a tumor specific CD8 + T-cell peptide (AH-1) and incubated for 48 hours. Cells secreting IFN-gamma were detected following the manufacturer's instructions. Spots were counted using a Bioreader 6000 F-z instrument (BioSys). Data are expressed as mean ⁇ S.E.M.
  • tumor-specific IFN-gamma secreting CD8 + T-cells were increased in mice treated with anti-mPD-1 antibody and in mice treated with a combination of anti-mDLL4 antibody 21R30 and anti-PD-1 antibody.
  • IL-2 secreting cells were detected using a mouse IL-2 ELISpot kit (MabTech).
  • Splenocytes (5 ⁇ 10 5 /well) from each mouse in each treatment group were dispensed into a 96 well plate coated with an antibody specific for mouse IL-2. The cells were incubated in the presence of the AH-1 peptide for 48 hours.
  • Cells secreting IL-2 were detected following the manufacturer's instructions. Spots were counted using Bioreader 6000 F-z instrument (BioSys). Data are expressed as mean ⁇ S.E.M.
  • IL-2 secreting cells were increased only in mice treated with a combination of anti-mDLL4 antibody 21R30 and anti-PD1 antibody.
  • IL-17 secreting cells were detected using a mouse IL-17 ELISPOT kit (MabTech).
  • Splenocytes (5 ⁇ 10 5 /well) from each mouse within each treatment group were dispensed into a 96 well plate coated with an antibody specific for mouse IL-17. The cells were incubated for 48 hours. Cells secreting IL-17 were detected following the manufacturer's instructions. Spots were counted using a Bioreader 6000 F-z instrument (BioSys). Data are expressed as mean ⁇ S.E.M.
  • IL-17 secreting cells were decreased in mice treated with anti-mDLL4 antibody 21R30 and in mice treated with a combination of anti-mDLL4 antibody 21R30 and anti-mPD-1 antibody.
  • anti-mPD-1 antibody as a single agent, a combination of anti-mDLL4 antibody and anti-mVEGF antibody, and a triple combination of anti-mDLL4 antibody, anti-mVEGF antibody, and anti-mPD-1 antibody did not reduce the number of IL-17-secreting cells in spleens from treated mice (data not shown).
  • blocking DLL4 alone may have a different mechanism regulating immune responses as compared to the mechanism of blocking DLL4 in combination with VEGF or blocking DLL4 in combination with VEGF and PD-1.
  • IL-6 production was detected using a mouse IL-6 ELISA kit (eBioscience).
  • Splenocytes (5 ⁇ 10 5 /well) from each mouse within each treatment group were dispensed into a 96 well plate. The cells were cultured in the presence or the absence of a tumor specific CD8 + T-cell peptide (AH-1) and incubated for 48 hours. The level of IL-6 was detected in each cell supernatant following the manufacturer's instructions. The plate was read using a SpectraMax Plus instrument (Molecular Devices). Data are expressed as mean ⁇ S.E.M.
  • IL-6 production was the same in supernatants from cells incubated in the presence or the absence of the AH-1 peptide.
  • FIG. 10D the level of IL-6 produced by splenocytes from mice treated with anti-mPD-1 antibody and in mice treated with a combination of anti-mDLL4 antibody 21R30 and anti-mPD1 antibody was greatly reduced as compared to IL-6 produced by splenocytes from mice treated with only anti-mDLL4 antibody 21R30 or the control antibody.
  • IFN-gamma is generally produced by NK cells, Th1 CD4 + T-cells, CD8 + T-cells, antigen presenting cells, and B-cells.
  • Studies have suggested a role for IFN-gamma in tumor immunity and that it may be a regulator of anti-tumor activity mediated by other cytokines, in particular IL-12 and IL-2.
  • the predominant source of IL-2 is the Th1 CD4 + T-cell and its major role is to promote the activation and proliferation of T-cells and NK cells in an autocrine and paracrine manner.
  • exposure of NK cells to IL-2 results in proliferation and enhanced cytolytic activity.
  • IL-2 is required for the maintenance and survival of memory T-cells.
  • IL-17 is produced by T H 17 cells, a subset of helper T-cells believed to have a pro-inflammatory role in autoimmune disease. IL-17 contributes to the recruitment of myeloid cells of the monocyte and granulocyte lineages through local induction of chemokines and stimulation of G-CSF and GM-CSF production. A factor of ineffective or absent immune responses against tumors can be the presence of MDSCs derived from both the monocytic and granulocytic lineages.
  • Tumor-specific T H 17 cells may play a role in promoting the attraction of myeloid cells to the tumor and thus the promotion of an immune suppressive environment.
  • the ability of a DLL4 antagonist to reduce the frequency of tumor-specific T H 17 cells and the production of IL-17 may therefore reduce the generation of MDSC and promote anti-tumor immunity.
  • IL-6 is generally produced by macrophages, endothelial cells, and some activated T-cells. In contrast to IFN-gamma and IL-2, over-expression of IL-6 appears to play a role in the pathogenesis of many cancers.
  • treatment with a DLL4 antagonist and/or an anti-PD-1 antibody that results in a decrease in IL-6 production should enhance anti-tumor immunity.
  • MDSCs accumulate in the blood, lymph nodes, bone marrow, and at tumor sites in most patients and experimental animals with cancer. MDSCs have been shown to inhibit both adaptive and innate immunity.
  • MDSCs facilitate cancer progression by inhibiting anti-tumor immune responses, promoting angiogenesis, and creating a pre-metastatic environment. MDSCs suppress the proliferation and activation of CD4 + T-cells and CD8 + T-cells, thereby inhibiting anti-tumor immunity. Importantly, MDSCs facilitate the generation of Treg cells.
  • MDSCs are a heterogeneous family of myeloid cells. In mice, MDSCs are characterized by the cell surface expression of the myeloid lineage differentiation antigens Gr1 and CD11b. MDSCs can be divided into two subpopulations: granulocytic MDSCs (G-MDSC) and monocytic MDSCs (M-MDSC). G-MDSCs typically have multilobed nuclei and a CD11b + Ly6G + Ly6C low phenotype, whereas M-MDSCs have a monocytic morphology and a CD11b + Ly6G +/ ⁇ Ly6C high phenotype.
  • G-MDSC granulocytic MDSCs
  • M-MDSCs monocytic MDSCs
  • MDSCs Both populations of MDSCs have been shown to suppress T-cell responses by multiple mechanisms including increased production of arginase, inducible nitric oxide synthase (iNOS), nitric oxide, and reactive oxygen species.
  • iNOS inducible nitric oxide synthase
  • nitric oxide nitric oxide
  • reactive oxygen species nitric oxide species
  • MDSCs contribute to an immunosuppressive tumor microenvironment and may limit the effects of anti-tumor immune responses.
  • mice treated with a DLL4 antagonist and/or an anti-PD1 antibody were evaluated.
  • the freshly prepared single cell suspensions were blocked using a blocking solution for 10 minutes and then stained with anti-mouse Gr1 (clone RB6-8C5, BioLegend) and anti-mouse CD11 b (clone M1/70, BioLegend) in FACS buffer (HBSS plus 2% FCS) for 20 minutes on ice.
  • the activated myeloid cell population was analyzed by staining spleen cells with anti-mouse CD11b and anti-mouse MHC class II antibody.
  • the cells are washed, labeled with fixable cell viability dye (eBiosciences), and fixed in 2% paraformaldehyde for analysis.
  • Cells were analyzed using a FACSCanto II instrument (BD Sciences) and using Diva software. Dead cells were excluded using the viability dye and cell doublets and clumps were excluded using doublet discrimination gating. Cells were analyzed for M-MDSC and activated myeloid populations.
  • treatment with anti-mDLL4 antibody 21R30 alone or antibody 21R30 in combination with anti-mPD-1 antibody reduced the percentage of M-MDSCs in spleens from tumor-bearing mice as compared to treatment with anti-mPD-1 antibody alone or with a control antibody.
  • treatment with anti-mDLL4 antibody 21R30 alone, anti-mPD-1 antibody alone, or a combination of anti-mDLL4 antibody 21R30 and anti-mPD-1 antibody increased the percentage of activated myeloid cells as compared to treatment with control antibody.
  • DLL4 may contribute to inhibiting the suppressive activity of MDSCs by reducing the percentage and/or number of these immunosuppressive cells. This result is consistent with our hypothesis that DLL4 antagonist treatment may reduce the generation of MDSC and promote a productive anti-tumor immunity by reducing the frequency of tumor-specific T H 17 cells. The reduction on MDSC number and/or the activation of myeloid cells may be even greater within the tumor microenvironment, but this has not been assessed at this point in time due to the small tumor size after treatment.
  • Memory T-cells are a heterogeneous T-cell population and are separated into two distinct subsets (central memory T-cells and effector memory T-cells) based upon phenotype and function.
  • central and effector memory CD8 + T cells can be separated into two distinct populations according to their respective CD44 and CD62L expression levels.
  • a CD44 high CD62L low CD8 + T-cell population rapidly acquires effector functions which constitute the effector memory
  • CD8 + T-cells expressing a CD44 high CD62L high population acquire profound proliferative capacities upon antigen recognition, and constitute the central memory T cells.
  • mice treated with anti-PD1 and/or anti-mDLL4 antibodies were evaluated.
  • FACS staining was done as described above using anti-mouse CD8b (clone 53-5.8, BioLegend), anti-mouse CD4 (clone GK1.5, BioLegend, Clone), anti-mouse CD62L (clone MEL-14, BioLegend) and anti-mouse CD44 (clone 1M7, BioLegend).
  • Cells were analyzed for CD44 high CD62L low expression (central memory) and CD44 high CD62L low CD8 + expression (effector memory).
  • treatment with anti-mDLL4 antibody 21R30 alone or anti-mDLL4 antibody 21R30 in combination with anti-mPD-1 antibody increased the percentage of central memory and effector memory CD8 + T-cells in spleens as compared to treatment with anti-mPD-1 antibody alone or with a control antibody.
  • DLL4 antagonist and an anti-PD-1 antibody facilitates the generation of central and effector memory CD8 + T-cells.
  • These memory T-cells may provide long-term immune memory function and work to provide an immune response against reoccurrence of tumors and/or metastases.
  • DLL4 antagonist treatment reduces the generation of MDSC and thereby enables T cells to mount a more productive and substantial anti-tumor immune response.
  • the distinct mechanism of DLL4 antagonist is able to complement and promote the anti-tumor response promoted by an immune checkpoint inhibitor such as an anti-PD-1 antibody.
  • Tregs are an immune T-cell population that suppresses the proliferative responses of CD4 + and CD8 + T cells.
  • the functionality of Tregs in mice treated with a DLL4 antagonist and/or a PD-1 antibody was evaluated by determining the effect the Tregs had on proliferation of na ⁇ ve CD4 + or CD8 + T-cells.
  • Naive T-cells were purified from the spleens of untreated mice using a mouse CD3 + T-cell enrichment column (R&D Systems). Purified T-cells were labeled with 5 ⁇ M violet tracking dye (VTD) (Life Technologies). 2 ⁇ 10 5 VTD-labeled T-cells were stimulated with anti-CD3 and anti-CD28 antibody-coated beads to stimulate T-cell proliferation.
  • VTD violet tracking dye
  • the VTD-labeled na ⁇ ve T-cells were co-cultured with isolated splenic Tregs from the mice treated with anti-mDLL4 antibody, the mice treated with anti-mPD-1 antibody, the mice treated with a combination of anti-mDLL4 antibody and anti-mPD-1 antibody, and the mice treated with the control antibody.
  • the stimulated VTD-labeled cells were co-cultured with Treg cells (effector:Treg of 1:0.5 or 1:0.25).
  • Treg cells effector:Treg of 1:0.5 or 1:0.25).
  • cells were washed, and stained with anti-mCD4 and anti-mCD8 antibodies. Changes in VTD concentration were evaluated by FACS analysis and the results were used to calculate T-cell proliferation.
  • treatment with anti-mPD-1 antibody reduced the suppressive function of Treg on CD4 + T-cell proliferation.
  • Treatment with a combination of anti-mDLL4 antibody 21R30 and anti-mPD-1 antibody also reduced the suppressive function of Treg on the CD4 + T-cell proliferation, but to a lesser extent.
  • treatment with anti-DLL4 antibody 21R30 had a greater effect than anti-mPD-1 antibody on reducing the suppressive function of Treg on the CD8 + T-cell proliferation.
  • treatment with a combination of anti-mDLL4 antibody 21R30 and anti-mPD-1 antibody had a significantly greater effect on reducing the suppressive function of Treg on the CD8 + T-cell proliferation than either antibody alone.
  • DLL4 antagonist treatment reduces the generation of MDSC and thereby promotes a more robust immune response.
  • MDSC contribute to the maintenance and expansion of Tregs though several mechanisms including PD-L1/B7-H1 and arginase.
  • the distinct mechanism of DLL4 antagonist both promotes anti-tumor immunity as a single agent and also compliments the action of checkpoint inhibitors such as anti-PD-1.
  • CD8 + cytotoxic T-cells in mice treated with a DLL4 antagonist and/or anti-PD-1 antibody was evaluated.
  • the splenocytes were cultured in media supplemented with 30 IU/ml recombinant murine IL-2 (Peprotech, Rocky Hill, N.J.) and 1 ⁇ g/ml CD8 + T-cell peptide AH-1 peptide.
  • the splenocytes were incubated for 7 days at 37° C., harvested, counted, and used in cytotoxicity assays with CT26.WT tumor cells as targets.
  • the CT26.WT target cells were labeled with 10 ⁇ M calcein AM (Life Technologies) for 1 hour at 37° C. and then combined with the splenocytes at an effector:target ratio of 50:1.
  • cell-free supernatants were harvested and calcein release was quantified on a fluorometer at an excitation of 485 nm and an emission of 535 nm.
  • % lysis 100 ⁇ (ER-SR)/(MR-SR), where ER, SR, and MR represent experimental, spontaneous, and maximum calcein release, respectively.
  • Spontaneous release is the fluorescence emitted by target cells incubated in media alone (i.e., in the absence of effector cells), while maximum release is determined by lysing target cells with an equal volume of 10% SDS.
  • tumor-specific CD8 + T-cells from mice treated with either anti-mDLL4 antibody 21R30 or combination of anti-mDLL4 antibody 21R30 and an anti-mPD-1 antibody had an increased level of cytolytic activity against parental tumor cells as compared to control, and the combination of anti-mDLL4 antibody and anti-mPD-1 antibody further increased CD8 + T-cell activity relative to single agents.
  • a PD-L1 immunohistochemistry (IHC) assay is used to determine the expression level of PD-L1 in samples.
  • FFPE sections are cut and mounted on coated glass slides.
  • Tissues are deparaffinized and rehydrated by successively incubating them in xylene, 100% ethanol, 95% ethanol, 70% ethanol, and distilled water for antigen retrieval.
  • Slides are placed into retrieval solution and placed in a decloaker for antigen retrieval.
  • To block endogenous peroxidase activity slides are incubated in 6% hydrogen peroxide for 5 minutes and washed in PBS.
  • To block non-specific background staining slides are incubated incubated in CAS-Block (Life Technologies) for 30 minutes at room temperature.
  • H-score [3 ⁇ (% 3+ cells)]+[2 ⁇ (% 2+ cells)]+[1 ⁇ (% 1+ cells)]. This calculation allows for a top H-score of 300.
  • Positive and negative controls may include human tissue sections purchased from a commercial supplier as well as patient-derived xenograft samples from the OncoMed tumor bank with known expression levels of PD-L1.
  • the study is an open-label Phase 1b dose-escalation and expansion study of demcizumab (OMP-21M18) in combination with pembrolizumab (anti-PD-1; KEYTRUDA) with or without chemotherapy in subjects with advanced or metastatic solid tumors.
  • the primary objective of the study is to identity dose-limiting toxicities (DLTs) and estimate the maximum tolerated dose (MTD) of demcizumab with pembrolizumab and to identity DLTs and estimate the MTD of demcizumab with pembrolizumab administered with pemetrexed and carboplatin.
  • DLTs dose-limiting toxicities
  • MTD maximum tolerated dose
  • the secondary objectives are to determine the safety, the incidence of immunogenicity, the pharmacokinetics of demcizumab and pembrolizumab as compared to the respective single agent drug exposure, the preliminary response rate as assessed by immune-based criteria, and the preliminary efficacy.
  • demcizumab Approximately 6-12 patients will be enrolled in the dose-escalation stage of demcizumab in combination with pembrolizumab. Dose escalation will be conducted to determine the MTD of demcizumab when given with pembrolizumab. Approximately two cohorts per demcizumab dose level will be tested. The dose levels of demcizumab will be 2.5 and 5 mg/kg administered IV once every 3 weeks through Day 63. In the absence of disease progression, a second course of study drug (demcizumab at 1, 2.5 or 5 mg/kg) will be administered once every 3 weeks for 4 doses starting at Day 168 if the subject fulfills study criteria.
  • Three patients will be initially treated at the 2.5 mg/kg demcizumab and 2 mg/kg pembrolizumab dose level. If 1 of 3 subjects experiences a DLT, that dose level will be expanded to 6 subjects. If 2 or more patients experience a DLT, no further patients will be dosed at that level and 3 additional patients will be tested at 1 mg/kg demcizumab and 2 mg/kg pembrolizumab dose level. Patients will be assessed for DLTs from the time of the first dose through Day 21. Dose escalation, if appropriate, will occur after all patients in a cohort have completed their Day 21 DLT assessment. The maximum dose of demcizumab to be tested is 5 mg/kg. Once the MTD of demcizumab with pembrolizumab has been established, patients will be enrolled into the cohort expansion stage.
  • the planned expansion cohorts will include, but may not be limited to, patients with non-squamous stage IIIB/IV NSCLC treated with up to 2 prior lines of chemotherapy, patients with any solid tumor that has progressed on prior treatment with an anti-PD1 or anti PDL-1 inhibitor, patients with castrate-resistant prostate cancer that has progressed on prior therapy, patients with colorectal cancer treated with up to 3 prior lines of chemotherapy, and patients with pancreatic cancer treated with up to 2 prior lines of chemotherapy.
  • a second course of study drug (demcizumab at 1, 2.5 or 5 mg/kg) will be administered once every 3 weeks for 4 doses starting at Day 168 if the subject's Day 168 BNP is ⁇ 100 pg/mL, peak tricuspid velocity is ⁇ 3.0 m/s and LVEF is ⁇ 50%, and the subject fulfills study criteria.
  • Pembrolizumab will be administered IV at a dose of 2 mg/kg over 30 minutes every 3 weeks.
  • Pemetrexed at 500 mg/m 2 will be administered as an intravenous infusion over 10 minutes once every 21 days.
  • Carboplatin at 6 mg/ml ⁇ min will be administered as an intravenous infusion over 15 to 60 minutes once every 21 days for 4 cycles (or less than 4 full cycles if disease progression or toxicity warrants treatment interruption or termination). If 1 of 3 subjects experiences a DLT, that dose level will be expanded to 6 subjects. If 2 or more patients experience a DLT, no further patients will be dosed at that level and 3 additional patients will be tested at 1 mg/kg demcizumab and 2 mg/kg pembrolizumab dose level. Patients will be assessed for DLTs from the time of the first dose through Day 21. Dose escalation, if appropriate, will occur after all patients in a cohort have completed their Day 21 DLT assessment.
  • the maximum dose of demcizumab to be tested is 5 mg/kg.
  • mice with palpable tumors were treated with an anti-mPD-1 antibody (250 ⁇ g/mouse, twice a week), a combination of anti-mDLL4 antibody 21R50 (5 mg/kg, once a week) and anti-mVEGF antibody (2.5 mg/kg, once a week), a combination of anti-mPD-1 antibody, anti-mDLL4 antibody 21R50, and anti-mVEGF antibody, or a control antibody (20 mg/kg, twice a week).
  • Mice were administered the antibodies for 3 weeks by intraperitoneal injection. Tumor growth was monitored and tumor volumes were measured with electronic calipers at the indicated time points. Data are expressed as mean ⁇ S.E.M.
  • treatment with the combination of anti-mDLL4 antibody 21R50, anti-mVEGF antibody, and anti-mPD-1 antibody significantly reduced CT26.WT tumor growth as compared to treatment with the control antibody.
  • Treatment with the combination of anti-mDLL4 antibody 21R50 and anti-mVEGF antibody significantly reduced CT26.WT tumor growth as compared to treatment with the control antibody.
  • Anti-mPD-1 antibody as a single agent was not as effective and inhibited tumor growth only 59% as compared to mice treated with control antibody.
  • mice treated with the combination of anti-mDLL4 antibody 21R50, anti-mVEGF antibody, and anti-mPD-1 antibody showed 10 of 20 mice (50%) had tumors that were the same size or had regressed to a smaller size than the size of the tumor prior to treatment.
  • Evaluation of individual mice treated with the combination of anti-mDLL4 antibody 21R50 and anti-mVEGF antibody showed 5 of 10 mice (50%) had tumors that were the same size or had regressed to a smaller size than the size of the tumor prior to treatment and evaluation of mice treated with just anti-mPD-1 antibody showed 6 of 15 mice (40%) had tumors that were the same size or had regressed to a size smaller than the size of the tumor prior to treatment.
  • mice with palpable tumors were treated with an anti-mPD-1 antibody (10 mg/kg, twice a week), anti-mDLL4 21R50 (10 mg/kg, once a week), a combination of anti-mDLL4 antibody 21R50 (10 mg/kg, once a week) and anti-mVEGF antibody (10 mg/kg, once a week), a combination of anti-mDLL4 antibody 21R50 (10 mg/kg, once a week) and anti-mPD-1 antibody (10 mg/kg, twice a week), a combination of anti-mPD-1 antibody, anti-mDLL4 antibody 21R50, and anti-mVEGF antibody, or a control antibody (20 mg/kg, twice a week).
  • treatment with the combination of anti-mDLL4 antibody 21R50, anti-mVEGF antibody, and anti-mPD-1 antibody significantly reduced Renca tumor growth as compared to treatment with the control antibody.
  • Treatment with the combination of anti-mDLL4 antibody 21R50 and anti-mVEGF antibody also reduced Renca tumor growth as compared to treatment with the control antibody (78%).
  • treatment with an anti-PD-1 antibody as a single agent did not inhibit tumor growth.
  • Cells were harvested from the spleens of the CT26.WT tumor-bearing mice described above (Example 15). At Day 30 post-cell injection splenocytes were isolated. Splenocytes (1 ⁇ 10 6 ) were incubated for 10 minutes with a recombinant Fc protein to block non-specific binding, and then incubated with fluorochrome-conjugated antibodies in 100 ⁇ l FACS staining buffer (HBSS plus 2% heat inactivated calf serum) for 20 min on ice. Unbound antibodies were removed by washing and dead cells were labeled with a fixable viability dye. Cells were fixed in 2% paraformaldehyde for 20 min at room temperature and analyzed using a FACSCanto II instrument and FACSDiva Software v6.1.3 (BD Biosciences).
  • Total T-cells were identified using an anti-mouse CD3e antibody, CD4+ T-cells using an anti-mouse CD4 antibody, and CD8+ T-cells using an anti-mouse CD8 antibody.
  • Central memory cells were identified using an anti-mouse/human CD44 antibody and an anti-human CD62L antibody. FACS staining was done as described above using anti-mouse CD8b antibody (clone 53-5.8, BioLegend), anti-mouse CD4 antibody (clone GK1.5, BioLegend), anti-mouse CD62L antibody (clone MEL-14, BioLegend), and anti-mouse CD44 antibody (clone 1M7, BioLegend). Cells were analyzed for CD44 high CD62L high expression, indicating central memory cells (gated on CD8+ T-cells).
  • mice treated with a combination of anti-mDLL4 antibody, anti-mVEGF antibody, and anti-mPD-1 antibody had an increased percentage of central memory cells within the CD4+ T-cell population and within the CD8+ T-cell population as compared to mice treated with a control antibody ( FIG. 16 ).
  • mice treated with a combination of anti-mDLL4 and anti-mVEGF or mice treated with anti-mPD1 antibody as a single agent did not have a noticeable change in the percentage of central memory cells.
  • RNA samples were taken from the CT26.WT tumor-bearing mice described above in Example 15.
  • quantitative real-time RT-PCR was performed on total RNA obtained from the tumor samples.
  • the tumor samples are expected to contain tumor cells, immune cells associated with the tumor, and any stromal cells attached to the tumor sample.
  • Tumor specimens were harvested and immediately snap frozen and stored at ⁇ 80° C. prior to RNA isolation.
  • Total RNA was extracted using the RNeasy Fibrous Mini Kit (Qiagen, Valencia Calif., PN#74704) with TissueLyzer homogenization and DNase I treatment according to the manufacturer's protocol.
  • RNAs were visualized on a Bioanalyzer 2100 (Agilent, Santa Clara, Calif.) and verified to be intact with RIN values >6.0. All RNAs had A260/A280 ratios >1.8.
  • cDNA was synthesized from total RNA using random hexamers.
  • the cDNA and PCR Master Mix were added to a TaqMan Array Immune Response Plate (Applied Biosystems/Life Technologies) and reactions were run on a real-time PCR instrument according to the manufacturer's protocol.
  • treatment with a combination of anti-mDLL4, anti-mVEGF, and anti-mPD-1 increased gene expression of IL-2, granzyme B, and CCL2 in the tumor sample.
  • Treatment with anti-mPD-1 as a single agent increased gene expression of IFN-gamma and decreased gene expression of IL-6 at the tumor site.
  • all treatments decreased gene expression of IL-18.
  • IL-18 has been shown to have pleiotropic functions and appears to play a dual role in cancer (see, e.g., Palma et al., 2013 , Biochimica et Biophysica Acta, 1836:296-303). IL-18 is generally considered to be part of a Th1-type response and one might have expected to see increased levels of IL-18 expression. These results will be evaluated further. IL-2 is required for secondary population expansion of CD8+ memory T-cells, therefore these results suggest that the triple blockade of DLL4, VEGF, and PD-1 may increase T-cell activation, maintenance of T-cells, and memory T-cell function.
  • CCL2 (C-C motif ligand 2) is a chemokine which is also referred to as monocyte chemotactic protein 1 (MCP 1) and small inducible cytokine A2.
  • MCP 1 monocyte chemotactic protein 1
  • Chemokines have been shown to recruit monocytes, memory T cells, and dendritic cells to the sites of inflammation and tumors. The recruitment of immune cells may enhance an anti-tumor response. However, in some studies, chemokines have been found to promote tumorigenesis, therefore this result will need to be studied further.
  • Granzyme B is a serine protease found in the granules of CTLs and NK cells. It is secreted by these cells along with the pore forming protein perforin to mediate apoptosis in target cells. The increased expression of granzyme B suggests the presence of active tumor-killing cells at the tumor site in mice treated with anti-mDLL4, anti-mVEGF, and anti-mPD-1.
  • Mice were administered the anti-PD-1 antibody twice a week for 3 weeks and the anti-Notch2/3 antibody once a week for 3 weeks by intraperitoneal injection. Tumor growth was monitored and tumor volumes were measured with electronic calipers at the indicated time points. Data are expressed as mean ⁇ S.E.M.
  • treatment with the combination of anti-Notch2/3 antibody 59R5 and an anti-mPD-1 antibody significantly reduced CT26.WT tumor growth as compared to treatment with the control antibody.
  • Tumor growth was inhibited 80% as compared to control on Day 24.
  • an anti-PD-1 antibody as a single agent inhibited tumor growth by only 46% as compared to control and treatment with anti-Notch2/3 antibody 59R5 was observed to increase tumor growth as compared to control.
  • tumors regressed to undetectable levels in 3 of the 10 mice treated with the combination of anti-Notch2/3 antibody and anti-PD-1 antibody and were still undetectable at Day 90.
  • tumor regression was observed in only one mouse treated with anti-PD-1 antibody as a single agent.
  • 21M18 Heavy chain CDR1 (SEQ ID NO: 1) TAYYIH 21M18 - H2 Heavy chain CDR2 (SEQ ID NO: 2) YISCYNGATNYNQKFKG 21M18 - H7 Heavy chain CDR2 (SEQ ID NO: 3) YISSYNGATNYNQKFKG 21M18 - H9 Heavy chain CDR2 (SEQ ID NO: 4) YISVYNGATNYNQKFKG 21M18 Heavy chain CDR3 (SEQ ID NO: 5) RDYDYDVGMDY 21M18 Light chain CDR1 (SEQ ID NO: 6) RASESVDNYGISFMK 21M18 Light chain CDR2 (SEQ ID NO: 7) AASNQGS 21M18 Light chain CDR3 (SEQ ID NO: 8) QQSKEVPWTFGG 21M18 - H2 Heavy chain variable region (SEQ ID NO: 9) QVQLVQSGAEVKKPGASVKISCKASGYSFTAYYIHWVKQAPG

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Immunology (AREA)
  • Engineering & Computer Science (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Biomedical Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biophysics (AREA)
  • Epidemiology (AREA)
  • Biochemistry (AREA)
  • Microbiology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • General Engineering & Computer Science (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Biotechnology (AREA)
  • Mycology (AREA)
  • Endocrinology (AREA)
  • Plant Pathology (AREA)
  • Physics & Mathematics (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Oncology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
US14/928,271 2014-10-31 2015-10-30 Combination Therapy For Treatment Of Disease Abandoned US20160176962A1 (en)

Priority Applications (4)

Application Number Priority Date Filing Date Title
US14/928,271 US20160176962A1 (en) 2014-10-31 2015-10-30 Combination Therapy For Treatment Of Disease
US15/889,532 US11046760B2 (en) 2014-10-31 2018-02-06 Combination therapy for treatment of disease
US17/330,716 US20210403553A1 (en) 2014-10-31 2021-05-26 Combination therapy for treatment of disease
US18/758,255 US20250179169A1 (en) 2014-10-31 2024-06-28 Combination therapy for treatment of disease

Applications Claiming Priority (5)

Application Number Priority Date Filing Date Title
US201462073634P 2014-10-31 2014-10-31
US201562127172P 2015-03-02 2015-03-02
US201562192133P 2015-07-14 2015-07-14
US201562242567P 2015-10-16 2015-10-16
US14/928,271 US20160176962A1 (en) 2014-10-31 2015-10-30 Combination Therapy For Treatment Of Disease

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US15/889,532 Continuation US11046760B2 (en) 2014-10-31 2018-02-06 Combination therapy for treatment of disease

Publications (1)

Publication Number Publication Date
US20160176962A1 true US20160176962A1 (en) 2016-06-23

Family

ID=55858530

Family Applications (4)

Application Number Title Priority Date Filing Date
US14/928,271 Abandoned US20160176962A1 (en) 2014-10-31 2015-10-30 Combination Therapy For Treatment Of Disease
US15/889,532 Active 2036-06-20 US11046760B2 (en) 2014-10-31 2018-02-06 Combination therapy for treatment of disease
US17/330,716 Abandoned US20210403553A1 (en) 2014-10-31 2021-05-26 Combination therapy for treatment of disease
US18/758,255 Pending US20250179169A1 (en) 2014-10-31 2024-06-28 Combination therapy for treatment of disease

Family Applications After (3)

Application Number Title Priority Date Filing Date
US15/889,532 Active 2036-06-20 US11046760B2 (en) 2014-10-31 2018-02-06 Combination therapy for treatment of disease
US17/330,716 Abandoned US20210403553A1 (en) 2014-10-31 2021-05-26 Combination therapy for treatment of disease
US18/758,255 Pending US20250179169A1 (en) 2014-10-31 2024-06-28 Combination therapy for treatment of disease

Country Status (11)

Country Link
US (4) US20160176962A1 (ja�@�@)
EP (1) EP3212233B1 (ja�@�@)
JP (1) JP6827415B2 (ja�@�@)
CN (1) CN107530419B (ja�@�@)
AU (1) AU2015338974B2 (ja�@�@)
CA (1) CA2966042A1 (ja�@�@)
DK (1) DK3212233T3 (ja�@�@)
ES (1) ES2808153T3 (ja�@�@)
MX (1) MX382902B (ja�@�@)
PT (1) PT3212233T (ja�@�@)
WO (1) WO2016070051A2 (ja�@�@)

Cited By (20)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20150274835A1 (en) * 2012-10-04 2015-10-01 Dana-Farber Cancer Institute, Inc. Human monoclonal anti-pd-l1 antibodies and methods of use
US20150283234A1 (en) * 2012-10-23 2015-10-08 Bristol-Myers Squibb Company Combination of anti-kir and anti-ctla-4 antibodies to treat cancer
US9815897B2 (en) 2013-05-02 2017-11-14 Anaptysbio, Inc. Antibodies directed against programmed death-1 (PD-1)
WO2018009904A3 (en) * 2016-07-08 2018-02-15 Tumeh Paul C Compositions and treatment methods for cancer immunotherapy
WO2018049042A1 (en) * 2016-09-07 2018-03-15 The Wistar Institute Of Anatomy And Biology Methods and compositions for treating cancers by inhibiting estrogen signaling in myeloid-derived suppressor cells
WO2018102769A1 (en) * 2016-12-01 2018-06-07 Bluelink Pharmaceuticals, Inc. Treatment of cancer
US10336824B2 (en) 2015-03-13 2019-07-02 Cytomx Therapeutics, Inc. Anti-PDL1 antibodies, activatable anti-PDL1 antibodies, and methods of thereof
US10513558B2 (en) 2015-07-13 2019-12-24 Cytomx Therapeutics, Inc. Anti-PD1 antibodies, activatable anti-PD1 antibodies, and methods of use thereof
US10836824B2 (en) 2015-02-03 2020-11-17 Anaptysbio, Inc. Antibodies directed against lymphocyte activation gene 3 (LAG-3)
WO2020247633A1 (en) * 2019-06-05 2020-12-10 Southern Research Institute Thiarabine- and thiarabine prodrug-based treatments
US11046760B2 (en) 2014-10-31 2021-06-29 Oncomed Pharmaceuticals, Inc. Combination therapy for treatment of disease
US20210244745A1 (en) * 2018-05-06 2021-08-12 Ayala Pharmaceuticals Inc. Combination compositions comprising bisfluoroalkyl-1,4-benzodiazepinone compounds and methods of use thereof
US11155624B2 (en) 2016-11-01 2021-10-26 Anaptysbio, Inc. Antibodies directed against programmed death-1 (PD-1)
US11168144B2 (en) 2017-06-01 2021-11-09 Cytomx Therapeutics, Inc. Activatable anti-PDL1 antibodies, and methods of use thereof
US20220017610A1 (en) * 2018-11-16 2022-01-20 The Brigham And Women`S Hospital, Inc. Antibodies Blocking DLL4-Mediated Notch Signalling
US11275080B2 (en) 2014-11-05 2022-03-15 The Regents Of The University Of California Methods for stratifying non-responders to therapies that block PD1/PDL1 axis
US11407830B2 (en) 2017-01-09 2022-08-09 Tesaro, Inc. Methods of treating cancer with anti-PD-1 antibodies
US11535670B2 (en) * 2016-05-11 2022-12-27 Huyabio International, Llc Combination therapies of HDAC inhibitors and PD-L1 inhibitors
US12122833B2 (en) 2016-05-11 2024-10-22 Huyabio International, Llc Combination therapies of HDAC inhibitors and PD-1 inhibitors
US12173081B2 (en) 2023-03-21 2024-12-24 Biograph 55, Inc. CD19/CD38 multispecific antibodies

Families Citing this family (28)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
HUE029661T2 (en) 2009-10-16 2017-03-28 Oncomed Pharm Inc A therapeutic combination and use of DLL4 antagonist antibodies and antihypertensive agents
LT3485903T (lt) 2011-09-23 2023-02-27 Mereo Biopharma 5, Inc. Vegf/ dll4 surišantys agentai ir jų panaudojimas
SG10201804945WA (en) 2013-12-12 2018-07-30 Shanghai hengrui pharmaceutical co ltd Pd-1 antibody, antigen-binding fragment thereof, and medical application thereof
US11339213B2 (en) 2015-09-23 2022-05-24 Mereo Biopharma 5, Inc. Methods and compositions for treatment of cancer
EP3442528B1 (en) 2016-04-12 2021-05-26 Eli Lilly and Company Combination therapy with notch and pi3k/mtor inhibitors for use in treating ovarian cancer
TWI910495B (zh) * 2016-05-13 2026-01-01 美商再生元醫藥公司 藉由投予pd-1抑制劑治療皮膚癌之方法
JP7194022B2 (ja) * 2016-05-20 2022-12-21 イーライ リリー アンド カンパニー Notch阻害剤とPD-1またはPD-L1阻害剤との併用療法
CN109563170B (zh) * 2016-06-10 2023-10-13 瑞泽恩制药公司 抗gitr抗体及其用途
CN109757103B (zh) 2016-07-14 2024-01-02 百时美施贵宝公司 针对tim3的抗体及其用途
WO2018027524A1 (en) * 2016-08-09 2018-02-15 Innovent Biologics (Suzhou) Co., Ltd. Pd-1 antibody formulation
CN112481217A (zh) 2016-09-01 2021-03-12 嵌合体生物工程公司 Gold优化的car t-细胞
WO2018049474A1 (en) * 2016-09-16 2018-03-22 Bionomics Limited Antibody and checkpoint inhibitor combination therapy
US10780080B2 (en) * 2016-11-23 2020-09-22 Translational Drug Development, Llc Benzamide and active compound compositions and methods of use
JOP20190260A1 (ar) 2017-05-02 2019-10-31 Merck Sharp & Dohme صيغ ثابتة لأجسام مضادة لمستقبل الموت المبرمج 1 (pd-1) وطرق استخدامها
MY206158A (en) 2017-05-24 2024-12-02 Novartis Ag Antibody-cytokine engrafted proteins and methods of use in the treatment of cancer
WO2019023786A1 (en) * 2017-08-01 2019-02-07 University Health Network COMBINED THERAPIES FOR THE INHIBITION OF TTK PROTEIN KINASE
BR112020003362A2 (pt) 2017-08-28 2020-08-18 Bristol-Myers Squibb Company antagonistas de tim-3 para o tratamento e diagnóstico de cânceres
MX2020004568A (es) 2017-11-06 2020-10-05 Juno Therapeutics Inc Combinación de una terapia celular y un inhibidor de gamma secretasa.
EP3737700A1 (en) 2018-01-12 2020-11-18 Bristol-Myers Squibb Company Antibodies against tim3 and uses thereof
CN111989108B (zh) 2018-02-13 2024-07-16 嵌合体生物工程公司 利用rna去稳定元件协调基因表达
CN108753833B (zh) * 2018-05-28 2021-12-03 上海海洋大学 斑马鱼notch3基因突变体的制备方法
WO2020081408A1 (en) 2018-10-18 2020-04-23 Merck Sharp & Dohme Corp. Formulations of anti-rsv antibodies and methods of use thereof
JP2022546282A (ja) 2019-08-18 2022-11-04 キメラ・バイオエンジニアリング,インコーポレーテッド Gold制御導入遺伝子による併用療法
US11787867B2 (en) 2020-03-06 2023-10-17 Regeneron Pharmaceuticals, Inc. Anti-GITR antibodies and uses thereof
WO2022125392A1 (en) * 2020-12-09 2022-06-16 Chimera Bioengineering, Inc. Compositions and methods for activating t-cells
US20250281638A1 (en) * 2021-06-10 2025-09-11 Chimera Bioengineering, Inc. Compositions and Methods for Activating Natural Killer Cells
WO2023056194A2 (en) 2021-09-29 2023-04-06 Chimera Bioengineering, Inc. Compositions and methods for anti-tnmuc1 gold car t-cells
WO2023063842A1 (ru) * 2021-10-12 2023-04-20 Общество с ограниченной ответственностью "Пальмира Биофарма" Нуклеотидная последовательность, кодирующая слитый белок

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20090217401A1 (en) * 2005-05-09 2009-08-27 Medarex, Inc Human Monoclonal Antibodies To Programmed Death 1(PD-1) And Methods For Treating Cancer Using Anti-PD-1 Antibodies Alone or in Combination with Other Immunotherapeutics
US7803377B2 (en) * 2006-06-06 2010-09-28 Genentech, Inc. Anti-DLL4 antibodies and methods using same

Family Cites Families (165)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3773919A (en) 1969-10-23 1973-11-20 Du Pont Polylactide-drug mixtures
US4485045A (en) 1981-07-06 1984-11-27 Research Corporation Synthetic phosphatidyl cholines useful in forming liposomes
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US4544545A (en) 1983-06-20 1985-10-01 Trustees University Of Massachusetts Liposomes containing modified cholesterol for organ targeting
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
GB8823869D0 (en) 1988-10-12 1988-11-16 Medical Res Council Production of antibodies
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
US5013556A (en) 1989-10-20 1991-05-07 Liposome Technology, Inc. Liposomes with enhanced circulation time
ATE158021T1 (de) 1990-08-29 1997-09-15 Genpharm Int Produktion und nützung nicht-menschliche transgentiere zur produktion heterologe antikörper
US5545806A (en) 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
US5633425A (en) 1990-08-29 1997-05-27 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5661016A (en) 1990-08-29 1997-08-26 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5625126A (en) 1990-08-29 1997-04-29 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
CA2095633C (en) 1990-12-03 2003-02-04 Lisa J. Garrard Enrichment method for variant proteins with altered binding properties
US6582959B2 (en) 1991-03-29 2003-06-24 Genentech, Inc. Antibodies to vascular endothelial cell growth factor
IL101728A (en) 1991-05-03 2007-08-19 Univ Yale Human Abandonment and Delta, Restrictive Areas of Effect in Tophoric Proteins, and Methods Based on Them
US5786158A (en) 1992-04-30 1998-07-28 Yale University Therapeutic and diagnostic methods and compositions based on notch proteins and nucleic acids
US20050112121A1 (en) 1992-04-30 2005-05-26 Yale University Therapeutic and diagnostic methods and compositions based on notch proteins and nucleic acids
US5840299A (en) 1994-01-25 1998-11-24 Athena Neurosciences, Inc. Humanized antibodies against leukocyte adhesion molecule VLA-4
US5731168A (en) 1995-03-01 1998-03-24 Genentech, Inc. Method for making heteromultimeric polypeptides
US5641870A (en) 1995-04-20 1997-06-24 Genentech, Inc. Low pH hydrophobic interaction chromatography for antibody purification
DE69638023D1 (de) 1995-06-28 2009-10-22 Univ Yale Nukleotid- und proteinsequenzen von delta-genen von vertebraten und darauf basierende methoden
US5730977A (en) 1995-08-21 1998-03-24 Mitsui Toatsu Chemicals, Inc. Anti-VEGF human monoclonal antibody
JPH09124697A (ja) 1995-11-01 1997-05-13 Toagosei Co Ltd ペプチド及びモノクローナル抗体
US6337387B1 (en) 1995-11-17 2002-01-08 Asahi Kasei Kabushiki Kaisha Differentiation-suppressive polypeptide
US20020137890A1 (en) 1997-03-31 2002-09-26 Genentech, Inc. Secreted and transmembrane polypeptides and nucleic acids encoding the same
US20060122373A1 (en) 1997-04-04 2006-06-08 Millennium Pharmaceuticals, Inc. Delta3, FTHMA-070, Tango85, Tango77, SPOIL,NEOKINE, Tango129 and integrin alpha subunit protein and nucleic acid molecules and uses thereof
US6121045A (en) 1997-04-04 2000-09-19 Millennium Biotherapeutics, Inc. Human Delta3 nucleic acid molecules
US20030180784A1 (en) 1997-04-04 2003-09-25 Millennium Pharmaceuticals, Inc. Novel human Delta3 compositions and therapeutic and diagnostic uses therefor
AU6952498A (en) 1997-04-04 1998-10-30 Millenium Pharmaceuticals, Inc. Novel human delta3 compositions and therapeutic and diagnostic uses therefor
US20020032315A1 (en) 1997-08-06 2002-03-14 Manuel Baca Anti-vegf antibodies
KR100816621B1 (ko) 1997-04-07 2008-03-24 제넨테크, 인크. 항-vegf 항체
US20070059302A1 (en) 1997-04-07 2007-03-15 Genentech, Inc. Anti-vegf antibodies
ATE299938T1 (de) 1997-05-02 2005-08-15 Genentech Inc Ein verfahren zur herstellung multispezifischer antikörper die heteromultimere und gemeinsame komponenten besitzen
US20020062010A1 (en) 1997-05-02 2002-05-23 Genentech, Inc. Method for making multispecific antibodies having heteromultimeric and common components
US7951917B1 (en) 1997-05-02 2011-05-31 Genentech, Inc. Method for making multispecific antibodies having heteromultimeric and common components
US6664098B1 (en) 1997-05-14 2003-12-16 Asahi Kasei Kabushiki Kaisha Differentiation inhibitory agent
WO1998057621A1 (en) 1997-06-18 1998-12-23 The Trustees Of Columbia University In The City Ofnew York Angiogenic modulation by notch signal transduction
US6004528A (en) 1997-09-18 1999-12-21 Bergstein; Ivan Methods of cancer diagnosis and therapy targeted against the cancer stemline
EP1100899A2 (en) 1998-07-27 2001-05-23 Amgen Inc. Delta-related polypeptides
US6342219B1 (en) 1999-04-28 2002-01-29 Board Of Regents, The University Of Texas System Antibody compositions for selectively inhibiting VEGF
CA2491433A1 (en) 1999-12-01 2001-06-07 Genentech, Inc. Secreted and transmembrane polypeptides and nucleic acids encoding the same
US20110131679A2 (en) 2000-04-19 2011-06-02 Thomas La Rosa Rice Nucleic Acid Molecules and Other Molecules Associated with Plants and Uses Thereof for Plant Improvement
US20020028488A1 (en) 2000-06-19 2002-03-07 Sujay Singh Transgenic avian species for making human and chimeric antibodies
US6984522B2 (en) 2000-08-03 2006-01-10 Regents Of The University Of Michigan Isolation and use of solid tumor stem cells
US8044259B2 (en) 2000-08-03 2011-10-25 The Regents Of The University Of Michigan Determining the capability of a test compound to affect solid tumor stem cells
US6689744B2 (en) 2000-09-22 2004-02-10 Genentech, Inc. Notch receptor agonists and uses
US7667004B2 (en) 2001-04-17 2010-02-23 Abmaxis, Inc. Humanized antibodies against vascular endothelial growth factor
EP1410018A1 (en) 2001-07-25 2004-04-21 Lorantis Limited Method for detecting modultators of notch signalling
DE60235761D1 (de) 2001-08-01 2010-05-06 Univ Bristol Clifton Isoform des vegfs
US20050137130A1 (en) 2001-11-14 2005-06-23 Bodmer Mark W. Medical treatment
WO2003042246A2 (en) 2001-11-14 2003-05-22 Lorantis Limited Inhibitors of the notch signalling pathway for use in the treatment of cancer
JP2005518785A (ja) 2001-11-14 2005-06-30 ロランティス リミテッド 内科療法
AU2002364537A1 (en) 2001-12-07 2003-06-23 Regents Of The University Of Michigan Prospective identification and characterization of breast cancer stem cells
AUPS054702A0 (en) * 2002-02-14 2002-03-07 Immunaid Pty Ltd Cancer therapy
US8034904B2 (en) 2002-06-14 2011-10-11 Immunogen Inc. Anti-IGF-I receptor antibody
GB0218879D0 (en) 2002-08-14 2002-09-25 Lorantis Ltd Medical treatment
AU2003267563A1 (en) 2002-09-10 2004-04-30 Lorantis Limited Pharmaceutical composition and medical treatments comprising notch ligand proteins
WO2004110490A2 (en) 2003-06-06 2004-12-23 Regeneron Pharmaceuticals, Inc. Use of vegf inhibitors for tumor regression
US7758859B2 (en) 2003-08-01 2010-07-20 Genentech, Inc. Anti-VEGF antibodies
US20050106667A1 (en) 2003-08-01 2005-05-19 Genentech, Inc Binding polypeptides with restricted diversity sequences
WO2005014618A2 (en) 2003-08-08 2005-02-17 Immunomedics, Inc. Bispecific antibodies for inducing apoptosis of tumor and diseased cells
FR2859725B1 (fr) 2003-09-16 2006-03-10 Neovacs Procede a haut rendement pour l'obtention d'anticorps humains neutralisant l'activite biologique d'une cytokine humaine
CA2567686A1 (en) 2004-06-10 2005-12-29 Regeneron Pharmaceuticals, Inc. Use of vegf inhibitors for the treatment of human cancer
EP1759214B1 (en) 2004-06-15 2013-04-24 F.Hoffmann-La Roche Ag The use of cardiac hormones for diagnosing the risk of suffering from a cardiovascular complication as a consequence of cardiotoxic medication
MXPA06014689A (es) 2004-06-18 2008-03-11 Regeneron Pharma Inhibidores del vegf para el tratamiento de efusion pleural maligna.
EP1615036B1 (en) 2004-07-07 2007-09-19 F.Hoffmann-La Roche Ag Multimarker panel for diabetes type 1 and 2
WO2006028936A2 (en) 2004-09-02 2006-03-16 Genentech, Inc. Heteromultimeric molecules
WO2006027693A2 (en) 2004-09-09 2006-03-16 Exonhit Therapeutics Sa Tumor specific genes and variant rnas and uses thereof as targets for cancer therapy and diagnosis
EP1810979B1 (en) 2004-09-22 2012-06-20 Kyowa Hakko Kirin Co., Ltd. STABILIZED HUMAN IgG4 ANTIBODIES
US20060134121A1 (en) 2004-10-29 2006-06-22 Gavin Thurston DII4 antagonists, assays, and therapeutic methods thereof
US8048418B2 (en) 2004-10-29 2011-11-01 Regeneron Pharmaceuticals, Inc. Therapeutic methods for inhibiting tumor growth with combination of Dll4 antagonists and VEGF antagonists
NZ555216A (en) 2004-11-10 2010-05-28 Hubrecht Lab Treatment of an intestinal adenoma and/or adenocarcinoma by inhibition of notch pathway activation
WO2006083355A2 (en) 2004-11-19 2006-08-10 Cornell Research Foundation, Inc. Use of vascular endothelial growth factor receptor 1+ cells in treating and monitoring cancer and in screening for chemotherapeutics
US7432107B2 (en) 2005-01-24 2008-10-07 Roche Diagnostics Operations, Inc. Cardiac hormones for assessing cardiovascular risk
EP1853298A2 (en) 2005-02-11 2007-11-14 Regeneron Pharmaceuticals, Inc. Therapeutic combination of a vegf antagonist (vegf trap) and an anti-hypertensive agent
AU2006232287B2 (en) 2005-03-31 2011-10-06 Chugai Seiyaku Kabushiki Kaisha Methods for producing polypeptides by regulating polypeptide association
ES2971647T3 (es) 2005-04-15 2024-06-06 Macrogenics Inc Diacuerpos covalentes y usos de los mismos
CA2607699A1 (en) 2005-06-02 2006-12-07 Galaxy Biotech, Llc Methods of treating brain tumors with antibodies
PT1907424E (pt) * 2005-07-01 2015-10-09 Squibb & Sons Llc Anticorpos monoclonais humanos para o ligando 1 de morte programada (pd-l1)
CA2615636A1 (en) 2005-08-12 2007-02-22 Regeneron Pharmaceuticals, Inc. Treatment of diseases by subcutaneous administration of a vegf antagonist
JP2009507796A (ja) 2005-09-01 2009-02-26 バスジーン セラピューティクス, インコーポレイテッド デルタ様リガンド4のモジュレーターの利用及び同定方法
US7906116B2 (en) 2005-09-01 2011-03-15 Parkash Gill Methods for using and identifying modulators of Delta-like 4
CA2628255C (en) 2005-10-31 2016-04-19 The Regents Of The University Of Michigan Compositions and methods for treating and diagnosing cancer
CA2630839C (en) 2005-12-16 2017-01-17 Regeneron Pharmaceuticals, Inc. Therapeutic methods for inhibiting tumor growth with dll4 antagonists
EP1993541A2 (en) 2006-02-17 2008-11-26 Gilead Colorado, Inc. Antihypertensive therapy
WO2011053822A2 (en) 2009-11-01 2011-05-05 The Brigham And Women's Hospital, Inc. Notch inhibition in the treatment and prevention of obesity and metabolic syndrome
WO2007103114A2 (en) 2006-03-07 2007-09-13 The Brigham & Women's Hospital, Inc. Notch inhibition in the treatment or prevention of atherosclerosis
US7354582B2 (en) 2006-03-10 2008-04-08 Regeneron Pharmaceuticals, Inc. Use of VEGF antagonists for the treatment of malignant gliomas
PT1999154E (pt) 2006-03-24 2013-01-24 Merck Patent Gmbh Domínios proteicos heterodiméricos modificados
EP2029159A2 (en) 2006-06-06 2009-03-04 Genentech, Inc. Compositions and methods for modulating vascular development
ES2413087T3 (es) 2006-06-13 2013-07-15 Oncomed Pharmaceuticals, Inc. Composiciones y métodos para el diagnóstico y tratamiento del cáncer
JP2009541275A (ja) 2006-06-22 2009-11-26 ノボ・ノルデイスク・エー/エス 二重特異性抗体の生産
HRP20130271T1 (hr) 2006-08-07 2013-04-30 Regeneron Pharmaceuticals, Inc. Upotreba dii4 antagonista kod ishemijskih ozljeda ili vaskularne insuficijencije
WO2008027236A2 (en) 2006-08-30 2008-03-06 Genentech, Inc. Multispecific antibodies
DK2066694T3 (en) 2006-09-29 2016-02-08 Oncomed Pharm Inc Compositions and Methods for Diagnosing and Treating Cancer
UA110315C2 (uk) * 2006-09-29 2015-12-25 Oncomed Pharm Inc Композиція та спосіб лікування раку
JP2010507594A (ja) 2006-10-20 2010-03-11 シェーリング コーポレイション 完全ヒト抗vegf抗体および使用方法
US8466154B2 (en) 2006-10-27 2013-06-18 The Board Of Regents Of The University Of Texas System Methods and compositions related to wrapping of dehydrons
US20100166746A1 (en) 2006-12-04 2010-07-01 Medlmmune Way High potency recombinant antibodies, methods for producing them and use in cancer therapy
CA2670707A1 (en) 2006-12-11 2008-06-19 Genentech, Inc. Compositions and methods for treating a neoplasm
RU2448979C2 (ru) 2006-12-14 2012-04-27 Ридженерон Фармасьютикалз, Инк. Антитела человека к дельта-подобному лиганду-4 человека
HUE029445T2 (en) 2006-12-19 2017-02-28 Genentech Inc VEGF-specific antagonists for adjuvant and neoadjuvant therapy and treatment of early-stage tumors
EP2120996A2 (en) 2006-12-20 2009-11-25 Vasgene Therapeutics, Inc. Methods for using and identifying modulators of delta-like 4
JP2010517944A (ja) 2007-01-26 2010-05-27 バイオインヴェント インターナショナル アーベー Dll4シグナリング阻害薬およびその使用
EP2671584A3 (en) 2007-05-04 2014-03-26 Ironwood Pharmaceuticals, Inc. Compositions and methods for treating disorders associated with salt or fluid retention
GB0709333D0 (en) 2007-05-15 2007-06-20 Smart Targeting Ltd Binding protein
JP2011500086A (ja) 2007-10-22 2011-01-06 シェーリング コーポレイション 完全ヒト抗vegf抗体および使用方法
EP2203480A1 (en) 2007-10-25 2010-07-07 University Of Bristol Antibodies specific to pro-angiogenic isoforms of vascular endothelial growth factor (vegf)
TWI468417B (zh) 2007-11-30 2015-01-11 Genentech Inc 抗-vegf抗體
WO2009075565A1 (en) 2007-12-12 2009-06-18 Erasmus University Medical Center Rotterdam Methods for controlling vasculogenesis
US9266967B2 (en) 2007-12-21 2016-02-23 Hoffmann-La Roche, Inc. Bivalent, bispecific antibodies
JP6157046B2 (ja) 2008-01-07 2017-07-05 アムジェン インコーポレイテッド 静電的ステアリング(electrostaticsteering)効果を用いた抗体Fcヘテロ二量体分子を作製するための方法
JP2011516520A (ja) 2008-04-07 2011-05-26 アブリンクス エン.ヴェー. Notch経路に指向性を有するアミノ酸配列及びその使用
SG190572A1 (en) 2008-04-29 2013-06-28 Abbott Lab Dual variable domain immunoglobulins and uses thereof
US20100260668A1 (en) 2008-04-29 2010-10-14 Abbott Laboratories Dual Variable Domain Immunoglobulins and Uses Thereof
CN102112490B (zh) * 2008-07-08 2014-10-22 昂考梅德药品有限公司 Notch1受体结合剂和其使用方法
EP2321651B1 (en) 2008-07-23 2017-08-23 F. Hoffmann-La Roche AG Identification of subjects being susceptible to anti-angiogenesis therapy
JP2011528798A (ja) 2008-07-23 2011-11-24 エフ.ホフマン−ラ ロシュ アーゲー 抗血管形成療法のモニター
JP2012500855A (ja) * 2008-08-25 2012-01-12 アンプリミューン、インコーポレーテッド Pd−1アンタゴニストおよび感染性疾患を処置するための方法
AU2009294415B2 (en) * 2008-09-19 2015-09-24 Medimmune Llc Antibodies directed to DLL4 and uses thereof
CA2742969A1 (en) 2008-11-07 2010-05-14 Fabrus Llc Anti-dll4 antibodies and uses thereof
NZ597692A (en) 2008-12-12 2013-08-30 Boehringer Ingelheim Int Anti-IGF antibodies
AR076344A1 (es) 2009-04-20 2011-06-01 Genentech Inc Metodo de terapia complementaria contra el cancer
WO2010124009A2 (en) 2009-04-21 2010-10-28 Schering Corporation Fully human anti-vegf antibodies and methods of using
WO2010129304A2 (en) 2009-04-27 2010-11-11 Oncomed Pharmaceuticals, Inc. Method for making heteromultimeric molecules
TWI513465B (zh) 2009-06-25 2015-12-21 Regeneron Pharma 以dll4拮抗劑與化學治療劑治療癌症之方法
JP2012532608A (ja) 2009-07-08 2012-12-20 アムジェン インコーポレイテッド CH3ドメイン界面操作を通じた、安定でそして凝集しない抗体Fc分子の設計
BR112012004546A8 (pt) 2009-08-29 2017-12-05 Abbott Lab Terapêutica por proteínas ligantes dll4-ligantes
WO2011028811A2 (en) 2009-09-01 2011-03-10 Abbott Laboratories Dual variable domain immunoglobulins and uses thereof
US20110172398A1 (en) 2009-10-02 2011-07-14 Boehringer Ingelheim International Gmbh Bispecific binding molecules for anti-angiogenesis therapy
HUE029661T2 (en) 2009-10-16 2017-03-28 Oncomed Pharm Inc A therapeutic combination and use of DLL4 antagonist antibodies and antihypertensive agents
AU2010310895A1 (en) 2009-10-23 2012-05-03 Garvan Institute Of Medical Research Modified variable domain molecules and methods for producing and using same
CA2782299A1 (en) 2009-12-01 2011-06-09 Oncomed Pharmaceuticals, Inc. Methods for treating cancers comprising k-ras mutations
MX2012008085A (es) * 2010-01-13 2012-09-12 Oncomed Pharm Inc Agentes de union notch1 y metodos de uso de los mismos.
JO3183B1 (ar) 2010-01-29 2018-03-08 Regeneron Pharma طرق لمعالجة أمراض المناعة الذاتية مضادات dll4
CA2789446A1 (en) 2010-02-12 2011-08-18 Oncomed Pharmaceuticals, Inc. Methods for identifying and isolating cells expressing a polypeptide
KR101853278B1 (ko) 2010-03-02 2018-05-02 애브비 인코포레이티드 치료학적 dll4 결합 단백질
CA2809089C (en) 2010-08-23 2018-12-18 Board Of Regents, The University Of Texas System Anti-ox40 antibodies and methods of using the same
US8551479B2 (en) * 2010-09-10 2013-10-08 Oncomed Pharmaceuticals, Inc. Methods for treating melanoma
US20130323265A1 (en) 2010-11-15 2013-12-05 Oncomed Pharmaceuticals, Inc. Methods for treating cancer with dll4 antagonists
JP5889800B2 (ja) * 2010-12-01 2016-03-22 キッコーマン株式会社 大腸菌形質転換体、それを用いたフラビン結合型グルコースデヒドロゲナーゼの製造方法、および、変異型フラビン結合型グルコースデヒドロゲナーゼ
TWI530489B (zh) * 2011-03-22 2016-04-21 必治妥美雅史谷比公司 雙(氟烷基)-1,4-苯二氮呯酮化合物
US8685401B2 (en) 2011-06-17 2014-04-01 Adrian Harris Methods of enhancing the response to radiation in tumor therapy using anti-DLL4 antibodies
LT3485903T (lt) * 2011-09-23 2023-02-27 Mereo Biopharma 5, Inc. Vegf/ dll4 surišantys agentai ir jų panaudojimas
EP2780354A4 (en) * 2011-11-16 2015-06-24 Oncomed Pharm Inc HUMAN NOTCH RECEPTOR MUTATIONS AND THEIR USE
US20150005475A1 (en) 2012-02-03 2015-01-01 Medimmune Limited Process for reducing antibody aggregate levels and antibodies produced thereby
HK1203971A1 (en) * 2012-05-15 2015-11-06 Bristol-Myers Squibb Company Cancer immunotherapy by disrupting pd-1/pd-l1 signaling
US20130323266A1 (en) * 2012-05-16 2013-12-05 Oncomed Pharmaceuticals, Inc. Methods for treating cancer with notch2/3 antibodies
AR092325A1 (es) 2012-05-31 2015-04-15 Regeneron Pharma Formulaciones estabilizadas que contienen anticuerpos anti-dll4 y kit
JP2015520172A (ja) 2012-05-31 2015-07-16 ソレント・セラピューティクス・インコーポレイテッドSorrento Therapeutics, Inc. Dll−4に結合する抗原結合蛋白質
KR101535341B1 (ko) 2012-07-02 2015-07-13 한화케미칼 주식회사 Dll4에 특이적으로 결합하는 신규한 단일클론항체 및 이의 용도
SG11201408538PA (en) 2012-07-13 2015-02-27 Roche Glycart Ag Bispecific anti-vegf/anti-ang-2 antibodies and their use in the treatment of ocular vascular diseases
KR20150060686A (ko) 2012-09-28 2015-06-03 베링거 인겔하임 인터내셔날 게엠베하 이중 안지오포이에틴-2/Dll4 결합제 및 항-VEGF 제제를 포함하는 약제학적 조합물
BR112015007672A2 (pt) 2012-10-04 2017-08-08 Dana Farber Cancer Inst Inc anticorpos anti-pd-l1 monoclonais humanos e métodos de uso
US9599620B2 (en) 2012-10-31 2017-03-21 Oncomed Pharmaceuticals, Inc. Methods and monitoring of treatment with a DLL4 antagonist
TW202037609A (zh) 2012-11-01 2020-10-16 美商艾伯維有限公司 抗-vegf/dll4雙重可變區域免疫球蛋白及其用途
AR093445A1 (es) 2012-11-14 2015-06-10 Regeneron Pharma Metodos para tratar el cancer de ovario con antagonistas de dll4
SMT202100065T1 (it) 2013-05-02 2021-03-15 Anaptysbio Inc Anticorpi diretti contro la proteina della morte programmata (pd-1)
WO2015130751A1 (en) 2014-02-26 2015-09-03 Medimmune, Llc Methods of treatment with dll4 antagonists
JP6632984B2 (ja) * 2014-03-11 2020-01-22 リジェネロン・ファーマシューティカルズ・インコーポレイテッドRegeneron Pharmaceuticals, Inc. 抗EGFRvIII抗体およびその使用
CN106488775A (zh) 2014-07-11 2017-03-08 基因泰克公司 Notch途径抑制
ES2808153T3 (es) 2014-10-31 2021-02-25 Mereo Biopharma 5 Inc Terapia de combinación para tratamiento de enfermedad
US11339213B2 (en) * 2015-09-23 2022-05-24 Mereo Biopharma 5, Inc. Methods and compositions for treatment of cancer
WO2020012447A1 (en) 2018-07-13 2020-01-16 Composite Interceptive Med-Science Laboratories Private Limited Polyherbal formulation and method for production thereof

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20090217401A1 (en) * 2005-05-09 2009-08-27 Medarex, Inc Human Monoclonal Antibodies To Programmed Death 1(PD-1) And Methods For Treating Cancer Using Anti-PD-1 Antibodies Alone or in Combination with Other Immunotherapeutics
US7803377B2 (en) * 2006-06-06 2010-09-28 Genentech, Inc. Anti-DLL4 antibodies and methods using same

Cited By (30)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10604581B2 (en) 2012-10-04 2020-03-31 Dana-Farber Cancer Institute, Inc. Human monoclonal anti-PD-L1 antibodies and methods of use
US9828434B2 (en) * 2012-10-04 2017-11-28 Dana-Farber Cancer Institute, Inc. Human monoclonal anti-PD-L1 antibodies and methods of use
US20150274835A1 (en) * 2012-10-04 2015-10-01 Dana-Farber Cancer Institute, Inc. Human monoclonal anti-pd-l1 antibodies and methods of use
US20150283234A1 (en) * 2012-10-23 2015-10-08 Bristol-Myers Squibb Company Combination of anti-kir and anti-ctla-4 antibodies to treat cancer
US9789182B2 (en) * 2012-10-23 2017-10-17 Bristol-Myers Squibb Company Combination of anti-KIR and anti-CTLA-4 antibodies to treat cancer
US10688180B2 (en) 2012-10-23 2020-06-23 Bristol-Myers Squibb Company Combination of anti-KIR and anti-CTLA-4 antibodies to treat cancer
US9815897B2 (en) 2013-05-02 2017-11-14 Anaptysbio, Inc. Antibodies directed against programmed death-1 (PD-1)
US10738117B2 (en) 2013-05-02 2020-08-11 Anaptysbio, Inc. Antibodies directed against programmed death-1 (PD-1)
US11046760B2 (en) 2014-10-31 2021-06-29 Oncomed Pharmaceuticals, Inc. Combination therapy for treatment of disease
US11275080B2 (en) 2014-11-05 2022-03-15 The Regents Of The University Of California Methods for stratifying non-responders to therapies that block PD1/PDL1 axis
US10836824B2 (en) 2015-02-03 2020-11-17 Anaptysbio, Inc. Antibodies directed against lymphocyte activation gene 3 (LAG-3)
US10336824B2 (en) 2015-03-13 2019-07-02 Cytomx Therapeutics, Inc. Anti-PDL1 antibodies, activatable anti-PDL1 antibodies, and methods of thereof
US10669339B2 (en) 2015-03-13 2020-06-02 Cytomx Therapeutics, Inc. Anti-PDL1 antibodies, activatable anti-PDL1 antibodies, and methods of use thereof
US11174316B2 (en) 2015-03-13 2021-11-16 Cytomx Therapeutics, Inc. Anti-PDL1 antibodies, activatable anti-PDL1 antibodies, and methods of use thereof
US10513558B2 (en) 2015-07-13 2019-12-24 Cytomx Therapeutics, Inc. Anti-PD1 antibodies, activatable anti-PD1 antibodies, and methods of use thereof
US12122833B2 (en) 2016-05-11 2024-10-22 Huyabio International, Llc Combination therapies of HDAC inhibitors and PD-1 inhibitors
US20230151099A1 (en) * 2016-05-11 2023-05-18 Huyabio International, Llc Combination therapies of hdac inhibitors and pd-l1 inhibitors
US11535670B2 (en) * 2016-05-11 2022-12-27 Huyabio International, Llc Combination therapies of HDAC inhibitors and PD-L1 inhibitors
WO2018009904A3 (en) * 2016-07-08 2018-02-15 Tumeh Paul C Compositions and treatment methods for cancer immunotherapy
WO2018049042A1 (en) * 2016-09-07 2018-03-15 The Wistar Institute Of Anatomy And Biology Methods and compositions for treating cancers by inhibiting estrogen signaling in myeloid-derived suppressor cells
US11155624B2 (en) 2016-11-01 2021-10-26 Anaptysbio, Inc. Antibodies directed against programmed death-1 (PD-1)
WO2018102769A1 (en) * 2016-12-01 2018-06-07 Bluelink Pharmaceuticals, Inc. Treatment of cancer
US11407830B2 (en) 2017-01-09 2022-08-09 Tesaro, Inc. Methods of treating cancer with anti-PD-1 antibodies
US12415855B2 (en) 2017-01-09 2025-09-16 Tesaro, Inc. Methods of treating cancer with anti-PD-1 antibodies
US11168144B2 (en) 2017-06-01 2021-11-09 Cytomx Therapeutics, Inc. Activatable anti-PDL1 antibodies, and methods of use thereof
US20210244745A1 (en) * 2018-05-06 2021-08-12 Ayala Pharmaceuticals Inc. Combination compositions comprising bisfluoroalkyl-1,4-benzodiazepinone compounds and methods of use thereof
US20220017610A1 (en) * 2018-11-16 2022-01-20 The Brigham And Women`S Hospital, Inc. Antibodies Blocking DLL4-Mediated Notch Signalling
US12378307B2 (en) * 2018-11-16 2025-08-05 The Brigham And Women's Hospital, Inc. Antibodies blocking DLL4-mediated notch signalling
WO2020247633A1 (en) * 2019-06-05 2020-12-10 Southern Research Institute Thiarabine- and thiarabine prodrug-based treatments
US12173081B2 (en) 2023-03-21 2024-12-24 Biograph 55, Inc. CD19/CD38 multispecific antibodies

Also Published As

Publication number Publication date
ES2808153T3 (es) 2021-02-25
AU2015338974A1 (en) 2017-05-11
CA2966042A1 (en) 2016-05-06
US20210403553A1 (en) 2021-12-30
WO2016070051A3 (en) 2016-07-14
US11046760B2 (en) 2021-06-29
EP3212233A2 (en) 2017-09-06
EP3212233B1 (en) 2020-06-24
WO2016070051A4 (en) 2016-09-29
MX382902B (es) 2025-03-13
AU2015338974B2 (en) 2021-08-26
CN107530419B (zh) 2021-05-18
EP3212233A4 (en) 2018-04-18
JP2017537892A (ja) 2017-12-21
WO2016070051A2 (en) 2016-05-06
MX2017005258A (es) 2017-07-26
US20250179169A1 (en) 2025-06-05
PT3212233T (pt) 2020-07-16
JP6827415B2 (ja) 2021-02-10
DK3212233T3 (da) 2020-07-27
CN107530419A (zh) 2018-01-02
US20180273618A1 (en) 2018-09-27

Similar Documents

Publication Publication Date Title
US20250179169A1 (en) Combination therapy for treatment of disease
JP7203446B2 (ja) Tigit結合物質およびその使用法
US9724390B2 (en) Tumor necrosis factor receptor soluble factor binding (TNFRSF-binding) agents
US20180346571A1 (en) Pd-l1-binding agents and uses thereof
US20180222958A1 (en) Lymphotoxin-beta receptor-binding agents, targeting antibodies, and uses thereof
WO2018017864A2 (en) Pvrig-binding agents and uses thereof
US20190048094A1 (en) Redirecting immune responses
US20180244783A1 (en) Combination therapy for treatment of disease
WO2017040660A1 (en) Combination therapy for treatment of disease
US20170267758A1 (en) Immunotherapy with binding agents
HK1242195A1 (en) Combination therapy for treatment of disease
HK1242195B (en) Combination therapy for treatment of disease
HK40075836A (en) Tigit-binding agents and uses thereof
EA039540B1 (ru) Связывающие tigit агенты и варианты их применения

Legal Events

Date Code Title Description
AS Assignment

Owner name: ONCOMED PHARMACEUTICALS, INC., CALIFORNIA

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:MURRIEL, CHRISTOPHER LAMOND;HOEY, TIMOTHY CHARLES;GURNEY, AUSTIN L.;AND OTHERS;SIGNING DATES FROM 20160803 TO 20160813;REEL/FRAME:039497/0867

STCB Information on status: application discontinuation

Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION