WO2017040660A1 - Combination therapy for treatment of disease - Google Patents
Combination therapy for treatment of disease Download PDFInfo
- Publication number
- WO2017040660A1 WO2017040660A1 PCT/US2016/049697 US2016049697W WO2017040660A1 WO 2017040660 A1 WO2017040660 A1 WO 2017040660A1 US 2016049697 W US2016049697 W US 2016049697W WO 2017040660 A1 WO2017040660 A1 WO 2017040660A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- rspo
- seq
- lgr
- antagonist
- Prior art date
Links
- 238000011282 treatment Methods 0.000 title abstract description 48
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 title abstract description 23
- 238000002648 combination therapy Methods 0.000 title abstract description 18
- 201000010099 disease Diseases 0.000 title abstract description 15
- 239000005557 antagonist Substances 0.000 claims abstract description 289
- 238000000034 method Methods 0.000 claims abstract description 218
- 206010028980 Neoplasm Diseases 0.000 claims abstract description 195
- 239000002955 immunomodulating agent Substances 0.000 claims abstract description 194
- 201000011510 cancer Diseases 0.000 claims abstract description 102
- 230000004614 tumor growth Effects 0.000 claims abstract description 32
- 230000002401 inhibitory effect Effects 0.000 claims abstract description 24
- 108091006332 Leucine-rich repeat-containing G-protein-coupled receptors Proteins 0.000 claims description 429
- 102000037126 Leucine-rich repeat-containing G-protein-coupled receptors Human genes 0.000 claims description 429
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 174
- 230000000694 effects Effects 0.000 claims description 164
- 229920001184 polypeptide Polymers 0.000 claims description 164
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 164
- 108090000623 proteins and genes Proteins 0.000 claims description 156
- 102000004169 proteins and genes Human genes 0.000 claims description 147
- 230000027455 binding Effects 0.000 claims description 92
- 150000001413 amino acids Chemical class 0.000 claims description 85
- 239000000427 antigen Substances 0.000 claims description 63
- 108091007433 antigens Proteins 0.000 claims description 62
- 102000036639 antigens Human genes 0.000 claims description 62
- 102000005962 receptors Human genes 0.000 claims description 57
- 108020003175 receptors Proteins 0.000 claims description 57
- 230000001965 increasing effect Effects 0.000 claims description 52
- 101100112922 Candida albicans CDR3 gene Proteins 0.000 claims description 51
- 229940045513 CTLA4 antagonist Drugs 0.000 claims description 45
- 101001063456 Homo sapiens Leucine-rich repeat-containing G-protein coupled receptor 5 Proteins 0.000 claims description 42
- 239000000556 agonist Substances 0.000 claims description 35
- 108010021625 Immunoglobulin Fragments Proteins 0.000 claims description 33
- 102000008394 Immunoglobulin Fragments Human genes 0.000 claims description 33
- 210000004881 tumor cell Anatomy 0.000 claims description 33
- -1 IL 15 Proteins 0.000 claims description 24
- 102100031036 Leucine-rich repeat-containing G-protein coupled receptor 5 Human genes 0.000 claims description 24
- 210000001744 T-lymphocyte Anatomy 0.000 claims description 24
- 102100022153 Tumor necrosis factor receptor superfamily member 4 Human genes 0.000 claims description 24
- 101710165473 Tumor necrosis factor receptor superfamily member 4 Proteins 0.000 claims description 24
- 102000017578 LAG3 Human genes 0.000 claims description 21
- 101001137987 Homo sapiens Lymphocyte activation gene 3 protein Proteins 0.000 claims description 20
- 102100040678 Programmed cell death protein 1 Human genes 0.000 claims description 20
- 101710089372 Programmed cell death protein 1 Proteins 0.000 claims description 20
- 108010021064 CTLA-4 Antigen Proteins 0.000 claims description 19
- 102000008203 CTLA-4 Antigen Human genes 0.000 claims description 19
- 210000004408 hybridoma Anatomy 0.000 claims description 19
- 206010006187 Breast cancer Diseases 0.000 claims description 18
- 101000801234 Homo sapiens Tumor necrosis factor receptor superfamily member 18 Proteins 0.000 claims description 18
- 229940076838 Immune checkpoint inhibitor Drugs 0.000 claims description 18
- 102000037984 Inhibitory immune checkpoint proteins Human genes 0.000 claims description 18
- 108091008026 Inhibitory immune checkpoint proteins Proteins 0.000 claims description 18
- 102100033728 Tumor necrosis factor receptor superfamily member 18 Human genes 0.000 claims description 18
- 102000047766 human LGR5 Human genes 0.000 claims description 18
- 239000012274 immune-checkpoint protein inhibitor Substances 0.000 claims description 18
- 208000026310 Breast neoplasm Diseases 0.000 claims description 17
- 229940123309 Immune checkpoint modulator Drugs 0.000 claims description 17
- 108010043610 KIR Receptors Proteins 0.000 claims description 16
- 210000003289 regulatory T cell Anatomy 0.000 claims description 16
- 229940124060 PD-1 antagonist Drugs 0.000 claims description 15
- 102000004127 Cytokines Human genes 0.000 claims description 14
- 108090000695 Cytokines Proteins 0.000 claims description 14
- 239000013598 vector Substances 0.000 claims description 13
- 101000831007 Homo sapiens T-cell immunoreceptor with Ig and ITIM domains Proteins 0.000 claims description 12
- 102100024834 T-cell immunoreceptor with Ig and ITIM domains Human genes 0.000 claims description 12
- 108060008682 Tumor Necrosis Factor Proteins 0.000 claims description 12
- 101001063463 Homo sapiens Leucine-rich repeat-containing G-protein coupled receptor 4 Proteins 0.000 claims description 11
- 101000981765 Homo sapiens Leucine-rich repeat-containing G-protein coupled receptor 6 Proteins 0.000 claims description 11
- 102100031035 Leucine-rich repeat-containing G-protein coupled receptor 4 Human genes 0.000 claims description 11
- 102100024140 Leucine-rich repeat-containing G-protein coupled receptor 6 Human genes 0.000 claims description 11
- 102000003390 tumor necrosis factor Human genes 0.000 claims description 11
- 208000008839 Kidney Neoplasms Diseases 0.000 claims description 10
- 208000005017 glioblastoma Diseases 0.000 claims description 10
- 102100027207 CD27 antigen Human genes 0.000 claims description 9
- 101000914511 Homo sapiens CD27 antigen Proteins 0.000 claims description 9
- 101000914484 Homo sapiens T-lymphocyte activation antigen CD80 Proteins 0.000 claims description 9
- 108010002350 Interleukin-2 Proteins 0.000 claims description 9
- 102000000588 Interleukin-2 Human genes 0.000 claims description 9
- 102100027222 T-lymphocyte activation antigen CD80 Human genes 0.000 claims description 9
- 108010074328 Interferon-gamma Proteins 0.000 claims description 8
- 206010027476 Metastases Diseases 0.000 claims description 8
- 108091034117 Oligonucleotide Proteins 0.000 claims description 8
- 239000003623 enhancer Substances 0.000 claims description 8
- 230000009401 metastasis Effects 0.000 claims description 8
- 108010074708 B7-H1 Antigen Proteins 0.000 claims description 7
- 102000008096 B7-H1 Antigen Human genes 0.000 claims description 7
- 102100034458 Hepatitis A virus cellular receptor 2 Human genes 0.000 claims description 7
- 101001068133 Homo sapiens Hepatitis A virus cellular receptor 2 Proteins 0.000 claims description 7
- 102000014150 Interferons Human genes 0.000 claims description 7
- 108010050904 Interferons Proteins 0.000 claims description 7
- 102000015696 Interleukins Human genes 0.000 claims description 7
- 108010063738 Interleukins Proteins 0.000 claims description 7
- 101100407308 Mus musculus Pdcd1lg2 gene Proteins 0.000 claims description 7
- 108700030875 Programmed Cell Death 1 Ligand 2 Proteins 0.000 claims description 7
- 102100024213 Programmed cell death 1 ligand 2 Human genes 0.000 claims description 7
- 230000003013 cytotoxicity Effects 0.000 claims description 7
- 231100000135 cytotoxicity Toxicity 0.000 claims description 7
- 230000008595 infiltration Effects 0.000 claims description 7
- 238000001764 infiltration Methods 0.000 claims description 7
- 229940079322 interferon Drugs 0.000 claims description 7
- 102000019034 Chemokines Human genes 0.000 claims description 6
- 108010012236 Chemokines Proteins 0.000 claims description 6
- 206010009944 Colon cancer Diseases 0.000 claims description 6
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 claims description 6
- 102000037982 Immune checkpoint proteins Human genes 0.000 claims description 6
- 108091008036 Immune checkpoint proteins Proteins 0.000 claims description 6
- 102000008070 Interferon-gamma Human genes 0.000 claims description 6
- 206010061535 Ovarian neoplasm Diseases 0.000 claims description 6
- 206010038389 Renal cancer Diseases 0.000 claims description 6
- 208000005718 Stomach Neoplasms Diseases 0.000 claims description 6
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 claims description 6
- 208000029742 colonic neoplasm Diseases 0.000 claims description 6
- 206010017758 gastric cancer Diseases 0.000 claims description 6
- 229960003130 interferon gamma Drugs 0.000 claims description 6
- 201000010982 kidney cancer Diseases 0.000 claims description 6
- 208000020816 lung neoplasm Diseases 0.000 claims description 6
- 229960003301 nivolumab Drugs 0.000 claims description 6
- 229960002621 pembrolizumab Drugs 0.000 claims description 6
- 201000011549 stomach cancer Diseases 0.000 claims description 6
- 229940121697 CD27 agonist Drugs 0.000 claims description 5
- 208000001333 Colorectal Neoplasms Diseases 0.000 claims description 5
- 208000032612 Glial tumor Diseases 0.000 claims description 5
- 201000010915 Glioblastoma multiforme Diseases 0.000 claims description 5
- 206010018338 Glioma Diseases 0.000 claims description 5
- 206010029260 Neuroblastoma Diseases 0.000 claims description 5
- 206010061902 Pancreatic neoplasm Diseases 0.000 claims description 5
- 208000024770 Thyroid neoplasm Diseases 0.000 claims description 5
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 claims description 5
- 208000014829 head and neck neoplasm Diseases 0.000 claims description 5
- 206010073071 hepatocellular carcinoma Diseases 0.000 claims description 5
- 208000014018 liver neoplasm Diseases 0.000 claims description 5
- 201000001441 melanoma Diseases 0.000 claims description 5
- 201000002528 pancreatic cancer Diseases 0.000 claims description 5
- 238000002560 therapeutic procedure Methods 0.000 claims description 5
- 102100022005 B-lymphocyte antigen CD20 Human genes 0.000 claims description 4
- 101150013553 CD40 gene Proteins 0.000 claims description 4
- 206010008342 Cervix carcinoma Diseases 0.000 claims description 4
- 206010061968 Gastric neoplasm Diseases 0.000 claims description 4
- 101000897405 Homo sapiens B-lymphocyte antigen CD20 Proteins 0.000 claims description 4
- 101000596234 Homo sapiens T-cell surface protein tactile Proteins 0.000 claims description 4
- 206010058467 Lung neoplasm malignant Diseases 0.000 claims description 4
- 102000004473 OX40 Ligand Human genes 0.000 claims description 4
- 108010042215 OX40 Ligand Proteins 0.000 claims description 4
- 206010033128 Ovarian cancer Diseases 0.000 claims description 4
- 102100035268 T-cell surface protein tactile Human genes 0.000 claims description 4
- 229940123803 TIM3 antagonist Drugs 0.000 claims description 4
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 claims description 4
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 claims description 4
- 230000006037 cell lysis Effects 0.000 claims description 4
- 201000010881 cervical cancer Diseases 0.000 claims description 4
- 230000003308 immunostimulating effect Effects 0.000 claims description 4
- 229960005386 ipilimumab Drugs 0.000 claims description 4
- 201000005202 lung cancer Diseases 0.000 claims description 4
- 229950005972 urelumab Drugs 0.000 claims description 4
- 206010005003 Bladder cancer Diseases 0.000 claims description 3
- 229940123205 CD28 agonist Drugs 0.000 claims description 3
- 229940123189 CD40 agonist Drugs 0.000 claims description 3
- 229940123828 CD80 antagonist Drugs 0.000 claims description 3
- 229940121850 CD86 agonist Drugs 0.000 claims description 3
- 229940121764 CD86 antagonist Drugs 0.000 claims description 3
- 229940119179 CD96 antagonist Drugs 0.000 claims description 3
- 206010014733 Endometrial cancer Diseases 0.000 claims description 3
- 206010014759 Endometrial neoplasm Diseases 0.000 claims description 3
- 206010017993 Gastrointestinal neoplasms Diseases 0.000 claims description 3
- 229940121678 PD-L2 antagonist Drugs 0.000 claims description 3
- 206010060862 Prostate cancer Diseases 0.000 claims description 3
- 208000000236 Prostatic Neoplasms Diseases 0.000 claims description 3
- 201000010536 head and neck cancer Diseases 0.000 claims description 3
- 201000007270 liver cancer Diseases 0.000 claims description 3
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 claims description 3
- 208000008443 pancreatic carcinoma Diseases 0.000 claims description 3
- 230000004044 response Effects 0.000 claims description 3
- 201000002510 thyroid cancer Diseases 0.000 claims description 3
- 201000005112 urinary bladder cancer Diseases 0.000 claims description 3
- ZBJUUYIGBAQYBN-QKLNNLIKSA-N (4S)-5-amino-4-[[(2S)-6-amino-2-[[(2S,3S)-2-[[(2S)-5-amino-2-[[(2S)-2-[[(2S)-6-amino-2-[[(2S)-1-[(2S)-2-[[(2S)-2-[[(2S)-5-amino-2-[[(2S,3R)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2,6-bis[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S,3R)-2-[[(2S)-4-amino-2-[[(2S)-2-amino-3-hydroxypropanoyl]amino]-4-oxobutanoyl]amino]-3-hydroxybutanoyl]amino]-3-hydroxypropanoyl]amino]-4-carboxybutanoyl]amino]-3-hydroxypropanoyl]amino]-3-phenylpropanoyl]amino]hexanoyl]amino]-3-phenylpropanoyl]amino]-5-carbamimidamidopentanoyl]amino]-3-methylbutanoyl]amino]-3-hydroxybutanoyl]amino]-5-oxopentanoyl]amino]-4-methylpentanoyl]amino]propanoyl]pyrrolidine-2-carbonyl]amino]hexanoyl]amino]propanoyl]amino]-5-oxopentanoyl]amino]-3-methylpentanoyl]amino]hexanoyl]amino]-5-oxopentanoic acid Chemical group CC[C@H](C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(=O)O)C(=O)N)NC(=O)[C@H](CCC(=O)N)NC(=O)[C@H](C)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(=O)N)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](C(C)C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CC2=CC=CC=C2)NC(=O)[C@H](CCCCNC(=O)[C@H](CC3=CC=CC=C3)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC(=O)N)NC(=O)[C@H](CO)N)NC(=O)[C@H](CC4=CC=CC=C4)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC(=O)N)NC(=O)[C@H](CO)N ZBJUUYIGBAQYBN-QKLNNLIKSA-N 0.000 claims description 2
- 229940125565 BMS-986016 Drugs 0.000 claims description 2
- 229940123494 CD20 antagonist Drugs 0.000 claims description 2
- 208000002699 Digestive System Neoplasms Diseases 0.000 claims description 2
- 206010019695 Hepatic neoplasm Diseases 0.000 claims description 2
- 101000597780 Mus musculus Tumor necrosis factor ligand superfamily member 18 Proteins 0.000 claims description 2
- 229960003852 atezolizumab Drugs 0.000 claims description 2
- 229950002916 avelumab Drugs 0.000 claims description 2
- 229950009791 durvalumab Drugs 0.000 claims description 2
- 229940056913 eftilagimod alfa Drugs 0.000 claims description 2
- 208000023965 endometrium neoplasm Diseases 0.000 claims description 2
- 229940121569 ieramilimab Drugs 0.000 claims description 2
- 229950011263 lirilumab Drugs 0.000 claims description 2
- 208000037841 lung tumor Diseases 0.000 claims description 2
- 229950010773 pidilizumab Drugs 0.000 claims description 2
- 208000023958 prostate neoplasm Diseases 0.000 claims description 2
- 229940126625 tavolimab Drugs 0.000 claims description 2
- 208000013076 thyroid tumor Diseases 0.000 claims description 2
- 229950007217 tremelimumab Drugs 0.000 claims description 2
- 208000024719 uterine cervix neoplasm Diseases 0.000 claims description 2
- 229950001067 varlilumab Drugs 0.000 claims description 2
- 229940055760 yervoy Drugs 0.000 claims description 2
- 102000002698 KIR Receptors Human genes 0.000 claims 5
- 101150096994 Cdx1 gene Proteins 0.000 claims 1
- 230000028993 immune response Effects 0.000 abstract description 19
- 239000011230 binding agent Substances 0.000 description 361
- 235000018102 proteins Nutrition 0.000 description 144
- 125000003275 alpha amino acid group Chemical group 0.000 description 134
- 235000001014 amino acid Nutrition 0.000 description 116
- 229940024606 amino acid Drugs 0.000 description 87
- 210000004027 cell Anatomy 0.000 description 79
- 239000003795 chemical substances by application Substances 0.000 description 77
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 55
- 238000006467 substitution reaction Methods 0.000 description 50
- 230000011664 signaling Effects 0.000 description 42
- 102000015735 Beta-catenin Human genes 0.000 description 40
- 108060000903 Beta-catenin Proteins 0.000 description 40
- 239000003814 drug Substances 0.000 description 32
- 239000000203 mixture Substances 0.000 description 30
- 230000014509 gene expression Effects 0.000 description 27
- 102000037865 fusion proteins Human genes 0.000 description 26
- 210000000130 stem cell Anatomy 0.000 description 26
- 108060003951 Immunoglobulin Proteins 0.000 description 25
- 108020001507 fusion proteins Proteins 0.000 description 25
- 102000018358 immunoglobulin Human genes 0.000 description 25
- 241000699670 Mus sp. Species 0.000 description 23
- 239000012634 fragment Substances 0.000 description 22
- 230000006870 function Effects 0.000 description 22
- 239000013612 plasmid Substances 0.000 description 22
- 229940124597 therapeutic agent Drugs 0.000 description 22
- 108010076504 Protein Sorting Signals Proteins 0.000 description 21
- 230000004913 activation Effects 0.000 description 20
- 230000037396 body weight Effects 0.000 description 18
- 108020004414 DNA Proteins 0.000 description 16
- 125000000539 amino acid group Chemical group 0.000 description 15
- 239000012636 effector Substances 0.000 description 15
- 108010087819 Fc receptors Proteins 0.000 description 14
- 102000009109 Fc receptors Human genes 0.000 description 14
- 241001465754 Metazoa Species 0.000 description 14
- 230000007423 decrease Effects 0.000 description 14
- 239000008194 pharmaceutical composition Substances 0.000 description 14
- 230000000295 complement effect Effects 0.000 description 13
- 238000012217 deletion Methods 0.000 description 13
- 230000037430 deletion Effects 0.000 description 13
- 239000013604 expression vector Substances 0.000 description 13
- 230000009467 reduction Effects 0.000 description 13
- 239000000090 biomarker Substances 0.000 description 12
- 229940127089 cytotoxic agent Drugs 0.000 description 12
- 150000007523 nucleic acids Chemical class 0.000 description 12
- 125000003729 nucleotide group Chemical group 0.000 description 12
- 230000036961 partial effect Effects 0.000 description 12
- 102000040430 polynucleotide Human genes 0.000 description 12
- 108091033319 polynucleotide Proteins 0.000 description 12
- 239000002157 polynucleotide Substances 0.000 description 12
- 230000001225 therapeutic effect Effects 0.000 description 12
- 102100033627 Killer cell immunoglobulin-like receptor 3DL1 Human genes 0.000 description 11
- 241000699666 Mus <mouse, genus> Species 0.000 description 11
- ZDZOTLJHXYCWBA-VCVYQWHSSA-N N-debenzoyl-N-(tert-butoxycarbonyl)-10-deacetyltaxol Chemical compound O([C@H]1[C@H]2[C@@](C([C@H](O)C3=C(C)[C@@H](OC(=O)[C@H](O)[C@@H](NC(=O)OC(C)(C)C)C=4C=CC=CC=4)C[C@]1(O)C3(C)C)=O)(C)[C@@H](O)C[C@H]1OC[C@]12OC(=O)C)C(=O)C1=CC=CC=C1 ZDZOTLJHXYCWBA-VCVYQWHSSA-N 0.000 description 11
- 230000003247 decreasing effect Effects 0.000 description 11
- 229960003668 docetaxel Drugs 0.000 description 11
- 238000000338 in vitro Methods 0.000 description 11
- 238000004519 manufacturing process Methods 0.000 description 11
- 230000004048 modification Effects 0.000 description 11
- 238000012986 modification Methods 0.000 description 11
- 239000002773 nucleotide Substances 0.000 description 11
- 239000002246 antineoplastic agent Substances 0.000 description 10
- 238000003776 cleavage reaction Methods 0.000 description 10
- 238000009472 formulation Methods 0.000 description 10
- 230000007017 scission Effects 0.000 description 10
- 210000002966 serum Anatomy 0.000 description 10
- 230000009870 specific binding Effects 0.000 description 10
- 230000003393 splenic effect Effects 0.000 description 10
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 9
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 9
- 150000001875 compounds Chemical class 0.000 description 9
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 9
- 235000018417 cysteine Nutrition 0.000 description 9
- 229960002949 fluorouracil Drugs 0.000 description 9
- 230000005764 inhibitory process Effects 0.000 description 9
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 9
- 230000035772 mutation Effects 0.000 description 9
- 230000002829 reductive effect Effects 0.000 description 9
- 108091028043 Nucleic acid sequence Proteins 0.000 description 8
- 239000002253 acid Substances 0.000 description 8
- 238000003556 assay Methods 0.000 description 8
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 8
- 208000035475 disorder Diseases 0.000 description 8
- 238000010494 dissociation reaction Methods 0.000 description 8
- 230000005593 dissociations Effects 0.000 description 8
- 230000002163 immunogen Effects 0.000 description 8
- 229940072221 immunoglobulins Drugs 0.000 description 8
- 102000039446 nucleic acids Human genes 0.000 description 8
- 108020004707 nucleic acids Proteins 0.000 description 8
- 239000011780 sodium chloride Substances 0.000 description 8
- WYWHKKSPHMUBEB-UHFFFAOYSA-N tioguanine Chemical compound N1C(N)=NC(=S)C2=C1N=CN2 WYWHKKSPHMUBEB-UHFFFAOYSA-N 0.000 description 8
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 7
- 108060008245 Thrombospondin Proteins 0.000 description 7
- 102000002938 Thrombospondin Human genes 0.000 description 7
- 230000004075 alteration Effects 0.000 description 7
- 239000003937 drug carrier Substances 0.000 description 7
- 230000012010 growth Effects 0.000 description 7
- 239000003112 inhibitor Substances 0.000 description 7
- 230000037361 pathway Effects 0.000 description 7
- 230000001105 regulatory effect Effects 0.000 description 7
- 150000003839 salts Chemical class 0.000 description 7
- 239000000126 substance Substances 0.000 description 7
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 6
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 6
- 241000124008 Mammalia Species 0.000 description 6
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 6
- 150000007513 acids Chemical class 0.000 description 6
- 230000009471 action Effects 0.000 description 6
- 230000003053 immunization Effects 0.000 description 6
- 238000001727 in vivo Methods 0.000 description 6
- 239000002502 liposome Substances 0.000 description 6
- 230000035515 penetration Effects 0.000 description 6
- 239000000546 pharmaceutical excipient Substances 0.000 description 6
- 150000003384 small molecules Chemical class 0.000 description 6
- 125000006850 spacer group Chemical group 0.000 description 6
- 241000894007 species Species 0.000 description 6
- 210000004988 splenocyte Anatomy 0.000 description 6
- 238000010561 standard procedure Methods 0.000 description 6
- 230000001988 toxicity Effects 0.000 description 6
- 231100000419 toxicity Toxicity 0.000 description 6
- 241000283973 Oryctolagus cuniculus Species 0.000 description 5
- 102000013814 Wnt Human genes 0.000 description 5
- 108050003627 Wnt Proteins 0.000 description 5
- 238000007792 addition Methods 0.000 description 5
- 239000002671 adjuvant Substances 0.000 description 5
- 230000000890 antigenic effect Effects 0.000 description 5
- 238000012875 competitive assay Methods 0.000 description 5
- 230000002708 enhancing effect Effects 0.000 description 5
- 230000005847 immunogenicity Effects 0.000 description 5
- 230000007762 localization of cell Effects 0.000 description 5
- 238000012423 maintenance Methods 0.000 description 5
- GLVAUDGFNGKCSF-UHFFFAOYSA-N mercaptopurine Chemical compound S=C1NC=NC2=C1NC=N2 GLVAUDGFNGKCSF-UHFFFAOYSA-N 0.000 description 5
- 239000003094 microcapsule Substances 0.000 description 5
- 229920000642 polymer Polymers 0.000 description 5
- 230000028327 secretion Effects 0.000 description 5
- 230000002103 transcriptional effect Effects 0.000 description 5
- 238000012546 transfer Methods 0.000 description 5
- 206010003445 Ascites Diseases 0.000 description 4
- 108091026890 Coding region Proteins 0.000 description 4
- 241000699800 Cricetinae Species 0.000 description 4
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 4
- 238000002965 ELISA Methods 0.000 description 4
- 241000588724 Escherichia coli Species 0.000 description 4
- 241001529936 Murinae Species 0.000 description 4
- 241000700159 Rattus Species 0.000 description 4
- RJURFGZVJUQBHK-UHFFFAOYSA-N actinomycin D Natural products CC1OC(=O)C(C(C)C)N(C)C(=O)CN(C)C(=O)C2CCCN2C(=O)C(C(C)C)NC(=O)C1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)NC4C(=O)NC(C(N5CCCC5C(=O)N(C)CC(=O)N(C)C(C(C)C)C(=O)OC4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-UHFFFAOYSA-N 0.000 description 4
- 230000000340 anti-metabolite Effects 0.000 description 4
- 229940100197 antimetabolite Drugs 0.000 description 4
- 239000002256 antimetabolite Substances 0.000 description 4
- 230000005975 antitumor immune response Effects 0.000 description 4
- 210000003719 b-lymphocyte Anatomy 0.000 description 4
- 230000004071 biological effect Effects 0.000 description 4
- 150000001720 carbohydrates Chemical class 0.000 description 4
- 235000014633 carbohydrates Nutrition 0.000 description 4
- 230000009089 cytolysis Effects 0.000 description 4
- 231100000599 cytotoxic agent Toxicity 0.000 description 4
- 239000003534 dna topoisomerase inhibitor Substances 0.000 description 4
- 210000002472 endoplasmic reticulum Anatomy 0.000 description 4
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 4
- 239000013022 formulation composition Substances 0.000 description 4
- 238000003018 immunoassay Methods 0.000 description 4
- 210000004698 lymphocyte Anatomy 0.000 description 4
- 230000007246 mechanism Effects 0.000 description 4
- 239000012528 membrane Substances 0.000 description 4
- KKZJGLLVHKMTCM-UHFFFAOYSA-N mitoxantrone Chemical compound O=C1C2=C(O)C=CC(O)=C2C(=O)C2=C1C(NCCNCCO)=CC=C2NCCNCCO KKZJGLLVHKMTCM-UHFFFAOYSA-N 0.000 description 4
- 230000008569 process Effects 0.000 description 4
- 230000002062 proliferating effect Effects 0.000 description 4
- 230000019491 signal transduction Effects 0.000 description 4
- 238000002741 site-directed mutagenesis Methods 0.000 description 4
- 230000001629 suppression Effects 0.000 description 4
- 239000003826 tablet Substances 0.000 description 4
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 4
- 231100001274 therapeutic index Toxicity 0.000 description 4
- 229960003087 tioguanine Drugs 0.000 description 4
- 229940044693 topoisomerase inhibitor Drugs 0.000 description 4
- 230000004565 tumor cell growth Effects 0.000 description 4
- 108010087967 type I signal peptidase Proteins 0.000 description 4
- 230000003442 weekly effect Effects 0.000 description 4
- WVDDGKGOMKODPV-UHFFFAOYSA-N Benzyl alcohol Chemical compound OCC1=CC=CC=C1 WVDDGKGOMKODPV-UHFFFAOYSA-N 0.000 description 3
- 102000017420 CD3 protein, epsilon/gamma/delta subunit Human genes 0.000 description 3
- 108050005493 CD3 protein, epsilon/gamma/delta subunit Proteins 0.000 description 3
- 210000001266 CD8-positive T-lymphocyte Anatomy 0.000 description 3
- GAGWJHPBXLXJQN-UORFTKCHSA-N Capecitabine Chemical compound C1=C(F)C(NC(=O)OCCCCC)=NC(=O)N1[C@H]1[C@H](O)[C@H](O)[C@@H](C)O1 GAGWJHPBXLXJQN-UORFTKCHSA-N 0.000 description 3
- UHDGCWIWMRVCDJ-CCXZUQQUSA-N Cytarabine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 UHDGCWIWMRVCDJ-CCXZUQQUSA-N 0.000 description 3
- 108010092160 Dactinomycin Proteins 0.000 description 3
- 102000017944 Dishevelled Human genes 0.000 description 3
- 108050007016 Dishevelled Proteins 0.000 description 3
- 102100031788 E3 ubiquitin-protein ligase MYLIP Human genes 0.000 description 3
- 101710190174 E3 ubiquitin-protein ligase MYLIP Proteins 0.000 description 3
- 239000004471 Glycine Substances 0.000 description 3
- 241000238631 Hexapoda Species 0.000 description 3
- 102000003839 Human Proteins Human genes 0.000 description 3
- 108090000144 Human Proteins Proteins 0.000 description 3
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 3
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 3
- 102000013691 Interleukin-17 Human genes 0.000 description 3
- 108050003558 Interleukin-17 Proteins 0.000 description 3
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 3
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 3
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical group CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 3
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 3
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 3
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 3
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 3
- 108010000817 Leuprolide Proteins 0.000 description 3
- 206010035226 Plasma cell myeloma Diseases 0.000 description 3
- 239000002202 Polyethylene glycol Substances 0.000 description 3
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 3
- 239000004473 Threonine Substances 0.000 description 3
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 description 3
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 description 3
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 3
- 230000003213 activating effect Effects 0.000 description 3
- 239000000654 additive Substances 0.000 description 3
- 230000000996 additive effect Effects 0.000 description 3
- 238000010171 animal model Methods 0.000 description 3
- 230000010056 antibody-dependent cellular cytotoxicity Effects 0.000 description 3
- 239000003080 antimitotic agent Substances 0.000 description 3
- 230000006907 apoptotic process Effects 0.000 description 3
- 238000013459 approach Methods 0.000 description 3
- 230000001580 bacterial effect Effects 0.000 description 3
- 230000008901 benefit Effects 0.000 description 3
- 238000006664 bond formation reaction Methods 0.000 description 3
- 210000004899 c-terminal region Anatomy 0.000 description 3
- 230000010261 cell growth Effects 0.000 description 3
- 238000006243 chemical reaction Methods 0.000 description 3
- 238000002512 chemotherapy Methods 0.000 description 3
- 238000000576 coating method Methods 0.000 description 3
- 230000004540 complement-dependent cytotoxicity Effects 0.000 description 3
- 229920001577 copolymer Polymers 0.000 description 3
- 238000011161 development Methods 0.000 description 3
- 230000018109 developmental process Effects 0.000 description 3
- 239000002552 dosage form Substances 0.000 description 3
- 238000005516 engineering process Methods 0.000 description 3
- 210000004602 germ cell Anatomy 0.000 description 3
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 3
- 230000016784 immunoglobulin production Effects 0.000 description 3
- 238000000099 in vitro assay Methods 0.000 description 3
- 238000005462 in vivo assay Methods 0.000 description 3
- 239000005414 inactive ingredient Substances 0.000 description 3
- 230000001939 inductive effect Effects 0.000 description 3
- 210000003734 kidney Anatomy 0.000 description 3
- 238000012933 kinetic analysis Methods 0.000 description 3
- 230000003902 lesion Effects 0.000 description 3
- 238000011068 loading method Methods 0.000 description 3
- 239000000463 material Substances 0.000 description 3
- 229960001428 mercaptopurine Drugs 0.000 description 3
- 229930182817 methionine Chemical group 0.000 description 3
- 229960000485 methotrexate Drugs 0.000 description 3
- 229960001156 mitoxantrone Drugs 0.000 description 3
- 201000000050 myeloid neoplasm Diseases 0.000 description 3
- 231100000252 nontoxic Toxicity 0.000 description 3
- 230000003000 nontoxic effect Effects 0.000 description 3
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 3
- 239000006187 pill Substances 0.000 description 3
- 229920001223 polyethylene glycol Polymers 0.000 description 3
- 239000000843 powder Substances 0.000 description 3
- 238000003127 radioimmunoassay Methods 0.000 description 3
- 238000001959 radiotherapy Methods 0.000 description 3
- 238000003259 recombinant expression Methods 0.000 description 3
- 239000007787 solid Substances 0.000 description 3
- 239000003381 stabilizer Substances 0.000 description 3
- 208000024891 symptom Diseases 0.000 description 3
- 230000002195 synergetic effect Effects 0.000 description 3
- NRUKOCRGYNPUPR-QBPJDGROSA-N teniposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@@H](OC[C@H]4O3)C=3SC=CC=3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 NRUKOCRGYNPUPR-QBPJDGROSA-N 0.000 description 3
- 210000001519 tissue Anatomy 0.000 description 3
- 238000013518 transcription Methods 0.000 description 3
- 230000014616 translation Effects 0.000 description 3
- 230000032258 transport Effects 0.000 description 3
- 231100000588 tumorigenic Toxicity 0.000 description 3
- 230000000381 tumorigenic effect Effects 0.000 description 3
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 3
- FPVKHBSQESCIEP-UHFFFAOYSA-N (8S)-3-(2-deoxy-beta-D-erythro-pentofuranosyl)-3,6,7,8-tetrahydroimidazo[4,5-d][1,3]diazepin-8-ol Natural products C1C(O)C(CO)OC1N1C(NC=NCC2O)=C2N=C1 FPVKHBSQESCIEP-UHFFFAOYSA-N 0.000 description 2
- NDMPLJNOPCLANR-UHFFFAOYSA-N 3,4-dihydroxy-15-(4-hydroxy-18-methoxycarbonyl-5,18-seco-ibogamin-18-yl)-16-methoxy-1-methyl-6,7-didehydro-aspidospermidine-3-carboxylic acid methyl ester Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 NDMPLJNOPCLANR-UHFFFAOYSA-N 0.000 description 2
- NMUSYJAQQFHJEW-KVTDHHQDSA-N 5-azacytidine Chemical compound O=C1N=C(N)N=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 NMUSYJAQQFHJEW-KVTDHHQDSA-N 0.000 description 2
- STQGQHZAVUOBTE-UHFFFAOYSA-N 7-Cyan-hept-2t-en-4,6-diinsaeure Natural products C1=2C(O)=C3C(=O)C=4C(OC)=CC=CC=4C(=O)C3=C(O)C=2CC(O)(C(C)=O)CC1OC1CC(N)C(O)C(C)O1 STQGQHZAVUOBTE-UHFFFAOYSA-N 0.000 description 2
- 102100025854 Acyl-coenzyme A thioesterase 1 Human genes 0.000 description 2
- 101710175445 Acyl-coenzyme A thioesterase 1 Proteins 0.000 description 2
- 102000004379 Adrenomedullin Human genes 0.000 description 2
- 101800004616 Adrenomedullin Proteins 0.000 description 2
- 108010012934 Albumin-Bound Paclitaxel Proteins 0.000 description 2
- 239000004475 Arginine Substances 0.000 description 2
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 2
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 2
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- 241000894006 Bacteria Species 0.000 description 2
- 210000004366 CD4-positive T-lymphocyte Anatomy 0.000 description 2
- GAGWJHPBXLXJQN-UHFFFAOYSA-N Capecitabine Natural products C1=C(F)C(NC(=O)OCCCCC)=NC(=O)N1C1C(O)C(O)C(C)O1 GAGWJHPBXLXJQN-UHFFFAOYSA-N 0.000 description 2
- 241000699802 Cricetulus griseus Species 0.000 description 2
- 101710112752 Cytotoxin Proteins 0.000 description 2
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 2
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 2
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 2
- 231100000491 EC50 Toxicity 0.000 description 2
- 102000003951 Erythropoietin Human genes 0.000 description 2
- 108090000394 Erythropoietin Proteins 0.000 description 2
- 102100037362 Fibronectin Human genes 0.000 description 2
- 102100039939 Growth/differentiation factor 8 Human genes 0.000 description 2
- 102100026122 High affinity immunoglobulin gamma Fc receptor I Human genes 0.000 description 2
- 241000282412 Homo Species 0.000 description 2
- 101000913074 Homo sapiens High affinity immunoglobulin gamma Fc receptor I Proteins 0.000 description 2
- 101000917826 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor II-a Proteins 0.000 description 2
- 101000917824 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor II-b Proteins 0.000 description 2
- 101001039199 Homo sapiens Low-density lipoprotein receptor-related protein 6 Proteins 0.000 description 2
- 101001012157 Homo sapiens Receptor tyrosine-protein kinase erbB-2 Proteins 0.000 description 2
- 101000934346 Homo sapiens T-cell surface antigen CD2 Proteins 0.000 description 2
- 206010020751 Hypersensitivity Diseases 0.000 description 2
- 102000037978 Immune checkpoint receptors Human genes 0.000 description 2
- 108091008028 Immune checkpoint receptors Proteins 0.000 description 2
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 2
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 2
- 102100037850 Interferon gamma Human genes 0.000 description 2
- 108090000172 Interleukin-15 Proteins 0.000 description 2
- 102000003812 Interleukin-15 Human genes 0.000 description 2
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 2
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 2
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 2
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 2
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 2
- LRQKBLKVPFOOQJ-YFKPBYRVSA-N L-norleucine Chemical group CCCC[C@H]([NH3+])C([O-])=O LRQKBLKVPFOOQJ-YFKPBYRVSA-N 0.000 description 2
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 2
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 2
- 239000002147 L01XE04 - Sunitinib Substances 0.000 description 2
- 102100029204 Low affinity immunoglobulin gamma Fc region receptor II-a Human genes 0.000 description 2
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 2
- 239000004472 Lysine Substances 0.000 description 2
- 108010056852 Myostatin Proteins 0.000 description 2
- NWIBSHFKIJFRCO-WUDYKRTCSA-N Mytomycin Chemical compound C1N2C(C(C(C)=C(N)C3=O)=O)=C3[C@@H](COC(N)=O)[C@@]2(OC)[C@@H]2[C@H]1N2 NWIBSHFKIJFRCO-WUDYKRTCSA-N 0.000 description 2
- 125000001429 N-terminal alpha-amino-acid group Chemical group 0.000 description 2
- 238000005481 NMR spectroscopy Methods 0.000 description 2
- 108010025020 Nerve Growth Factor Proteins 0.000 description 2
- 108091005461 Nucleic proteins Proteins 0.000 description 2
- 229940123751 PD-L1 antagonist Drugs 0.000 description 2
- 229930012538 Paclitaxel Natural products 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Natural products OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- 102100030086 Receptor tyrosine-protein kinase erbB-2 Human genes 0.000 description 2
- 108020004511 Recombinant DNA Proteins 0.000 description 2
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 2
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 2
- 108010071390 Serum Albumin Proteins 0.000 description 2
- 102000007562 Serum Albumin Human genes 0.000 description 2
- 229930006000 Sucrose Natural products 0.000 description 2
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 2
- 102100025237 T-cell surface antigen CD2 Human genes 0.000 description 2
- NKANXQFJJICGDU-QPLCGJKRSA-N Tamoxifen Chemical compound C=1C=CC=CC=1C(/CC)=C(C=1C=CC(OCCN(C)C)=CC=1)/C1=CC=CC=C1 NKANXQFJJICGDU-QPLCGJKRSA-N 0.000 description 2
- FOCVUCIESVLUNU-UHFFFAOYSA-N Thiotepa Chemical compound C1CN1P(N1CC1)(=S)N1CC1 FOCVUCIESVLUNU-UHFFFAOYSA-N 0.000 description 2
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 2
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 2
- 230000002159 abnormal effect Effects 0.000 description 2
- RJURFGZVJUQBHK-IIXSONLDSA-N actinomycin D Chemical compound C[C@H]1OC(=O)[C@H](C(C)C)N(C)C(=O)CN(C)C(=O)[C@@H]2CCCN2C(=O)[C@@H](C(C)C)NC(=O)[C@H]1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)N[C@@H]4C(=O)N[C@@H](C(N5CCC[C@H]5C(=O)N(C)CC(=O)N(C)[C@@H](C(C)C)C(=O)O[C@@H]4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-IIXSONLDSA-N 0.000 description 2
- ULCUCJFASIJEOE-NPECTJMMSA-N adrenomedullin Chemical compound C([C@@H](C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)NCC(=O)N[C@@H]1C(N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=2C=CC=CC=2)C(=O)NCC(=O)N[C@H](C(=O)N[C@@H](CSSC1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(N)=O)[C@@H](C)O)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C1=CC=CC=C1 ULCUCJFASIJEOE-NPECTJMMSA-N 0.000 description 2
- 238000001042 affinity chromatography Methods 0.000 description 2
- 208000026935 allergic disease Diseases 0.000 description 2
- 238000004458 analytical method Methods 0.000 description 2
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 2
- 235000009582 asparagine Nutrition 0.000 description 2
- 229960001230 asparagine Drugs 0.000 description 2
- 230000001363 autoimmune Effects 0.000 description 2
- 229960002756 azacitidine Drugs 0.000 description 2
- 230000008512 biological response Effects 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 230000000903 blocking effect Effects 0.000 description 2
- 210000000988 bone and bone Anatomy 0.000 description 2
- 229960004117 capecitabine Drugs 0.000 description 2
- YCIMNLLNPGFGHC-UHFFFAOYSA-N catechol Chemical compound OC1=CC=CC=C1O YCIMNLLNPGFGHC-UHFFFAOYSA-N 0.000 description 2
- 229960002412 cediranib Drugs 0.000 description 2
- 238000004113 cell culture Methods 0.000 description 2
- 230000032823 cell division Effects 0.000 description 2
- 230000004663 cell proliferation Effects 0.000 description 2
- 230000001413 cellular effect Effects 0.000 description 2
- 230000008859 change Effects 0.000 description 2
- 239000002738 chelating agent Substances 0.000 description 2
- 229960004630 chlorambucil Drugs 0.000 description 2
- JCKYGMPEJWAADB-UHFFFAOYSA-N chlorambucil Chemical compound OC(=O)CCCC1=CC=C(N(CCCl)CCCl)C=C1 JCKYGMPEJWAADB-UHFFFAOYSA-N 0.000 description 2
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 2
- 239000011248 coating agent Substances 0.000 description 2
- 230000004154 complement system Effects 0.000 description 2
- 239000002299 complementary DNA Substances 0.000 description 2
- 239000003636 conditioned culture medium Substances 0.000 description 2
- 238000007796 conventional method Methods 0.000 description 2
- 230000001461 cytolytic effect Effects 0.000 description 2
- 231100000433 cytotoxic Toxicity 0.000 description 2
- 239000002254 cytotoxic agent Substances 0.000 description 2
- 230000001472 cytotoxic effect Effects 0.000 description 2
- 239000002619 cytotoxin Substances 0.000 description 2
- 229960000640 dactinomycin Drugs 0.000 description 2
- 230000006378 damage Effects 0.000 description 2
- STQGQHZAVUOBTE-VGBVRHCVSA-N daunorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 STQGQHZAVUOBTE-VGBVRHCVSA-N 0.000 description 2
- 239000003405 delayed action preparation Substances 0.000 description 2
- 210000004443 dendritic cell Anatomy 0.000 description 2
- 230000001419 dependent effect Effects 0.000 description 2
- 238000000502 dialysis Methods 0.000 description 2
- 230000029087 digestion Effects 0.000 description 2
- 229960004679 doxorubicin Drugs 0.000 description 2
- 229940079593 drug Drugs 0.000 description 2
- 239000012055 enteric layer Substances 0.000 description 2
- 102000052116 epidermal growth factor receptor activity proteins Human genes 0.000 description 2
- 108700015053 epidermal growth factor receptor activity proteins Proteins 0.000 description 2
- 108010002591 epsilon receptor Proteins 0.000 description 2
- 229940105423 erythropoietin Drugs 0.000 description 2
- VJJPUSNTGOMMGY-MRVIYFEKSA-N etoposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 VJJPUSNTGOMMGY-MRVIYFEKSA-N 0.000 description 2
- 210000003527 eukaryotic cell Anatomy 0.000 description 2
- GIUYCYHIANZCFB-FJFJXFQQSA-N fludarabine phosphate Chemical compound C1=NC=2C(N)=NC(F)=NC=2N1[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@@H]1O GIUYCYHIANZCFB-FJFJXFQQSA-N 0.000 description 2
- OVBPIULPVIDEAO-LBPRGKRZSA-N folic acid Chemical compound C=1N=C2NC(N)=NC(=O)C2=NC=1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 OVBPIULPVIDEAO-LBPRGKRZSA-N 0.000 description 2
- CHPZKNULDCNCBW-UHFFFAOYSA-N gallium nitrate Chemical compound [Ga+3].[O-][N+]([O-])=O.[O-][N+]([O-])=O.[O-][N+]([O-])=O CHPZKNULDCNCBW-UHFFFAOYSA-N 0.000 description 2
- 238000001502 gel electrophoresis Methods 0.000 description 2
- 229960005277 gemcitabine Drugs 0.000 description 2
- SDUQYLNIPVEERB-QPPQHZFASA-N gemcitabine Chemical compound O=C1N=C(N)C=CN1[C@H]1C(F)(F)[C@H](O)[C@@H](CO)O1 SDUQYLNIPVEERB-QPPQHZFASA-N 0.000 description 2
- 230000002068 genetic effect Effects 0.000 description 2
- 229960002989 glutamic acid Drugs 0.000 description 2
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 2
- 239000003102 growth factor Substances 0.000 description 2
- 239000001963 growth medium Substances 0.000 description 2
- BXWNKGSJHAJOGX-UHFFFAOYSA-N hexadecan-1-ol Chemical compound CCCCCCCCCCCCCCCCO BXWNKGSJHAJOGX-UHFFFAOYSA-N 0.000 description 2
- 230000009610 hypersensitivity Effects 0.000 description 2
- 229960001101 ifosfamide Drugs 0.000 description 2
- HOMGKSMUEGBAAB-UHFFFAOYSA-N ifosfamide Chemical compound ClCCNP1(=O)OCCCN1CCCl HOMGKSMUEGBAAB-UHFFFAOYSA-N 0.000 description 2
- 210000002865 immune cell Anatomy 0.000 description 2
- 230000005746 immune checkpoint blockade Effects 0.000 description 2
- 238000002649 immunization Methods 0.000 description 2
- 238000001114 immunoprecipitation Methods 0.000 description 2
- 230000006872 improvement Effects 0.000 description 2
- 230000002779 inactivation Effects 0.000 description 2
- 230000002757 inflammatory effect Effects 0.000 description 2
- 230000028709 inflammatory response Effects 0.000 description 2
- 238000001802 infusion Methods 0.000 description 2
- 230000003993 interaction Effects 0.000 description 2
- 230000031261 interleukin-10 production Effects 0.000 description 2
- 230000024949 interleukin-17 production Effects 0.000 description 2
- 230000004073 interleukin-2 production Effects 0.000 description 2
- 230000017306 interleukin-6 production Effects 0.000 description 2
- 238000004255 ion exchange chromatography Methods 0.000 description 2
- 229960000310 isoleucine Drugs 0.000 description 2
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 2
- 108010045069 keyhole-limpet hemocyanin Proteins 0.000 description 2
- 230000002147 killing effect Effects 0.000 description 2
- 210000000265 leukocyte Anatomy 0.000 description 2
- GFIJNRVAKGFPGQ-LIJARHBVSA-N leuprolide Chemical compound CCNC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H]1NC(=O)CC1)CC1=CC=C(O)C=C1 GFIJNRVAKGFPGQ-LIJARHBVSA-N 0.000 description 2
- 229960004338 leuprorelin Drugs 0.000 description 2
- 239000003446 ligand Substances 0.000 description 2
- 150000002632 lipids Chemical class 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 210000004962 mammalian cell Anatomy 0.000 description 2
- 238000005259 measurement Methods 0.000 description 2
- 210000003071 memory t lymphocyte Anatomy 0.000 description 2
- 239000004005 microsphere Substances 0.000 description 2
- 238000001565 modulated differential scanning calorimetry Methods 0.000 description 2
- 102000051367 mu Opioid Receptors Human genes 0.000 description 2
- 210000000066 myeloid cell Anatomy 0.000 description 2
- YOHYSYJDKVYCJI-UHFFFAOYSA-N n-[3-[[6-[3-(trifluoromethyl)anilino]pyrimidin-4-yl]amino]phenyl]cyclopropanecarboxamide Chemical compound FC(F)(F)C1=CC=CC(NC=2N=CN=C(NC=3C=C(NC(=O)C4CC4)C=CC=3)C=2)=C1 YOHYSYJDKVYCJI-UHFFFAOYSA-N 0.000 description 2
- 210000000822 natural killer cell Anatomy 0.000 description 2
- 231100001221 nontumorigenic Toxicity 0.000 description 2
- 150000002482 oligosaccharides Polymers 0.000 description 2
- 230000014207 opsonization Effects 0.000 description 2
- 210000000056 organ Anatomy 0.000 description 2
- 210000003463 organelle Anatomy 0.000 description 2
- 210000001672 ovary Anatomy 0.000 description 2
- 229960001592 paclitaxel Drugs 0.000 description 2
- 229960001972 panitumumab Drugs 0.000 description 2
- 239000002245 particle Substances 0.000 description 2
- 244000052769 pathogen Species 0.000 description 2
- 230000001575 pathological effect Effects 0.000 description 2
- 229960000639 pazopanib Drugs 0.000 description 2
- CUIHSIWYWATEQL-UHFFFAOYSA-N pazopanib Chemical compound C1=CC2=C(C)N(C)N=C2C=C1N(C)C(N=1)=CC=NC=1NC1=CC=C(C)C(S(N)(=O)=O)=C1 CUIHSIWYWATEQL-UHFFFAOYSA-N 0.000 description 2
- AQIXEPGDORPWBJ-UHFFFAOYSA-N pentan-3-ol Chemical compound CCC(O)CC AQIXEPGDORPWBJ-UHFFFAOYSA-N 0.000 description 2
- 229960002340 pentostatin Drugs 0.000 description 2
- FPVKHBSQESCIEP-JQCXWYLXSA-N pentostatin Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(N=CNC[C@H]2O)=C2N=C1 FPVKHBSQESCIEP-JQCXWYLXSA-N 0.000 description 2
- 230000002093 peripheral effect Effects 0.000 description 2
- 238000002823 phage display Methods 0.000 description 2
- 230000026731 phosphorylation Effects 0.000 description 2
- 238000006366 phosphorylation reaction Methods 0.000 description 2
- 230000003169 placental effect Effects 0.000 description 2
- BASFCYQUMIYNBI-UHFFFAOYSA-N platinum Chemical compound [Pt] BASFCYQUMIYNBI-UHFFFAOYSA-N 0.000 description 2
- 229920000136 polysorbate Polymers 0.000 description 2
- OXCMYAYHXIHQOA-UHFFFAOYSA-N potassium;[2-butyl-5-chloro-3-[[4-[2-(1,2,4-triaza-3-azanidacyclopenta-1,4-dien-5-yl)phenyl]phenyl]methyl]imidazol-4-yl]methanol Chemical compound [K+].CCCCC1=NC(Cl)=C(CO)N1CC1=CC=C(C=2C(=CC=CC=2)C2=N[N-]N=N2)C=C1 OXCMYAYHXIHQOA-UHFFFAOYSA-N 0.000 description 2
- 239000002243 precursor Substances 0.000 description 2
- 238000002360 preparation method Methods 0.000 description 2
- 230000001737 promoting effect Effects 0.000 description 2
- QELSKZZBTMNZEB-UHFFFAOYSA-N propylparaben Chemical compound CCCOC(=O)C1=CC=C(O)C=C1 QELSKZZBTMNZEB-UHFFFAOYSA-N 0.000 description 2
- RXWNCPJZOCPEPQ-NVWDDTSBSA-N puromycin Chemical compound C1=CC(OC)=CC=C1C[C@H](N)C(=O)N[C@H]1[C@@H](O)[C@H](N2C3=NC=NC(=C3N=C2)N(C)C)O[C@@H]1CO RXWNCPJZOCPEPQ-NVWDDTSBSA-N 0.000 description 2
- 229960004622 raloxifene Drugs 0.000 description 2
- GZUITABIAKMVPG-UHFFFAOYSA-N raloxifene Chemical compound C1=CC(O)=CC=C1C1=C(C(=O)C=2C=CC(OCCN3CCCCC3)=CC=2)C2=CC=C(O)C=C2S1 GZUITABIAKMVPG-UHFFFAOYSA-N 0.000 description 2
- 230000010076 replication Effects 0.000 description 2
- GHMLBKRAJCXXBS-UHFFFAOYSA-N resorcinol Chemical compound OC1=CC=CC(O)=C1 GHMLBKRAJCXXBS-UHFFFAOYSA-N 0.000 description 2
- 238000012216 screening Methods 0.000 description 2
- 125000003607 serino group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(O[H])([H])[H] 0.000 description 2
- 238000009097 single-agent therapy Methods 0.000 description 2
- 210000004872 soft tissue Anatomy 0.000 description 2
- 239000000600 sorbitol Substances 0.000 description 2
- 235000010356 sorbitol Nutrition 0.000 description 2
- PVYJZLYGTZKPJE-UHFFFAOYSA-N streptonigrin Chemical compound C=1C=C2C(=O)C(OC)=C(N)C(=O)C2=NC=1C(C=1N)=NC(C(O)=O)=C(C)C=1C1=CC=C(OC)C(OC)=C1O PVYJZLYGTZKPJE-UHFFFAOYSA-N 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- 239000000758 substrate Substances 0.000 description 2
- 239000005720 sucrose Substances 0.000 description 2
- 239000000829 suppository Substances 0.000 description 2
- 238000003786 synthesis reaction Methods 0.000 description 2
- 229960001278 teniposide Drugs 0.000 description 2
- 229960001196 thiotepa Drugs 0.000 description 2
- 231100000331 toxic Toxicity 0.000 description 2
- 230000002588 toxic effect Effects 0.000 description 2
- 230000035897 transcription Effects 0.000 description 2
- 238000013519 translation Methods 0.000 description 2
- 241000701161 unidentified adenovirus Species 0.000 description 2
- 241000701447 unidentified baculovirus Species 0.000 description 2
- 239000004474 valine Substances 0.000 description 2
- 239000003981 vehicle Substances 0.000 description 2
- 229960004355 vindesine Drugs 0.000 description 2
- UGGWPQSBPIFKDZ-KOTLKJBCSA-N vindesine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(N)=O)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1N=C1[C]2C=CC=C1 UGGWPQSBPIFKDZ-KOTLKJBCSA-N 0.000 description 2
- 238000011179 visual inspection Methods 0.000 description 2
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 2
- 210000005253 yeast cell Anatomy 0.000 description 2
- 108020001612 μ-opioid receptors Proteins 0.000 description 2
- HDTRYLNUVZCQOY-UHFFFAOYSA-N α-D-glucopyranosyl-α-D-glucopyranoside Natural products OC1C(O)C(O)C(CO)OC1OC1C(O)C(O)C(O)C(CO)O1 HDTRYLNUVZCQOY-UHFFFAOYSA-N 0.000 description 1
- NNJPGOLRFBJNIW-HNNXBMFYSA-N (-)-demecolcine Chemical compound C1=C(OC)C(=O)C=C2[C@@H](NC)CCC3=CC(OC)=C(OC)C(OC)=C3C2=C1 NNJPGOLRFBJNIW-HNNXBMFYSA-N 0.000 description 1
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 1
- FLWWDYNPWOSLEO-HQVZTVAUSA-N (2s)-2-[[4-[1-(2-amino-4-oxo-1h-pteridin-6-yl)ethyl-methylamino]benzoyl]amino]pentanedioic acid Chemical compound C=1N=C2NC(N)=NC(=O)C2=NC=1C(C)N(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FLWWDYNPWOSLEO-HQVZTVAUSA-N 0.000 description 1
- XMQUEQJCYRFIQS-YFKPBYRVSA-N (2s)-2-amino-5-ethoxy-5-oxopentanoic acid Chemical compound CCOC(=O)CC[C@H](N)C(O)=O XMQUEQJCYRFIQS-YFKPBYRVSA-N 0.000 description 1
- CGMTUJFWROPELF-YPAAEMCBSA-N (3E,5S)-5-[(2S)-butan-2-yl]-3-(1-hydroxyethylidene)pyrrolidine-2,4-dione Chemical compound CC[C@H](C)[C@@H]1NC(=O)\C(=C(/C)O)C1=O CGMTUJFWROPELF-YPAAEMCBSA-N 0.000 description 1
- VEEGZPWAAPPXRB-BJMVGYQFSA-N (3e)-3-(1h-imidazol-5-ylmethylidene)-1h-indol-2-one Chemical group O=C1NC2=CC=CC=C2\C1=C/C1=CN=CN1 VEEGZPWAAPPXRB-BJMVGYQFSA-N 0.000 description 1
- XRBSKUSTLXISAB-XVVDYKMHSA-N (5r,6r,7r,8r)-8-hydroxy-7-(hydroxymethyl)-5-(3,4,5-trimethoxyphenyl)-5,6,7,8-tetrahydrobenzo[f][1,3]benzodioxole-6-carboxylic acid Chemical compound COC1=C(OC)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@H](O)[C@@H](CO)[C@@H]2C(O)=O)=C1 XRBSKUSTLXISAB-XVVDYKMHSA-N 0.000 description 1
- XRBSKUSTLXISAB-UHFFFAOYSA-N (7R,7'R,8R,8'R)-form-Podophyllic acid Natural products COC1=C(OC)C(OC)=CC(C2C3=CC=4OCOC=4C=C3C(O)C(CO)C2C(O)=O)=C1 XRBSKUSTLXISAB-UHFFFAOYSA-N 0.000 description 1
- AESVUZLWRXEGEX-DKCAWCKPSA-N (7S,9R)-7-[(2S,4R,5R,6R)-4-amino-5-hydroxy-6-methyloxan-2-yl]oxy-6,9,11-trihydroxy-9-(2-hydroxyacetyl)-4-methoxy-8,10-dihydro-7H-tetracene-5,12-dione iron(3+) Chemical compound [Fe+3].COc1cccc2C(=O)c3c(O)c4C[C@@](O)(C[C@H](O[C@@H]5C[C@@H](N)[C@@H](O)[C@@H](C)O5)c4c(O)c3C(=O)c12)C(=O)CO AESVUZLWRXEGEX-DKCAWCKPSA-N 0.000 description 1
- JXVAMODRWBNUSF-KZQKBALLSA-N (7s,9r,10r)-7-[(2r,4s,5s,6s)-5-[[(2s,4as,5as,7s,9s,9ar,10ar)-2,9-dimethyl-3-oxo-4,4a,5a,6,7,9,9a,10a-octahydrodipyrano[4,2-a:4',3'-e][1,4]dioxin-7-yl]oxy]-4-(dimethylamino)-6-methyloxan-2-yl]oxy-10-[(2s,4s,5s,6s)-4-(dimethylamino)-5-hydroxy-6-methyloxan-2 Chemical compound O([C@@H]1C2=C(O)C=3C(=O)C4=CC=CC(O)=C4C(=O)C=3C(O)=C2[C@@H](O[C@@H]2O[C@@H](C)[C@@H](O[C@@H]3O[C@@H](C)[C@H]4O[C@@H]5O[C@@H](C)C(=O)C[C@@H]5O[C@H]4C3)[C@H](C2)N(C)C)C[C@]1(O)CC)[C@H]1C[C@H](N(C)C)[C@H](O)[C@H](C)O1 JXVAMODRWBNUSF-KZQKBALLSA-N 0.000 description 1
- VNTHYLVDGVBPOU-QQYBVWGSSA-N (7s,9s)-9-acetyl-7-[(2r,4s,5s,6s)-4-amino-5-hydroxy-6-methyloxan-2-yl]oxy-6,9,11-trihydroxy-4-methoxy-8,10-dihydro-7h-tetracene-5,12-dione;2-hydroxypropane-1,2,3-tricarboxylic acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O.O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 VNTHYLVDGVBPOU-QQYBVWGSSA-N 0.000 description 1
- IEXUMDBQLIVNHZ-YOUGDJEHSA-N (8s,11r,13r,14s,17s)-11-[4-(dimethylamino)phenyl]-17-hydroxy-17-(3-hydroxypropyl)-13-methyl-1,2,6,7,8,11,12,14,15,16-decahydrocyclopenta[a]phenanthren-3-one Chemical compound C1=CC(N(C)C)=CC=C1[C@@H]1C2=C3CCC(=O)C=C3CC[C@H]2[C@H](CC[C@]2(O)CCCO)[C@@]2(C)C1 IEXUMDBQLIVNHZ-YOUGDJEHSA-N 0.000 description 1
- FDKXTQMXEQVLRF-ZHACJKMWSA-N (E)-dacarbazine Chemical compound CN(C)\N=N\c1[nH]cnc1C(N)=O FDKXTQMXEQVLRF-ZHACJKMWSA-N 0.000 description 1
- LKJPYSCBVHEWIU-KRWDZBQOSA-N (R)-bicalutamide Chemical compound C([C@@](O)(C)C(=O)NC=1C=C(C(C#N)=CC=1)C(F)(F)F)S(=O)(=O)C1=CC=C(F)C=C1 LKJPYSCBVHEWIU-KRWDZBQOSA-N 0.000 description 1
- AGNGYMCLFWQVGX-AGFFZDDWSA-N (e)-1-[(2s)-2-amino-2-carboxyethoxy]-2-diazonioethenolate Chemical compound OC(=O)[C@@H](N)CO\C([O-])=C\[N+]#N AGNGYMCLFWQVGX-AGFFZDDWSA-N 0.000 description 1
- JRMGHBVACUJCRP-BTJKTKAUSA-N (z)-but-2-enedioic acid;4-[(4-fluoro-2-methyl-1h-indol-5-yl)oxy]-6-methoxy-7-(3-pyrrolidin-1-ylpropoxy)quinazoline Chemical compound OC(=O)\C=C/C(O)=O.COC1=CC2=C(OC=3C(=C4C=C(C)NC4=CC=3)F)N=CN=C2C=C1OCCCN1CCCC1 JRMGHBVACUJCRP-BTJKTKAUSA-N 0.000 description 1
- UKAUYVFTDYCKQA-UHFFFAOYSA-N -2-Amino-4-hydroxybutanoic acid Natural products OC(=O)C(N)CCO UKAUYVFTDYCKQA-UHFFFAOYSA-N 0.000 description 1
- OWEGMIWEEQEYGQ-UHFFFAOYSA-N 100676-05-9 Natural products OC1C(O)C(O)C(CO)OC1OCC1C(O)C(O)C(O)C(OC2C(OC(O)C(O)C2O)CO)O1 OWEGMIWEEQEYGQ-UHFFFAOYSA-N 0.000 description 1
- BTOTXLJHDSNXMW-POYBYMJQSA-N 2,3-dideoxyuridine Chemical compound O1[C@H](CO)CC[C@@H]1N1C(=O)NC(=O)C=C1 BTOTXLJHDSNXMW-POYBYMJQSA-N 0.000 description 1
- BOMZMNZEXMAQQW-UHFFFAOYSA-N 2,5,11-trimethyl-6h-pyrido[4,3-b]carbazol-2-ium-9-ol;acetate Chemical compound CC([O-])=O.C[N+]1=CC=C2C(C)=C(NC=3C4=CC(O)=CC=3)C4=C(C)C2=C1 BOMZMNZEXMAQQW-UHFFFAOYSA-N 0.000 description 1
- QCXJFISCRQIYID-IAEPZHFASA-N 2-amino-1-n-[(3s,6s,7r,10s,16s)-3-[(2s)-butan-2-yl]-7,11,14-trimethyl-2,5,9,12,15-pentaoxo-10-propan-2-yl-8-oxa-1,4,11,14-tetrazabicyclo[14.3.0]nonadecan-6-yl]-4,6-dimethyl-3-oxo-9-n-[(3s,6s,7r,10s,16s)-7,11,14-trimethyl-2,5,9,12,15-pentaoxo-3,10-di(propa Chemical compound C[C@H]1OC(=O)[C@H](C(C)C)N(C)C(=O)CN(C)C(=O)[C@@H]2CCCN2C(=O)[C@H](C(C)C)NC(=O)[C@H]1NC(=O)C1=C(N=C2C(C(=O)N[C@@H]3C(=O)N[C@H](C(N4CCC[C@H]4C(=O)N(C)CC(=O)N(C)[C@@H](C(C)C)C(=O)O[C@@H]3C)=O)[C@@H](C)CC)=C(N)C(=O)C(C)=C2O2)C2=C(C)C=C1 QCXJFISCRQIYID-IAEPZHFASA-N 0.000 description 1
- VNBAOSVONFJBKP-UHFFFAOYSA-N 2-chloro-n,n-bis(2-chloroethyl)propan-1-amine;hydrochloride Chemical compound Cl.CC(Cl)CN(CCCl)CCCl VNBAOSVONFJBKP-UHFFFAOYSA-N 0.000 description 1
- PWMYMKOUNYTVQN-UHFFFAOYSA-N 3-(8,8-diethyl-2-aza-8-germaspiro[4.5]decan-2-yl)-n,n-dimethylpropan-1-amine Chemical compound C1C[Ge](CC)(CC)CCC11CN(CCCN(C)C)CC1 PWMYMKOUNYTVQN-UHFFFAOYSA-N 0.000 description 1
- AOJJSUZBOXZQNB-VTZDEGQISA-N 4'-epidoxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-VTZDEGQISA-N 0.000 description 1
- XXJWYDDUDKYVKI-UHFFFAOYSA-N 4-[(4-fluoro-2-methyl-1H-indol-5-yl)oxy]-6-methoxy-7-[3-(1-pyrrolidinyl)propoxy]quinazoline Chemical compound COC1=CC2=C(OC=3C(=C4C=C(C)NC4=CC=3)F)N=CN=C2C=C1OCCCN1CCCC1 XXJWYDDUDKYVKI-UHFFFAOYSA-N 0.000 description 1
- DODQJNMQWMSYGS-QPLCGJKRSA-N 4-[(z)-1-[4-[2-(dimethylamino)ethoxy]phenyl]-1-phenylbut-1-en-2-yl]phenol Chemical compound C=1C=C(O)C=CC=1C(/CC)=C(C=1C=CC(OCCN(C)C)=CC=1)/C1=CC=CC=C1 DODQJNMQWMSYGS-QPLCGJKRSA-N 0.000 description 1
- PQYGLZAKNWQTCV-HNNXBMFYSA-N 4-[N'-(2-hydroxyethyl)thioureido]-L-benzyl EDTA Chemical compound OCCNC(=S)NC1=CC=C(C[C@@H](CN(CC(O)=O)CC(O)=O)N(CC(O)=O)CC(O)=O)C=C1 PQYGLZAKNWQTCV-HNNXBMFYSA-N 0.000 description 1
- TVZGACDUOSZQKY-LBPRGKRZSA-N 4-aminofolic acid Chemical compound C1=NC2=NC(N)=NC(N)=C2N=C1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 TVZGACDUOSZQKY-LBPRGKRZSA-N 0.000 description 1
- NMUSYJAQQFHJEW-UHFFFAOYSA-N 5-Azacytidine Natural products O=C1N=C(N)N=CN1C1C(O)C(O)C(CO)O1 NMUSYJAQQFHJEW-UHFFFAOYSA-N 0.000 description 1
- IDPUKCWIGUEADI-UHFFFAOYSA-N 5-[bis(2-chloroethyl)amino]uracil Chemical compound ClCCN(CCCl)C1=CNC(=O)NC1=O IDPUKCWIGUEADI-UHFFFAOYSA-N 0.000 description 1
- WYXSYVWAUAUWLD-SHUUEZRQSA-N 6-azauridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C=N1 WYXSYVWAUAUWLD-SHUUEZRQSA-N 0.000 description 1
- YCWQAMGASJSUIP-YFKPBYRVSA-N 6-diazo-5-oxo-L-norleucine Chemical compound OC(=O)[C@@H](N)CCC(=O)C=[N+]=[N-] YCWQAMGASJSUIP-YFKPBYRVSA-N 0.000 description 1
- 229960005538 6-diazo-5-oxo-L-norleucine Drugs 0.000 description 1
- IADAQXMUWITWNG-UHFFFAOYSA-N 8,9-dichloro-2,3,4,5-tetrahydro-1h-benzo[c]azepine Chemical compound C1CCNCC2=C(Cl)C(Cl)=CC=C21 IADAQXMUWITWNG-UHFFFAOYSA-N 0.000 description 1
- ZGXJTSGNIOSYLO-UHFFFAOYSA-N 88755TAZ87 Chemical compound NCC(=O)CCC(O)=O ZGXJTSGNIOSYLO-UHFFFAOYSA-N 0.000 description 1
- HDZZVAMISRMYHH-UHFFFAOYSA-N 9beta-Ribofuranosyl-7-deazaadenin Natural products C1=CC=2C(N)=NC=NC=2N1C1OC(CO)C(O)C1O HDZZVAMISRMYHH-UHFFFAOYSA-N 0.000 description 1
- OONFNUWBHFSNBT-HXUWFJFHSA-N AEE788 Chemical compound C1CN(CC)CCN1CC1=CC=C(C=2NC3=NC=NC(N[C@H](C)C=4C=CC=CC=4)=C3C=2)C=C1 OONFNUWBHFSNBT-HXUWFJFHSA-N 0.000 description 1
- 108010088751 Albumins Proteins 0.000 description 1
- 102000009027 Albumins Human genes 0.000 description 1
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 1
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- CEIZFXOZIQNICU-UHFFFAOYSA-N Alternaria alternata Crofton-weed toxin Natural products CCC(C)C1NC(=O)C(C(C)=O)=C1O CEIZFXOZIQNICU-UHFFFAOYSA-N 0.000 description 1
- 102000009840 Angiopoietins Human genes 0.000 description 1
- 108010009906 Angiopoietins Proteins 0.000 description 1
- 102000014654 Aromatase Human genes 0.000 description 1
- 108010078554 Aromatase Proteins 0.000 description 1
- NOWKCMXCCJGMRR-UHFFFAOYSA-N Aziridine Chemical class C1CN1 NOWKCMXCCJGMRR-UHFFFAOYSA-N 0.000 description 1
- MLDQJTXFUGDVEO-UHFFFAOYSA-N BAY-43-9006 Chemical compound C1=NC(C(=O)NC)=CC(OC=2C=CC(NC(=O)NC=3C=C(C(Cl)=CC=3)C(F)(F)F)=CC=2)=C1 MLDQJTXFUGDVEO-UHFFFAOYSA-N 0.000 description 1
- 241000193830 Bacillus <bacterium> Species 0.000 description 1
- VGGGPCQERPFHOB-MCIONIFRSA-N Bestatin Chemical compound CC(C)C[C@H](C(O)=O)NC(=O)[C@@H](O)[C@H](N)CC1=CC=CC=C1 VGGGPCQERPFHOB-MCIONIFRSA-N 0.000 description 1
- 108010006654 Bleomycin Proteins 0.000 description 1
- 241000701822 Bovine papillomavirus Species 0.000 description 1
- 102000004219 Brain-derived neurotrophic factor Human genes 0.000 description 1
- 108090000715 Brain-derived neurotrophic factor Proteins 0.000 description 1
- COVZYZSDYWQREU-UHFFFAOYSA-N Busulfan Chemical compound CS(=O)(=O)OCCCCOS(C)(=O)=O COVZYZSDYWQREU-UHFFFAOYSA-N 0.000 description 1
- 241000282465 Canis Species 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 1
- SHHKQEUPHAENFK-UHFFFAOYSA-N Carboquone Chemical compound O=C1C(C)=C(N2CC2)C(=O)C(C(COC(N)=O)OC)=C1N1CC1 SHHKQEUPHAENFK-UHFFFAOYSA-N 0.000 description 1
- 201000009030 Carcinoma Diseases 0.000 description 1
- AOCCBINRVIKJHY-UHFFFAOYSA-N Carmofur Chemical compound CCCCCCNC(=O)N1C=C(F)C(=O)NC1=O AOCCBINRVIKJHY-UHFFFAOYSA-N 0.000 description 1
- DLGOEMSEDOSKAD-UHFFFAOYSA-N Carmustine Chemical compound ClCCNC(=O)N(N=O)CCCl DLGOEMSEDOSKAD-UHFFFAOYSA-N 0.000 description 1
- 102000014914 Carrier Proteins Human genes 0.000 description 1
- 108010078791 Carrier Proteins Proteins 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- JWBOIMRXGHLCPP-UHFFFAOYSA-N Chloditan Chemical compound C=1C=CC=C(Cl)C=1C(C(Cl)Cl)C1=CC=C(Cl)C=C1 JWBOIMRXGHLCPP-UHFFFAOYSA-N 0.000 description 1
- XCDXSSFOJZZGQC-UHFFFAOYSA-N Chlornaphazine Chemical compound C1=CC=CC2=CC(N(CCCl)CCCl)=CC=C21 XCDXSSFOJZZGQC-UHFFFAOYSA-N 0.000 description 1
- MKQWTWSXVILIKJ-LXGUWJNJSA-N Chlorozotocin Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](C=O)NC(=O)N(N=O)CCCl MKQWTWSXVILIKJ-LXGUWJNJSA-N 0.000 description 1
- 102100029297 Cholinephosphotransferase 1 Human genes 0.000 description 1
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 1
- PTOAARAWEBMLNO-KVQBGUIXSA-N Cladribine Chemical compound C1=NC=2C(N)=NC(Cl)=NC=2N1[C@H]1C[C@H](O)[C@@H](CO)O1 PTOAARAWEBMLNO-KVQBGUIXSA-N 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 229920002261 Corn starch Polymers 0.000 description 1
- 108050006400 Cyclin Proteins 0.000 description 1
- 102000016736 Cyclin Human genes 0.000 description 1
- CMSMOCZEIVJLDB-UHFFFAOYSA-N Cyclophosphamide Chemical compound ClCCN(CCCl)P1(=O)NCCCO1 CMSMOCZEIVJLDB-UHFFFAOYSA-N 0.000 description 1
- 241000701022 Cytomegalovirus Species 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 description 1
- 229960005500 DHA-paclitaxel Drugs 0.000 description 1
- 102000053602 DNA Human genes 0.000 description 1
- 102000003915 DNA Topoisomerases Human genes 0.000 description 1
- 108090000323 DNA Topoisomerases Proteins 0.000 description 1
- 239000003155 DNA primer Substances 0.000 description 1
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 1
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 1
- 108090000626 DNA-directed RNA polymerases Proteins 0.000 description 1
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 description 1
- WEAHRLBPCANXCN-UHFFFAOYSA-N Daunomycin Natural products CCC1(O)CC(OC2CC(N)C(O)C(C)O2)c3cc4C(=O)c5c(OC)cccc5C(=O)c4c(O)c3C1 WEAHRLBPCANXCN-UHFFFAOYSA-N 0.000 description 1
- NNJPGOLRFBJNIW-UHFFFAOYSA-N Demecolcine Natural products C1=C(OC)C(=O)C=C2C(NC)CCC3=CC(OC)=C(OC)C(OC)=C3C2=C1 NNJPGOLRFBJNIW-UHFFFAOYSA-N 0.000 description 1
- 229920001353 Dextrin Polymers 0.000 description 1
- 239000004375 Dextrin Substances 0.000 description 1
- 235000019739 Dicalciumphosphate Nutrition 0.000 description 1
- 108050007106 Dishevelled-1 Proteins 0.000 description 1
- 108050007105 Dishevelled-2 Proteins 0.000 description 1
- 108050007103 Dishevelled-3 Proteins 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 238000012286 ELISA Assay Methods 0.000 description 1
- 102100025137 Early activation antigen CD69 Human genes 0.000 description 1
- SAMRUMKYXPVKPA-VFKOLLTISA-N Enocitabine Chemical compound O=C1N=C(NC(=O)CCCCCCCCCCCCCCCCCCCCC)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 SAMRUMKYXPVKPA-VFKOLLTISA-N 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 102000009024 Epidermal Growth Factor Human genes 0.000 description 1
- HTIJFSOGRVMCQR-UHFFFAOYSA-N Epirubicin Natural products COc1cccc2C(=O)c3c(O)c4CC(O)(CC(OC5CC(N)C(=O)C(C)O5)c4c(O)c3C(=O)c12)C(=O)CO HTIJFSOGRVMCQR-UHFFFAOYSA-N 0.000 description 1
- OBMLHUPNRURLOK-XGRAFVIBSA-N Epitiostanol Chemical compound C1[C@@H]2S[C@@H]2C[C@]2(C)[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CC[C@H]21 OBMLHUPNRURLOK-XGRAFVIBSA-N 0.000 description 1
- 241000283074 Equus asinus Species 0.000 description 1
- 229930189413 Esperamicin Natural products 0.000 description 1
- JOYRKODLDBILNP-UHFFFAOYSA-N Ethyl urethane Chemical compound CCOC(N)=O JOYRKODLDBILNP-UHFFFAOYSA-N 0.000 description 1
- 101150021185 FGF gene Proteins 0.000 description 1
- 241000282324 Felis Species 0.000 description 1
- 108010067306 Fibronectins Proteins 0.000 description 1
- 108090000331 Firefly luciferases Proteins 0.000 description 1
- 238000012413 Fluorescence activated cell sorting analysis Methods 0.000 description 1
- 102100028466 Frizzled-8 Human genes 0.000 description 1
- 101710140933 Frizzled-8 Proteins 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 102000034615 Glial cell line-derived neurotrophic factor Human genes 0.000 description 1
- 108091010837 Glial cell line-derived neurotrophic factor Proteins 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 1
- 102000005720 Glutathione transferase Human genes 0.000 description 1
- 108010070675 Glutathione transferase Proteins 0.000 description 1
- JZNWSCPGTDBMEW-UHFFFAOYSA-N Glycerophosphorylethanolamin Natural products NCCOP(O)(=O)OCC(O)CO JZNWSCPGTDBMEW-UHFFFAOYSA-N 0.000 description 1
- 108010069236 Goserelin Proteins 0.000 description 1
- BLCLNMBMMGCOAS-URPVMXJPSA-N Goserelin Chemical compound C([C@@H](C(=O)N[C@H](COC(C)(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N1[C@@H](CCC1)C(=O)NNC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H]1NC(=O)CC1)C1=CC=C(O)C=C1 BLCLNMBMMGCOAS-URPVMXJPSA-N 0.000 description 1
- 108010017080 Granulocyte Colony-Stimulating Factor Proteins 0.000 description 1
- 102000004269 Granulocyte Colony-Stimulating Factor Human genes 0.000 description 1
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 1
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 description 1
- 102100035970 Growth/differentiation factor 9 Human genes 0.000 description 1
- 102100021866 Hepatocyte growth factor Human genes 0.000 description 1
- 102100031000 Hepatoma-derived growth factor Human genes 0.000 description 1
- 108010093488 His-His-His-His-His-His Proteins 0.000 description 1
- 101000859570 Homo sapiens Carnitine O-palmitoyltransferase 1, liver isoform Proteins 0.000 description 1
- 101000909313 Homo sapiens Carnitine O-palmitoyltransferase 2, mitochondrial Proteins 0.000 description 1
- 101000989606 Homo sapiens Cholinephosphotransferase 1 Proteins 0.000 description 1
- 101000934374 Homo sapiens Early activation antigen CD69 Proteins 0.000 description 1
- 101001027128 Homo sapiens Fibronectin Proteins 0.000 description 1
- 101001075110 Homo sapiens Growth/differentiation factor 9 Proteins 0.000 description 1
- 101000898034 Homo sapiens Hepatocyte growth factor Proteins 0.000 description 1
- 101000599951 Homo sapiens Insulin-like growth factor I Proteins 0.000 description 1
- 101001076408 Homo sapiens Interleukin-6 Proteins 0.000 description 1
- 101001043594 Homo sapiens Low-density lipoprotein receptor-related protein 5 Proteins 0.000 description 1
- 101000825960 Homo sapiens R-spondin-3 Proteins 0.000 description 1
- 101000868152 Homo sapiens Son of sevenless homolog 1 Proteins 0.000 description 1
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 1
- PMMYEEVYMWASQN-DMTCNVIQSA-N Hydroxyproline Chemical compound O[C@H]1CN[C@H](C(O)=O)C1 PMMYEEVYMWASQN-DMTCNVIQSA-N 0.000 description 1
- VSNHCAURESNICA-UHFFFAOYSA-N Hydroxyurea Chemical compound NC(=O)NO VSNHCAURESNICA-UHFFFAOYSA-N 0.000 description 1
- MPBVHIBUJCELCL-UHFFFAOYSA-N Ibandronate Chemical compound CCCCCN(C)CCC(O)(P(O)(O)=O)P(O)(O)=O MPBVHIBUJCELCL-UHFFFAOYSA-N 0.000 description 1
- XDXDZDZNSLXDNA-TZNDIEGXSA-N Idarubicin Chemical compound C1[C@H](N)[C@H](O)[C@H](C)O[C@H]1O[C@@H]1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2C[C@@](O)(C(C)=O)C1 XDXDZDZNSLXDNA-TZNDIEGXSA-N 0.000 description 1
- XDXDZDZNSLXDNA-UHFFFAOYSA-N Idarubicin Natural products C1C(N)C(O)C(C)OC1OC1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2CC(O)(C(C)=O)C1 XDXDZDZNSLXDNA-UHFFFAOYSA-N 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical class C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- 206010061598 Immunodeficiency Diseases 0.000 description 1
- 102000009786 Immunoglobulin Constant Regions Human genes 0.000 description 1
- 108010009817 Immunoglobulin Constant Regions Proteins 0.000 description 1
- 102000012745 Immunoglobulin Subunits Human genes 0.000 description 1
- 108010079585 Immunoglobulin Subunits Proteins 0.000 description 1
- 108700001097 Insect Genes Proteins 0.000 description 1
- 102100037852 Insulin-like growth factor I Human genes 0.000 description 1
- 238000012695 Interfacial polymerization Methods 0.000 description 1
- 108010002352 Interleukin-1 Proteins 0.000 description 1
- 102000000589 Interleukin-1 Human genes 0.000 description 1
- 108010065805 Interleukin-12 Proteins 0.000 description 1
- 108090000171 Interleukin-18 Proteins 0.000 description 1
- 108010002386 Interleukin-3 Proteins 0.000 description 1
- 108090000978 Interleukin-4 Proteins 0.000 description 1
- 108010002616 Interleukin-5 Proteins 0.000 description 1
- 108090001005 Interleukin-6 Proteins 0.000 description 1
- 108010002586 Interleukin-7 Proteins 0.000 description 1
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 1
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- UKAUYVFTDYCKQA-VKHMYHEASA-N L-homoserine Chemical group OC(=O)[C@@H](N)CCO UKAUYVFTDYCKQA-VKHMYHEASA-N 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- QEFRNWWLZKMPFJ-ZXPFJRLXSA-N L-methionine (R)-S-oxide Chemical group C[S@@](=O)CC[C@H]([NH3+])C([O-])=O QEFRNWWLZKMPFJ-ZXPFJRLXSA-N 0.000 description 1
- QEFRNWWLZKMPFJ-UHFFFAOYSA-N L-methionine sulphoxide Chemical group CS(=O)CCC(N)C(O)=O QEFRNWWLZKMPFJ-UHFFFAOYSA-N 0.000 description 1
- 239000003798 L01XE11 - Pazopanib Substances 0.000 description 1
- 101000844802 Lacticaseibacillus rhamnosus Teichoic acid D-alanyltransferase Proteins 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 101150030213 Lag3 gene Proteins 0.000 description 1
- 229920001491 Lentinan Polymers 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 108010006444 Leucine-Rich Repeat Proteins Proteins 0.000 description 1
- GQYIWUVLTXOXAJ-UHFFFAOYSA-N Lomustine Chemical compound ClCCN(N=O)C(=O)NC1CCCCC1 GQYIWUVLTXOXAJ-UHFFFAOYSA-N 0.000 description 1
- 102100021926 Low-density lipoprotein receptor-related protein 5 Human genes 0.000 description 1
- 102100040704 Low-density lipoprotein receptor-related protein 6 Human genes 0.000 description 1
- 102000008072 Lymphokines Human genes 0.000 description 1
- 108010074338 Lymphokines Proteins 0.000 description 1
- 206010025323 Lymphomas Diseases 0.000 description 1
- 241000282553 Macaca Species 0.000 description 1
- 241000282567 Macaca fascicularis Species 0.000 description 1
- 241000829100 Macaca mulatta polyomavirus 1 Species 0.000 description 1
- 239000004907 Macro-emulsion Substances 0.000 description 1
- GUBGYTABKSRVRQ-PICCSMPSSA-N Maltose Natural products O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-PICCSMPSSA-N 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- VJRAUFKOOPNFIQ-UHFFFAOYSA-N Marcellomycin Natural products C12=C(O)C=3C(=O)C4=C(O)C=CC(O)=C4C(=O)C=3C=C2C(C(=O)OC)C(CC)(O)CC1OC(OC1C)CC(N(C)C)C1OC(OC1C)CC(O)C1OC1CC(O)C(O)C(C)O1 VJRAUFKOOPNFIQ-UHFFFAOYSA-N 0.000 description 1
- IVDYZAAPOLNZKG-KWHRADDSSA-N Mepitiostane Chemical compound O([C@@H]1[C@]2(CC[C@@H]3[C@@]4(C)C[C@H]5S[C@H]5C[C@@H]4CC[C@H]3[C@@H]2CC1)C)C1(OC)CCCC1 IVDYZAAPOLNZKG-KWHRADDSSA-N 0.000 description 1
- 108700005443 Microbial Genes Proteins 0.000 description 1
- VFKZTMPDYBFSTM-KVTDHHQDSA-N Mitobronitol Chemical compound BrC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CBr VFKZTMPDYBFSTM-KVTDHHQDSA-N 0.000 description 1
- 229930192392 Mitomycin Natural products 0.000 description 1
- 108090000143 Mouse Proteins Proteins 0.000 description 1
- 241000699660 Mus musculus Species 0.000 description 1
- 101710135898 Myc proto-oncogene protein Proteins 0.000 description 1
- 102100038895 Myc proto-oncogene protein Human genes 0.000 description 1
- 101001055320 Myxine glutinosa Insulin-like growth factor Proteins 0.000 description 1
- OVBPIULPVIDEAO-UHFFFAOYSA-N N-Pteroyl-L-glutaminsaeure Natural products C=1N=C2NC(N)=NC(=O)C2=NC=1CNC1=CC=C(C(=O)NC(CCC(O)=O)C(O)=O)C=C1 OVBPIULPVIDEAO-UHFFFAOYSA-N 0.000 description 1
- 108091061960 Naked DNA Proteins 0.000 description 1
- 102000007072 Nerve Growth Factors Human genes 0.000 description 1
- SYNHCENRCUAUNM-UHFFFAOYSA-N Nitrogen mustard N-oxide hydrochloride Chemical compound Cl.ClCC[N+]([O-])(C)CCCl SYNHCENRCUAUNM-UHFFFAOYSA-N 0.000 description 1
- KGTDRFCXGRULNK-UHFFFAOYSA-N Nogalamycin Natural products COC1C(OC)(C)C(OC)C(C)OC1OC1C2=C(O)C(C(=O)C3=C(O)C=C4C5(C)OC(C(C(C5O)N(C)C)O)OC4=C3C3=O)=C3C=C2C(C(=O)OC)C(C)(O)C1 KGTDRFCXGRULNK-UHFFFAOYSA-N 0.000 description 1
- 229930187135 Olivomycin Natural products 0.000 description 1
- 108700020796 Oncogene Proteins 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 108090000526 Papain Proteins 0.000 description 1
- 108010057150 Peplomycin Proteins 0.000 description 1
- 102000057297 Pepsin A Human genes 0.000 description 1
- 108090000284 Pepsin A Proteins 0.000 description 1
- 102000007079 Peptide Fragments Human genes 0.000 description 1
- 108010033276 Peptide Fragments Proteins 0.000 description 1
- 108091000080 Phosphotransferase Proteins 0.000 description 1
- KMSKQZKKOZQFFG-HSUXVGOQSA-N Pirarubicin Chemical compound O([C@H]1[C@@H](N)C[C@@H](O[C@H]1C)O[C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1CCCCO1 KMSKQZKKOZQFFG-HSUXVGOQSA-N 0.000 description 1
- 239000004698 Polyethylene Substances 0.000 description 1
- HFVNWDWLWUCIHC-GUPDPFMOSA-N Prednimustine Chemical compound O=C([C@@]1(O)CC[C@H]2[C@H]3[C@@H]([C@]4(C=CC(=O)C=C4CC3)C)[C@@H](O)C[C@@]21C)COC(=O)CCCC1=CC=C(N(CCCl)CCCl)C=C1 HFVNWDWLWUCIHC-GUPDPFMOSA-N 0.000 description 1
- 101710098940 Pro-epidermal growth factor Proteins 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 102100022766 R-spondin-3 Human genes 0.000 description 1
- AHHFEZNOXOZZQA-ZEBDFXRSSA-N Ranimustine Chemical compound CO[C@H]1O[C@H](CNC(=O)N(CCCl)N=O)[C@@H](O)[C@H](O)[C@H]1O AHHFEZNOXOZZQA-ZEBDFXRSSA-N 0.000 description 1
- 108700008625 Reporter Genes Proteins 0.000 description 1
- 108091028664 Ribonucleotide Proteins 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- 206010039491 Sarcoma Diseases 0.000 description 1
- 229920001800 Shellac Polymers 0.000 description 1
- 108020004682 Single-Stranded DNA Proteins 0.000 description 1
- 235000021355 Stearic acid Nutrition 0.000 description 1
- 230000024932 T cell mediated immunity Effects 0.000 description 1
- 229940123237 Taxane Drugs 0.000 description 1
- CGMTUJFWROPELF-UHFFFAOYSA-N Tenuazonic acid Natural products CCC(C)C1NC(=O)C(=C(C)/O)C1=O CGMTUJFWROPELF-UHFFFAOYSA-N 0.000 description 1
- WDLRUFUQRNWCPK-UHFFFAOYSA-N Tetraxetan Chemical compound OC(=O)CN1CCN(CC(O)=O)CCN(CC(O)=O)CCN(CC(O)=O)CC1 WDLRUFUQRNWCPK-UHFFFAOYSA-N 0.000 description 1
- 102000036693 Thrombopoietin Human genes 0.000 description 1
- 108010041111 Thrombopoietin Proteins 0.000 description 1
- 101710183280 Topoisomerase Proteins 0.000 description 1
- 101710150448 Transcriptional regulator Myc Proteins 0.000 description 1
- 102000004887 Transforming Growth Factor beta Human genes 0.000 description 1
- 108090001012 Transforming Growth Factor beta Proteins 0.000 description 1
- HDTRYLNUVZCQOY-WSWWMNSNSA-N Trehalose Natural products O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-WSWWMNSNSA-N 0.000 description 1
- UMILHIMHKXVDGH-UHFFFAOYSA-N Triethylene glycol diglycidyl ether Chemical compound C1OC1COCCOCCOCCOCC1CO1 UMILHIMHKXVDGH-UHFFFAOYSA-N 0.000 description 1
- 102000004243 Tubulin Human genes 0.000 description 1
- 108090000704 Tubulin Proteins 0.000 description 1
- 102100040247 Tumor necrosis factor Human genes 0.000 description 1
- 102000007537 Type II DNA Topoisomerases Human genes 0.000 description 1
- 108010046308 Type II DNA Topoisomerases Proteins 0.000 description 1
- 108091008605 VEGF receptors Proteins 0.000 description 1
- 102000009484 Vascular Endothelial Growth Factor Receptors Human genes 0.000 description 1
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 1
- 229940122803 Vinca alkaloid Drugs 0.000 description 1
- 108700005077 Viral Genes Proteins 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 241000269370 Xenopus <genus> Species 0.000 description 1
- ZYVSOIYQKUDENJ-ASUJBHBQSA-N [(2R,3R,4R,6R)-6-[[(6S,7S)-6-[(2S,4R,5R,6R)-4-[(2R,4R,5R,6R)-4-[(2S,4S,5S,6S)-5-acetyloxy-4-hydroxy-4,6-dimethyloxan-2-yl]oxy-5-hydroxy-6-methyloxan-2-yl]oxy-5-hydroxy-6-methyloxan-2-yl]oxy-7-[(3S,4R)-3,4-dihydroxy-1-methoxy-2-oxopentyl]-4,10-dihydroxy-3-methyl-5-oxo-7,8-dihydro-6H-anthracen-2-yl]oxy]-4-[(2R,4R,5R,6R)-4-hydroxy-5-methoxy-6-methyloxan-2-yl]oxy-2-methyloxan-3-yl] acetate Chemical class COC([C@@H]1Cc2cc3cc(O[C@@H]4C[C@@H](O[C@@H]5C[C@@H](O)[C@@H](OC)[C@@H](C)O5)[C@H](OC(C)=O)[C@@H](C)O4)c(C)c(O)c3c(O)c2C(=O)[C@H]1O[C@H]1C[C@@H](O[C@@H]2C[C@@H](O[C@H]3C[C@](C)(O)[C@@H](OC(C)=O)[C@H](C)O3)[C@H](O)[C@@H](C)O2)[C@H](O)[C@@H](C)O1)C(=O)[C@@H](O)[C@@H](C)O ZYVSOIYQKUDENJ-ASUJBHBQSA-N 0.000 description 1
- SPJCRMJCFSJKDE-ZWBUGVOYSA-N [(3s,8s,9s,10r,13r,14s,17r)-10,13-dimethyl-17-[(2r)-6-methylheptan-2-yl]-2,3,4,7,8,9,11,12,14,15,16,17-dodecahydro-1h-cyclopenta[a]phenanthren-3-yl] 2-[4-[bis(2-chloroethyl)amino]phenyl]acetate Chemical compound O([C@@H]1CC2=CC[C@H]3[C@@H]4CC[C@@H]([C@]4(CC[C@@H]3[C@@]2(C)CC1)C)[C@H](C)CCCC(C)C)C(=O)CC1=CC=C(N(CCCl)CCCl)C=C1 SPJCRMJCFSJKDE-ZWBUGVOYSA-N 0.000 description 1
- IFJUINDAXYAPTO-UUBSBJJBSA-N [(8r,9s,13s,14s,17s)-17-[2-[4-[4-[bis(2-chloroethyl)amino]phenyl]butanoyloxy]acetyl]oxy-13-methyl-6,7,8,9,11,12,14,15,16,17-decahydrocyclopenta[a]phenanthren-3-yl] benzoate Chemical compound C([C@@H]1[C@@H](C2=CC=3)CC[C@]4([C@H]1CC[C@@H]4OC(=O)COC(=O)CCCC=1C=CC(=CC=1)N(CCCl)CCCl)C)CC2=CC=3OC(=O)C1=CC=CC=C1 IFJUINDAXYAPTO-UUBSBJJBSA-N 0.000 description 1
- IHGLINDYFMDHJG-UHFFFAOYSA-N [2-(4-methoxyphenyl)-3,4-dihydronaphthalen-1-yl]-[4-(2-pyrrolidin-1-ylethoxy)phenyl]methanone Chemical compound C1=CC(OC)=CC=C1C(CCC1=CC=CC=C11)=C1C(=O)C(C=C1)=CC=C1OCCN1CCCC1 IHGLINDYFMDHJG-UHFFFAOYSA-N 0.000 description 1
- XZSRRNFBEIOBDA-CFNBKWCHSA-N [2-[(2s,4s)-4-[(2r,4s,5s,6s)-4-amino-5-hydroxy-6-methyloxan-2-yl]oxy-2,5,12-trihydroxy-7-methoxy-6,11-dioxo-3,4-dihydro-1h-tetracen-2-yl]-2-oxoethyl] 2,2-diethoxyacetate Chemical compound O([C@H]1C[C@](CC2=C(O)C=3C(=O)C4=CC=CC(OC)=C4C(=O)C=3C(O)=C21)(O)C(=O)COC(=O)C(OCC)OCC)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 XZSRRNFBEIOBDA-CFNBKWCHSA-N 0.000 description 1
- 229940028652 abraxane Drugs 0.000 description 1
- 238000010521 absorption reaction Methods 0.000 description 1
- 238000009825 accumulation Methods 0.000 description 1
- ZOZKYEHVNDEUCO-XUTVFYLZSA-N aceglatone Chemical compound O1C(=O)[C@H](OC(C)=O)[C@@H]2OC(=O)[C@@H](OC(=O)C)[C@@H]21 ZOZKYEHVNDEUCO-XUTVFYLZSA-N 0.000 description 1
- 229950002684 aceglatone Drugs 0.000 description 1
- 230000021736 acetylation Effects 0.000 description 1
- 238000006640 acetylation reaction Methods 0.000 description 1
- 229940081735 acetylcellulose Drugs 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 229930183665 actinomycin Natural products 0.000 description 1
- 239000012190 activator Substances 0.000 description 1
- 239000004480 active ingredient Substances 0.000 description 1
- 239000013543 active substance Substances 0.000 description 1
- 239000000853 adhesive Substances 0.000 description 1
- 230000001070 adhesive effect Effects 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 239000000443 aerosol Substances 0.000 description 1
- 230000009824 affinity maturation Effects 0.000 description 1
- 238000007818 agglutination assay Methods 0.000 description 1
- 230000001270 agonistic effect Effects 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 125000003295 alanine group Chemical group N[C@@H](C)C(=O)* 0.000 description 1
- 125000000217 alkyl group Chemical group 0.000 description 1
- 229940045714 alkyl sulfonate alkylating agent Drugs 0.000 description 1
- 150000008052 alkyl sulfonates Chemical class 0.000 description 1
- 229940100198 alkylating agent Drugs 0.000 description 1
- 239000002168 alkylating agent Substances 0.000 description 1
- SHGAZHPCJJPHSC-YCNIQYBTSA-N all-trans-retinoic acid Chemical compound OC(=O)\C=C(/C)\C=C\C=C(/C)\C=C\C1=C(C)CCCC1(C)C SHGAZHPCJJPHSC-YCNIQYBTSA-N 0.000 description 1
- HDTRYLNUVZCQOY-LIZSDCNHSA-N alpha,alpha-trehalose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-LIZSDCNHSA-N 0.000 description 1
- 229960000473 altretamine Drugs 0.000 description 1
- 125000003277 amino group Chemical group 0.000 description 1
- 229960003437 aminoglutethimide Drugs 0.000 description 1
- ROBVIMPUHSLWNV-UHFFFAOYSA-N aminoglutethimide Chemical compound C=1C=C(N)C=CC=1C1(CC)CCC(=O)NC1=O ROBVIMPUHSLWNV-UHFFFAOYSA-N 0.000 description 1
- 229960002749 aminolevulinic acid Drugs 0.000 description 1
- 229960003896 aminopterin Drugs 0.000 description 1
- 229960001220 amsacrine Drugs 0.000 description 1
- XCPGHVQEEXUHNC-UHFFFAOYSA-N amsacrine Chemical compound COC1=CC(NS(C)(=O)=O)=CC=C1NC1=C(C=CC=C2)C2=NC2=CC=CC=C12 XCPGHVQEEXUHNC-UHFFFAOYSA-N 0.000 description 1
- BBDAGFIXKZCXAH-CCXZUQQUSA-N ancitabine Chemical compound N=C1C=CN2[C@@H]3O[C@H](CO)[C@@H](O)[C@@H]3OC2=N1 BBDAGFIXKZCXAH-CCXZUQQUSA-N 0.000 description 1
- 229950000242 ancitabine Drugs 0.000 description 1
- 239000003098 androgen Substances 0.000 description 1
- 229940030486 androgens Drugs 0.000 description 1
- 239000002870 angiogenesis inducing agent Substances 0.000 description 1
- 239000004037 angiogenesis inhibitor Substances 0.000 description 1
- 229940121369 angiogenesis inhibitor Drugs 0.000 description 1
- 230000003042 antagnostic effect Effects 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 230000002280 anti-androgenic effect Effects 0.000 description 1
- 229940046836 anti-estrogen Drugs 0.000 description 1
- 230000001833 anti-estrogenic effect Effects 0.000 description 1
- 239000000051 antiandrogen Substances 0.000 description 1
- 229940030495 antiandrogen sex hormone and modulator of the genital system Drugs 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 239000013059 antihormonal agent Substances 0.000 description 1
- 229940045687 antimetabolites folic acid analogs Drugs 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 235000006708 antioxidants Nutrition 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 150000008209 arabinosides Chemical class 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 229960005070 ascorbic acid Drugs 0.000 description 1
- 235000010323 ascorbic acid Nutrition 0.000 description 1
- 239000011668 ascorbic acid Substances 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 230000017047 asymmetric cell division Effects 0.000 description 1
- 229940120638 avastin Drugs 0.000 description 1
- VSRXQHXAPYXROS-UHFFFAOYSA-N azanide;cyclobutane-1,1-dicarboxylic acid;platinum(2+) Chemical compound [NH2-].[NH2-].[Pt+2].OC(=O)C1(C(O)=O)CCC1 VSRXQHXAPYXROS-UHFFFAOYSA-N 0.000 description 1
- 229950011321 azaserine Drugs 0.000 description 1
- LMEKQMALGUDUQG-UHFFFAOYSA-N azathioprine Chemical compound CN1C=NC([N+]([O-])=O)=C1SC1=NC=NC2=C1NC=N2 LMEKQMALGUDUQG-UHFFFAOYSA-N 0.000 description 1
- 229960002170 azathioprine Drugs 0.000 description 1
- 150000001541 aziridines Chemical class 0.000 description 1
- 229960000686 benzalkonium chloride Drugs 0.000 description 1
- 229960001950 benzethonium chloride Drugs 0.000 description 1
- UREZNYTWGJKWBI-UHFFFAOYSA-M benzethonium chloride Chemical compound [Cl-].C1=CC(C(C)(C)CC(C)(C)C)=CC=C1OCCOCC[N+](C)(C)CC1=CC=CC=C1 UREZNYTWGJKWBI-UHFFFAOYSA-M 0.000 description 1
- 235000019445 benzyl alcohol Nutrition 0.000 description 1
- CADWTSSKOVRVJC-UHFFFAOYSA-N benzyl(dimethyl)azanium;chloride Chemical compound [Cl-].C[NH+](C)CC1=CC=CC=C1 CADWTSSKOVRVJC-UHFFFAOYSA-N 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- GUBGYTABKSRVRQ-QUYVBRFLSA-N beta-maltose Chemical compound OC[C@H]1O[C@H](O[C@H]2[C@H](O)[C@@H](O)[C@H](O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@@H]1O GUBGYTABKSRVRQ-QUYVBRFLSA-N 0.000 description 1
- 229960000397 bevacizumab Drugs 0.000 description 1
- 229960000997 bicalutamide Drugs 0.000 description 1
- 238000005842 biochemical reaction Methods 0.000 description 1
- HUTDDBSSHVOYJR-UHFFFAOYSA-H bis[(2-oxo-1,3,2$l^{5},4$l^{2}-dioxaphosphaplumbetan-2-yl)oxy]lead Chemical compound [Pb+2].[Pb+2].[Pb+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O HUTDDBSSHVOYJR-UHFFFAOYSA-H 0.000 description 1
- 229950008548 bisantrene Drugs 0.000 description 1
- OYVAGSVQBOHSSS-UAPAGMARSA-O bleomycin A2 Chemical class N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCC[S+](C)C)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C OYVAGSVQBOHSSS-UAPAGMARSA-O 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 210000001124 body fluid Anatomy 0.000 description 1
- 239000000872 buffer Substances 0.000 description 1
- 229960002092 busulfan Drugs 0.000 description 1
- DQXBYHZEEUGOBF-UHFFFAOYSA-N but-3-enoic acid;ethene Chemical compound C=C.OC(=O)CC=C DQXBYHZEEUGOBF-UHFFFAOYSA-N 0.000 description 1
- LRHPLDYGYMQRHN-UHFFFAOYSA-N butyl alcohol Substances CCCCO LRHPLDYGYMQRHN-UHFFFAOYSA-N 0.000 description 1
- 125000000484 butyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 108700002839 cactinomycin Proteins 0.000 description 1
- 229950009908 cactinomycin Drugs 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229930195731 calicheamicin Natural products 0.000 description 1
- HXCHCVDVKSCDHU-LULTVBGHSA-N calicheamicin Chemical compound C1[C@H](OC)[C@@H](NCC)CO[C@H]1O[C@H]1[C@H](O[C@@H]2C\3=C(NC(=O)OC)C(=O)C[C@](C/3=C/CSSSC)(O)C#C\C=C/C#C2)O[C@H](C)[C@@H](NO[C@@H]2O[C@H](C)[C@@H](SC(=O)C=3C(=C(OC)C(O[C@H]4[C@@H]([C@H](OC)[C@@H](O)[C@H](C)O4)O)=C(I)C=3C)OC)[C@@H](O)C2)[C@@H]1O HXCHCVDVKSCDHU-LULTVBGHSA-N 0.000 description 1
- 229950009823 calusterone Drugs 0.000 description 1
- IVFYLRMMHVYGJH-PVPPCFLZSA-N calusterone Chemical compound C1C[C@]2(C)[C@](O)(C)CC[C@H]2[C@@H]2[C@@H](C)CC3=CC(=O)CC[C@]3(C)[C@H]21 IVFYLRMMHVYGJH-PVPPCFLZSA-N 0.000 description 1
- 239000003560 cancer drug Substances 0.000 description 1
- 230000005907 cancer growth Effects 0.000 description 1
- 238000002619 cancer immunotherapy Methods 0.000 description 1
- 208000035269 cancer or benign tumor Diseases 0.000 description 1
- 229950002826 canertinib Drugs 0.000 description 1
- OMZCMEYTWSXEPZ-UHFFFAOYSA-N canertinib Chemical compound C1=C(Cl)C(F)=CC=C1NC1=NC=NC2=CC(OCCCN3CCOCC3)=C(NC(=O)C=C)C=C12 OMZCMEYTWSXEPZ-UHFFFAOYSA-N 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- 229910052799 carbon Inorganic materials 0.000 description 1
- 229960004562 carboplatin Drugs 0.000 description 1
- 229960002115 carboquone Drugs 0.000 description 1
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 1
- UHBYWPGGCSDKFX-UHFFFAOYSA-N carboxyglutamic acid Chemical compound OC(=O)C(N)CC(C(O)=O)C(O)=O UHBYWPGGCSDKFX-UHFFFAOYSA-N 0.000 description 1
- 229960003261 carmofur Drugs 0.000 description 1
- 229960005243 carmustine Drugs 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 108010047060 carzinophilin Proteins 0.000 description 1
- 125000002091 cationic group Chemical group 0.000 description 1
- 230000022131 cell cycle Effects 0.000 description 1
- 239000002771 cell marker Substances 0.000 description 1
- 230000002032 cellular defenses Effects 0.000 description 1
- 229920002301 cellulose acetate Polymers 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 229960005395 cetuximab Drugs 0.000 description 1
- 229960000541 cetyl alcohol Drugs 0.000 description 1
- 230000000739 chaotic effect Effects 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 239000003638 chemical reducing agent Substances 0.000 description 1
- 239000012829 chemotherapy agent Substances 0.000 description 1
- 229950008249 chlornaphazine Drugs 0.000 description 1
- 229960001480 chlorozotocin Drugs 0.000 description 1
- 235000012000 cholesterol Nutrition 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 1
- 229960004316 cisplatin Drugs 0.000 description 1
- 229960002436 cladribine Drugs 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 238000011260 co-administration Methods 0.000 description 1
- 238000005354 coacervation Methods 0.000 description 1
- 238000004440 column chromatography Methods 0.000 description 1
- 230000002860 competitive effect Effects 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 239000000356 contaminant Substances 0.000 description 1
- 239000013256 coordination polymer Substances 0.000 description 1
- 239000008120 corn starch Substances 0.000 description 1
- 239000006071 cream Substances 0.000 description 1
- 239000003431 cross linking reagent Substances 0.000 description 1
- 238000012866 crystallographic experiment Methods 0.000 description 1
- HPXRVTGHNJAIIH-UHFFFAOYSA-N cyclohexanol Chemical compound OC1CCCCC1 HPXRVTGHNJAIIH-UHFFFAOYSA-N 0.000 description 1
- 229960004397 cyclophosphamide Drugs 0.000 description 1
- 229960000684 cytarabine Drugs 0.000 description 1
- 239000000824 cytostatic agent Substances 0.000 description 1
- 230000001085 cytostatic effect Effects 0.000 description 1
- 229960003901 dacarbazine Drugs 0.000 description 1
- 229960000975 daunorubicin Drugs 0.000 description 1
- 229960003334 daunorubicin citrate Drugs 0.000 description 1
- 230000003111 delayed effect Effects 0.000 description 1
- 229960005052 demecolcine Drugs 0.000 description 1
- 239000005547 deoxyribonucleotide Substances 0.000 description 1
- 125000002637 deoxyribonucleotide group Chemical group 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 229950003913 detorubicin Drugs 0.000 description 1
- 235000019425 dextrin Nutrition 0.000 description 1
- LRCZQSDQZJBHAF-PUBGEWHCSA-N dha-paclitaxel Chemical compound N([C@H]([C@@H](OC(=O)CC\C=C/C\C=C/C\C=C/C\C=C/C\C=C/C\C=C/CC)C(=O)O[C@@H]1C(=C2[C@@H](OC(C)=O)C(=O)[C@]3(C)[C@@H](O)C[C@H]4OC[C@]4([C@H]3[C@H](OC(=O)C=3C=CC=CC=3)[C@](C2(C)C)(O)C1)OC(C)=O)C)C=1C=CC=CC=1)C(=O)C1=CC=CC=C1 LRCZQSDQZJBHAF-PUBGEWHCSA-N 0.000 description 1
- WVYXNIXAMZOZFK-UHFFFAOYSA-N diaziquone Chemical compound O=C1C(NC(=O)OCC)=C(N2CC2)C(=O)C(NC(=O)OCC)=C1N1CC1 WVYXNIXAMZOZFK-UHFFFAOYSA-N 0.000 description 1
- 229950002389 diaziquone Drugs 0.000 description 1
- NEFBYIFKOOEVPA-UHFFFAOYSA-K dicalcium phosphate Chemical compound [Ca+2].[Ca+2].[O-]P([O-])([O-])=O NEFBYIFKOOEVPA-UHFFFAOYSA-K 0.000 description 1
- 229940038472 dicalcium phosphate Drugs 0.000 description 1
- 229910000390 dicalcium phosphate Inorganic materials 0.000 description 1
- 230000004069 differentiation Effects 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- 150000002016 disaccharides Chemical class 0.000 description 1
- 125000002228 disulfide group Chemical group 0.000 description 1
- PMMYEEVYMWASQN-UHFFFAOYSA-N dl-hydroxyproline Natural products OC1C[NH2+]C(C([O-])=O)C1 PMMYEEVYMWASQN-UHFFFAOYSA-N 0.000 description 1
- ZWAOHEXOSAUJHY-ZIYNGMLESA-N doxifluridine Chemical compound O[C@@H]1[C@H](O)[C@@H](C)O[C@H]1N1C(=O)NC(=O)C(F)=C1 ZWAOHEXOSAUJHY-ZIYNGMLESA-N 0.000 description 1
- 229950005454 doxifluridine Drugs 0.000 description 1
- NOTIQUSPUUHHEH-UXOVVSIBSA-N dromostanolone propionate Chemical compound C([C@@H]1CC2)C(=O)[C@H](C)C[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H](OC(=O)CC)[C@@]2(C)CC1 NOTIQUSPUUHHEH-UXOVVSIBSA-N 0.000 description 1
- 239000006196 drop Substances 0.000 description 1
- 229950004683 drostanolone propionate Drugs 0.000 description 1
- 239000000890 drug combination Substances 0.000 description 1
- 238000012377 drug delivery Methods 0.000 description 1
- 238000002651 drug therapy Methods 0.000 description 1
- VLCYCQAOQCDTCN-UHFFFAOYSA-N eflornithine Chemical compound NCCCC(N)(C(F)F)C(O)=O VLCYCQAOQCDTCN-UHFFFAOYSA-N 0.000 description 1
- 229950000549 elliptinium acetate Drugs 0.000 description 1
- 230000013020 embryo development Effects 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 210000002889 endothelial cell Anatomy 0.000 description 1
- 229950011487 enocitabine Drugs 0.000 description 1
- 239000002702 enteric coating Substances 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 229940088598 enzyme Drugs 0.000 description 1
- 229960001904 epirubicin Drugs 0.000 description 1
- 210000002919 epithelial cell Anatomy 0.000 description 1
- 229950002973 epitiostanol Drugs 0.000 description 1
- 229940082789 erbitux Drugs 0.000 description 1
- AAKJLRGGTJKAMG-UHFFFAOYSA-N erlotinib Chemical compound C=12C=C(OCCOC)C(OCCOC)=CC2=NC=NC=1NC1=CC=CC(C#C)=C1 AAKJLRGGTJKAMG-UHFFFAOYSA-N 0.000 description 1
- 229950002017 esorubicin Drugs 0.000 description 1
- ITSGNOIFAJAQHJ-BMFNZSJVSA-N esorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)C[C@H](C)O1 ITSGNOIFAJAQHJ-BMFNZSJVSA-N 0.000 description 1
- 229960001842 estramustine Drugs 0.000 description 1
- FRPJXPJMRWBBIH-RBRWEJTLSA-N estramustine Chemical compound ClCCN(CCCl)C(=O)OC1=CC=C2[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CCC2=C1 FRPJXPJMRWBBIH-RBRWEJTLSA-N 0.000 description 1
- 239000000328 estrogen antagonist Substances 0.000 description 1
- QSRLNKCNOLVZIR-KRWDZBQOSA-N ethyl (2s)-2-[[2-[4-[bis(2-chloroethyl)amino]phenyl]acetyl]amino]-4-methylsulfanylbutanoate Chemical compound CCOC(=O)[C@H](CCSC)NC(=O)CC1=CC=C(N(CCCl)CCCl)C=C1 QSRLNKCNOLVZIR-KRWDZBQOSA-N 0.000 description 1
- 239000005038 ethylene vinyl acetate Substances 0.000 description 1
- 229960005237 etoglucid Drugs 0.000 description 1
- 229960005420 etoposide Drugs 0.000 description 1
- 238000001704 evaporation Methods 0.000 description 1
- 230000008020 evaporation Effects 0.000 description 1
- 210000002950 fibroblast Anatomy 0.000 description 1
- 239000012467 final product Substances 0.000 description 1
- 238000000684 flow cytometry Methods 0.000 description 1
- 229960000961 floxuridine Drugs 0.000 description 1
- ODKNJVUHOIMIIZ-RRKCRQDMSA-N floxuridine Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(F)=C1 ODKNJVUHOIMIIZ-RRKCRQDMSA-N 0.000 description 1
- 229960000390 fludarabine Drugs 0.000 description 1
- 229960005304 fludarabine phosphate Drugs 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- MKXKFYHWDHIYRV-UHFFFAOYSA-N flutamide Chemical compound CC(C)C(=O)NC1=CC=C([N+]([O-])=O)C(C(F)(F)F)=C1 MKXKFYHWDHIYRV-UHFFFAOYSA-N 0.000 description 1
- 229960002074 flutamide Drugs 0.000 description 1
- 229960000304 folic acid Drugs 0.000 description 1
- 235000019152 folic acid Nutrition 0.000 description 1
- 239000011724 folic acid Substances 0.000 description 1
- 150000002224 folic acids Chemical class 0.000 description 1
- 229960004783 fotemustine Drugs 0.000 description 1
- YAKWPXVTIGTRJH-UHFFFAOYSA-N fotemustine Chemical compound CCOP(=O)(OCC)C(C)NC(=O)N(CCCl)N=O YAKWPXVTIGTRJH-UHFFFAOYSA-N 0.000 description 1
- 230000002538 fungal effect Effects 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 229940044658 gallium nitrate Drugs 0.000 description 1
- 230000002496 gastric effect Effects 0.000 description 1
- XGALLCVXEZPNRQ-UHFFFAOYSA-N gefitinib Chemical compound C=12C=C(OCCCN3CCOCC3)C(OC)=CC2=NC=NC=1NC1=CC=C(F)C(Cl)=C1 XGALLCVXEZPNRQ-UHFFFAOYSA-N 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 238000012817 gel-diffusion technique Methods 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- 229930182470 glycoside Natural products 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- 229960002913 goserelin Drugs 0.000 description 1
- 239000008187 granular material Substances 0.000 description 1
- 229940093915 gynecological organic acid Drugs 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 201000005787 hematologic cancer Diseases 0.000 description 1
- 108010052188 hepatoma-derived growth factor Proteins 0.000 description 1
- 229940022353 herceptin Drugs 0.000 description 1
- UUVWYPNAQBNQJQ-UHFFFAOYSA-N hexamethylmelamine Chemical compound CN(C)C1=NC(N(C)C)=NC(N(C)C)=N1 UUVWYPNAQBNQJQ-UHFFFAOYSA-N 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- 239000008240 homogeneous mixture Substances 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- 230000008348 humoral response Effects 0.000 description 1
- 239000000017 hydrogel Substances 0.000 description 1
- 239000001257 hydrogen Substances 0.000 description 1
- 229910052739 hydrogen Inorganic materials 0.000 description 1
- 125000004435 hydrogen atom Chemical group [H]* 0.000 description 1
- 229920001477 hydrophilic polymer Polymers 0.000 description 1
- 229920001600 hydrophobic polymer Polymers 0.000 description 1
- 229960001330 hydroxycarbamide Drugs 0.000 description 1
- 229920003063 hydroxymethyl cellulose Polymers 0.000 description 1
- 229940031574 hydroxymethyl cellulose Drugs 0.000 description 1
- 229960002591 hydroxyproline Drugs 0.000 description 1
- 229940015872 ibandronate Drugs 0.000 description 1
- 229960000908 idarubicin Drugs 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 238000003119 immunoblot Methods 0.000 description 1
- 238000003365 immunocytochemistry Methods 0.000 description 1
- 230000000951 immunodiffusion Effects 0.000 description 1
- 238000010166 immunofluorescence Methods 0.000 description 1
- 230000001024 immunotherapeutic effect Effects 0.000 description 1
- 238000009169 immunotherapy Methods 0.000 description 1
- 230000002637 immunotoxin Effects 0.000 description 1
- 239000002596 immunotoxin Substances 0.000 description 1
- 229940051026 immunotoxin Drugs 0.000 description 1
- 231100000608 immunotoxin Toxicity 0.000 description 1
- DBIGHPPNXATHOF-UHFFFAOYSA-N improsulfan Chemical compound CS(=O)(=O)OCCCNCCCOS(C)(=O)=O DBIGHPPNXATHOF-UHFFFAOYSA-N 0.000 description 1
- 229950008097 improsulfan Drugs 0.000 description 1
- 230000001976 improved effect Effects 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 206010022000 influenza Diseases 0.000 description 1
- 239000004615 ingredient Substances 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 229940047122 interleukins Drugs 0.000 description 1
- 238000001361 intraarterial administration Methods 0.000 description 1
- 238000007917 intracranial administration Methods 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 239000007928 intraperitoneal injection Substances 0.000 description 1
- 238000007919 intrasynovial administration Methods 0.000 description 1
- 238000007913 intrathecal administration Methods 0.000 description 1
- 230000002601 intratumoral effect Effects 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 238000007914 intraventricular administration Methods 0.000 description 1
- 238000005342 ion exchange Methods 0.000 description 1
- 229960004768 irinotecan Drugs 0.000 description 1
- UWKQSNNFCGGAFS-XIFFEERXSA-N irinotecan Chemical compound C1=C2C(CC)=C3CN(C(C4=C([C@@](C(=O)OC4)(O)CC)C=4)=O)C=4C3=NC2=CC=C1OC(=O)N(CC1)CCC1N1CCCCC1 UWKQSNNFCGGAFS-XIFFEERXSA-N 0.000 description 1
- 229940043355 kinase inhibitor Drugs 0.000 description 1
- 238000002372 labelling Methods 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 229940115286 lentinan Drugs 0.000 description 1
- 210000004901 leucine-rich repeat Anatomy 0.000 description 1
- 208000032839 leukemia Diseases 0.000 description 1
- RGLRXNKKBLIBQS-XNHQSDQCSA-N leuprolide acetate Chemical compound CC(O)=O.CCNC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H]1NC(=O)CC1)CC1=CC=C(O)C=C1 RGLRXNKKBLIBQS-XNHQSDQCSA-N 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 230000029226 lipidation Effects 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 230000004807 localization Effects 0.000 description 1
- 229960002247 lomustine Drugs 0.000 description 1
- 229960003538 lonidamine Drugs 0.000 description 1
- WDRYRZXSPDWGEB-UHFFFAOYSA-N lonidamine Chemical compound C12=CC=CC=C2C(C(=O)O)=NN1CC1=CC=C(Cl)C=C1Cl WDRYRZXSPDWGEB-UHFFFAOYSA-N 0.000 description 1
- 239000006210 lotion Substances 0.000 description 1
- 238000003468 luciferase reporter gene assay Methods 0.000 description 1
- 229940087857 lupron Drugs 0.000 description 1
- 239000008176 lyophilized powder Substances 0.000 description 1
- RLSSMJSEOOYNOY-UHFFFAOYSA-N m-cresol Chemical compound CC1=CC=CC(O)=C1 RLSSMJSEOOYNOY-UHFFFAOYSA-N 0.000 description 1
- 229940124302 mTOR inhibitor Drugs 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 230000003211 malignant effect Effects 0.000 description 1
- 239000003628 mammalian target of rapamycin inhibitor Substances 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- MQXVYODZCMMZEM-ZYUZMQFOSA-N mannomustine Chemical compound ClCCNC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CNCCCl MQXVYODZCMMZEM-ZYUZMQFOSA-N 0.000 description 1
- 229950008612 mannomustine Drugs 0.000 description 1
- 238000013507 mapping Methods 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 238000004949 mass spectrometry Methods 0.000 description 1
- 210000003519 mature b lymphocyte Anatomy 0.000 description 1
- 229960004961 mechlorethamine Drugs 0.000 description 1
- HAWPXGHAZFHHAD-UHFFFAOYSA-N mechlorethamine Chemical compound ClCCN(C)CCCl HAWPXGHAZFHHAD-UHFFFAOYSA-N 0.000 description 1
- 230000001404 mediated effect Effects 0.000 description 1
- 229960001924 melphalan Drugs 0.000 description 1
- SGDBTWWWUNNDEQ-LBPRGKRZSA-N melphalan Chemical compound OC(=O)[C@@H](N)CC1=CC=C(N(CCCl)CCCl)C=C1 SGDBTWWWUNNDEQ-LBPRGKRZSA-N 0.000 description 1
- 229950009246 mepitiostane Drugs 0.000 description 1
- 108020004999 messenger RNA Proteins 0.000 description 1
- 239000002207 metabolite Substances 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Chemical class 0.000 description 1
- 230000001394 metastastic effect Effects 0.000 description 1
- 206010061289 metastatic neoplasm Diseases 0.000 description 1
- 125000001360 methionine group Chemical group N[C@@H](CCSC)C(=O)* 0.000 description 1
- BKBBTCORRZMASO-ZOWNYOTGSA-M methotrexate monosodium Chemical compound [Na+].C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C([O-])=O)C=C1 BKBBTCORRZMASO-ZOWNYOTGSA-M 0.000 description 1
- 229960003058 methotrexate sodium Drugs 0.000 description 1
- VJRAUFKOOPNFIQ-TVEKBUMESA-N methyl (1r,2r,4s)-4-[(2r,4s,5s,6s)-5-[(2s,4s,5s,6s)-5-[(2s,4s,5s,6s)-4,5-dihydroxy-6-methyloxan-2-yl]oxy-4-hydroxy-6-methyloxan-2-yl]oxy-4-(dimethylamino)-6-methyloxan-2-yl]oxy-2-ethyl-2,5,7,10-tetrahydroxy-6,11-dioxo-3,4-dihydro-1h-tetracene-1-carboxylat Chemical compound O([C@H]1[C@@H](O)C[C@@H](O[C@H]1C)O[C@H]1[C@H](C[C@@H](O[C@H]1C)O[C@H]1C[C@]([C@@H](C2=CC=3C(=O)C4=C(O)C=CC(O)=C4C(=O)C=3C(O)=C21)C(=O)OC)(O)CC)N(C)C)[C@H]1C[C@H](O)[C@H](O)[C@H](C)O1 VJRAUFKOOPNFIQ-TVEKBUMESA-N 0.000 description 1
- DFTAZNAEBRBBKP-UHFFFAOYSA-N methyl 4-sulfanylbutanimidate Chemical compound COC(=N)CCCS DFTAZNAEBRBBKP-UHFFFAOYSA-N 0.000 description 1
- 235000010270 methyl p-hydroxybenzoate Nutrition 0.000 description 1
- 239000004292 methyl p-hydroxybenzoate Substances 0.000 description 1
- 229960002216 methylparaben Drugs 0.000 description 1
- LSDPWZHWYPCBBB-UHFFFAOYSA-O methylsulfide anion Chemical compound [SH2+]C LSDPWZHWYPCBBB-UHFFFAOYSA-O 0.000 description 1
- HPNSFSBZBAHARI-UHFFFAOYSA-N micophenolic acid Natural products OC1=C(CC=C(C)CCC(O)=O)C(OC)=C(C)C2=C1C(=O)OC2 HPNSFSBZBAHARI-UHFFFAOYSA-N 0.000 description 1
- 239000004530 micro-emulsion Substances 0.000 description 1
- 230000000813 microbial effect Effects 0.000 description 1
- 229960005485 mitobronitol Drugs 0.000 description 1
- 239000003226 mitogen Substances 0.000 description 1
- 229960003539 mitoguazone Drugs 0.000 description 1
- MXWHMTNPTTVWDM-NXOFHUPFSA-N mitoguazone Chemical compound NC(N)=N\N=C(/C)\C=N\N=C(N)N MXWHMTNPTTVWDM-NXOFHUPFSA-N 0.000 description 1
- VFKZTMPDYBFSTM-GUCUJZIJSA-N mitolactol Chemical compound BrC[C@H](O)[C@@H](O)[C@@H](O)[C@H](O)CBr VFKZTMPDYBFSTM-GUCUJZIJSA-N 0.000 description 1
- 229950010913 mitolactol Drugs 0.000 description 1
- 229960004857 mitomycin Drugs 0.000 description 1
- 229960000350 mitotane Drugs 0.000 description 1
- 230000000394 mitotic effect Effects 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 108091005601 modified peptides Proteins 0.000 description 1
- ZDZOTLJHXYCWBA-BSEPLHNVSA-N molport-006-823-826 Chemical compound O([C@H]1[C@H]2[C@@](C([C@H](O)C3=C(C)[C@@H](OC(=O)[C@H](O)[C@@H](NC(=O)OC(C)(C)C)C=4C=CC=CC=4)C[C@@]1(O)C3(C)C)=O)(C)[C@@H](O)C[C@H]1OC[C@]12OC(=O)C)C(=O)C1=CC=CC=C1 ZDZOTLJHXYCWBA-BSEPLHNVSA-N 0.000 description 1
- 150000002772 monosaccharides Chemical class 0.000 description 1
- FOYWNSCCNCUEPU-UHFFFAOYSA-N mopidamol Chemical compound C12=NC(N(CCO)CCO)=NC=C2N=C(N(CCO)CCO)N=C1N1CCCCC1 FOYWNSCCNCUEPU-UHFFFAOYSA-N 0.000 description 1
- 229950010718 mopidamol Drugs 0.000 description 1
- 238000010172 mouse model Methods 0.000 description 1
- 229940126619 mouse monoclonal antibody Drugs 0.000 description 1
- 238000002703 mutagenesis Methods 0.000 description 1
- 231100000350 mutagenesis Toxicity 0.000 description 1
- 229960000951 mycophenolic acid Drugs 0.000 description 1
- HPNSFSBZBAHARI-RUDMXATFSA-N mycophenolic acid Chemical compound OC1=C(C\C=C(/C)CCC(O)=O)C(OC)=C(C)C2=C1C(=O)OC2 HPNSFSBZBAHARI-RUDMXATFSA-N 0.000 description 1
- 210000004985 myeloid-derived suppressor cell Anatomy 0.000 description 1
- NJSMWLQOCQIOPE-OCHFTUDZSA-N n-[(e)-[10-[(e)-(4,5-dihydro-1h-imidazol-2-ylhydrazinylidene)methyl]anthracen-9-yl]methylideneamino]-4,5-dihydro-1h-imidazol-2-amine Chemical compound N1CCN=C1N\N=C\C(C1=CC=CC=C11)=C(C=CC=C2)C2=C1\C=N\NC1=NCCN1 NJSMWLQOCQIOPE-OCHFTUDZSA-N 0.000 description 1
- LBWFXVZLPYTWQI-IPOVEDGCSA-N n-[2-(diethylamino)ethyl]-5-[(z)-(5-fluoro-2-oxo-1h-indol-3-ylidene)methyl]-2,4-dimethyl-1h-pyrrole-3-carboxamide;(2s)-2-hydroxybutanedioic acid Chemical compound OC(=O)[C@@H](O)CC(O)=O.CCN(CC)CCNC(=O)C1=C(C)NC(\C=C/2C3=CC(F)=CC=C3NC\2=O)=C1C LBWFXVZLPYTWQI-IPOVEDGCSA-N 0.000 description 1
- 239000002088 nanocapsule Substances 0.000 description 1
- 239000002105 nanoparticle Substances 0.000 description 1
- 239000006199 nebulizer Substances 0.000 description 1
- 230000010807 negative regulation of binding Effects 0.000 description 1
- QZGIWPZCWHMVQL-UIYAJPBUSA-N neocarzinostatin chromophore Chemical compound O1[C@H](C)[C@H](O)[C@H](O)[C@@H](NC)[C@H]1O[C@@H]1C/2=C/C#C[C@H]3O[C@@]3([C@@H]3OC(=O)OC3)C#CC\2=C[C@H]1OC(=O)C1=C(O)C=CC2=C(C)C=C(OC)C=C12 QZGIWPZCWHMVQL-UIYAJPBUSA-N 0.000 description 1
- XWXYUMMDTVBTOU-UHFFFAOYSA-N nilutamide Chemical compound O=C1C(C)(C)NC(=O)N1C1=CC=C([N+]([O-])=O)C(C(F)(F)F)=C1 XWXYUMMDTVBTOU-UHFFFAOYSA-N 0.000 description 1
- 229960002653 nilutamide Drugs 0.000 description 1
- 229950010203 nimotuzumab Drugs 0.000 description 1
- 229960001420 nimustine Drugs 0.000 description 1
- VFEDRRNHLBGPNN-UHFFFAOYSA-N nimustine Chemical compound CC1=NC=C(CNC(=O)N(CCCl)N=O)C(N)=N1 VFEDRRNHLBGPNN-UHFFFAOYSA-N 0.000 description 1
- YMVWGSQGCWCDGW-UHFFFAOYSA-N nitracrine Chemical compound C1=CC([N+]([O-])=O)=C2C(NCCCN(C)C)=C(C=CC=C3)C3=NC2=C1 YMVWGSQGCWCDGW-UHFFFAOYSA-N 0.000 description 1
- 229950008607 nitracrine Drugs 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- 229950009266 nogalamycin Drugs 0.000 description 1
- KGTDRFCXGRULNK-JYOBTZKQSA-N nogalamycin Chemical compound CO[C@@H]1[C@@](OC)(C)[C@@H](OC)[C@H](C)O[C@H]1O[C@@H]1C2=C(O)C(C(=O)C3=C(O)C=C4[C@@]5(C)O[C@H]([C@H]([C@@H]([C@H]5O)N(C)C)O)OC4=C3C3=O)=C3C=C2[C@@H](C(=O)OC)[C@@](C)(O)C1 KGTDRFCXGRULNK-JYOBTZKQSA-N 0.000 description 1
- 239000012457 nonaqueous media Substances 0.000 description 1
- 230000036963 noncompetitive effect Effects 0.000 description 1
- 239000002736 nonionic surfactant Substances 0.000 description 1
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical compound CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 1
- OQCDKBAXFALNLD-UHFFFAOYSA-N octadecanoic acid Natural products CCCCCCCC(C)CCCCCCCCC(O)=O OQCDKBAXFALNLD-UHFFFAOYSA-N 0.000 description 1
- 239000002674 ointment Substances 0.000 description 1
- CZDBNBLGZNWKMC-MWQNXGTOSA-N olivomycin Chemical class O([C@@H]1C[C@@H](O[C@H](C)[C@@H]1O)OC=1C=C2C=C3C[C@H]([C@@H](C(=O)C3=C(O)C2=C(O)C=1)O[C@H]1O[C@@H](C)[C@H](O)[C@@H](OC2O[C@@H](C)[C@H](O)[C@@H](O)C2)C1)[C@H](OC)C(=O)[C@@H](O)[C@@H](C)O)[C@H]1C[C@H](O)[C@H](OC)[C@H](C)O1 CZDBNBLGZNWKMC-MWQNXGTOSA-N 0.000 description 1
- 229950011093 onapristone Drugs 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 230000008520 organization Effects 0.000 description 1
- LXCFILQKKLGQFO-UHFFFAOYSA-N p-hydroxybenzoic acid methyl ester Natural products COC(=O)C1=CC=C(O)C=C1 LXCFILQKKLGQFO-UHFFFAOYSA-N 0.000 description 1
- 229940055729 papain Drugs 0.000 description 1
- 235000019834 papain Nutrition 0.000 description 1
- 229960005079 pemetrexed Drugs 0.000 description 1
- QOFFJEBXNKRSPX-ZDUSSCGKSA-N pemetrexed Chemical compound C1=N[C]2NC(N)=NC(=O)C2=C1CCC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 QOFFJEBXNKRSPX-ZDUSSCGKSA-N 0.000 description 1
- QIMGFXOHTOXMQP-GFAGFCTOSA-N peplomycin Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCCN[C@@H](C)C=1C=CC=CC=1)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1NC=NC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C QIMGFXOHTOXMQP-GFAGFCTOSA-N 0.000 description 1
- 229950003180 peplomycin Drugs 0.000 description 1
- 229940111202 pepsin Drugs 0.000 description 1
- 238000010647 peptide synthesis reaction Methods 0.000 description 1
- 229960002087 pertuzumab Drugs 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- WTJKGGKOPKCXLL-RRHRGVEJSA-N phosphatidylcholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCCC=CCCCCCCCC WTJKGGKOPKCXLL-RRHRGVEJSA-N 0.000 description 1
- 150000008104 phosphatidylethanolamines Chemical class 0.000 description 1
- BZQFBWGGLXLEPQ-REOHCLBHSA-N phosphoserine Chemical compound OC(=O)[C@@H](N)COP(O)(O)=O BZQFBWGGLXLEPQ-REOHCLBHSA-N 0.000 description 1
- 102000020233 phosphotransferase Human genes 0.000 description 1
- 230000004962 physiological condition Effects 0.000 description 1
- 229960000952 pipobroman Drugs 0.000 description 1
- NJBFOOCLYDNZJN-UHFFFAOYSA-N pipobroman Chemical compound BrCCC(=O)N1CCN(C(=O)CCBr)CC1 NJBFOOCLYDNZJN-UHFFFAOYSA-N 0.000 description 1
- NUKCGLDCWQXYOQ-UHFFFAOYSA-N piposulfan Chemical compound CS(=O)(=O)OCCC(=O)N1CCN(C(=O)CCOS(C)(=O)=O)CC1 NUKCGLDCWQXYOQ-UHFFFAOYSA-N 0.000 description 1
- 229950001100 piposulfan Drugs 0.000 description 1
- 229960001221 pirarubicin Drugs 0.000 description 1
- 229910052697 platinum Inorganic materials 0.000 description 1
- 150000003057 platinum Chemical class 0.000 description 1
- 229920001200 poly(ethylene-vinyl acetate) Polymers 0.000 description 1
- 229920000747 poly(lactic acid) Polymers 0.000 description 1
- 230000008488 polyadenylation Effects 0.000 description 1
- 229920000728 polyester Polymers 0.000 description 1
- 229920002338 polyhydroxyethylmethacrylate Polymers 0.000 description 1
- 229950008882 polysorbate Drugs 0.000 description 1
- 229920002451 polyvinyl alcohol Polymers 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- 239000011148 porous material Substances 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 229960004694 prednimustine Drugs 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- CPTBDICYNRMXFX-UHFFFAOYSA-N procarbazine Chemical compound CNNCC1=CC=C(C(=O)NC(C)C)C=C1 CPTBDICYNRMXFX-UHFFFAOYSA-N 0.000 description 1
- 229960000624 procarbazine Drugs 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 230000000644 propagated effect Effects 0.000 description 1
- 230000000069 prophylactic effect Effects 0.000 description 1
- 235000010232 propyl p-hydroxybenzoate Nutrition 0.000 description 1
- 239000004405 propyl p-hydroxybenzoate Substances 0.000 description 1
- 229960003415 propylparaben Drugs 0.000 description 1
- 238000000159 protein binding assay Methods 0.000 description 1
- 239000003909 protein kinase inhibitor Substances 0.000 description 1
- 238000001742 protein purification Methods 0.000 description 1
- 238000001243 protein synthesis Methods 0.000 description 1
- 230000017854 proteolysis Effects 0.000 description 1
- 230000002797 proteolythic effect Effects 0.000 description 1
- WOLQREOUPKZMEX-UHFFFAOYSA-N pteroyltriglutamic acid Chemical compound C=1N=C2NC(N)=NC(=O)C2=NC=1CNC1=CC=C(C(=O)NC(CCC(=O)NC(CCC(=O)NC(CCC(O)=O)C(O)=O)C(O)=O)C(O)=O)C=C1 WOLQREOUPKZMEX-UHFFFAOYSA-N 0.000 description 1
- 230000002685 pulmonary effect Effects 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 150000003212 purines Chemical class 0.000 description 1
- 229950010131 puromycin Drugs 0.000 description 1
- 150000003230 pyrimidines Chemical class 0.000 description 1
- 229960002633 ramucirumab Drugs 0.000 description 1
- 238000002708 random mutagenesis Methods 0.000 description 1
- 229960002185 ranimustine Drugs 0.000 description 1
- BMKDZUISNHGIBY-UHFFFAOYSA-N razoxane Chemical compound C1C(=O)NC(=O)CN1C(C)CN1CC(=O)NC(=O)C1 BMKDZUISNHGIBY-UHFFFAOYSA-N 0.000 description 1
- 229960000460 razoxane Drugs 0.000 description 1
- 208000016691 refractory malignant neoplasm Diseases 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 230000004043 responsiveness Effects 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 230000000717 retained effect Effects 0.000 description 1
- 229930002330 retinoic acid Natural products 0.000 description 1
- 238000003757 reverse transcription PCR Methods 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- 239000002336 ribonucleotide Substances 0.000 description 1
- 125000002652 ribonucleotide group Chemical group 0.000 description 1
- 229950004892 rodorubicin Drugs 0.000 description 1
- VHXNKPBCCMUMSW-FQEVSTJZSA-N rubitecan Chemical compound C1=CC([N+]([O-])=O)=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 VHXNKPBCCMUMSW-FQEVSTJZSA-N 0.000 description 1
- 238000007423 screening assay Methods 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 239000004208 shellac Substances 0.000 description 1
- 229940113147 shellac Drugs 0.000 description 1
- ZLGIYFNHBLSMPS-ATJNOEHPSA-N shellac Chemical compound OCCCCCC(O)C(O)CCCCCCCC(O)=O.C1C23[C@H](C(O)=O)CCC2[C@](C)(CO)[C@@H]1C(C(O)=O)=C[C@@H]3O ZLGIYFNHBLSMPS-ATJNOEHPSA-N 0.000 description 1
- 235000013874 shellac Nutrition 0.000 description 1
- 238000004513 sizing Methods 0.000 description 1
- 230000022379 skeletal muscle tissue development Effects 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- 239000008247 solid mixture Substances 0.000 description 1
- 239000000243 solution Substances 0.000 description 1
- 229950006315 spirogermanium Drugs 0.000 description 1
- 239000007921 spray Substances 0.000 description 1
- SFVFIFLLYFPGHH-UHFFFAOYSA-M stearalkonium chloride Chemical compound [Cl-].CCCCCCCCCCCCCCCCCC[N+](C)(C)CC1=CC=CC=C1 SFVFIFLLYFPGHH-UHFFFAOYSA-M 0.000 description 1
- 239000008117 stearic acid Substances 0.000 description 1
- 210000002784 stomach Anatomy 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 229960001052 streptozocin Drugs 0.000 description 1
- ZSJLQEPLLKMAKR-GKHCUFPYSA-N streptozocin Chemical compound O=NN(C)C(=O)N[C@H]1[C@@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O ZSJLQEPLLKMAKR-GKHCUFPYSA-N 0.000 description 1
- 239000007929 subcutaneous injection Substances 0.000 description 1
- 239000001797 sucrose acetate isobutyrate Substances 0.000 description 1
- 235000010983 sucrose acetate isobutyrate Nutrition 0.000 description 1
- UVGUPMLLGBCFEJ-SWTLDUCYSA-N sucrose acetate isobutyrate Chemical compound CC(C)C(=O)O[C@H]1[C@H](OC(=O)C(C)C)[C@@H](COC(=O)C(C)C)O[C@@]1(COC(C)=O)O[C@@H]1[C@H](OC(=O)C(C)C)[C@@H](OC(=O)C(C)C)[C@H](OC(=O)C(C)C)[C@@H](COC(C)=O)O1 UVGUPMLLGBCFEJ-SWTLDUCYSA-N 0.000 description 1
- 235000000346 sugar Nutrition 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 229960001796 sunitinib Drugs 0.000 description 1
- WINHZLLDWRZWRT-ATVHPVEESA-N sunitinib Chemical compound CCN(CC)CCNC(=O)C1=C(C)NC(\C=C/2C3=CC(F)=CC=C3NC\2=O)=C1C WINHZLLDWRZWRT-ATVHPVEESA-N 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 238000001356 surgical procedure Methods 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 238000013268 sustained release Methods 0.000 description 1
- 239000012730 sustained-release form Substances 0.000 description 1
- 229940034785 sutent Drugs 0.000 description 1
- 230000002194 synthesizing effect Effects 0.000 description 1
- 230000009885 systemic effect Effects 0.000 description 1
- 239000000454 talc Substances 0.000 description 1
- 229910052623 talc Inorganic materials 0.000 description 1
- 235000012222 talc Nutrition 0.000 description 1
- 229960001603 tamoxifen Drugs 0.000 description 1
- 238000002626 targeted therapy Methods 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- DKPFODGZWDEEBT-QFIAKTPHSA-N taxane Chemical class C([C@]1(C)CCC[C@@H](C)[C@H]1C1)C[C@H]2[C@H](C)CC[C@@H]1C2(C)C DKPFODGZWDEEBT-QFIAKTPHSA-N 0.000 description 1
- 229960001674 tegafur Drugs 0.000 description 1
- WFWLQNSHRPWKFK-ZCFIWIBFSA-N tegafur Chemical compound O=C1NC(=O)C(F)=CN1[C@@H]1OCCC1 WFWLQNSHRPWKFK-ZCFIWIBFSA-N 0.000 description 1
- 229960005353 testolactone Drugs 0.000 description 1
- BPEWUONYVDABNZ-DZBHQSCQSA-N testolactone Chemical compound O=C1C=C[C@]2(C)[C@H]3CC[C@](C)(OC(=O)CC4)[C@@H]4[C@@H]3CCC2=C1 BPEWUONYVDABNZ-DZBHQSCQSA-N 0.000 description 1
- ZRKFYGHZFMAOKI-QMGMOQQFSA-N tgfbeta Chemical compound C([C@H](NC(=O)[C@H](C(C)C)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCSC)C(C)C)[C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O)C1=CC=C(O)C=C1 ZRKFYGHZFMAOKI-QMGMOQQFSA-N 0.000 description 1
- YFTWHEBLORWGNI-UHFFFAOYSA-N tiamiprine Chemical compound CN1C=NC([N+]([O-])=O)=C1SC1=NC(N)=NC2=C1NC=N2 YFTWHEBLORWGNI-UHFFFAOYSA-N 0.000 description 1
- 229950011457 tiamiprine Drugs 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 229960000303 topotecan Drugs 0.000 description 1
- UCFGDBYHRUNTLO-QHCPKHFHSA-N topotecan Chemical compound C1=C(O)C(CN(C)C)=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 UCFGDBYHRUNTLO-QHCPKHFHSA-N 0.000 description 1
- 229960005026 toremifene Drugs 0.000 description 1
- XFCLJVABOIYOMF-QPLCGJKRSA-N toremifene Chemical compound C1=CC(OCCN(C)C)=CC=C1C(\C=1C=CC=CC=1)=C(\CCCl)C1=CC=CC=C1 XFCLJVABOIYOMF-QPLCGJKRSA-N 0.000 description 1
- 239000003053 toxin Substances 0.000 description 1
- 231100000765 toxin Toxicity 0.000 description 1
- 108700012359 toxins Proteins 0.000 description 1
- FGMPLJWBKKVCDB-UHFFFAOYSA-N trans-L-hydroxy-proline Natural products ON1CCCC1C(O)=O FGMPLJWBKKVCDB-UHFFFAOYSA-N 0.000 description 1
- 230000005026 transcription initiation Effects 0.000 description 1
- 230000009261 transgenic effect Effects 0.000 description 1
- 238000011830 transgenic mouse model Methods 0.000 description 1
- 230000014621 translational initiation Effects 0.000 description 1
- 238000002054 transplantation Methods 0.000 description 1
- 229960000575 trastuzumab Drugs 0.000 description 1
- 229950001353 tretamine Drugs 0.000 description 1
- IUCJMVBFZDHPDX-UHFFFAOYSA-N tretamine Chemical compound C1CN1C1=NC(N2CC2)=NC(N2CC2)=N1 IUCJMVBFZDHPDX-UHFFFAOYSA-N 0.000 description 1
- 229960001727 tretinoin Drugs 0.000 description 1
- 229960004560 triaziquone Drugs 0.000 description 1
- PXSOHRWMIRDKMP-UHFFFAOYSA-N triaziquone Chemical compound O=C1C(N2CC2)=C(N2CC2)C(=O)C=C1N1CC1 PXSOHRWMIRDKMP-UHFFFAOYSA-N 0.000 description 1
- 229960001670 trilostane Drugs 0.000 description 1
- KVJXBPDAXMEYOA-CXANFOAXSA-N trilostane Chemical compound OC1=C(C#N)C[C@]2(C)[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CC[C@@]32O[C@@H]31 KVJXBPDAXMEYOA-CXANFOAXSA-N 0.000 description 1
- NOYPYLRCIDNJJB-UHFFFAOYSA-N trimetrexate Chemical compound COC1=C(OC)C(OC)=CC(NCC=2C(=C3C(N)=NC(N)=NC3=CC=2)C)=C1 NOYPYLRCIDNJJB-UHFFFAOYSA-N 0.000 description 1
- 229960001099 trimetrexate Drugs 0.000 description 1
- 229950000212 trioxifene Drugs 0.000 description 1
- 229960000875 trofosfamide Drugs 0.000 description 1
- UMKFEPPTGMDVMI-UHFFFAOYSA-N trofosfamide Chemical compound ClCCN(CCCl)P1(=O)OCCCN1CCCl UMKFEPPTGMDVMI-UHFFFAOYSA-N 0.000 description 1
- HDZZVAMISRMYHH-LITAXDCLSA-N tubercidin Chemical compound C1=CC=2C(N)=NC=NC=2N1[C@@H]1O[C@@H](CO)[C@H](O)[C@H]1O HDZZVAMISRMYHH-LITAXDCLSA-N 0.000 description 1
- 210000005102 tumor initiating cell Anatomy 0.000 description 1
- 229950009811 ubenimex Drugs 0.000 description 1
- 238000011144 upstream manufacturing Methods 0.000 description 1
- 229960001055 uracil mustard Drugs 0.000 description 1
- UHTHHESEBZOYNR-UHFFFAOYSA-N vandetanib Chemical compound COC1=CC(C(/N=CN2)=N/C=3C(=CC(Br)=CC=3)F)=C2C=C1OCC1CCN(C)CC1 UHTHHESEBZOYNR-UHFFFAOYSA-N 0.000 description 1
- 230000008189 vertebrate development Effects 0.000 description 1
- 229960004528 vincristine Drugs 0.000 description 1
- OGWKCGZFUXNPDA-XQKSVPLYSA-N vincristine Chemical compound C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-XQKSVPLYSA-N 0.000 description 1
- OGWKCGZFUXNPDA-UHFFFAOYSA-N vincristine Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(OC(C)=O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-UHFFFAOYSA-N 0.000 description 1
- GBABOYUKABKIAF-GHYRFKGUSA-N vinorelbine Chemical compound C1N(CC=2C3=CC=CC=C3NC=22)CC(CC)=C[C@H]1C[C@]2(C(=O)OC)C1=CC([C@]23[C@H]([C@]([C@H](OC(C)=O)[C@]4(CC)C=CCN([C@H]34)CC2)(O)C(=O)OC)N2C)=C2C=C1OC GBABOYUKABKIAF-GHYRFKGUSA-N 0.000 description 1
- 229960002066 vinorelbine Drugs 0.000 description 1
- 239000013603 viral vector Substances 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
- 238000002424 x-ray crystallography Methods 0.000 description 1
- 229940053867 xeloda Drugs 0.000 description 1
- 229950008250 zalutumumab Drugs 0.000 description 1
- 229950009268 zinostatin Drugs 0.000 description 1
- 229960000641 zorubicin Drugs 0.000 description 1
- FBTUMDXHSRTGRV-ALTNURHMSA-N zorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(\C)=N\NC(=O)C=1C=CC=CC=1)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 FBTUMDXHSRTGRV-ALTNURHMSA-N 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/24—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2818—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2827—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against B7 molecules, e.g. CD80, CD86
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
- A61K2039/507—Comprising a combination of two or more separate antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
Definitions
- the present invention provides methods comprising combination therapy for modulating immune responses and treating cancer and other diseases.
- the present invention provides RSPO or LGR antagonists in combination with at least one additional immunotherapeutic agent for the treatment of cancer.
- the R-spondin (RSPO) family of proteins is conserved among vertebrates and comprises four members, RSPOl, RSP02, RSP03, and RSP04. These proteins have been referred to by a variety of names, including roof plate-specific spondins, hPWTSR (hRSP03), THS2D (RSP03), Cristin 1-4, and Futrin 1-4.
- the RSPOs are small secreted proteins that overall share approximately 40-60% sequence homology and domain organization.
- All RSPO proteins contain two furin-like cysteine-rich domains at the N-terminus followed by a thrombospondin domain and a basic charged C-terminal tail (Kim et al, 2006, Cell Cycle, 5:23-26).
- RSPO proteins have a role during vertebrate development (Kamata et al., 2004, Biochim. Biophys Acta, 1676:51-62) and inXenopus myogenesis (Kazanskaya et al., 2004, Dev. Cell, 7:525-534).
- RSPO 1 has also been shown to function as a potent mitogen for
- gastrointestinal epithelial cells (Kim et al., 2005, Science, 309: 1256-1259). It has been reported that RSP03 is prominently expressed in or close by endothelial cells and their cellular precursors in Xenopus and mouse. Furthermore, it has been suggested that RSP03 may act as an angiogenic factor in embryogenesis (Kazanskaya et al., 2008, Development, 135:3655-3664). RSPO proteins are known to activate ⁇ -catenin signaling similar to Wnt signaling, however the relationship between RSPO proteins and Wnt signaling is still being investigated.
- RSPO proteins possess a positive modulatory activity on Wnt ligands (Nam et al., 2006, JBC 281 : 13247-57). This study also reported that RSPO proteins could function as Frizzled8 and LRP6 receptor ligands and induce ⁇ - catenin signaling (Nam et al., 2006, JBC 281 : 13247-57). Recent studies have identified an interaction between RSPO proteins and LGR (leucine-rich repeat containing, G protein-coupler receptor) proteins, such as LGR5 (U.S. Patent Publication Nos. 2009/0074782 and 2009/0191205), and these data present an alternative pathway for the activation of ⁇ -catenin signaling.
- LGR leucine-rich repeat containing, G protein-coupler receptor
- biomolecules e.g., anti-RSP03 antibodies
- ⁇ -catenin signaling are a potential source of new therapeutic agents for cancer, as well as other ⁇ -catenin- associated diseases.
- the present invention provides methods for treating diseases such as cancer, where the methods include administering to a subject an RPSO or LGR antagonist, such as an anti-RSPO antibody or anti-LGR antibody, or a soluble LGR receptor, in combination with an RPSO or LGR antagonist, such as an anti-RSPO antibody or anti-LGR antibody, or a soluble LGR receptor, in combination with an RPSO or LGR antagonist, such as an anti-RSPO antibody or anti-LGR antibody, or a soluble LGR receptor, in combination with an RPSO or LGR antagonist, such as an anti-RSPO antibody or anti-LGR antibody, or a soluble LGR receptor, in combination with an RPSO or LGR antagonist, such as an anti-RSPO antibody or anti-LGR antibody, or a soluble LGR receptor, in combination with an RPSO or LGR antagonist, such as an anti-RSPO antibody or anti-LGR antibody, or a soluble LGR receptor, in combination with an RPSO or LGR antagonist, such as an anti-RSPO
- Combination therapy can employ at least two different agents that work by different mechanisms of action and/or target different pathways. The combination may result in additive or synergetic effects. Combination therapy may allow for a lower dose of each agent than used in monotherapy, thereby reducing toxic side effects and/or increasing the therapeutic index of the agent(s). Combination therapy may decrease the likelihood that resistance to an agent will develop. Combination therapy may allow one agent to sensitize tumor cells (including cancer stem cells) to enhanced activity by a second agent. Combination therapy comprising an immunotherapeutic agent may allow one agent to enhance the immune response to a tumor or tumor cells while the second agent may be effective at killing tumor cells more directly. In addition, the order and/or timing of the administration of each therapeutic agent may affect the overall efficacy of a drug combination.
- the invention provides an RPSO or LGR antagonist, including but not limited to, antibodies and other polypeptides that bind to at least one RPSO or LGR protein, small molecules that bind at least one RSPO or LGR protein, and soluble LGR proteins.
- the RSPO protein e.g., human protein
- the LGR protein may be LGR5.
- the invention provides immunotherapeutic agents, including but not limited to, a modulator of PD-1 activity, a modulator of PD-L 1 activity, a modulator of PD-L2 activity, a modulator of CTLA-4 activity, a modulator of CD28 activity, a modulator of CD 80 activity, a modulator of CD 86 activity, a modulator of 4- IBB activity, an modulator of OX40 activity, a modulator of KIR activity, a modulator of Tim-3 activity, a modulator of LAG3 activity, a modulator of CD27 activity, a modulator of CD40 activity, a modulator of GITR activity, a modulator of TIGIT activity, a modulator of CD20 activity, a modulator of CD96 activity, a modulator of IDO 1 activity, a cytokine, a chemokine, an interferon, an interleukin, a lymphokine, a member of the tumor necrosis factor (TNF) family, and an immunostimul
- compositions comprising an RSPO or LGR antagonist (e.g., an anti-RSPO, anti-LGR antibody, or soluble LGR receptor) and/or at least one additional immunotherapeutic agent are provided.
- an RSPO or LGR antagonist e.g., an anti-RSPO, anti-LGR antibody, or soluble LGR receptor
- additional immunotherapeutic agent e.g., an anti-RSPO, anti-LGR antibody, or soluble LGR receptor
- the invention provides methods of inhibiting tumor growth.
- a method comprises contacting tumor cells with an effective amount of a RSPO or LGR antagonist (e.g., an anti-RSPO, anti-LGR antibody, or soluble LGR receptor) in combination with an effective amount of an immunotherapeutic agent.
- the method may be in vivo or in vitro.
- the tumor is in a subject, and contacting tumor cells with the RSPO or LGR antagonist and the immunotherapeutic agent comprises administering a therapeutically effective amount of each of the agents to the subject.
- a method of treating cancer comprises administering to a subject a therapeutically effective amount of a RSPO or LGR antagonist (e.g., an anti-RSPO, anti-LGR antibody, or soluble LGR receptor) in combination with a therapeutically effective amount of an immunotherapeutic agent.
- a RSPO or LGR antagonist e.g., an anti-RSPO, anti-LGR antibody, or soluble LGR receptor
- the invention provides a method of inhibiting the activity of regulatory T- cells (Tregs).
- a method of inhibiting the activity of Tregs comprises administering to a subject a therapeutically effective amount of a RSPO or LGR antagonist (e.g., an anti-RSPO, anti-LGR antibody, or soluble LGR receptor) in combination with a therapeutically effective amount of an immunotherapeutic agent.
- the inhibition of Treg activity comprises inhibiting the suppression of immune responses.
- the inhibition of Treg activity results in the inhibition of suppression of immune responses.
- the invention provides a method of increasing T cell infiltration into a tumor.
- a method of increasing T cell infiltration into a tumor comprises administering to a subject a therapeutically effective amount of a RSPO or LGR antagonist (e.g., an anti-RSPO, anti-LGR antibody, or soluble LGR receptor) in combination with a therapeutically effective amount of an immunotherapeutic agent.
- a RSPO or LGR antagonist e.g., an anti-RSPO, anti-LGR antibody, or soluble LGR receptor
- the invention provides a method of increasing T cell cytotoxicity to a tumor.
- a method of increasing T cell cytotoxicity to a tumor comprises administering to a subject a therapeutically effective amount of a RSPO or LGR antagonist (e.g., an anti-RSPO, anti-LGR antibody, or soluble LGR receptor) in combination with a therapeutically effective amount of an immunotherapeutic agent.
- a RSPO or LGR antagonist e.g., an anti-RSPO, anti-LGR antibody, or soluble LGR receptor
- the invention provides a method of increasing tumor cell lysis.
- a method of increasing tumor cell lysis comprises administering to a subject a therapeutically effective amount of a RSPO or LGR antagonist (e.g., an anti-RSPO, anti-LGR antibody, or soluble LGR receptor) in combination with a therapeutically effective amount of an immunotherapeutic agent.
- a RSPO or LGR antagonist e.g., an anti-RSPO, anti-LGR antibody, or soluble LGR receptor
- the invention provides a method to increase the efficacy of an immune checkpoint modulator.
- a method to increase the efficacy of an immune checkpoint modulator comprises administering to a subject a therapeutically effective amount of a RSPO or LGR antagonist (e.g., an anti-RSPO, anti-LGR antibody, or soluble LGR receptor) in combination with a therapeutically effective amount of an immune checkpoint modulator.
- a RSPO or LGR antagonist e.g., an anti-RSPO, anti-LGR antibody, or soluble LGR receptor
- the immune checkpoint modulator is an immune checkpoint inhibitor.
- the immune checkpoint modulator is an immune checkpoint enhancer or stimulator.
- the invention provides a method of reducing or preventing metastasis in a subject.
- a method of reducing or preventing metastasis in a subject comprises administering to the subject a therapeutically effective amount of a RSPO or LGR antagonist (e.g., an anti-RSPO, anti-LGR antibody, or soluble LGR receptor) and a therapeutically effective amount of an immunotherapeutic agent.
- a RSPO or LGR antagonist e.g., an anti-RSPO, anti-LGR antibody, or soluble LGR receptor
- the invention provides a method of enhancing treatment for a subject who is being treated with an immune checkpoint inhibitor, the method comprising administering to the subject a therapeutically effective amount of a RSPO or LGR antagonist (e.g., an anti-RSPO, anti- LGR antibody, or soluble LGR receptor).
- a RSPO or LGR antagonist e.g., an anti-RSPO, anti- LGR antibody, or soluble LGR receptor.
- the invention provides a method of enhancing or inducing an anti-tumor immune response in a subject, the method comprising administering to the subject a therapeutically effective amount of a RSPO or LGR antagonist (e.g., an anti-RSPO, anti-LGR antibody, or soluble LGR receptor).
- a RSPO or LGR antagonist e.g., an anti-RSPO, anti-LGR antibody, or soluble LGR receptor.
- the RSPO or LGR antagonist is an RSPO-binding agent. In some embodiments, the RSPO or LGR antagonist is an LGR-binding agent. In some embodiments, the RSPO or LGR antagonist is an antibody. In some embodiments, the RSPO or LGR antagonist is an anti-RSPO antibody. In some embodiments, the RSPO or LGR antagonist is an anti-LGR antibody. In some embodiments, the RSPO or LGR antagonist is the antibody OMP-131R10 (also referred to as OMP-131R010, 131R10, or 131R010). In some embodiments, the RSPO or LGR antagonist is a soluble receptor.
- the RSPO or LGR antagonist is an LGR-Fc soluble receptor. In some embodiments, the RSPO or LGR antagonist is an LGR5-Fc soluble receptor. In certain embodiments, the LGR5-Fc soluble receptor comprises amino acid sequence of SEQ ID NO:57.
- the RSPO or LGR antagonist is an antibody that specifically binds at least one RSPO protein or portion thereof.
- the antibody specifically binds at least one human RSPO protein selected from the group consisting of: RSPOl, RSP02, RSP03, and RSP04. In some embodiments, the antibody specifically binds at least one human RSP03.
- the antibody specifically binds at least human RSPOl .
- the antibody includes (a) a heavy chain CDR1 including TGYTMH (SEQ ID NO:5), a heavy chain CDR2 including GINPN GGTTYNQNFKG (SEQ ID NO:6), and a heavy chain CDR3 including KEFSDGYYFFAY (SEQ ID NO:7); and/or (b) a light chain CDR1 including KASQDVIFAVA (SEQ ID NO: 8), a light chain CDR2 including WASTRHT (SEQ ID NO:9), and a light chain CDR3 including QQHYSTPW (SEQ ID NO: 10).
- the antibody includes a heavy chain variable region including an amino acid sequence at least 80%, 85%, 90%, 90%, 95%, or 100% identical to SEQ ID NO: 11 or 44 (e.g., including one, two or three of the heavy chain CDRs mentioned above), and a light chain variable region including an amino acid sequence at least 80%, 85%, 90%, 90%, 95%, or 100% identical to SEQ ID NO: 12 or 45 (e.g., including one, two, or three of the light chain CDRs mentioned above).
- the antibody includes a heavy chain variable region including SEQ ID NO: 1 1 and a light chain variable region including SEQ ID NO: 12.
- the antibody specifically binds at least human RSP02.
- the antibody includes (a) a heavy chain CDR1 including SSYAMS (SEQ ID NO: 17), a heavy chain CDR2 including SISSGGSTYYPDSVKG (SEQ ID NO: 18), and a heavy chain CDR3 including RGGDPGVYNGDYEDAMDY (SEQ ID NO: 19); and (b) a light chain CDR1 including KASQDVSSAVA (SEQ ID NO:20), a light chain CDR2 including WASTRHT (SEQ ID NO:21), and a light chain CDR3 including QQHYSTP (SEQ ID NO:22).
- the antibody includes a heavy chain variable region including an amino acid sequence at least 80%, 85%, 90%, 90%, 95%, or 100% identical to SEQ ID NO:23 (e.g., including one, two, or three of the heavy chain CDRs mentioned above)and a light chain variable region including an amino acid sequence at least 80%, 85%, 90%, 90%, 95%, or 100% identical to SEQ ID NO:24 (e.g., including one, two, or three of the light CDRs mentioned above).
- the antibody specifically binds at least human RSP03.
- the antibody includes (a) a heavy chain CDR1 including DYSIH (SEQ ID NO:29), a heavy chain CDR2 including YIYPSNGDSGYNQKFK (SEQ ID NO:30), and a heavy chain CDR3 including TYFANNFD (SEQ ID NO:31) or ATYF ANNTD Y( SEQ ID NO:32); and (b) a light chain CDR1 including KASQSVDYDGDSYMN (SEQ ID NO:33), a light chain CDR2 including
- AASNLES SEQ ID NO:34
- AAS SEQ ID NO:35
- a light chain CDR3 including
- the antibody includes (a) a heavy chain CDR1 including DYSIH (SEQ ID NO:29), a heavy chain CDR2 including YIYPSNGDSGYNQKFK (SEQ ID NO:30), and a heavy chain CDR3 including
- TYFANNFD SEQ ID NO:31
- a light chain CDR1 including KASQSVDYDGDSYMN SEQ ID NO:33
- a light chain CDR2 including AASNLES SEQ ID NO:34
- a light chain CDR3 including QQSNEDPLT SEQ ID NO:36
- the antibody includes a heavy chain variable region including an amino acid sequence at least 80%, 85%, 90%, 90%, 95%, or 100% identical to SEQ ID NO:38 (e.g., including one, two, or three of the heavy chain CDRs mentioned above), and a light chain variable region including an amino acid sequence at least 80%, 85%, 90%, 90%, 95%, or 100% identical to SEQ ID NO:39 (e.g., including one, two, or three of the light chain CDRs mentioned above).
- the antibody is 131R10.
- the RSPO or LGR antagonist is an antibody that specifically binds at least one human LGR protein (e.g., LGR4, LGR5, and LGR6). In some embodiments, the antibody specifically binds at least human LGR5. In certain embodiments, the antibody includes (a) the heavy chain CDR1, CDR2, and CDR3 sequences of the monoclonal antibody produced by the 88M1 hybridoma having the ATCC deposit number PTA-9342; and (b) the light chain CDR1, CDR2, and CDR3 sequences of the monoclonal antibody produced by the 88M1 hybridoma having the ATCC deposit number PTA-9342. In some embodiments, the antibody includes the heavy chain variable region and light chain variable region of the monoclonal antibody produced by the 88M1 hybridoma having the ATCC deposit number PTA-9342.
- the antibody includes the heavy chain variable region and light chain variable region of the monoclonal antibody produced by the 88M1 hybridoma having the ATCC deposit number PTA-9342
- the antibody is a monoclonal antibody, a recombinant antibody, a chimeric antibody, a humanized antibody, a human antibody, or an antibody fragment including an antigen-binding site.
- the antibody is a monospecific antibody or a bispecific antibody.
- the antibody is an IgGl antibody or an IgG2 antibody.
- the RSPO or LGR antagonist is a soluble receptor including an extracellular domain of a human LGR protein (e.g., LGR5), where the extracellular domain is capable of binding a human RSPO protein.
- the extracellular domain of a human LGR protein includes amino acids 22-564 of human LGR5 (SEQ ID NO:56).
- the soluble receptor includes a non-LGR polypeptide.
- the non-LGR polypeptide is directly linked to the extracellular domain of the human LGR protein or is connected to the extracellular domain of the human LGR protein by a linker.
- the non-LGR polypeptide includes a human Fc region (e.g., includes SEQ ID NO:58, SEQ ID NO:59, SEQ ID NO:60, SEQ ID NO:61, or SEQ ID NO:62, or an amino acid sequence at least 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO:58, SEQ ID NO:59, SEQ ID NO:60, SEQ ID NO:61, or SEQ ID NO:62).
- a human Fc region e.g., includes SEQ ID NO:58, SEQ ID NO:59, SEQ ID NO:60, SEQ ID NO:61, or SEQ ID NO:62, or an amino acid sequence at least 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO:58, SEQ ID NO:59, SEQ ID NO:60, SEQ ID NO:61, or SEQ ID NO:62).
- the RSPO or LGR antagonist enhances the activity of the immunotherapeutic agent.
- the immunotherapeutic agent enhances the activity of the RSPO or LGR antagonist.
- the RSPO or LGR antagonist and the immunotherapeutic agent act synergistically.
- the immunotherapeutic agent is an agent that modulates immune responses.
- the immunotherapeutic agent is an agent that enhances anti-tumor immune responses.
- the immunotherapeutic agent is an agent that increases cell-mediated immunity.
- the immunotherapeutic agent is an agent that increases T-cell activity.
- the immunotherapeutic agent is an agent that increases cytolytic T-cell (CTL) activity.
- CTL cytolytic T-cell
- the immunotherapeutic agent is an agent that increases natural killer (NK) cell activity. In some embodiments, the immunotherapeutic agent is an agent that inhibits suppression of an immune response. In some embodiments, the immunotherapeutic agent is an agent that inhibits suppressor cells or suppressor cell activity. In some embodiments, the immunotherapeutic agent is an agent that inhibits Treg activity. In some embodiments, the immunotherapeutic agent is an agent that inhibits the activity of inhibitory immune checkpoint receptors.
- the immunotherapeutic agent is a modulator of PD-1 activity, a modulator of PD-Ll activity, a modulator of PD-L2 activity, a modulator of CTLA-4 activity, a modulator of CD28 activity, a modulator of CD80 activity, a modulator of CD86 activity, a modulator of 4- IBB activity, an modulator of OX40 activity, a modulator of KIR activity, a modulator of Tim-3 activity, a modulator of LAG3 activity, a modulator of CD27 activity, a modulator of CD40 activity, a modulator of GITR activity, a modulator of TIGIT activity, a modulator of CD20 activity, a modulator of CD96 activity, a modulator of IDOl activity, a cytokine, a chemokine, an interferon, an interleukin, a lymphokine, a member of the tumor necrosis factor (TNF) family, or an
- the immunotherapeutic agent is an immune checkpoint modulator (e.g., an immune checkpoint inhibitor).
- the immunotherapeutic agent is an agent that inhibits the activity of PD-1. In some embodiments, the immunotherapeutic agent is an agent that inhibits the activity of PD-Ll and/or PD-L2. In some embodiments, the immunotherapeutic agent is an agent that inhibits the activity of CTLA-4. In some embodiments, the immunotherapeutic agent is an agent that inhibits the activity of CD80 and/or CD86. In some embodiments, the immunotherapeutic agent is an agent that inhibits the activity of TIGIT. In some embodiments, the immunotherapeutic agent is an agent that inhibits the activity of KIR. In some embodiments, the immunotherapeutic agent is an agent that enhances or stimulates the activity of activating immune checkpoint receptors.
- the immunotherapeutic agent is a PD-1 antagonist, a PD-Ll antagonist, a PD-L2 antagonist, a CTLA-4 antagonist, a CD80 antagonist, a CD86 antagonist, a KIR antagonist, a Tim-3 antagonist, a LAG3 antagonist, a TIGIT antagonist, a CD20 antagonist, a CD96 antagonist, or an IDOl antagonist.
- the PD-1 antagonist is an antibody that specifically binds PD-1.
- the antibody that binds PD-1 is pembrolizumab (KEYTRUDA, MK-3475;
- the antibody that binds PD-1 is described in PCT Publication WO 2014/179664, for example, an antibody identified as APE2058, APE1922, APE1923, APE1924, APE 1950, or APE 1963 (Anaptysbio), or an antibody containing the CDR regions of any of these antibodies.
- the PD-1 antagonist is a fusion protein that includes the extracellular domain of PD-Ll or PD-L2, for example, AMP-224 (AstraZeneca/Medlmmune).
- the PD-1 antagonist is a peptide inhibitor, for example, AUNP-12 (Aurigene).
- the PD-Ll antagonist is an antibody that specifically binds PD-Ll .
- the antibody that binds PD-Ll is atezolizumab (RG7446, MPDL3280A;
- the antibody that binds PD- L l is described in PCT Publication WO 2014/055897, for example, Ab-14, Ab-16, Ab-30, Ab-31, Ab-42, Ab-50, Ab-52, or Ab-55, or an antibody that contains the CDR regions of any of these antibodies.
- the CTLA-4 antagonist is an antibody that specifically binds CTLA-4.
- the antibody that binds CTLA-4 is ipilimumab (YERVOY; Bristol Myer Squibb) or tremelimumab (CP -675,206; Pfizer).
- the CTLA-4 antagonist a CTLA-4 fusion protein or soluble CTLA-4 receptor, for example, KAHR-102 (Kahr Medical Ltd.).
- the LAG3 antagonist is an antibody that specifically binds LAG3.
- the antibody that binds LAG3 is IMP701 (Prima BioMed), IMP731 (Prima BioMed/GlaxoSmithKline), BMS-986016 (Bristol Myer Squibb), LAG525 (Novartis), and
- the LAG3 antagonist includes a soluble LAG3 receptor, for example, IMP321 (Prima BioMed).
- the KIR antagonist is an antibody that specifically binds KIR.
- the antibody that binds KIR is lirilumab (Bristol Myer Squibb/Innate Pharma).
- the immune checkpoint enhancer or stimulator is a CD28 agonist, a 4- 1BB agonist, an OX40 agonist, a CD27 agonist, a CD80 agonist, a CD86 agonist, a CD40 agonist, or a GITR agonist.
- the OX40 agonist includes OX40 ligand, or an OX40-binding portion thereof.
- the OX40 agonist may be MEDI6383 (AstraZeneca).
- the OX40 agonist is an antibody that specifically binds OX40.
- the antibody that binds OX40 is MEDI6469 (AstraZeneca/Medlmmune), MEDI0562 (AstraZeneca/Medlmmune), or MOXR0916 (RG7888; Genentech).
- the OX40 agonist is a vector (e.g., an expression vector or virus, such as an adenovirus) capable of expressing OX40 ligand.
- the OX40-expressing vector is Delta-24-RGDOX (DNAtrix) or DNX2401 (DNAtrix).
- the 4-1BB (CD137) agonist is a binding molecule, such as an anticalin.
- the anticalin is PRS-343 (Pieris AG).
- the 4- 1BB agonist is an antibody that specifically binds 4-1BB.
- antibody that binds 4-1BB is PF-2566 (PF-05082566; Pfizer) or urelumab (BMS-663513; Bristol Myer Squibb).
- the CD27 agonist is an antibody that specifically binds CD27.
- the antibody that binds CD27 is varlilumab (CDX-1127; Celldex).
- the GITR agonist comprises GITR ligand or a GITR-binding portion thereof.
- the GITR agonist is an antibody that specifically binds GITR.
- the antibody that binds GITR is TRX518 (GITR, Inc.), MK-4166 (Merck), or INBRX-110 (Five Prime Therapeutics/Inhibrx).
- the RSPO or LGR antagonist and immunotherapeutic agent together are a bispecific antibody.
- the bispecific antibody may specifically bind a RSPO or LGR protein and immune checkpoint (e.g., any described herein, such as PD-1, PD-L1, PD-L2, or CTLA-4, LAG-3, OX40, or CD27).
- the bispecific antibody specifically binds a human RSPO protein and one of PD-1, PD-L1, and CTLA-4.
- the bispecific antibody does not have both RSP03 as a first antigen target and an effector molecule on a leukocyte of (e.g., CD2, CD3, CD28, CTLA-4, CD80, or CD86) or a Fc receptor (e.g., CD64, CD32, or CD 16) as a second antigen target.
- a leukocyte of e.g., CD2, CD3, CD28, CTLA-4, CD80, or CD86
- a Fc receptor e.g., CD64, CD32, or CD 16
- the immunotherapeutic agent is a cytokine, for example, a chemokine, an interferon, an interleukin, lymphokine, or a member of the tumor necrosis factor family.
- the cytokine is IL-2, IL15, or interferon-gamma.
- the cancer is selected from the group consisting of lung cancer, pancreatic cancer, breast cancer, colon cancer, colorectal cancer, melanoma, gastrointestinal cancer, gastric cancer, renal cancer, ovarian cancer, liver cancer, endometrial cancer, kidney cancer, prostate cancer, thyroid cancer,
- neuroblastoma neuroblastoma, glioma, glioblastoma, glioblastoma multiforme, cervical cancer, stomach cancer, bladder cancer, head and neck cancer, and hepatoma.
- the tumor is selected from the group consisting of lung tumor, pancreatic tumor, breast tumor, colon tumor, colorectal tumor, melanoma, gastrointestinal tumor, gastric tumor, renal tumor, ovarian tumor, liver tumor, endometrial tumor, kidney tumor, prostate tumor, thyroid tumor, neuroblastoma, glioma, glioblastoma, glioblastoma multiforme, cervical tumor, stomach tumor, bladder tumor, head and neck tumor, and hepatoma.
- the cancer expresses an RSPO protein (e.g., RSP03).
- the cancer does not express an RSPO protein, for example, does not express RSPO l, RSP02, RSP03, or RSP04.
- the cancer does not express RSP03.
- the subject's cancer or tumor does not respond to immune checkpoint inhibition (e.g., to any immune checkpoint inhibitor described herein, such as a PD-1 antagonist or PD-Ll antagonist) or the subject's cancer or tumor has progressed following an initial response to immune checkpoint inhibition (e.g., to any immune checkpoint inhibitor described herein, such as a PD-1 antagonist or PD-Ll antagonist).
- immune checkpoint inhibition e.g., to any immune checkpoint inhibitor described herein, such as a PD-1 antagonist or PD-Ll antagonist
- the subj ect is a human.
- Figures 1A-1D show the effect of anti-CTLA-4 and anti -PD-Ll antibody treatment on tumor growth in the presence or absence of the anti-RSP03 antibody 131R10.
- Figure 1A shows average results.
- Figures IB-ID show tumor measure growth measurements from individual control animals, animals receiving a control antibody with anti-CTLA-4 and anti -PD-Ll antibodies, and animals receiving 131R10 with anti-CTLA-4 and anti-PD-Ll antibodies, respectively.
- Figures 2A and 2B show changes in interferon-gamma (Figure 2A) and IL-2 ( Figure 2B) in splenocytes following treatment with control antibodies, anti-CTLA-4 and anti-PD-Ll antibodies, or 131R10 with anti-CTLA-4 and anti-PD-Ll antibodies.
- Figure 3 shows changes in T cell cytotoxicity following treatment with control antibodies, anti-CTLA-4 and anti-PD-Ll antibodies, or 131R10 with anti-CTLA-4 and anti-PD-Ll antibodies.
- Figures 4A and 4B show increases in tumor-infiltrating CD4 + (Figure 4A) and CD8 + ( Figure 4B) T-cells in cells receiving 131R10 with anti-CTLA-4 and anti-PD-Ll antibodies, as compared to those receiving anti-CTLA-4 and anti-PD-Ll antibodies without 131R10 or control antibodies.
- Figures 5A-5C show reduction in breast tumor cell growth in mice receiving anti-RSP03 antibody 131R10.
- Figure 5A shows the average in the control group (left) and 131R10 group (right).
- Figures 5B and 5C show the individual results from the control and 131R10 treatment groups, respectively.
- Figures 6A-6D show changes in splenocyte cytokine expression of interferon gamma (Figure 6A), IL-2 ( Figure 6B), IL-10 ( Figure 6C), and IL-17A ( Figure 6D) in mice implanted with breast tumor cells and receiving either control or 131R10.
- Figures 7A-7C show changes in splenic CD8+ T cells (Figure 7A), splenic CD4+ T cells (Figure 7B), and splenic regulatory T cells (Tregs; Figure 7C) in mice implanted with breast tumor cells and receiving either saline control or 131R10.
- Figures 8A-8D show reduction in breast tumor cell growth in mice receiving (left to right) control, anti-PD 1 , or anti-PD 1+131R10.
- Figure 8 A shows the average of each treatment group .
- Figures 8B-8D show the individual results from the control, anti-PDl, and 131R10+anti-PD l treatment groups, respectively.
- Figures 9A-9D show changes in splenocyte cytokine expression of interferon gamma (Figure 9A), IL-10 (Figure 9B), IL-2 ( Figure 9C), and IL-17A ( Figure 9D) in mice implanted with breast tumor cells and receiving control, anti-PDl, or 13 lRlO+anti-PDl treatment.
- Figure 10A shows changes in T cell cytotoxicity in mice implanted with breast tumor cells and receiving control, anti-PDl, or 131R10+anti-PDl treatment.
- Figures 10B and IOC show changes in tumor T cell numbers in mice implanted with breast tumor cells and receiving control, anti-PDl, or 131R10+anti-PDl treatment.
- Figures 10D-10F show changes in splenic CD8+ T cells (Figure 7A), splenic CD4+ T cells ( Figure 7B), and splenic regulatory T cells (Tregs; Figure 7C) in mice implanted with breast tumor cells and receiving control, anti-PDl, or 131R10+anti-PD l treatment.
- Figures 11A-11D show reduction in breast tumor cell growth in mice receiving (left to right) control, anti-CTLA-4, or anti-CTLA-4+131R10.
- Figure 11A shows the average of each treatment group.
- Figures 1 lB-1 ID show the individual results from the control, anti-CTLA-4, and
- Figures 12A-12D show changes in splenocyte cytokine expression of interferon gamma (Figure 12A), IL-10 (Figure 12B), IL-2 ( Figure 12C), and IL-17A ( Figure 12D) in mice implanted with breast tumor cells and receiving control, anti-CLTA-4, or 13 lRlO+anti-CTLA-4 treatment.
- Figure 13 shows changes in T cell cytotoxicity in mice implanted with breast tumor cells and receiving control, anti-CTLA-4, or 131R10+anti-CTLA-4 treatment.
- Figures 14A-14C show changes in splenic CD8+ T cells (Figure 14A), splenic CD4+ T cells ( Figure 14B), and splenic regulatory T cells (Tregs; Figure 14C) in mice implanted with breast tumor cells and receiving the control, anti-CLTA-4, or 131R10+anti-CTLA-4.
- Figure 15 shows changes in colon tumor size in mice receiving (left to right) saline, 5- fluorouracil (5-FU), 131R10+5-FU, anti-PD l+5-FU, or 131R10+anti-PD l+5-FU.
- Figure 16 shows changes in 4T1 tumor size in mice receiving saline, 131R10, anti-PD-1 antibody, docetaxel, anti-PDl+docetaxel, or 131R10+anti-PDl+docetaxel.
- the lower six graphs show the results from each individual animal treated.
- Figures 17A-17D show changes in tumor dendritic cell frequency (CD103 + and CD8a + CD3 + ; Figures 17A and 17B), CD8a + cell tumor infiltration (Figure 17C), and expression of the activation marker CD69 on CD8a + cells ( Figure 17D) in 4T1 tumor-implanted mice receiving saline, 131R10, anti-PDl antibody, docetaxel, anti-PDl+docetaxel, or 131R10+anti-PD l+docetaxel.
- Figures 18A-18B show changes in splenic dendritic cells (Figure 18A) and T regulatory cells (Figure 18B) in 4T1 tumor-implanted mice receiving saline, 131R10, anti-PDl antibody, docetaxel, anti-PDl+docetaxel, or 131R10+anti-PDl+docetaxel.
- Figures 19A-19D show changes in IL-17a ( Figures 19A and 19B) and IL-2 ( Figures 19C and Figure 19D) secreted by splenocytes from 4T1 tumor-implanted mice.
- Figure 20 shows changes in MC38 tumor size in mice receiving saline, 131R10, anti-PDl antibody, or 13 lRlO+anti-PD 1.
- the lower four graphs show the results from each individual animal treated.
- Figure 21 shows the percentage of tumors in each experimental group that were below 500 mm 3 in volume following treatment in MC38-implated mice.
- Figures 22A-22B show changes in IL-2 ( Figure 22A) and IL-17a ( Figure 22B) secreted by splenocytes from MC38-implanted mice.
- the present invention provides methods of modulating immune responses, particularly antitumor immune responses, methods of inhibiting tumor growth, and methods of treating cancer.
- the methods provided herein comprise administering to a subject a therapeutically effective amount of a RSPO or LGR antagonist in combination with a therapeutically effective amount of an
- the RSPO or LGR antagonist is an antibody that specifically binds a human RSPO protein (e.g., RSP03), an antibody that specifically binds a human LGR protein (e.g., LGR5), or an LGR soluble receptor (e.g., an LGR5 soluble receptor).
- the anti-RSP03 antibody is 131R10 or an antibody containing the CDR regions of 131R10.
- the immunotherapeutic agent includes but is not limited to, a modulator of PD-1 activity, a modulator of PD-L1 activity, a modulator of PD-L2 activity, a modulator of CTLA-4 activity, a modulator of CD28 activity, a modulator of CD80 activity, a modulator of CD86 activity, a modulator of 4-1BB activity, an modulator of OX40 activity, a modulator of KIR activity, a modulator of Tim -3 activity, a modulator of LAG3 activity, a modulator of CD27 activity, a modulator of CD40 activity, a modulator of GITR activity, a modulator of TIGIT activity, a modulator of CD20 activity, a modulator of CD96 activity, a modulator of IDO 1 activity, a cytokine, a chemokine, an interferon, an interleukin, a lymphokine, a member of the tumor necrosis factor (TNF) family, and an immunostimulatory
- TNF
- antagonists refer to any molecule that partially or fully blocks, inhibits, reduces, or neutralizes a biological activity of a target and/or signaling pathway.
- antagonists are used herein to include any molecule that partially or fully blocks, inhibits, reduces, or neutralizes the activity of a protein. Suitable antagonist molecules include, but are not limited to, antagonist antibodies, antibody fragments, soluble receptors, and small molecules.
- agonist and agonistic refer to or describe an agent that is capable of, directly or indirectly, substantially inducing, activating, promoting, increasing, or enhancing the biological activity of a target and/or a signaling pathway.
- agonist is used herein to include any agent that partially or fully induces, activates, promotes, increases, or enhances the activity of a protein.
- Suitable agonists specifically include, but are not limited to, agonist antibodies or fragments thereof, soluble receptors, other fusion proteins, and small molecules.
- biomarker may include but is not limited to, nucleic acids and proteins, and variants and fragments thereof.
- a biomarker may include DNA comprising the entire or partial nucleic acid sequence encoding the biomarker, or the complement of such a sequence.
- Biomarker nucleic acids useful in the invention are considered to include both DNA and RNA comprising the entire or partial sequence of any of the nucleic acid sequences of interest.
- Biomarker proteins are considered to comprise the entire or partial amino acid sequence of any of the biomarker proteins or polypeptides.
- antibody refers to an immunoglobulin molecule that recognizes and specifically binds a target, such as a protein, polypeptide, peptide, carbohydrate, polynucleotide, lipid, or combinations of the foregoing, through at least one antigen-binding site within the variable region of the immunoglobulin molecule.
- the term encompasses intact polyclonal antibodies, intact monoclonal antibodies, antibody fragments comprising an antigen-binding site (such as Fab, Fab', F(ab')2, and Fv fragments), single chain Fv (scFv) antibodies, multispecific antibodies such as bispecific antibodies, monospecific antibodies, monovalent antibodies, chimeric antibodies, humanized antibodies, human antibodies, fusion proteins comprising an antigen-binding site of an antibody, and any other modified immunoglobulin molecule comprising an antigen-binding site as long as the antibodies exhibit the desired biological activity.
- an antigen-binding site such as Fab, Fab', F(ab')2, and Fv fragments
- scFv single chain Fv
- multispecific antibodies such as bispecific antibodies, monospecific antibodies, monovalent antibodies, chimeric antibodies, humanized antibodies, human antibodies, fusion proteins comprising an antigen-binding site of an antibody, and any other modified immunoglobulin molecule comprising an antigen-binding site as long as the antibodies exhibit
- An antibody can be any of the five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, or subclasses (isotypes) thereof (e.g., IgGl, IgG2, IgG3, IgG4, IgA l and IgA2), based on the identity of their heavy-chain constant domains referred to as alpha, delta, epsilon, gamma, and mu, respectively.
- the different classes of immunoglobulins have different and well -characterized subunit structures and three-dimensional configurations.
- Antibodies can be naked or conjugated to other molecules, including but not limited to, toxins and radioisotopes.
- antibody fragment refers to a portion of an intact antibody and generally includes the antigenic determining variable region or antigen-binding site of an intact antibody.
- antibody fragments include, but are not limited to, Fab, Fab', F(ab')2, and Fv fragments, linear antibodies, single chain antibodies, and multispecific antibodies formed from antibody fragments.
- Antibody fragment as used herein comprises at least one antigen-binding site or epitope -binding site.
- variable region of an antibody as used herein refers to the variable region of the antibody light chain, or the variable region of the antibody heavy chain, either alone or in
- variable region of the heavy or light chain generally consists of four framework regions connected by three complementarity determining regions (CDRs), also known as
- CDRs in each chain are held together in close proximity by the framework regions and, with the CDRs from the other chain, contribute to the formation of the antigen-binding site of the antibody.
- the term "monoclonal antibody” as used herein refers to a homogenous antibody population involved in the highly specific recognition and binding of a single antigenic determinant or epitope. This is in contrast to polyclonal antibodies that typically include a mixture of different antibodies directed against different antigenic determinants.
- the term “monoclonal antibody” encompasses both intact and full-length antibodies as well as antibody fragments (e.g., Fab, Fab', F(ab')2, Fv), single chain (scFv) antibodies, fusion proteins comprising an antibody portion, and any other modified immunoglobulin molecule comprising at least one antigen-binding site.
- “monoclonal antibody” refers to such antibodies made by any number of techniques, including but not limited to, hybridoma production, phage selection, recombinant expression, and transgenic animals.
- humanized antibody refers to antibodies that are specific immunoglobulin chains, chimeric immunoglobulins, or fragments thereof that contain minimal non- human sequences.
- humanized antibodies are human immunoglobulins in which amino acid residues of the CDRs are replaced by amino acid residues from the CDRs of a non-human species (e.g., mouse, rat, rabbit, or hamster) that have the desired specificity, affinity, and/or binding capability.
- human antibody refers to an antibody produced by a human or an antibody having an amino acid sequence corresponding to an antibody produced by a human made using any of the techniques known in the art.
- chimeric antibody refers to an antibody where the amino acid sequence of the immunoglobulin molecule is derived from two or more species.
- the variable region of both light and heavy chains corresponds to the variable region of antibodies derived from one species of mammals (e.g., mouse, rat, rabbit, etc.) with the desired specificity, affinity, and/or binding capability, while the constant regions are homologous to the sequences in antibodies derived from another species (usually human).
- the term "affinity-matured antibody” as used herein refers to an antibody with one or more alterations in one or more CDRs that result in an improvement in the affinity of the antibody for antigen, compared to a parent antibody that does not possess those alterations(s).
- affinity-matured antibodies will have nanomolar or even picomolar affinities for the target antigen.
- Affinity-matured antibodies are produced by procedures known in the art including heavy chain and light chain variable region shuffling, random mutagenesis of CDR and/or framework residues, or site-directed mutagenesis of CDR and/or framework residues.
- epitopes can be formed both from contiguous amino acids and non-contiguous amino acids juxtaposed by tertiary folding of a protein. Epitopes formed from contiguous amino acids (also referred to as linear epitopes) are typically retained upon protein denaturing, whereas epitopes formed by tertiary folding (also referred to as conformational epitopes) are typically lost upon protein denaturing.
- An epitope typically includes at least 3, and more usually, at least 5, or 8-10 amino acids in a unique spatial conformation.
- binding agent or an antibody reacts or associates more frequently, more rapidly, with greater duration, with greater affinity, or with some combination of the above to the epitope, protein, or target molecule than with alternative substances, including unrelated or related proteins.
- specifically binds means, for instance, that an antibody binds a target with a K D of about 0. ImM or less, but more usually less than about ⁇ ⁇ .
- specifically binds means that an antibody binds a target with a K D of at least about 0. ⁇ ⁇ or less, at least about 0.0 ⁇ ⁇ or less, or at least about InM or less. Because of the sequence identity between homologous proteins in different species, specific binding can include an antibody that recognizes a protein in more than one species.
- specific binding can include an antibody (or other polypeptide or binding agent) that recognizes more than one protein. It is understood that, in certain embodiments, an antibody or binding agent that specifically binds a first target may or may not specifically bind a second target. As such, “specific binding” does not necessarily require (although it can include) exclusive binding, i.e. binding to a single target. Thus, an antibody may, in certain embodiments, specifically bind more than one target. In certain embodiments, multiple targets may be bound by the same antigen-binding site on the antibody.
- an antibody may, in certain instances, comprise two identical antigen-binding sites, each of which specifically binds the same epitope on two or more proteins.
- an antibody may be bispecific and comprise at least two antigen-binding sites with differing specificities.
- reference to binding means specific binding.
- soluble receptor refers to an extracellular fragment (or a portion thereof) of a receptor protein preceding the first transmembrane domain of the receptor that can be secreted from a cell in soluble form.
- polypeptide and “peptide” and “protein” are used interchangeably herein and refer to polymers of amino acids of any length.
- the polymer may be linear or branched, it may comprise modified amino acids, and it may be interrupted by non-amino acids.
- the terms also encompass an amino acid polymer that has been modified naturally or by intervention; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation or modification, such as conjugation with a labeling component.
- polypeptides of this invention may be based upon antibodies, in certain embodiments, the polypeptides can occur as single chains or associated chains.
- amino acid refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function similarly to the naturally occurring amino acids.
- Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, gamma-carboxyglutamate, and O-phosphoserine.
- amino acid analog refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, e.g., an alpha carbon that is bound to an hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs can have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid.
- amino acid mimetic refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that function similarly to a naturally occurring amino acid.
- polynucleotide and “nucleic acid” are used interchangeably herein and refer to polymers of nucleotides of any length, and include DNA and RNA.
- the nucleotides can be deoxyribonucleotides, ribonucleotides, modified nucleotides or bases, and/or their analogs, or any substrate that can be incorporated into a polymer by DNA or RNA polymerase.
- nucleic acids or polypeptides refer to two or more sequences or subsequences that are the same or have a specified percentage of nucleotides or amino acid residues that are the same, when compared and aligned (introducing gaps, if necessary) for maximum correspondence, not considering any conservative amino acid substitutions as part of the sequence identity.
- the percent identity may be measured using sequence comparison software or algorithms or by visual inspection. Various algorithms and software that may be used to obtain alignments of amino acid or nucleotide sequences are well-known in the art.
- two nucleic acids or polypeptides of the invention are substantially identical, meaning they have at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, and in some embodiments at least 95%, 96%, 97%, 98%, 99% nucleotide or amino acid residue identity, when compared and aligned for maximum correspondence, as measured using a sequence comparison algorithm or by visual inspection.
- identity exists over a region of the sequences that is at least about 10, at least about 20, at least about 40-60, at least about 60-80 nucleotides or amino acid residues in length or any integral value therebetween. In some embodiments, identity exists over a longer region than 60-80 nucleotides or amino acid residues, such as at least about 80-100 nucleotides or amino acid residues, and in some embodiments the sequences are substantially identical over the full length of the sequences being compared, such as the coding region of a nucleotide sequence.
- amino acid substitution refers to a substitution in which one amino acid residue is replaced with another amino acid residue having a similar side chain.
- Families of amino acid residues having similar side chains have been defined in the art, including basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), non-polar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan,
- substitution of a phenylalanine for a tyrosine is a conservative substitution.
- conservative substitutions in the sequences of the polypeptides and antibodies of the invention do not abrogate the binding of the polypeptide or antibody containing the amino acid sequence to the antigen(s).
- Methods of identifying nucleotide and amino acid conservative substitutions which do not eliminate antigen binding are well- known in the art.
- vector means a construct, which is capable of delivering, and usually expressing, one or more gene(s) or sequence(s) of interest in a host cell.
- vectors include, but are not limited to, viral vectors, naked DNA or RNA expression vectors, plasmid, cosmid, or phage vectors, DNA or RNA expression vectors associated with cationic condensing agents, and DNA or RNA expression vectors encapsulated in liposomes.
- a polypeptide, antibody, polynucleotide, vector, cell, or composition which is "isolated” is a polypeptide, antibody, polynucleotide, vector, cell, or composition which is in a form not found in nature. Isolated polypeptides, antibodies, polynucleotides, vectors, cells, or compositions include those which have been purified to a degree that they are no longer in a form in which they are found in nature. In some embodiments, a polypeptide, antibody, polynucleotide, vector, cell, or composition which is isolated is substantially pure. [0099] The term "substantially pure” as used herein refers to material which is at least 50% pure (i.e., free from contaminants), at least 90% pure, at least 95% pure, at least 98% pure, or at least 99% pure.
- cancer and “cancerous” as used herein refer to or describe the physiological condition in mammals in which a population of cells is characterized by unregulated cell growth.
- examples of cancer include, but are not limited to, carcinoma, blastema, sarcoma, and hematologic cancers such as lymphoma and leukemia.
- proliferative disorder and “proliferative disease” as used herein refer to disorders associated with abnormal cell proliferation such as cancer.
- tumor and "neoplasm” as used herein refer to any mass of tissue that results from excessive cell growth or proliferation, either benign (non -cancerous) or malignant (cancerous), including pre-cancerous lesions.
- metalastasis refers to the process by which a cancer spreads or transfers from the site of origin to other regions of the body with the development of a similar cancerous lesion at the new location.
- a “metastatic” or “metastasizing” cell is generally one that loses adhesive contacts with neighboring cells and migrates from the primary site of disease to invade neighboring tissue sites.
- cancer stem cell and “CSC” and “tumor stem cell” and “tumor initiating cell” are used interchangeably herein and refer to cells from a cancer or tumor that: ( 1) have extensive proliferative capacity; 2) are capable of asymmetric cell division to generate one or more types of differentiated cell progeny where the differentiated cells have reduced proliferative or developmental potential; and (3) are capable of symmetric cell divisions for self-renewal or self-maintenance.
- CSC cancer stem cell
- tumor stem cell undergo self-renewal versus differentiation in a chaotic manner to form tumors with abnormal cell types that can change over time as mutations occur.
- cancer cell and "tumor cell” as used herein refer to the total population of cells derived from a cancer or tumor or pre-cancerous lesion, including both non-tumorigenic cells, which comprise the bulk of the cancer cell population, and tumorigenic cells (cancer stem cells).
- cancer stem cells tumorigenic cells
- subject refers to any animal (e.g., a mammal), including, but not limited to, humans, non-human primates, canines, felines, rodents, and the like, which is to be the recipient of a particular treatment.
- subject and patient are used
- pharmaceutically acceptable refers to an agent, compound, molecule, etc.
- phrases "pharmaceutically acceptable excipient, carrier or adjuvant” and “acceptable pharmaceutical carrier” refer to an excipient, carrier, or adjuvant that can be administered to a subject, together with a therapeutic agent, and which does not destroy the pharmacological activity thereof and is nontoxic when administered in doses sufficient to deliver a therapeutic effect.
- pharmaceutically acceptable excipient, carrier, or adjuvant to be an inactive ingredient of any formulation or pharmaceutical composition.
- an effective amount and “therapeutically effective amount” and “therapeutic effect” as used herein refer to an amount of a binding agent, an antibody, a polypeptide, a polynucleotide, a small molecule, or other therapeutic agent effective to "treat” a disease or disorder in a subject or mammal.
- the therapeutically effective amount of an agent has a therapeutic effect and as such can reduce the number of cancer cells; decrease tumorigenicity, tumorigenic frequency, or tumorigenic capacity; reduce the number or frequency of cancer stem cells; reduce tumor size; reduce the cancer cell population; inhibit and/or stop cancer cell infiltration into peripheral organs including, for example, the spread of cancer into soft tissue and bone; inhibit and stop tumor or cancer cell metastasis; inhibit and/or stop tumor or cancer cell growth; relieve to some extent one or more of the symptoms associated with the cancer; reduce morbidity and mortality; improve quality of life; or a combination of such effects.
- the agent prevents growth and/or kills existing cancer cells, it can be referred to as cytostatic and/or cytotoxic.
- treating and “treatment” and “to treat” and “alleviating” and “to alleviate” refer to both 1) therapeutic measures that cure, slow down, lessen symptoms of, and/or halt progression of a diagnosed pathologic condition or disorder and 2) prophylactic or preventative measures that prevent or slow the development of a targeted pathologic condition or disorder.
- those in need of treatment include those who already have a disorder; those prone to have a disorder; and those in whom a disorder is to be prevented.
- a subject is successfully "treated” according to the methods of the present invention if the patient shows one or more of the following: a reduction in the number of or complete absence of cancer cells; a reduction in tumor size; inhibition of or an absence of cancer cell infiltration into peripheral organs including the spread of cancer cells into soft tissue and bone; inhibition of or an absence of tumor or cancer cell metastasis; inhibition or an absence of cancer growth; inhibition or an absence of tumor growth; relief of one or more symptoms associated with the specific cancer; reduced morbidity and mortality; improvement in quality of life; reduction in tumorigenicity; reduction in the number or frequency of cancer stem cells; or some combination of effects.
- biomarker may include but is not limited to, nucleic acids and proteins, and variants and fragments thereof.
- a biomarker may include DNA comprising the entire or partial nucleic acid sequence encoding the biomarker, or the complement of such a sequence.
- Biomarker nucleic acids useful in the invention are considered to include both DNA and RNA comprising the entire or partial sequence of any of the nucleic acid sequences of interest.
- Biomarker proteins are considered to comprise the entire or partial amino acid sequence of any of the biomarker proteins or polypeptides.
- a RSPO or LGR antagonist described herein in combination with an immunotherapeutic agent is useful in a variety of applications including, but not limited to, therapeutic treatment methods, such as immunotherapy for cancer.
- a RSPO or LGR antagonist e.g., an anti-RSPO or anti-LGR antibody or a soluble LGR receptor
- an RSPO or LGR antagonist e.g., an anti-RSPO or anti-LGR antibody or a soluble LGR receptor
- immunotherapeutic agent is useful for activating, promoting, increasing, and/or enhancing an immune response, inhibiting tumor growth, reducing tumor volume, increasing tumor cell apoptosis, and/or reducing the tumorigenicity of a tumor.
- the methods of use may be in vitro, ex vivo, or in vivo methods.
- the combination of a RSPO or LGR antagonist (e.g., an anti-RSPO or anti-LGR antibody or a soluble LGR receptor) with an immunotherapeutic agent acts as an agonist of an immune response.
- the combination of a RSPO or LGR antagonist acts as an enhancer, activator, or stimulator of an immune response.
- the combination of a RSPO or LGR antagonist e.g., an anti-RSPO or anti-LGR antibody or a soluble LGR receptor
- an immunotherapeutic agent acts as an agonist of an anti-tumor immune response.
- the combination of a RSPO or LGR antagonist e.g., an anti-RSPO or anti- LGR antibody or a soluble LGR receptor
- an immunotherapeutic agent works as an antagonist of the PD-1 pathway.
- the combination of a RSPO or LGR antagonist e.g., an anti-RSPO or anti-LGR antibody or a soluble LGR receptor
- an immunotherapeutic agent works as an antagonist of PD-1 or PD-1 activity.
- the combination of a RSPO or LGR antagonist e.g., an anti-RSPO or anti-LGR antibody or a soluble LGR receptor
- an immunotherapeutic agent works as an antagonist of PD-1 or PD-1 activity.
- the combination of a RSPO or LGR antagonist e.g., an anti-RSPO or anti-LGR antibody or a soluble LGR receptor
- the immunotherapeutic agent works as an antagonist of PD-L1 or PD-L1 activity.
- the combination of a RSPO or LGR antagonist e.g., an anti-RSPO or anti-LGR antibody or a soluble LGR receptor
- an immunotherapeutic agent works as an antagonist of the CTLA-4 pathway.
- the combination of a RSPO or LGR antagonist e.g., an anti-RSPO or anti-LGR antibody or a soluble LGR receptor
- an immunotherapeutic agent works as an antagonist of CTLA-4 or CTLA-4 activity.
- the combination of a RSPO or LGR antagonist e.g., an anti-RSPO or anti-LGR antibody or a soluble LGR receptor
- an immunotherapeutic agent works as an antagonist of Tim -3 or Tim-3 activity.
- the combination of a RSPO or LGR antagonist e.g., an anti-RSPO or anti-LGR antibody or a soluble LGR receptor
- an immunotherapeutic agent works as an antagonist of LAG3 or LAG3 activity.
- the combination of a RSPO or LGR antagonist e.g., an anti-RSPO or anti-LGR antibody or a soluble LGR receptor
- an immunotherapeutic agent works as an antagonist of TIGIT or TIGIT activity.
- the combination of a RSPO or LGR antagonist e.g., an anti-RSPO or anti-LGR antibody or a soluble LGR receptor
- the RSPO antagonist may be an anti-RSP03 antibody, such as 131R10 or an antibody containing the 131R10 CDR regions.
- a method of inhibiting tumor growth comprises contacting tumor cells with an effective amount of a RSPO or LGR antagonist in combination with an effective amount of an immunotherapeutic agent.
- the method may be in vivo or in vitro.
- the tumor is in a subject, and contacting tumor cells with the RSPO or LGR antagonist and the immunotherapeutic agent comprises administering a therapeutically effective amount of each of the agents to the subject.
- a method of inhibiting tumor growth comprises administering to a subject a therapeutically effective amount of a RSPO or LGR antagonist and a therapeutically effective amount of an immunotherapeutic agent, where the RSPO or LGR antagonist is an anti-RSPO or anti-LGR antibody or a soluble LGR receptor.
- the RSPO or LGR antagonist and the immunotherapeutic agent inhibit tumor growth by inhibiting or suppressing regulatory T-cell (Treg) activity.
- the RSPO or LGR antagonist and the immunotherapeutic agent inhibit tumor growth by increasing cytolytic cell activity.
- the RSPO or LGR antagonist and the immunotherapeutic agent inhibit tumor growth by increasing NK cell activity.
- the RSPO or LGR antagonist and the immunotherapeutic agent inhibit tumor growth by increasing the number of CD4+ or CD8+ T-cells. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent inhibit tumor growth by increasing cytolytic T-cell activity. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent inhibit tumor growth by increasing CD8+ cytolytic T-cell activity. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent inhibit tumor growth by decreasing PD-1 expression on T-cells. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent inhibit tumor growth by decreasing the number or percentage of PD-1 expressing T-cells.
- the RSPO or LGR antagonist and the immunotherapeutic agent inhibit tumor growth by decreasing the number or percentage of myeloid- derived suppressor cells (M-MDSCs). In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent inhibit tumor growth by increasing the number or percentage of activated myeloid cells. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent inhibit tumor growth by increasing the number or percentage of memory T-cells. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent inhibit tumor growth by increasing IFN-gamma production. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent inhibit tumor growth by increasing IL-2 production.
- M-MDSCs myeloid- derived suppressor cells
- the RSPO or LGR antagonist and the immunotherapeutic agent inhibit tumor growth by increasing the number or percentage of activated myeloid cells. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent inhibit tumor growth by increasing the number or percentage of memory T-cell
- the RSPO or LGR antagonist and the immunotherapeutic agent inhibit tumor growth by increasing IL- 10 production. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent inhibit tumor growth by increasing IL-17 production. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent inhibit tumor growth by decreasing IL-6 production.
- a method of treating cancer comprises administering to a subject a therapeutically effective amount of a RSPO or LGR antagonist in combination with a therapeutically effective amount of an immunotherapeutic agent.
- the RSPO or LGR antagonist and the immunotherapeutic agent treat cancer by inhibiting or suppressing Treg activity.
- the RSPO or LGR antagonist and the immunotherapeutic agent treat cancer by increasing cytolytic cell activity.
- the RSPO or LGR antagonist and the immunotherapeutic agent treat cancer by increasing NK cell activity.
- the RSPO or LGR antagonist and the immunotherapeutic agent treat cancer by increasing the number of CD4+ or CD8+ T-cells.
- the RSPO or LGR antagonist and the immunotherapeutic agent treat cancer by increasing cytolytic T-cell activity. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent treat cancer by increasing CD8+ cytolytic T-cell activity. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent treat cancer by decreasing PD-1 expression on T-cells. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent treat cancer by decreasing the number or percentage of PD-1 expressing T-cells. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent treat cancer by decreasing the number or percentage of M-MDSCs. In some embodiments, the RSPO or LGR antagonist and the
- the immunotherapeutic agent treat cancer by increasing the number or percentage of activated myeloid cells. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent treat cancer by increasing the number or percentage of memory T-cells. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent treat cancer by increasing IFN-gamma production. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent treat cancer by increasing IL-2 production. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent treat cancer by increasing IL-10 production. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent treat cancer by increasing IL-17 production. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent treat cancer by decreasing IL-6 production.
- a method of cancer immunotherapy comprises administering to a subject a therapeutically effective amount of a RSPO or LGR antagonist in combination with a therapeutically effective amount of an immunotherapeutic agent, and where the combination results in enhanced therapeutic efficacy as compared to administration of either agent alone.
- the RSPO or LGR antagonist is an anti-RSPO or anti-LGR antibody or a soluble LGR receptor.
- a method of inhibiting the activity of Tregs comprises administering to a subject a therapeutically effective amount of a RSPO or LGR antagonist in combination with a therapeutically effective amount of an immunotherapeutic agent.
- a method of inhibiting the activity of Tregs comprises administering to a subject a therapeutically effective amount of a RSPO or LGR antagonist and a therapeutically effective amount of an immunotherapeutic agent, where the RSPO or LGR antagonist is an anti-RSPO or anti- LGR antibody or a soluble LGR receptor.
- a method of inhibiting the suppression of immune responses by Tregs comprises administering to a subject a therapeutically effective amount of a RSPO or LGR antagonist (e.g., an anti-RSPO antibody, anti-LGR antibody, or soluble LGR receptor) in combination with a therapeutically effective amount of an RSPO or LGR antagonist (e.g., an anti-RSPO antibody, anti-LGR antibody, or soluble LGR receptor) in combination with a therapeutically effective amount of an RSPO or LGR antagonist (e.g., an anti-RSPO antibody, anti-LGR antibody, or soluble LGR receptor) in combination with a therapeutically effective amount of an RSPO or LGR antagonist
- a method of increasing T cell infiltration into a tumor comprises administering to a subject a therapeutically effective amount of a RSPO or LGR antagonist (e.g., an anti-RSPO antibody, anti-LGR antibody, or soluble LGR receptor) in combination with a therapeutically effective amount of an immunotherapeutic agent.
- a RSPO or LGR antagonist e.g., an anti-RSPO antibody, anti-LGR antibody, or soluble LGR receptor
- a method of increasing T cell cytotoxicity to a tumor comprises administering to a subject a therapeutically effective amount of a RSPO or LGR antagonist (e.g., an anti-RSPO antibody, anti-LGR antibody, or soluble LGR receptor) in combination with a therapeutically effective amount of an immunotherapeutic agent.
- a method of increasing tumor cell lysis comprises administering to a subject a therapeutically effective amount of a RSPO or LGR antagonist (e.g., an anti-RSPO antibody, anti-LGR antibody, or soluble LGR receptor) and an immunotherapeutic agent.
- a method of inhibiting tumor relapse or tumor regrowth comprises administering to a subject a therapeutically effective amount of a RSPO or LGR antagonist (e.g., an anti-RSPO antibody, anti-LGR antibody, or soluble LGR receptor) in combination with a therapeutically effective amount of an immunotherapeutic agent.
- a RSPO or LGR antagonist e.g., an anti-RSPO antibody, anti-LGR antibody, or soluble LGR receptor
- a method to increase the efficacy of an immune checkpoint modulator comprises administering to a subject a therapeutically effective amount of a RSPO or LGR antagonist (e.g., an anti-RSPO antibody, anti-LGR antibody, or soluble LGR receptor) in combination with a therapeutically effective amount of an immune checkpoint modulator.
- a RSPO or LGR antagonist e.g., an anti-RSPO antibody, anti-LGR antibody, or soluble LGR receptor
- the immune checkpoint modulator is an immune checkpoint inhibitor.
- the immune checkpoint modulator is an immune checkpoint enhancer or stimulator.
- a method of enhancing treatment for a subject who is being treated with an immune checkpoint modulator comprises administering to the subject a therapeutically effective amount of a RSPO or LGR antagonist, such as an anti-RSPO or anti-LGR antibody or a soluble LGR receptor.
- the immune checkpoint modulator is an immune checkpoint inhibitor.
- the immune checkpoint inhibitor is a PD-1 antagonist.
- the immune checkpoint inhibitor is an antibody that specifically binds PD-1.
- the immune checkpoint inhibitor is a PD-L 1 antagonist.
- immune checkpoint inhibitor is an antibody that specifically binds PD-L1.
- the immune checkpoint inhibitor is a CTLA-4 antagonist.
- the immune checkpoint inhibitor is an antibody that specifically binds CTLA-4.
- the method of inhibiting tumor growth comprises contacting the tumor or tumor cells with a RSPO or LGR antagonist, such as an anti-RSPO or anti-LGR antibody or a soluble LGR receptor and an immunotherapeutic agent in vivo.
- a RSPO or LGR antagonist such as an anti-RSPO or anti-LGR antibody or a soluble LGR receptor and an immunotherapeutic agent in vivo.
- contacting a tumor or tumor cell with a RSPO or LGR antagonist and an immunotherapeutic agent is undertaken in an animal model.
- a RSPO or LGR antagonist and an immunotherapeutic agent may be administered to mice which have tumors.
- a RSPO or LGR antagonist and an immunotherapeutic agent increases, promotes, and/or enhances the activity of immune cells in the mice.
- a RSPO or LGR antagonist and an immunotherapeutic agent are administered to an animal to inhibit growth of tumors.
- a RSPO or LGR antagonist and an immunotherapeutic agent are administered at the same time or shortly after introduction of tumor cells into the animal (preventative model).
- a RSPO or LGR antagonist and an immunotherapeutic agent are administered after the tumor cells have become established and grown to a tumor of specific size (therapeutic model).
- a method of inhibiting growth of a tumor comprises administering to a subject a therapeutically effective amount of a RSPO or LGR antagonist, such as an anti-RSPO or anti-LGR antibody or a soluble LGR receptor and a therapeutically effective amount of an immunotherapeutic agent.
- a RSPO or LGR antagonist such as an anti-RSPO or anti-LGR antibody or a soluble LGR receptor and a therapeutically effective amount of an immunotherapeutic agent.
- the subject is a human.
- the subject has a tumor or has had a tumor which was removed.
- the tumor comprises cancer stem cells.
- the frequency of cancer stem cells in the tumor is reduced by administration of the RSPO or LGR antagonist.
- the invention also provides a method of reducing or preventing metastasis in a subject comprising administering to the subject a therapeutically effective amount of a RSPO or LGR antagonist (e.g., an anti-RSPO antibody, anti-LGR antibody, or soluble LGR receptor) and a therapeutically effective amount of an immunotherapeutic agent.
- a RSPO or LGR antagonist e.g., an anti-RSPO antibody, anti-LGR antibody, or soluble LGR receptor
- an immunotherapeutic agent e.g., an anti-RSPO antibody, anti-LGR antibody, or soluble LGR receptor
- the reduction or prevention of metastasis comprises inhibiting invasiveness of a tumor.
- the subject is a human.
- the subject has a tumor or has had a tumor removed.
- the invention provides a method of reducing the tumorigenicity of a tumor in a subject, comprising administering to a subject a therapeutically effective amount of a RSPO or LGR antagonist (e.g., an anti-RSPO antibody, anti-LGR antibody, or soluble LGR receptor) and a therapeutically effective amount of an immunotherapeutic agent.
- the tumor comprises cancer stem cells.
- the tumorigenicity of a tumor is reduced by reducing the frequency of cancer stem cells in the tumor.
- the frequency of cancer stem cells in the tumor is reduced by administration of the RSPO or LGR antagonist and the immunotherapeutic agent.
- the tumorigenicity of the tumor is reduced by inducing apoptosis of the tumor cells.
- the tumorigenicity of the tumor is reduced by increasing apoptosis of the tumor cells.
- the invention also provides a method of reducing cancer stem cell frequency in a tumor comprising cancer stem cells, the method comprising administering to a subject a therapeutically effective amount of a RSPO or LGR antagonist (e.g., an anti-RSPO antibody, anti-LGR antibody, or soluble LGR receptor)and a therapeutically effective amount of an immunotherapeutic agent.
- a RSPO or LGR antagonist e.g., an anti-RSPO antibody, anti-LGR antibody, or soluble LGR receptor
- an immunotherapeutic agent e.g., an anti-RSPO antibody, anti-LGR antibody, or soluble LGR receptor
- the RSPO or LGR antagonist in combination with an immunotherapeutic agent is capable of reducing the tumorigenicity of a tumor comprising cancer stem cells in an animal model, such as a mouse model.
- the number or frequency of cancer stem cells in a treated tumor is reduced by at least about two-fold, about three-fold, about five-fold, about ten-fold, about 50-fold, about 100-fold, or about 1000-fold as compared to the number or frequency of cancer stem cells in an untreated tumor.
- the reduction in the number or frequency of cancer stem cells is determined by limiting dilution assay using an animal model.
- the cancer is a cancer selected from the group consisting of lung cancer, pancreatic cancer, breast cancer, colon cancer, colorectal cancer, melanoma, gastrointestinal cancer, gastric cancer, renal cancer, ovarian cancer, liver cancer, endometrial cancer, kidney cancer, prostate cancer, thyroid cancer, neuroblastoma, glioma, glioblastoma, glioblastoma multiforme, cervical cancer, stomach cancer, bladder cancer, head and neck cancer, and hepatoma.
- the cancer is lung cancer.
- the cancer is ovarian cancer.
- the RSPO or LGR antagonist is an RSPO-binding agent. In some embodiments, the RSPO or LGR antagonist is an LGR-binding agent. In some embodiments, the RSPO or LGR antagonist is an antibody. In some embodiments, the RSPO or LGR antagonist is an anti-RSPO antibody. In some embodiments, the RSPO or LGR antagonist is an anti-LGR antibody. In some embodiments, the RSPO or LGR antagonist is the antibody 131R10. In some embodiments, the RSPO or LGR antagonist is a soluble receptor. In some embodiments, the RSPO or LGR antagonist is an LGR-Fc soluble receptor. In some embodiments, the RSPO or LGR antagonist is an LGR5-Fc soluble receptor. In certain embodiments, the LGR5-Fc soluble receptor comprises amino acid sequence of SEQ ID NO: 57.
- the RSPO or LGR antagonist is an antibody that specifically binds at least one RSPO protein or portion thereof.
- the antibody specifically binds at least one human RSPO protein selected from the group consisting of: RSPOl, RSP02, RSP03, and RSP04. In some embodiments, the antibody specifically binds at least one human RSP03.
- the antibody specifically binds at least human RSPO 1.
- the antibody includes (a) a heavy chain CDR1 including TGYTMH (SEQ ID NO:5), a heavy chain CDR2 including GINPNNGGTTYNQNFKG (SEQ ID NO:6), and a heavy chain CDR3 including KEFSDGYYFFAY (SEQ ID NO:7); and/or (b) a light chain CDR1 including
- the antibody includes a heavy chain variable region including an amino acid sequence at least 80%, 85%, 90%, 90%, 95%, or 100% identical to SEQ ID NO: 11 or 44 (e.g., including one, two or three of the heavy chain CDRs mentioned above), and a light chain variable region including an amino acid sequence at least 80%, 85%, 90%, 90%, 95%, or 100% identical to SEQ ID NO: 12 or 45 (e.g., including one, two, or three of the light chain CDRs mentioned above).
- the antibody includes a heavy chain variable region including SEQ ID NO: 1 1 and a light chain variable region including SEQ ID NO: 12.
- the antibody specifically binds at least human RSP02.
- the antibody includes (a) a heavy chain CDR1 including SSYAMS (SEQ ID NO: 17), a heavy chain CDR2 including SISSGGSTYYPDSVKG (SEQ ID NO: 18), and a heavy chain CDR3 including RGGDPGVYNGDYEDAMDY (SEQ ID NO: 19); and (b) a light chain CDR1 including KASQDVSSAVA (SEQ ID NO:20), a light chain CDR2 including WASTRHT (SEQ ID NO:21), and a light chain CDR3 including QQHYSTP (SEQ ID NO:22).
- the antibody includes a heavy chain variable region including an amino acid sequence at least 80%, 85%, 90%, 90%, 95%, or 100% identical to SEQ ID NO:23 (e.g., including one, two, or three of the heavy chain CDRs mentioned above)and a light chain variable region including an amino acid sequence at least 80%, 85%, 90%, 90%, 95%, or 100% identical to SEQ ID NO:24 (e.g., including one, two, or three of the light CDRs mentioned above).
- the antibody specifically binds at least human RSP03.
- the antibody includes (a) a heavy chain CDR1 including DYSIH (SEQ ID NO:29), a heavy chain CDR2 including YIYPSNGDSGYNQKFK (SEQ ID NO:30), and a heavy chain CDR3 including TYFANNFD (SEQ ID NO:31) or ATYF ANNTD Y( SEQ ID NO:32); and (b) a light chain CDR1 including KASQSVDYDGDSYMN (SEQ ID NO:33), a light chain CDR2 including
- AASNLES SEQ ID NO:34
- AAS SEQ ID NO:35
- a light chain CDR3 including
- the antibody includes (a) a heavy chain CDR1 including DYSIH (SEQ ID NO:29), a heavy chain CDR2 including YIYPSNGDSGYNQKFK (SEQ ID NO:30), and a heavy chain CDR3 including
- TYFANNFD SEQ ID NO:31
- a light chain CDR1 including KASQSVDYDGDSYMN SEQ ID NO:33
- a light chain CDR2 including AASNLES SEQ ID NO:34
- a light chain CDR3 including QQSNEDPLT SEQ ID NO:36
- the antibody includes a heavy chain variable region including an amino acid sequence at least 80%, 85%, 90%, 90%, 95%, or 100% identical to SEQ ID NO:38 (e.g., including one, two, or three of the heavy chain CDRs mentioned above), and a light chain variable region including an amino acid sequence at least 80%, 85%, 90%, 90%, 95%, or 100% identical to SEQ ID NO:39 (e.g., including one, two, or three of the light chain CDRs mentioned above).
- the antibody is 131R10.
- the RSPO or LGR antagonist is an antibody that specifically binds at least one human LGR protein (e.g., LGR4, LGR5, and LGR6). In some embodiments, the antibody specifically binds at least human LGR5. In certain embodiments, the antibody includes (a) the heavy chain CDR1, CDR2, and CDR3 sequences of the monoclonal antibody produced by the 88M1 hybridoma having the ATCC deposit number PTA-9342; and (b) the light chain CDR1, CDR2, and CDR3 sequences of the monoclonal antibody produced by the 88M1 hybridoma having the ATCC deposit number PTA-9342. In some embodiments, the antibody includes the heavy chain variable region and light chain variable region of the monoclonal antibody produced by the 88M1 hybridoma having the ATCC deposit number PTA-9342.
- the antibody includes the heavy chain variable region and light chain variable region of the monoclonal antibody produced by the 88M1 hybridoma having the ATCC deposit number PTA-9342
- the antibody is a monoclonal antibody, a recombinant antibody, a chimeric antibody, a humanized antibody, a human antibody, or an antibody fragment comprising an antigen-binding site.
- the antibody is a monospecific antibody or a bispecific antibody.
- the antibody is an IgGl antibody or an IgG2 antibody.
- the RSPO or LGR antagonist is the antibody 131R10 or an antibody that contains the 131R10 CDR regions.
- the RSPO or LGR antagonist is a soluble receptor including an extracellular domain of a human LGR protein (e.g., LGR5), where the extracellular domain is capable of binding a human RSPO protein.
- the extracellular domain of a human LGR protein includes amino acids 22-564 of human LGR5 (SEQ ID NO:56).
- the soluble receptor includes a non-LGR polypeptide.
- the non-LGR polypeptide is directly linked to the extracellular domain of the human LGR protein or is connected to the extracellular domain of the human LGR protein by a linker.
- the non-LGR polypeptide includes a human Fc region (e.g., includes SEQ ID NO:58, SEQ ID NO:59, SEQ ID NO:60, SEQ ID NO:61, or SEQ ID NO:62, or an amino acid sequence at least 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO:58, SEQ ID NO:59, SEQ ID NO:60, SEQ ID NO:61, or SEQ ID NO:62).
- a human Fc region e.g., includes SEQ ID NO:58, SEQ ID NO:59, SEQ ID NO:60, SEQ ID NO:61, or SEQ ID NO:62, or an amino acid sequence at least 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO:58, SEQ ID NO:59, SEQ ID NO:60, SEQ ID NO:61, or SEQ ID NO:62).
- the RSPO or LGR antagonist is an antibody that specifically binds at least one human RSPO protein and the immunotherapeutic agent is a PD-1 antagonist. In some embodiments, the RSPO or LGR antagonist is an antibody that specifically binds at least one human RSPO protein and the immunotherapeutic agent is a PD-L 1 antagonist. In some embodiments, the RSPO or LGR antagonist is an antibody that specifically binds at least one human RSPO protein and the immunotherapeutic agent is a PD-L2 antagonist. In some embodiments, the RSPO or LGR antagonist is an antibody that specifically binds human at least one human RSPO protein and the immunotherapeutic agent is a CTLA-4 antagonist. In some
- the RSPO or LGR antagonist is an antibody that specifically binds at least one human RSPO protein and the immunotherapeutic agent is a CD80 antagonist.
- the immunotherapeutic agent is a CD80 antagonist.
- RSPO or LGR antagonist is an antibody that specifically binds at least one human RSPO protein and the immunotherapeutic agent is a CD86 antagonist.
- the RSPO or LGR antagonist is an antibody that specifically binds at least one human RSPO protein and the
- the immunotherapeutic agent is a KIR antagonist.
- the RSPO or LGR antagonist is an antibody that specifically binds at least one human RSPO protein and the immunotherapeutic agent is a Tim-3 antagonist.
- the RSPO or LGR antagonist is an antibody that specifically binds at least one human RSPO protein and the immunotherapeutic agent is a LAG3 antagonist.
- the RSPO or LGR antagonist is an antibody that specifically binds at least one human RSPO protein and the immunotherapeutic agent is a TIGIT antagonist.
- the RSPO or LGR antagonist is an antibody that specifically binds at least one human RSPO protein and the immunotherapeutic agent is a CD96 antagonist.
- the RSPO or LGR antagonist is an antibody that specifically binds at least one human RSPO protein and the immunotherapeutic agent is an IDOl antagonist. In some embodiments, the RSPO or LGR antagonist is an antibody that specifically binds at least one human RSPO protein and the
- the immunotherapeutic agent is a CD28 agonist.
- the RSPO or LGR antagonist is an antibody that specifically binds at least one human RSPO protein and the immunotherapeutic agent is a 4-1BB agonist.
- the RSPO or LGR antagonist is an antibody that specifically binds at least one human RSPO protein and the immunotherapeutic agent is an OX40 agonist.
- the RSPO or LGR antagonist is an antibody that specifically binds at least one human RSPO protein and the immunotherapeutic agent is a CD27 agonist.
- the RSPO or LGR antagonist is an antibody that specifically binds at least one human RSPO protein and the immunotherapeutic agent is a CD80 agonist.
- the RSPO or LGR antagonist is an antibody that specifically binds at least one human RSPO protein and the immunotherapeutic agent is a CD86 agonist. In some embodiments, the RSPO or LGR antagonist is an antibody that specifically binds at least one human RSPO protein and the immunotherapeutic agent is a CD40 agonist. In some embodiments, the RSPO or LGR antagonist is an antibody that specifically binds at least one human RSPO protein and the immunotherapeutic agent is a GITR agonist. In some embodiments, the RSPO or LGR antagonist is an antibody that specifically binds at least one human RSPO protein and the immunotherapeutic agent is a cytokine. In some embodiments, the RSPO or LGR antagonist is an antibody that specifically binds at least one human RSPO protein and the immunotherapeutic agent is a CD86 agonist. In some embodiments, the RSPO or LGR antagonist is an antibody that specifically binds at least one human RSPO protein and the immunotherapeutic agent is a CD40 agonist.
- the RSPO or LGR antagonist is an antibody that specifically binds at least one human RSPO protein and the immunotherapeutic agent is an interferon. In some embodiments, the RSPO or LGR antagonist is an antibody that specifically binds at least one human RSPO protein and the immunotherapeutic agent is a lymphokine. In any of these embodiments, the RSPO protein is RPS03.
- compositions comprising RSPO or LGR antagonists and compositions comprising immunotherapeutic agents.
- a composition comprises a RSPO or LGR antagonist described herein.
- a composition comprises an antibody that specifically binds at least one human RSPO or LGR protein described herein.
- the composition comprises a soluble receptor comprising the extracellular domain of human LGR protein (e.g., human LGR5) described herein.
- a composition comprises an immunotherapeutic agent described herein.
- a composition is a pharmaceutical composition comprising a RSPO or LGR antagonist and a pharmaceutically acceptable vehicle.
- a composition is a pharmaceutical composition comprising an immunotherapeutic agent and a pharmaceutically acceptable vehicle.
- the pharmaceutical compositions find use in modulating immune responses in human patients, particularly immune responses to tumors.
- the pharmaceutical compositions find use in inhibiting tumor cell growth and treating cancer in human patients.
- the pharmaceutical compositions find use in any of the methods described herein.
- a RSPO or LGR antagonist described herein finds use in the manufacture of a medicament for the treatment of cancer in combination with at least one immunotherapeutic agent.
- a RSPO or LGR antagonist described herein finds use in the manufacture of a medicament for the treatment of cancer in combination with at least one immunotherapeutic agent.
- Formulations and/or pharmaceutical compositions are prepared for storage and use by combining a therapeutic agent of the present invention with a pharmaceutically acceptable carrier, excipient, and/or stabilizer as a sterile lyophilized powder, aqueous solution, etc. (Remington: The Science and Practice of Pharmacy, 22nd Edition, 2012, Pharmaceutical Press, London). Those of skill in the art generally consider pharmaceutically acceptable carriers, excipients, and/or stabilizers to be inactive ingredients of a formulation or pharmaceutical composition.
- Suitable carriers, excipients, or stabilizers comprise nontoxic buffers such as phosphate, citrate, and other organic acids; salts such as sodium chloride; antioxidants including ascorbic acid and methionine; preservatives (e.g.
- octadecyldimethylbenzyl ammonium chloride hexamethonium chloride; benzalkonium chloride; benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens, such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m- cresol); low molecular weight polypeptides (such as less than about 10 amino acid residues); proteins such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as
- polyvinylpyrrolidone amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; carbohydrates such as monosaccharides, disaccharides, glucose, mannose, or dextrins;
- chelating agents such as EDTA
- sugars such as sucrose, mannitol, trehalose, or sorbitol
- salt-forming counter-ions such as sodium
- metal complexes e.g. Zn-protein complexes
- non-ionic surfactants such as polysorbate (TWEEN) or polyethylene glycol (PEG).
- the therapeutic formulation can be in unit dosage form.
- Such formulations include tablets, pills, capsules, powders, granules, solutions or suspensions in water or non-aqueous media, or suppositories for oral, parenteral, or rectal administration or for administration by inhalation.
- solid compositions such as tablets the principal active ingredient is mixed with a pharmaceutical carrier.
- pharmaceutical carriers are considered to be inactive ingredients of a formulation or composition.
- Conventional tableting ingredients include corn starch, lactose, sucrose, sorbitol, talc, stearic acid, magnesium stearate, dicalcium phosphate or gums, and other diluents (e.g.
- a solid pre -formulation composition containing a homogeneous mixture of a compound of the present invention, or a non-toxic pharmaceutically acceptable salt thereof.
- the solid pre-formulation composition is then subdivided into unit dosage forms of the type described above.
- the tablets, pills, etc., of the novel composition can be coated or otherwise compounded to provide a dosage form affording the advantage of prolonged action.
- the tablet or pill can comprise an inner composition covered by an outer component.
- the two components can be separated by an enteric layer that serves to resist disintegration and permits the inner component to pass intact through the stomach or to be delayed in release.
- enteric layers or coatings including a number of polymeric acids and mixtures of polymeric acids with such materials as shellac, cetyl alcohol and cellulose acetate.
- compositions may include the RSPO or LGR antagonists and/or the immunotherapeutic agents of the present invention complexed with liposomes.
- Liposomes can be generated by the reverse phase evaporation with a lipid composition comprising phosphatidylcholine, cholesterol, and PEG-derivatized phosphatidyl ethanolamine (PEG-PE). Liposomes are extruded through filters of defined pore size to yield liposomes with the desired diameter.
- microcapsules can also be entrapped in microcapsules.
- microcapsules are prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly- (methylmethacylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nanoparticles and nanocapsules) or in
- sustained-release preparations comprising RSPO or LGR antagonists and/or immunotherapeutic agents can be prepared.
- Suitable examples of sustained-release preparations include semi-permeable matrices of solid hydrophobic polymers containing the agent, which matrices are in the form of shaped articles (e.g., films or microcapsules).
- sustained-release matrices include polyesters, hydrogels such as poly(2-hydroxyethyl-methacrylate) or
- LUPRON DEPOTTM injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate
- sucrose acetate isobutyrate sucrose acetate isobutyrate
- poly-D-(-)-3-hydroxybutyric acid poly(vinylalcohol)
- the RSPO or LGR antagonists and immunotherapeutic agents are administered as appropriate pharmaceutical compositions to a human patient according to known methods.
- the pharmaceutical compositions can be administered in any number of ways for either local or systemic treatment.
- Suitable methods of administration include, but are not limited to, intravenous (administration as a bolus or by continuous infusion over a period of time), intraarterial, intramuscular (injection or infusion), intratumoral, intraperitoneal, intracerobrospinal, subcutaneous, intra-articular, intrasynovial, intracranial (e.g., intrathecal or intraventricular), or oral.
- administration can be topical, (e.g., transdermal patches, ointments, lotions, creams, gels, drops, suppositories, sprays, liquids and powders) or pulmonary (e.g., by inhalation or insufflation of powders or aerosols, including by nebulizer; intratracheal, intranasal, epidermal and transdermal).
- topical e.g., transdermal patches, ointments, lotions, creams, gels, drops, suppositories, sprays, liquids and powders
- pulmonary e.g., by inhalation or insufflation of powders or aerosols, including by nebulizer; intratracheal, intranasal, epidermal and transdermal.
- the appropriate dosage(s) of a RSPO or LGR antagonist in combination with an immunotherapeutic agent of the present invention depends on the type of disease to be treated, the severity and course of the disease, the responsiveness of the disease, whether the inhibitors are administered for therapeutic or preventative purposes, previous therapy, the patient's clinical history, and so on, all at the discretion of the treating physician.
- the RSPO or LGR antagonist can be administered one time or as a series of treatments spread over several days to several months, or until a cure is effected or a diminution of the disease state is achieved (e.g., reduction in tumor size).
- the immunotherapeutic agent can be administered one time or as a series of treatments spread over several days to several months, or until a cure is effected or a diminution of the disease state is achieved (e.g., reduction in tumor size).
- Optimal dosing schedules for each agent can be calculated from measurements of drug accumulation in the body of the patient and will vary depending on the relative potency of an individual agent. The administering physician can determine optimum dosages, dosing methodologies, and repetition rates.
- combined administration includes co-administration in a single pharmaceutical formulation.
- combined administration includes using separate formulations and consecutive administration in either order but generally within a time period such that all active agents can exert their biological activities simultaneously.
- combined administration includes using separate formulations and a staggered dosing regimen.
- combined administration includes using separate formulations and administration in a specific order.
- combined administration includes using separate formulations and administration of the agents in a specific order and in a staggered dosing regimen.
- dosage of a RSPO or LGR antagonist is from about 0.0 ⁇ g to about lOOmg/kg of body weight, from about O. ⁇ g to about lOOmg/kg of body weight, from about ⁇ g to about lOOmg/kg of body weight, from about lmg to about lOOmg/kg of body weight, about lmg to about 80mg/kg of body weight from about lOmg to about lOOmg/kg of body weight, from about lOmg to about 75mg/kg of body weight, or from about lOmg to about 50mg/kg of body weight. In certain embodiments, the dosage of the RSPO or LGR antagonist is from about 0.
- the RSPO or LGR antagonist is administered to the subject at a dosage of about 2mg/kg to about 15mg/kg. In some embodiments, the RSPO or LGR antagonist is administered to the subject at a dosage of about 5mg/kg to about 15mg/kg. In certain embodiments, the RSPO or LGR antagonist is administered once or more daily, weekly, monthly, or yearly. In certain embodiments, the RSPO or LGR antagonist is administered once every week, once every two weeks, once every three weeks, or once every four weeks.
- dosage of an immunotherapeutic agent is from about O.O ⁇ g to about lOOmg/kg of body weight, from about O. ⁇ g to about lOOmg/kg of body weight, from about ⁇ g to about lOOmg/kg of body weight, from about lmg to about lOOmg/kg of body weight, about lmg to about 80mg/kg of body weight from about lOmg to about lOOmg/kg of body weight, from about lOmg to about 75mg/kg of body weight, or from about lOmg to about 50mg/kg of body weight. In certain embodiments, the dosage of an immunotherapeutic agent is from about 0.
- an immunotherapeutic agent is administered to the subject at a dosage of about 2mg/kg to about 15mg/kg.
- the RSPO or LGR antagonist is administered to the subject at a dosage of about 5mg/kg to about 15mg/kg.
- an immunotherapeutic agent is administered once or more daily, weekly, monthly, or yearly.
- an immunotherapeutic agent is administered once every week, once every two weeks, once every three weeks, or once every four weeks.
- dosage of an immunotherapeutic agent is determined by what is considered "standard-of-care" for a particular agent by those of skill in the art (e.g., treating physicians).
- an inhibitor may be administered at an initial higher "loading" dose, followed by one or more lower doses.
- the frequency of administration may also change.
- a dosing regimen may comprise administering an initial dose, followed by additional doses (or "maintenance" doses) once a week, once every two weeks, once every three weeks, or once every month.
- a dosing regimen may comprise administering an initial loading dose, followed by a weekly maintenance dose of, for example, one-half of the initial dose.
- a dosing regimen may comprise administering an initial loading dose, followed by maintenance doses of, for example one-half of the initial dose every other week.
- a dosing regimen may comprise administering three initial doses for 3 weeks, followed by maintenance doses of, for example, the same amount every other week.
- any therapeutic agent may lead to side effects and/or toxicities.
- the side effects and/or toxicities are so severe as to preclude administration of the particular agent at a therapeutically effective dose.
- drug therapy must be discontinued, and other agents may be tried.
- many agents in the same therapeutic class often display similar side effects and/or toxicities, meaning that the patient either has to stop therapy, or if possible, suffer from the unpleasant side effects associated with the therapeutic agent.
- the present invention provides methods of treating cancer in a subject comprising using a dosing strategy for administering two or more agents that may reduce side effects and/or toxicities associated with administration of a RSPO or LGR antagonist and/or an immunotherapeutic agent.
- a method for treating cancer in a human subject comprises administering to the subject a therapeutically effective dose of a RSPO or LGR antagonist in combination with a therapeutically effective dose of an immunotherapeutic agent, where one or both of the inhibitors are administered according to an intermittent dosing strategy.
- the intermittent dosing strategy comprises administering an initial dose of a RSPO or LGR antagonist to the subject, and administering subsequent doses of the RSPO or LGR antagonist about once every 2 weeks.
- the intermittent dosing strategy comprises administering an initial dose of a RSPO or LGR antagonist to the subject, and administering subsequent doses of the RSPO or LGR antagonist about once every 3 weeks. In some embodiments, the intermittent dosing strategy comprises administering an initial dose of a RSPO or LGR antagonist to the subject, and
- the RSPO or LGR antagonist is administered using an intermittent dosing strategy and the immunotherapeutic agent is administered weekly or every week for 3 weeks out of 4.
- Combination therapy with two or more therapeutic agents often uses agents that work by different mechanisms of action, although this is not required. Combination therapy using agents with different mechanisms of action may result in additive or synergetic effects. Combination therapy may allow for a lower dose of each agent than is used in monotherapy, thereby reducing toxic side effects and/or increasing the therapeutic index of the agent(s). Combination therapy may decrease the likelihood that resistant cancer cells will develop. Combination therapy comprising an
- immunotherapeutic agent may allow one agent to enhance the immune response to a tumor or tumor cells while the other agent may be effective at killing tumor cells more directly.
- the immunotherapeutic agent results in additive or synergetic results.
- the combination therapy results in an increase in the therapeutic index of the RSPO or LGR antagonist.
- the combination therapy results in an increase in the therapeutic index of the immunotherapeutic agent.
- the combination therapy results in a decrease in the toxicity and/or side effects of the RSPO or LGR antagonist.
- the combination therapy results in a decrease in the toxicity and/or side effects of the immunotherapeutic agent.
- the treating physician can estimate repetition rates for dosing based on measured residence times and concentrations of the drug in bodily fluids or tissues.
- the progress of therapy can be monitored by conventional techniques and assays.
- treatment methods may further comprise
- the additional therapeutic agent(s) will be administered substantially simultaneously or concurrently with the RSPO or LGR antagonist or the immunotherapeutic agent.
- a subject may be given the RSPO or LGR antagonist and the immunotherapeutic agent while undergoing a course of treatment with the additional therapeutic agent (e.g., additional chemotherapeutic agent).
- the RSPO or LGR antagonist and the immunotherapeutic agent will be administered within 1 year of the treatment with the additional therapeutic agent.
- the RSPO or LGR antagonist and the immunotherapeutic agent will be administered within 10, 8, 6, 4, or 2 months of any treatment with the additional therapeutic agent.
- the RSPO or LGR antagonist and the immunotherapeutic agent will be administered within 4, 3, 2, or 1 week of any treatment with the additional therapeutic agent.
- the RSPO or LGR antagonist and the immunotherapeutic agent will be administered within 5, 4, 3, 2, or 1 days of any treatment with the additional therapeutic agent. It will further be appreciated that the agents or treatment may be administered to the subject within a matter of hours or minutes (i.e., substantially simultaneously) with the RSPO or LGR antagonist or the immunotherapeutic agent.
- Therapeutic agents that may be administered in combination with a RSPO or LGR antagonist and an immunotherapeutic agent include chemotherapeutic agents.
- the method or treatment involves the administration of a RSPO or LGR antagonist and
- immunotherapeutic agent of the present invention in combination with a chemotherapeutic agent or cocktail of multiple different chemotherapeutic agents.
- Treatment with a RSPO or LGR antagonist and immunotherapeutic agent can occur prior to, concurrently with, or subsequent to administration of chemotherapies.
- Preparation and dosing schedules for such chemotherapeutic agents can be used according to manufacturers' instructions or as determined empirically by the skilled practitioner. Preparation and dosing schedules for such chemotherapy are also described in Chemotherapy Service, 1992, M. C. Perry, Editor, Williams & Wilkins, Baltimore, MD.
- Chemotherapeutic agents useful in the instant invention include, but are not limited to, alkylating agents such as thiotepa and cyclosphosphamide; alkyl sulfonates such as busulfan, improsulfan, and piposulfan; aziridines such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylamelamines including altretamine, triethylenemelamine,
- trietylenephosphoramide triethylenethiophosphaoramide and trimethylolomelamime
- nitrogen mustards such as chlorambucil, chlornaphazine, cholophosphamide, estramustine, ifosfamide, mechlorethamine, mechlorethamine oxide hydrochloride, melphalan, novembichin, phenesterine, prednimustine, trofosfamide, uracil mustard
- nitrosureas such as carmustine, chlorozotocin, fotemustine, lomustine, nimustine, ranimustine
- antibiotics such as aclacinomysins, actinomycin, authramycin, azaserine, bleomycins, cactinomycin, calicheamicin, carabicin, caminomycin, carzinophilin, chromomycins, dactinomycin, daunorubicin, detorubicin, 6-di
- aldophosphamide glycoside aminolevulinic acid; amsacrine; bestrabucil; bisantrene; edatraxate; defofamine; demecolcine; diaziquone; elformithine; elliptinium acetate; etoglucid; gallium nitrate; hydroxyurea; lentinan; lonidamine; mitoguazone; mitoxantrone; mopidamol; nitracrine; pentostatin; phenamet; pirarubicin; podophyllinic acid; 2-ethylhydrazide; procarbazine; PSK.; razoxane;
- ifosfamide ifosfamide; mitomycin C; mitoxantrone; novantrone; teniposide; daunomycin; aminopterin; xeloda; ibandronate; CPT1 1 ; topoisomerase inhibitor RFS 2000; difluoromethylornithine (DMFO); retinoic acid; esperamicins; capecitabine; and pharmaceutically acceptable salts, acids or derivatives of any of the above.
- DMFO difluoromethylornithine
- Chemotherapeutic agents also include anti-hormonal agents that act to regulate or inhibit hormone action on tumors such as anti-estrogens including for example tamoxifen, raloxifene, aromatase inhibiting 4(5)-imidazoles, 4-hydroxytamoxifen, trioxifene, keoxifene, LY1 17018, onapristone, and toremifene; and antiandrogens such as flutamide, nilutamide, bicalutamide, leuprolide, and goserelin; and pharmaceutically acceptable salts, acids or derivatives of any of the above.
- anti-estrogens including for example tamoxifen, raloxifene, aromatase inhibiting 4(5)-imidazoles, 4-hydroxytamoxifen, trioxifene, keoxifene, LY1 17018, onapristone, and toremifene
- antiandrogens such as flutamide, nil
- the chemotherapeutic agent is a topoisomerase inhibitor.
- Topoisomerase inhibitors are chemotherapy agents that interfere with the action of a topoisomerase enzyme (e.g., topoisomerase I or II).
- Topoisomerase inhibitors include, but are not limited to, doxorubicin HC1, daunorubicin citrate, mitoxantrone HC1, actinomycin D, etoposide, topotecan HC1, teniposide (VM-26), and irinotecan.
- the chemotherapeutic agent is an anti -metabolite.
- An anti -metabolite is a chemical with a structure that is similar to a metabolite required for normal biochemical reactions, yet different enough to interfere with one or more normal functions of cells, such as cell division.
- Anti-metabolites include, but are not limited to, gemcitabine, fluorouracil, capecitabine, methotrexate sodium, ralitrexed, pemetrexed, tegafur, cytosine arabinoside, thioguanine, 5-azacytidine, 6- mercaptopurine, azathioprine, 6-thioguanine, pentostatin, fludarabine phosphate, and cladribine, as well as pharmaceutically acceptable salts, acids, or derivatives of any of these.
- the chemotherapeutic agent is an antimitotic agent, including, but not limited to, agents that bind tubulin.
- the agent is a taxane.
- the agent is paclitaxel or docetaxel, or a pharmaceutically acceptable salt, acid, or derivative of paclitaxel or docetaxel.
- the agent is paclitaxel (TAXOL), docetaxel (TAXOTERE), albumin-bound paclitaxel (ABRAXANE ® ), DHA-paclitaxel, or PG- paclitaxel.
- the antimitotic agent comprises a vinca alkaloid, such as vincristine, binblastine, vinorelbine, or vindesine, or pharmaceutically acceptable salts, acids, or derivatives thereof.
- the antimitotic agent is an inhibitor of kinesin Eg5 or an inhibitor of a mitotic kinase such as Aurora A or Plkl .
- an additional therapeutic agent that may be administered in combination with a RSPO or LGR antagonist and an immunotherapeutic agent comprises an agent such as a small molecule.
- treatment can involve the combined administration of a RSPO or LGR antagonist and an immunotherapeutic agent with a small molecule that acts as an inhibitor against tumor-associated antigens including, but not limited to, EGFR, HER2 (ErbB2), and/or VEGF.
- a RSPO or LGR antagonist and an immunotherapeutic agent are administered in combination with a protein kinase inhibitor selected from the group consisting of: gefitinib (IRESSA), erlotinib (TARCEVA), sunitinib (SUTENT), lapatanib, vandetanib (ZACTIMA), AEE788, CI-1033, cediranib (RECENTIN), sorafenib (NEXAVAR), and pazopanib (GW786034B).
- IRESSA gefitinib
- TARCEVA sunitinib
- ZACTIMA ZACTIMA
- AEE788, CI-1033 cediranib
- sorafenib NEXAVAR
- GW786034B pazopanib
- an additional therapeutic agent comprises a biological molecule, such as an antibody.
- treatment can involve the combined administration of a RSPO or LGR antagonist and an immunotherapeutic agent with antibodies against tumor-associated antigens including, but not limited to, antibodies that bind EGFR, HER2/ErbB2, and/or VEGF.
- the additional therapeutic agent is an antibody specific for a cancer stem cell marker.
- the additional therapeutic agent is an antibody that inhibits a cancer stem cell pathway.
- the additional therapeutic agent is an antibody that is an angiogenesis inhibitor (e.g., an anti-VEGF or VEGF receptor antibody).
- the additional therapeutic agent is bevacizumab (AVASTIN), ramucirumab, trastuzumab (HERCEPTIN), pertuzumab (OMNITARG), panitumumab (VECTIBIX), nimotuzumab, zalutumumab, or cetuximab (ERBITUX).
- treatment can involve the combined administration of a RSPO or LGR antagonist and an immunotherapeutic agent with other biologic molecules, such as one or more cytokines (e.g., lymphokines, interleukins, tumor necrosis factors, and/or growth factors) or can be accompanied by surgical removal of tumors, removal of cancer cells, or any other therapy deemed necessary by a treating physician.
- cytokines e.g., lymphokines, interleukins, tumor necrosis factors, and/or growth factors
- treatment can involve the combined administration of a RSPO or LGR antagonist and an immunotherapeutic agent with a growth factor selected from the group consisting of, but not limited to: adrenomedullin (AM), angiopoietin (Ang), BMPs, BDNF, EGF, erythropoietin (EPO), FGF, GDNF, G-CSF, GM-CSF, GDF9, HGF, HDGF, IGF, migration-stimulating factor, myostatin (GDF-8), NGF, neurotrophins, PDGF, thrombopoietin, TGF-a, TGF- ⁇ , TNF-a, VEGF, P1GF, IL-1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-12, IL-15, and IL-18.
- a growth factor selected from the group consisting of, but not limited to: adrenomedullin (AM), angiopoi
- treatment can involve the combined administration of a RSPO or LGR antagonist and an immunotherapeutic agent with radiation therapy.
- Treatment with a RSPO or LGR antagonist and an immunotherapeutic agent can occur prior to, concurrently with, or subsequent to administration of radiation therapy. Dosing schedules for such radiation therapy can be determined by the skilled medical practitioner.
- the RSPO or LGR antagonist binds one or more RSPO or LGR proteins. In certain embodiments, the RSPO or LGR antagonist binds one or more extracellular region(s) of LGR. In certain embodiments, the RSPO or LGR antagonist inhibits ⁇ -catenin signaling. In certain embodiments, the RSPO or LGR antagonist modulates Wnt mediated ⁇ -catenin signaling.
- the RSPO or LGR antagonist binds one or more human RSPO proteins.
- These agents are referred to herein as "RSPO-binding agents".
- RSPO-binding agents can be found in U.S. Patent Nos. 8158758, 8158757, 8802097, 8088374, and U.S. Patent Publication Nos. 2014/0017253, 2014/0134703, 2013/0337533, 2014/0186917,
- the RSPO-binding agent is an antibody. In some embodiments, the RSPO-binding agent is a polypeptide. In certain embodiments, the RSPO-binding agent binds RSPO l ("RSPOl -binding agents"). In certain embodiments, the RSPO-binding agent binds RSP02 ("RSP02- binding agents"). In certain embodiments, the RSPO-binding agent binds RSP03 ("RSP03-binding agents"). In certain embodiments, the RSPO-binding agent specifically binds one or more human RSPO proteins.
- RSPOl full-length amino acid sequences for human RSPOl, RSP02, RSP03, and RSP04 are known in the art and are provided herein as SEQ ID NO: 1 (RSPO l), SEQ ID NO:2 (RSP02), SEQ ID NO:3 (RSP03), and SEQ ID NO:4 (RSP04).
- the antigen-binding site of an RSPO-binding agent (e.g., an antibody or a bispecific antibody) described herein is capable of binding (or binds) one, two, three, or four RSPOs.
- the antigen-binding site of an RSPO-binding agent (e.g., an antibody or a bispecific antibody) described herein is capable of binding (or binds) a first RSPO protein (e.g., RSPO 1) as well as one, two, or three other RSPOs (e.g., RSP02, RSP03, and/or RSP04).
- the RSPO-binding agent (e.g., antibody) specifically binds both human RSPO and mouse RSPO.
- the RSPO-binding agent is an antibody that specifically binds within amino acids 21-263 of human RSPOl (SEQ ID NO: l). In certain embodiments, the RSPO-binding agent is an antibody that specifically binds within amino acids 31-263 of human RSPOl (SEQ ID NO: 1). In certain embodiments, the RSPO-binding agent is an antibody that specifically binds within amino acids 34-135 of human RSPOl (SEQ ID NO: 1). In certain embodiments, the RSPO-binding agent is an antibody that specifically binds within amino acids 34-85 of human RSPO l (SEQ ID NO: 1).
- the RSPO-binding agent is an antibody that specifically binds within amino acids 91-135 of human RSPOl (SEQ ID NO: 1). In certain embodiments, the RSPO-binding agent is an antibody that specifically binds within amino acids 147-207 of human RSPOl (SEQ ID NO: 1). In certain embodiments, the RSPO-binding agent binds a furin-like cysteine-rich domain of RSPOl. In some embodiments, the RSPO-binding agent binds at least one amino acid within a furin- like cysteine-rich domain of RSPO l . In some embodiments, the RSPO-binding agent binds the thrombospondin domain of RSPO 1. In some embodiments, the RSPO-binding agent binds at least one amino acid within the thrombospondin domain of RSPO 1.
- the RSPO-binding agent is an antibody that specifically binds within amino acids 22-243 of human RSP02 (SEQ ID NO:2).
- the RSPO-binding agent is an antibody that specifically binds within amino acids 22-205 of human RSP02 (SEQ ID NO:2).
- the RSPO-binding agent is an antibody that specifically binds within amino acids 35-134 of human RSP02 (SEQ ID NO:2).
- the RSPO-binding agent is an antibody that specifically binds within amino acids 34-84 of human RSP02 (SEQ ID NO:2).
- the RSPO-binding agent is an antibody that specifically binds within amino acids 90-134 of human RSP02 (SEQ ID NO:2). hi certain embodiments, the RSPO-binding agent binds a furin-like cysteine-rich domain of RSP02. hi some embodiments, the RSPO-binding agent binds at least one amino acid within a furin-like cysteine-rich domain of RSP02. In some embodiments, the RSPO-binding agent binds the thrombospondin domain of RSP02. In some embodiments, the RSPO-binding agent binds at least one amino acid within the thrombospondin domain of RSP02.
- the RSPO-binding agent is an antibody that specifically binds within amino acids 22-272 of human RSP03 (SEQ ID NO:3).
- the RSPO-binding agent is an antibody that specifically binds within amino acids 22-207 of human RSP03 (SEQ ID NO:3).
- the RSPO-binding agent is an antibody that specifically binds within amino acids 35-135 of human RSP03 (SEQ ID NO:3).
- the RSPO-binding agent is an antibody that specifically binds within amino acids 35-86 of human RSP03 (SEQ ID NO:3).
- the RSPO-binding agent is an antibody that specifically binds within amino acids 92-135 of human RSP03 (SEQ ID NO:3). In certain embodiments, the RSPO-binding agent binds a furin-like cysteine-rich domain of RSP03. In some embodiments, the RSPO-binding agent binds at least one amino acid within a furin-like cysteine-rich domain of RSP03. In some embodiments, the RSPO-binding agent binds the thrombospondin domain of RSP03. In some embodiments, the RSPO-binding agent binds at least one amino acid within the thrombospondin domain of RSP03.
- the RSPO-binding agent or antibody binds at least one RSPO protein with a dissociation constant (KD) of about ⁇ or less, about lOOnM or less, about 40nM or less, about 20nM or less, about ⁇ or less, about InM or less, or about O. lnM or less.
- an RSPO-binding agent or antibody binds at least one RSPO protein with a dissociation constant (KD) of about ⁇ or less, about lOOnM or less, about 40nM or less, about 20nM or less, about ⁇ or less, about InM or less, or about 0. InM or less.
- an RSPO- binding agent or antibody binds at least one RSPO protein with a KD of about 20nM or less. In some embodiments, an RSPO-binding agent or antibody binds at least one RSPO protein with a KD of about ⁇ or less. In some embodiments, an RSPO-binding agent or antibody binds at least one RSPO protein with a KD of about InM or less. In some embodiments, an RSPO-binding agent or antibody binds at least one RSPO protein with a KD of about 0.5nM or less. In some embodiments, an RSPO-binding agent or antibody binds at least one RSPO protein with a KD of about O. lnM or less. In certain embodiments, an RSPO-binding agent or antibody described herein binds at least two
- the RSPO-binding agent binds both human RSPO and mouse RSPO with a KD of about ⁇ or less. In some embodiments, an RSPO-binding agent binds both human RSPO and mouse RSPO with a KD of about InM or less. In some embodiments, an RSPO- binding agent binds both human RSPO and mouse RSPO with a KD of about O. lnM or less.
- the dissociation constant of a binding agent (e.g., an antibody) to an RSPO protein is the dissociation constant determined using an RSPO fusion protein comprising at least a portion of the RSPO protein immobilized on a Biacore chip.
- the dissociation constant of a binding agent (e.g., an antibody) to an RSPO protein is the dissociation constant determined using the binding agent captured by an anti-human IgG antibody on a Biacore chip and an RSPO protein.
- the RSPO-binding agent binds to at least one human RSPO protein with a half maximal effective concentration (EC50) of about ⁇ or less, about lOOnM or less, about 40nM or less, about 20nM or less, about ⁇ or less, about InM or less, or about 0. InM or less.
- an RSPO-binding agent binds to at least one human RSPO with a half maximal effective concentration (EC50) of about ⁇ or less, about lOOnM or less, about 40nM or less, about 20nM or less, about ⁇ or less, about InM or less, or about 0.
- the RSPO-binding agent is an RSPO l-binding agent (e.g., an antibody) that specifically binds human RSPO l, wherein the RSPOl-binding agent (e.g., an antibody) comprises one, two, three, four, five, and/or six of the CDRs of antibody 89M5 (see Table 1).
- the RSPOl-binding agent e.g., an antibody
- the RSPO-binding agent is an RSPO l-binding agent (e.g., an antibody) that specifically binds human RSPO 1 , wherein the RSPO 1 -binding agent comprises a heavy chain CDR1 comprising TGYTMH (SEQ ID NO:5), a heavy chain CDR2 comprising
- the RSPO 1 -binding agent further comprises a light chain CDR1 comprising KASQDVIFAVA (SEQ ID NO: 8), a light chain CDR2 comprising WASTRHT (SEQ ID NO:9), and a light chain CDR3 comprising QQHYSTPW (SEQ ID NO: 10).
- the RSPOl-binding agent comprises a light chain CDR1 comprising KASQDVIFAVA (SEQ ID NO: 8), a light chain CDR2 comprising WASTRHT (SEQ ID NO:9), and a light chain CDR3 comprising QQHYSTPW (SEQ ID NO: 10).
- the RSPO 1- binding agent comprises: (a) a heavy chain CDR1 comprising TGYTMH (SEQ ID NO:5), a heavy chain CDR2 comprising GINPNNGGTTYNQNFKG (SEQ ID NO:6), and a heavy chain CDR3 comprising KEFSDGYYFFAY (SEQ ID NO:7); and (b) a light chain CDR1 comprising KASQDVIFAVA (SEQ ID NO: 8), a light chain CDR2 comprising WASTRHT (SEQ ID NO:9), and a light chain CDR3 comprising QQHYSTPW (SEQ ID NO: 10).
- the RSPO-binding agent is an RSPO l-binding agent (e.g., an antibody or bispecific antibody) that specifically binds human RSPO 1 , wherein the RSPO 1 -binding agent comprises: (a) a heavy chain CDR1 comprising TGYTMH (SEQ ID NO:5) or a variant thereof comprising 1, 2, 3, or 4 amino acid substitutions; (b) a heavy chain CDR2 comprising
- GINPNNGGTTYNQNFKG SEQ ID NO:6 or a variant thereof comprising 1, 2, 3, or 4 amino acid substitutions
- a heavy chain CDR3 comprising KEFSDGYYFFAY (SEQ ID NO:7) or a variant thereof comprising 1, 2, 3, or 4 amino acid substitutions
- a light chain CDR1 comprising
- KASQDVIFAVA (SEQ ID NO: 8) or a variant thereof comprising 1, 2, 3, or 4 amino acid substitutions; (e) a light chain CDR2 comprising WASTRHT (SEQ ID NO: 9) or a variant thereof comprising 1, 2, 3, or 4 amino acid substitutions; and (f) a light chain CDR3 comprising
- QQHYSTPW (SEQ ID NO: 10) or a variant thereof comprising 1, 2, 3, or 4 amino acid substitutions.
- the amino acid substitutions are conservative substitutions.
- the substitutions are made as part of a germline humanization process.
- the RSPO-binding agent is an RSPO l-binding agent (e.g., an antibody) that specifically binds RSPOl, wherein the RSPOl-binding agent comprises a heavy chain variable region having at least about 80% sequence identity to SEQ ID NO: 11 and/or a light chain variable region having at least 80% sequence identity to SEQ ID NO: 12.
- the RSPOl-binding agent comprises a heavy chain variable region having at least about 85%, at least about 90%, at least about 95%, at least about 97%, or at least about 99% sequence identity to SEQ ID NO: 11.
- the RSPO l-binding agent comprises a light chain variable region having at least about 85%, at least about 90%, at least about 95%, at least about 97%, or at least about 99% sequence identity to SEQ ID NO: 12. In certain embodiments, the RSPOl-binding agent comprises a heavy chain variable region having at least about 95% sequence identity to SEQ ID NO: 11 and/or a light chain variable region having at least about 95% sequence identity to SEQ ID NO: 12. In certain embodiments, the RSPO l-binding agent comprises a heavy chain variable region comprising SEQ ID NO: 11, and/or a light chain variable region comprising SEQ ID NO: 12.
- the RSPOl-binding agent comprises a heavy chain variable region comprising SEQ ID NO: 11 and a light chain variable region comprising SEQ ID NO: 12. In certain embodiments, the RSPOl-binding agent comprises a heavy chain variable region consisting of SEQ ID NO: 11 and a light chain variable region consisting of SEQ ID NO: 12.
- the RSPO-binding agent is an RSPO l-binding agent (e.g., an antibody) that specifically binds RSPOl, wherein the RSPOl-binding agent comprises a heavy chain variable region having at least about 80% sequence identity to SEQ ID NO:44 and/or a light chain variable region having at least 80% sequence identity to SEQ ID NO:45. In certain embodiments, the RSPOl-binding agent comprises a heavy chain variable region having at least about 85%, at least about 90%, at least about 95%, at least about 97%, or at least about 99% sequence identity to SEQ ID NO: 44.
- the RSPO l-binding agent comprises a light chain variable region having at least about 85%, at least about 90%, at least about 95%, at least about 97%, or at least about 99% sequence identity to SEQ ID NO:45. In certain embodiments, the RSPOl-binding agent comprises a heavy chain variable region having at least about 95% sequence identity to SEQ ID NO: 44 and/or a light chain variable region having at least about 95% sequence identity to SEQ ID NO: 45. In certain embodiments, the RSPO l-binding agent comprises a heavy chain variable region comprising SEQ ID NO:44 and/or a light chain variable region comprising SEQ ID NO:45.
- the RSPOl-binding agent comprises a heavy chain variable region comprising SEQ ID NO:44 and a light chain variable region comprising SEQ ID NO:45. In certain embodiments, the RSPOl-binding agent comprises a heavy chain variable region consisting of SEQ ID NO:44 and a light chain variable region consisting of SEQ ID NO:45.
- the RSPO-binding agent is an RSPO 1-binding agent (e.g., an antibody) that specifically binds RSPOl, wherein the RSPOl-binding agent comprises: (a) a heavy chain having at least 90% sequence identity to SEQ ID NO: 13 or SEQ ID NO: 14; and/or (b) a light chain having at least 90% sequence identity to SEQ ID NO: 15 or SEQ ID NO: 16.
- the RSPOl-binding agent comprises: (a) a heavy chain having at least 95% sequence identity to SEQ ID NO: 13 or SEQ ID NO: 14; and/or (b) a light chain having at least 95% sequence identity to SEQ ID NO: 15 or SEQ ID NO: 16.
- the RSPOl-binding agent comprises a heavy chain comprising SEQ ID NO: 14 and/or a light chain comprising SEQ ID NO: 16. In some embodiments, the RSPO l-binding agent comprises a heavy chain comprising SEQ ID NO: 14 and a light chain comprising SEQ ID NO: 16.
- the RSPO-binding agent is an RSPO 1-binding agent (e.g., an antibody) that specifically binds RSPOl, wherein the RSPOl-binding agent comprises: (a) a heavy chain having at least 90% sequence identity to SEQ ID NO:46 or SEQ ID NO:47; and/or (b) a light chain having at least 90% sequence identity to SEQ ID NO:48 or SEQ ID NO:49.
- RSPO 1-binding agent e.g., an antibody
- the RSPOl-binding agent comprises: (a) a heavy chain having at least 90% sequence identity to SEQ ID NO:46 or SEQ ID NO:47; and/or (b) a light chain having at least 90% sequence identity to SEQ ID NO:48 or SEQ ID NO:49.
- the RSPOl-binding agent comprises: (a) a heavy chain having at least 95% sequence identity to SEQ ID NO:46 or SEQ ID NO:47; and/or (b) a light chain having at least 95% sequence identity to SEQ ID NO:48 or SEQ ID NO:49.
- the RSPOl-binding agent comprises a heavy chain comprising SEQ ID NO:47 and/or a light chain comprising SEQ ID NO:49.
- the RSPO l-binding agent comprises a heavy chain comprising SEQ ID NO:47 and a light chain comprising SEQ ID NO: 49.
- an RSPOl-binding agent comprises the heavy chain variable region and light chain variable region of antibody h89M5-H8L5. In certain embodiments, an RSPOl-binding agent comprises the heavy chain and light chain of antibody h89M5-H8L5 (with or without the leader sequence). In certain embodiments, an RSPOl-binding agent is antibody h89M5-H8L5. In certain embodiments, an RSPO l-binding agent comprises the heavy chain variable region and/or light chain variable region of antibody h89M5-H8L5 in a chimeric form of the antibody. In some embodiments, the anti-RSPO 1 antibody is h89M5-H8L5.
- an RSPOl-binding agent comprises the heavy chain variable region and light chain variable region of antibody h89M5-H2L2. In certain embodiments, an RSPOl-binding agent comprises the heavy chain and light chain of antibody h89M5-H2L2 (with or without the leader sequence). In certain embodiments, an RSPOl-binding agent is antibody h89M5-H2L2. In certain embodiments, an RSPO 1 -binding agent comprises the heavy chain variable region and/or light chain variable region of antibody h89M5-H2L2 in a chimeric form of the antibody. In some embodiments, the anti-RSPO 1 antibody is h89M5-H2L2.
- an RSPOl-binding agent comprises the heavy chain CDRs and/or light chain CDRs of antibody 89M5.
- the hybridoma cell line producing the 89M5 antibody was deposited with American Type Culture Collection (ATCC), 10801 University Boulevard, Manassas, VA, USA, under the conditions of the Budapest Treaty on June 30, 2011 and assigned ATCC deposit designation number PTA-11970.
- the RSPO l-binding agent comprises a heavy chain variable region encoded by the plasmid deposited with ATCC and designated PTA-121494. In some embodiments, the RSPOl-binding agent comprises a light chain variable region encoded by the plasmid deposited with ATCC and designated PTA-121495.
- the RSPOl-binding agent comprises a heavy chain variable region encoded by the plasmid deposited with ATCC and designated PTA- 121494 and a light chain variable region encoded by the plasmid deposited with ATCC and designated PTA-121495. In some embodiments, the RSPOl-binding agent comprises a heavy chain encoded by the plasmid deposited with ATCC and designated PTA-121494. In some embodiments, the RSPOl-binding agent comprises a light chain encoded by the plasmid deposited with ATCC and designated PTA-121495.
- the RSPOl-binding agent comprises a heavy chain encoded by the plasmid deposited with ATCC and designated PTA-121494 and a light chain encoded by the plasmid deposited with ATCC and designated PTA-121495.
- an RSPOl-binding agent comprises, consists essentially of, or consists of, antibody h89M5-H8L5. In certain embodiments, an RSPOl-binding agent comprises, consists essentially of, or consists of, a variant of antibody 89M5. In certain embodiments, an RSPOl- binding agent comprises, consists essentially of, or consists of, a variant of antibody h89M5-H8L5. [00195] In certain embodiments, an RSPOl -binding agent comprises, consists essentially of, or consists of, antibody h89M5-H2L2.
- an RSPO l-binding agent comprises, consists essentially of, or consists of, a variant of antibody 89M5. In certain embodiments, an RSPOl- binding agent comprises, consists essentially of, or consists of, a variant of antibody h89M5-H2L2.
- the RSPO-binding agent is an
- RSP02-binding agent e.g., an antibody
- the RSP02-binding agent comprises one, two, three, four, five, and/or six of the CDRs of antibody 130M23 (see Table 1).
- the RSPO-binding agent is an RSP02-binding agent (e.g., an antibody) that specifically binds human RSP02, wherein the RSP02-binding agent comprises a heavy chain CDRl comprising SSYAMS (SEQ ID NO: 17), a heavy chain CDR2 comprising
- the RSP02-binding agent further comprises a light chain CDRl comprising KASQDVSSAVA (SEQ ID NO:20), a light chain CDR2 comprising WASTRHT (SEQ ID NO:21), and a light chain CDR3 comprising QQHYSTP (SEQ ID NO:22).
- the RSP02-binding agent comprises a light chain CDRl comprising KASQDVSSAVA (SEQ ID NO:20), a light chain CDR2 comprising WASTRHT (SEQ ID NO:21), and a light chain CDR3 comprising QQHYSTP (SEQ ID NO:22).
- the RSP02-binding agent comprises: (a) a heavy chain CDRl comprising SSYAMS (SEQ ID NO: 17), a heavy chain CDR2 comprising SISSGGSTYYPDSVKG (SEQ ID NO: 18), and a heavy chain CDR3 comprising RGGDPGVYNGDYEDAMDY (SEQ ID NO: 19); and (b) a light chain CDRl comprising KASQDVSSAVA (SEQ ID NO:20), a light chain CDR2 comprising WASTRHT (SEQ ID NO:21), and a light chain CDR3 comprising QQHYSTP (SEQ ID NO:22).
- the RSPO-binding agent is an RSP02-binding agent (e.g., an antibody or bispecific antibody) that specifically binds human RSP02, wherein the RSP02-binding agent comprises: (a) a heavy chain CDRl comprising SSYAMS (SEQ ID NO: 17) or a variant thereof comprising 1, 2, 3, or 4 amino acid substitutions; (b) a heavy chain CDR2 comprising
- SISSGGSTYYPDSVKG SEQ ID NO: 18 or a variant thereof comprising 1, 2, 3, or 4 amino acid substitutions
- a heavy chain CDR3 comprising RGGDPGVYNGDYEDAMDY (SEQ ID NO: 19) or a variant thereof comprising 1, 2, 3, or 4 amino acid substitutions
- a light chain CDRl comprising KASQDVSSAVA (SEQ ID NO:20) or a variant thereof comprising 1, 2, 3, or 4 amino acid substitutions
- a light chain CDR2 comprising WASTRHT (SEQ ID NO:21) or a variant thereof comprising 1, 2, 3, or 4 amino acid substitutions
- a light chain CDR3 comprising QQHYSTP (SEQ ID NO:22) or a variant thereof comprising 1, 2, 3, or 4 amino acid substitutions.
- the amino acid substitutions are conservative substitutions.
- the substitutions are made as part of a germline humanization process.
- the RSPO-binding agent is an RSP02-binding agent (e.g., an antibody) that specifically binds RSP02, wherein the RSP02-binding agent comprises a heavy chain variable region having at least about 80% sequence identity to SEQ ID NO:23 and/or a light chain variable region having at least 80% sequence identity to SEQ ID NO:24 or SEQ ID NO:50.
- the RSP02-binding agent comprises a heavy chain variable region having at least about 85%, at least about 90%, at least about 95%, at least about 97%, or at least about 99% sequence identity to SEQ ID NO:23.
- the RSP02-binding agent comprises a light chain variable region having at least about 85%, at least about 90%, at least about 95%, at least about 97%, or at least about 99% sequence identity to SEQ ID NO:24. In certain embodiments, the RSP02- binding agent comprises a light chain variable region having at least about 85%, at least about 90%, at least about 95%, at least about 97%, or at least about 99% sequence identity to SEQ ID NO:50. In certain embodiments, the RSP02-binding agent comprises a heavy chain variable region having at least about 95% sequence identity to SEQ ID NO: 23 and/or a light chain variable region having at least about 95% sequence identity to SEQ ID NO: 24 or SEQ ID NO: 50.
- the RSP02-binding agent comprises a heavy chain variable region comprising SEQ ID NO:23 and/or a light chain variable region comprising SEQ ID NO:24 or SEQ ID NO:50. In certain embodiments, the RSP02-binding agent comprises a heavy chain variable region comprising SEQ ID NO:23 and a light chain variable region comprising SEQ ID NO:24. In certain embodiments, the RSP02-binding agent comprises a heavy chain variable region comprising SEQ ID NO:23 and a light chain variable region comprising SEQ ID NO: 50. In certain embodiments, the RSP02-binding agent comprises a heavy chain variable region consisting of SEQ ID NO: 23 and a light chain variable region consisting of SEQ ID NO:24. In certain embodiments, the RSP02-binding agent comprises a heavy chain variable region consisting of SEQ ID NO: 23 and a light chain variable region consisting of SEQ ID NO: 50.
- the RSPO-binding agent is an RSP02-binding agent (e.g., an antibody) that specifically binds RSP02, wherein the RSP02-binding agent comprises: (a) a heavy chain having at least 90% sequence identity to SEQ ID NO:25 or SEQ ID NO:26; and/or (b) a light chain having at least 90% sequence identity to SEQ ID NO:31 or SEQ ID NO:32.
- the RSP02-binding agent comprises: (a) a heavy chain having at least 95% sequence identity to SEQ ID NO:25 or SEQ ID NO:26; and/or (b) a light chain having at least 95% sequence identity to SEQ ID NO:27 or SEQ ID NO:28.
- the RSP02-binding agent comprises a heavy chain comprising SEQ ID NO:26 and/or a light chain comprising SEQ ID NO:28. In some embodiments, the RSP02-binding agent comprises a heavy chain comprising SEQ ID NO:26 and a light chain comprising SEQ ID NO:28.
- the RSPO-binding agent is an RSP02-binding agent (e.g., an antibody) that specifically binds RSP02, wherein the RSP02-binding agent comprises: (a) a heavy chain having at least 90% sequence identity to SEQ ID NO:25 or SEQ ID NO:26; and/or (b) a light chain having at least 90% sequence identity to SEQ ID NO:51 or SEQ ID NO:52.
- the RSP02-binding agent comprises: (a) a heavy chain having at least 95% sequence identity to SEQ ID NO:25 or SEQ ID NO:26; and/or (b) a light chain having at least 95% sequence identity to SEQ ID NO:51 or SEQ ID NO:52.
- the RSP02-binding agent comprises a heavy chain comprising SEQ ID NO:26 and/or a light chain comprising SEQ ID NO:52. In some embodiments, the RSP02-binding agent comprises a heavy chain comprising SEQ ID NO:26 and a light chain comprising SEQ ID NO:52.
- an RSP02-binding agent comprises the heavy chain variable region and light chain variable region of antibody hl30M23-HlL6. In certain embodiments, an RSP02- binding agent comprises the heavy chain and light chain of antibody hl30M23-HlL6 (with or without the leader sequence). In certain embodiments, an RSP02-binding agent is antibody hl30M23-HlL6. In certain embodiments, an RSP02-binding agent comprises the heavy chain variable region and/or light chain variable region of antibody hl30M23-HlL6 in a chimeric form of the antibody. In some embodiments, the anti-RSP02 antibody is hl30M23-HlL6.
- an RSP02-binding agent comprises the heavy chain variable region and light chain variable region of antibody hl30M23-HlL2. In certain embodiments, an RSP02- binding agent comprises the heavy chain and light chain of antibody hl30M23-HlL2 (with or without the leader sequence). In certain embodiments, an RSP02-binding agent is antibody hl30M23-HlL2. In certain embodiments, an RSP02-binding agent comprises the heavy chain variable region and/or light chain variable region of antibody hl30M23-HlL2 in a chimeric form of the antibody. In some embodiments, the anti-RSP02 antibody is hl30M23-HlL2.
- an RSP02-binding agent comprises the heavy chain CDRs and/or light chain CDRs of antibody 130M23.
- the hybridoma cell line producing the 130M23 antibody was deposited with ATCC, 10801 University Boulevard, Manassas, VA, USA, under the conditions of the Budapest Treaty on August 10, 2011 and assigned ATCC deposit designation number PTA-12021.
- an RSP02-binding agent comprises, consists essentially of, or consists of, antibody hl30M23-HlL6. In certain embodiments, an RSP02-binding agent comprises, consists essentially of, or consists of, a variant of antibody 130M23. In certain embodiments, an RSP02-binding agent comprises, consists essentially of, or consists of, a variant of antibody hl30M23-HlL6.
- an RSP02-binding agent comprises, consists essentially of, or consists of, antibody hl30M23-HlL2. In certain embodiments, an RSP02-binding agent comprises, consists essentially of, or consists of, a variant of antibody 130M23. In certain embodiments, an RSP02 -binding agent comprises, consists essentially of, or consists of, a variant of antibody hl30M23-HlL2.
- the RSPO-binding agent is an RSP03-binding agent (e.g., an antibody) that specifically binds human RSP03, wherein the RSP03- binding agent (e.g., an antibody) comprises one, two, three, four, five, and/or six of the CDRs of antibody 131R10 (see Table 1 herein).
- RSP03-binding agent e.g., an antibody
- the RSPO-binding agent is an RSP03-binding agent (e.g., an antibody) that specifically binds human RSP03, wherein the RSP03-binding agent comprises a heavy chain CDR1 comprising DYSIH (SEQ ID NO:29), a heavy chain CDR2 comprising
- the RSP03-binding agent further comprises a light chain CDR1 comprising KASQSVDYDGDSYMN (SEQ ID NO:33), a light chain CDR2 comprising AASNLES (SEQ ID NO:34) or AAS (SEQ ID NO:35), and a light chain CDR3 comprising QQSNEDPLT (SEQ ID NO:36) or QQSNEDPLTF (SEQ ID NO:37).
- the RSP03-binding agent comprises a light chain CDR1 comprising KASQSVDYDGDSYMN (SEQ ID NO:33), a light chain CDR2 comprising AASNLES (SEQ ID NO:34) or AAS (SEQ ID NO:35), and a light chain CDR3 comprising QQSNEDPLT (SEQ ID NO:36) or QQSNEDPLTF (SEQ ID NO:37).
- the RSP03-binding agent comprises a light chain CDR1 comprising
- KASQSVDYDGDSYMN (SEQ ID NO:33), a light chain CDR2 comprising AASNLES (SEQ ID NO:34) or AAS (SEQ ID NO:35), and a light chain CDR3 comprising QQSNEDPLT (SEQ ID NO:36) or QQSNEDPLTF (SEQ ID NO:37).
- the RSP03-binding agent comprises: (a) a heavy chain CDR1 comprising DYSIH (SEQ ID NO:29), a heavy chain CDR2 comprising YIYPSNGDSGYNQKFK (SEQ ID NO:30), and a heavy chain CDR3 comprising TYFANNFD (SEQ ID NO:31); and (b) a light chain CDR1 comprising KASQSVDYDGDSYMN (SEQ ID NO:33), a light chain CDR2 comprising AASNLES (SEQ ID NO:34), and a light chain CDR3 comprising QQSNEDPLT (SEQ ID NO:36).
- the RSPO-binding agent is an RSP03-binding agent (e.g., an antibody or bispecific antibody) that specifically binds human RSP03, wherein the RSP03-binding agent comprises: (a) a heavy chain CDR1 comprising DYSIH (SEQ ID NO:29) or a variant thereof comprising 1, 2, 3, or 4 amino acid substitutions; (b) a heavy chain CDR2 comprising
- YIYPSNGDSGYNQKFK (SEQ ID NO: 30) or a variant thereof comprising 1, 2, 3, or 4 amino acid substitutions;
- a heavy chain CDR3 comprising TYFANNFD (SEQ ID NO:31), ATYFANNFDY (SEQ ID NO:32), or a variant thereof comprising 1, 2, 3, or 4 amino acid substitutions;
- a light chain CDR1 comprising KASQSVDYDGDSYMN (SEQ ID NO:33) or a variant thereof comprising 1, 2, 3, or 4 amino acid substitutions;
- a light chain CDR2 comprising AASNLES (SEQ ID NO:34), AAS (SEQ ID NO:35), or a variant thereof comprising 1, 2, 3, or 4 amino acid substitutions; and
- a light chain CDR3 comprising QQSNEDPLT (SEQ ID NO:36), QQSNEDPLTF (SEQ ID NO:37), or a variant thereof comprising 1, 2, 3, or 4 amino acid substitutions.
- the amino acid substitutions are conservative substitutions. In some embodiments, the substitutions are made as part of a germline humanization process.
- the RSPO-binding agent is an RSP03-binding agent (e.g., an antibody) that specifically binds RSP03, wherein the RSP03-binding agent comprises a heavy chain variable region having at least about 80% sequence identity to SEQ ID NO:38 and/or a light chain variable region having at least 80% sequence identity to SEQ ID NO:39.
- the RSP03-binding agent comprises a heavy chain variable region having at least about 85%, at least about 90%, at least about 95%, at least about 97%, or at least about 99% sequence identity to SEQ ID NO:38. In certain embodiments, the RSP03-binding agent comprises a light chain variable region having at least about 85%, at least about 90%, at least about 95%, at least about 97%, or at least about 99% sequence identity to SEQ ID NO:39. In certain embodiments, the RSP03-binding agent comprises a heavy chain variable region having at least about 95% sequence identity to SEQ ID NO:38 and/or a light chain variable region having at least about 95% sequence identity to SEQ ID NO:39.
- the RSP03-binding agent comprises a heavy chain variable region comprising SEQ ID NO:38, and/or a light chain variable region comprising SEQ ID NO:39. In certain embodiments, the RSP03-binding agent comprises a heavy chain variable region comprising SEQ ID NO:38 and a light chain variable region comprising SEQ ID NO:39. In certain embodiments, the RSP03-binding agent comprises a heavy chain variable region consisting of SEQ ID NO:38 and a light chain variable region consisting of SEQ ID NO:39.
- the RSPO-binding agent is an RSP03-binding agent (e.g., an antibody) that specifically binds RSP03, wherein the RSP03-binding agent comprises: (a) a heavy chain having at least 90% sequence identity to SEQ ID NO: 40 or SEQ ID NO: 41 ; and/or (b) a light chain having at least 90% sequence identity to SEQ ID NO: 42 or SEQ ID NO: 43.
- RSP03-binding agent e.g., an antibody
- the RSP03-binding agent comprises: (a) a heavy chain having at least 90% sequence identity to SEQ ID NO: 40 or SEQ ID NO: 41 ; and/or (b) a light chain having at least 90% sequence identity to SEQ ID NO: 42 or SEQ ID NO: 43.
- the RSP03 -binding agent comprises: (a) a heavy chain having at least 95% sequence identity to SEQ ID NO: 40 or SEQ ID NO:41; and/or (b) a light chain having at least 95% sequence identity to SEQ ID NO:42 or SEQ ID NO:43.
- the RSP03-binding agent comprises a heavy chain comprising SEQ ID NO:41 and/or a light chain comprising SEQ ID NO:43.
- the RSP03-binding agent comprises a heavy chain comprising SEQ ID NO:41 and a light chain comprising SEQ ID NO:43.
- an RSP03-binding agent comprises the heavy chain variable region and light chain variable region of antibody 131R10. In certain embodiments, an RSP03-binding agent comprises the heavy chain and light chain of antibody 131R10 (with or without the leader sequence). In certain embodiments, an RSP03 -binding agent is antibody 131R10. In certain embodiments, an RSP03 -binding agent comprises the heavy chain variable region and/or light chain variable region of antibody 131R10 in a chimeric form of the antibody. In certain embodiments, an RSP03-binding agent comprises the heavy chain CDRs and/or light chain CDRs of antibody 131R10. In some embodiments, the anti-RSP03 antibody is 131R10.
- the RSP03-binding agent comprises a heavy chain variable region encoded by the plasmid deposited with ATCC and designated PTA- 120420. In some embodiments, the RSP03-binding agent comprises a light chain variable region encoded by the plasmid deposited with ATCC and designated PTA-120421.
- the RSP03-binding agent comprises a heavy chain variable region encoded by the plasmid deposited with ATCC and designated PTA-120420 and a light chain variable region encoded by the plasmid deposited with ATCC and designated PTA-120421. In some embodiments, the RSP03 -binding agent comprises a heavy chain encoded by the plasmid deposited with ATCC and designated PTA-120420. In some embodiments, the RSP03-binding agent comprises a light chain encoded by the plasmid deposited with ATCC and designated PTA-120421.
- the RSP03-binding agent comprises a heavy chain encoded by the plasmid deposited with ATCC and designated PTA-120420 and a light chain encoded by the plasmid deposited with ATCC and designated PTA-120421.
- an RSP03-binding agent comprises, consists essentially of, or consists of, antibody 131R10. In certain embodiments, an RSP03-binding agent comprises, consists essentially of, or consists of, a variant of antibody 131R10.
- polypeptides including, but not limited to, antibodies that specifically bind human at least one RSPO protein.
- a polypeptide binds human RSPOl .
- a polypeptide binds human RSP02.
- a polypeptide binds human RSP03.
- the polypeptide comprises one, two, three, four, five, and/or six of the CDRs of antibody 89M5 (see Table 1 herein). In certain embodiments, the polypeptide comprises one, two, three, four, five, and/or six of the CDRs of antibody 130M23 (see Table 1 herein). In certain embodiments, the polypeptide comprises one, two, three, four, five, and/or six of the CDRs of antibody 131R10 (see Table 1 herein). In some embodiments, the polypeptide comprises CDRs with up to four (i.e., 0, 1, 2, 3, or 4) amino acid substitutions per CDR. In certain embodiments, the heavy chain CDR(s) are contained within a heavy chain variable region. In certain embodiments, the light chain CDR(s) are contained within a light chain variable region.
- the RSPO-binding agent is a polypeptide that specifically binds a human RSPOl, wherein the polypeptide comprises an amino acid sequence having at least about 80% sequence identity to SEQ ID NO: 11 and/or SEQ ID NO: 12. In some embodiments, the polypeptide comprises an amino acid sequence having at least about 80% sequence identity to SEQ ID NO: 13 and/or an amino acid sequence having at least about 80% sequence identity to SEQ ID NO: 15. In some embodiments, the polypeptide comprises an amino acid sequence having at least about 80% sequence identity to SEQ ID NO: 14 and/or an amino acid sequence having at least about 80% sequence identity to SEQ ID NO: 16.
- the polypeptide comprises an amino acid sequence having at least about 85%, at least about 90%, at least about 95%, at least about 97%, or at least about 99% sequence identity to SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, or SEQ ID NO: 16.
- the polypeptide comprises an amino acid sequence having at least about 95% sequence identity to SEQ ID NO: 11 and/or an amino acid sequence having at least about 95% sequence identity to SEQ ID NO: 12.
- the polypeptide comprises an amino acid sequence having at least about 95% sequence identity to SEQ ID NO: 13 and/or an amino acid sequence having at least about 95% sequence identity to SEQ ID NO: 15.
- the polypeptide comprises an amino acid sequence having at least about 95% sequence identity to SEQ ID NO: 14 and/or an amino acid sequence having at least about 95% sequence identity to SEQ ID NO: 16. In certain embodiments, the polypeptide comprises an amino acid sequence of SEQ ID NO: 11 and/or an amino acid sequence of SEQ ID NO: 12. In certain embodiments, the polypeptide comprises an amino acid sequence of SEQ ID NO: 13 and/or an amino acid sequence of SEQ ID NO: 15. In certain embodiments, the polypeptide comprises an amino acid sequence of SEQ ID NO: 14 and/or an amino acid sequence of SEQ ID NO: 16.
- the RSPO-binding agent is a polypeptide that specifically binds a human RSPO l, wherein the polypeptide comprises an amino acid sequence having at least about 80% sequence identity to SEQ ID NO:44 and/or SEQ ID NO:45. In some embodiments, the polypeptide comprises an amino acid sequence having at least about 80% sequence identity to SEQ ID NO:46 and/or an amino acid sequence having at least about 80% sequence identity to SEQ ID NO:48. In some embodiments, the polypeptide comprises an amino acid sequence having at least about 80% sequence identity to SEQ ID NO:47 and/or an amino acid sequence having at least about 80% sequence identity to SEQ ID NO:49.
- the polypeptide comprises an amino acid sequence having at least about 85%, at least about 90%, at least about 95%, at least about 97%, or at least about 99% sequence identity to SEQ ID NO:44, SEQ ID NO:45, SEQ ID NO:46, SEQ ID NO:47, SEQ ID NO:48, or SEQ ID NO:49. In certain embodiments, the polypeptide comprises an amino acid sequence having at least about 95% sequence identity to SEQ ID NO:44 and/or an amino acid sequence having at least about 95% sequence identity to SEQ ID NO:45. In certain embodiments, the polypeptide comprises an amino acid sequence having at least about 95% sequence identity to
- polypeptide comprises an amino acid sequence having at least about 95% sequence identity to SEQ ID NO: 47 and/or an amino acid sequence having at least about 95% sequence identity to SEQ ID NO:49.
- polypeptide comprises an amino acid sequence of SEQ ID NO:44 and/or an amino acid sequence of SEQ ID NO:45.
- polypeptide comprises an amino acid sequence of SEQ ID NO:46 and/or an amino acid sequence of SEQ ID NO:48.
- polypeptide comprises an amino acid sequence of SEQ ID NO:47 and/or an amino acid sequence of SEQ ID NO:49.
- the RSPO-binding agent is a polypeptide that specifically binds a human RSP02, wherein the polypeptide comprises an amino acid sequence having at least about 80% sequence identity to SEQ ID NO:23 and/or SEQ ID NO:24. In some embodiments, the RSPO-binding agent is a polypeptide that specifically binds a human RSP02, wherein the polypeptide comprises an amino acid sequence having at least about 80% sequence identity to SEQ ID NO:23 and/or SEQ ID NO:50.
- the polypeptide comprises an amino acid sequence having at least about 80% sequence identity to SEQ ID NO:25 and/or an amino acid sequence having at least about 80% sequence identity to SEQ ID NO:27 or SEQ ID NO:51. In some embodiments, the polypeptide comprises an amino acid sequence having at least about 80% sequence identity to SEQ ID NO:26 and/or an amino acid sequence having at least about 80% sequence identity to SEQ ID NO:28 or SEQ ID NO: 52.
- the polypeptide comprises an amino acid sequence having at least about 85%, at least about 90%, at least about 95%, at least about 97%, or at least about 99% sequence identity to SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:28, SEQ ID NO:50, SEQ ID NO:51, or SEQ ID NO:52.
- the polypeptide comprises an amino acid sequence having at least about 95% sequence identity to SEQ ID NO:23 and/or an amino acid sequence having at least about 95% sequence identity to SEQ ID NO: 24 or SEQ ID NO: 50.
- the polypeptide comprises an amino acid sequence having at least about 95% sequence identity to SEQ ID NO: 25 and/or an amino acid sequence having at least about 95% sequence identity to SEQ ID NO:27 or SEQ ID NO: 51. In certain embodiments, the polypeptide comprises an amino acid sequence having at least about 95% sequence identity to SEQ ID NO: 26 and/or an amino acid sequence having at least about 95% sequence identity to SEQ ID NO:28 or SEQ ID NO:52. In certain embodiments, the polypeptide comprises an amino acid sequence of SEQ ID NO:23 and/or an amino acid sequence of SEQ ID NO:24. In certain embodiments, the polypeptide comprises an amino acid sequence of SEQ ID NO:23 and/or an amino acid sequence of SEQ ID NO: 50.
- the polypeptide comprises an amino acid sequence of SEQ ID NO:25 and/or an amino acid sequence of SEQ ID NO:27. In certain embodiments, the polypeptide comprises an amino acid sequence of SEQ ID NO: 25 and/or an amino acid sequence of SEQ ID NO: 51. In certain embodiments, the polypeptide comprises an amino acid sequence of SEQ ID NO: 26 and/or an amino acid sequence of SEQ ID NO:28. In certain embodiments, the polypeptide comprises an amino acid sequence of SEQ ID NO:26 and/or an amino acid sequence of SEQ ID NO:52.
- the RSPO-binding agent is a polypeptide that specifically binds a human RSP03, wherein the polypeptide comprises an amino acid sequence having at least about 80% sequence identity to SEQ ID NO:38 and/or SEQ DI NO:47.
- the polypeptide comprises an amino acid sequence having at least about 80% sequence identity to SEQ ID NO:40 and/or an amino acid sequence having at least about 80% sequence identity to SEQ ID NO:42.
- the polypeptide comprises an amino acid sequence having at least about 80% sequence identity to SEQ ID NO:41 and/or an amino acid sequence having at least about 80% sequence identity to SEQ ID NO:43.
- the polypeptide comprises an amino acid sequence having at least about 85%, at least about 90%, at least about 95%, at least about 97%, or at least about 99% sequence identity to SEQ ID NO:38, SEQ ID NO:39, SEQ ID NO:40, SEQ ID NO:41, SEQ ID NO:42, or SEQ ID NO:43. In certain embodiments, the polypeptide comprises an amino acid sequence having at least about 95% sequence identity to SEQ ID NO:38 and/or an amino acid sequence having at least about 95% sequence identity to SEQ ID NO: 39. In certain embodiments, the polypeptide comprises an amino acid sequence having at least about 95% sequence identity to
- polypeptide comprises an amino acid sequence having at least about 95% sequence identity to SEQ ID NO:41 and/or an amino acid sequence having at least about 95% sequence identity to SEQ ID NO:43.
- polypeptide comprises an amino acid sequence of SEQ ID NO:38 and/or an amino acid sequence of SEQ ID NO: 39.
- polypeptide comprises an amino acid sequence of SEQ ID NO:40 and/or an amino acid sequence of SEQ ID NO:42.
- polypeptide comprises an amino acid sequence of SEQ ID NO:41 and/or an amino acid sequence of SEQ ID NO:43.
- the RSPO-binding agent is an RSPO l-binding agent (e.g., antibody) that competes for specific binding to RSPOl with an antibody that comprises the CDRs of antibody 89M5.
- the RSPO-binding agent is an RSP02-binding agent (e.g., antibody) that competes for specific binding to RSP02 with an antibody that comprises the CDRs of antibody 130M23.
- the RSPO-binding agent is an RSP03-binding agent (e.g., antibody) that competes for specific binding to RSP03 with an antibody that comprises the CDRs of antibody 131R10.
- the RSPO-binding agent is an RSPOl-binding agent (e.g., an antibody) that binds the same epitope, or essentially the same epitope on RSPOl, as an antibody that comprises the CDRs of antibody 89M5.
- the RSPO-binding agent is an RSP02-binding agent (e.g., an antibody) that binds the same epitope, or essentially the same epitope on RSP02, as an antibody that comprises the CDRs of antibody 89M5.
- the RSPO-binding agent is an RSP03-binding agent (e.g., an antibody) that binds the same epitope, or essentially the same epitope on RSP03, as an antibody that comprises the CDRs of antibody 131R10.
- RSP03-binding agent e.g., an antibody
- the RSPO-binding agent is an RSPOl-binding agent (e.g., an antibody) that binds an epitope on RSPO 1 that overlaps with the epitope on RSPO 1 bound by an antibody comprising the CDRs of antibody 89M5.
- the RSPO-binding agent is an RSP02-binding agent (e.g., an antibody) that binds an epitope on RSP02 that overlaps with the epitope on RSP02 bound by an antibody comprising the CDRs of antibody 130M23.
- the RSPO-binding agent is an RSP03-binding agent (e.g., an antibody) that binds an epitope on RSP03 that overlaps with the epitope on RSP03 bound by an antibody comprising the CDRs of antibody 131R10.
- RSP03-binding agent e.g., an antibody
- an RSPO-binding agent e.g., an antibody binds at least one human RSPO protein and modulates RSPO activity.
- an RSPO-binding agent e.g., an antibody
- the RSPO-binding agent is an RSPO antagonist and decreases RSPO activity. In some embodiments, the RSPO-binding agent is an RSPO antagonist and decreases ⁇ -catenin activity.
- an RSPOl-binding agent binds human RSPOl and modulates RSPO l activity.
- an RSPOl-binding agent is an RSPOl antagonist and decreases RSPOl activity.
- an RSPOl-binding agent is an RSPOl antagonist and decreases ⁇ -catenin activity.
- an RSP02-binding agent binds human RSP02 and modulates RSP02 activity.
- an RSP02 -binding agent is an RSP02 antagonist and decreases RSP02 activity.
- an RSP02-binding agent is an RSP02 antagonist and decreases ⁇ -catenin activity.
- an RSP03-binding agent e.g., an antibody
- an RSP03-binding agent is an RSP03 antagonist and decreases RSP03 activity.
- an RSP03-binding agent is an RSP03 antagonist and decreases ⁇ -catenin activity.
- the RSPO-binding agent (e.g., an antibody) is an antagonist of at least one human RSPO protein. In some embodiments, the RSPO-binding agent is an antagonist of at least one RSPO and inhibits RSPO activity. In certain embodiments, the RSPO-binding agent inhibits RSPO activity by at least about 10%, at least about 20%, at least about 30%, at least about 50%, at least about 75%, at least about 90%, or about 100%. In some embodiments, the RSPO-binding agent inhibits activity of one, two, three, or four RSPO proteins. In some embodiments, the RSPO-binding agent inhibits activity of human RSPOl, RSP02, RSP03, and/or RSP04.
- the RSPO-binding agent inhibits activity of human RSPOl, RSP02, RSP03, and/or RSP04.
- the RSPO-binding agent (e.g., antibody) is an antagonist of at least one human RSPO protein.
- the RSPO-binding agent inhibits RSPO signaling by at least about 10%, at least about 20%, at least about 30%, at least about 50%, at least about 75%, at least about 90%, or about 100%.
- the RSPO-binding agent inhibits signaling by one, two, three, or four RSPO proteins.
- the RSPO-binding agent inhibits signaling of human RSPO l, RSP02, RSP03, and/or RSP04.
- the RSPO-binding agent (e.g., antibody) is an antagonist of ⁇ -catenin signaling. In certain embodiments, the RSPO-binding agent inhibits ⁇ -catenin signaling by at least about 10%, at least about 20%, at least about 30%, at least about 50%, at least about 75%, at least about 90%, or about 100%. [00229] In certain embodiments, the RSPO-binding agent (e.g., antibody) inhibits binding of at least one RSPO protein to a receptor. In certain embodiments, the RSPO-binding agent inhibits binding of a human RSPO protein to one or more of its receptors.
- the RSPO-binding agent inhibits binding of an RSPO protein to at least one LGR protein. In some embodiments, the RSPO-binding agent inhibits binding of an RSPO protein to LGR4 (SEQ ID NO: 53), LGR5 (SEQ ID NO:54), and/or LGR6 (SEQ ID NO:55). In certain embodiments, the inhibition of binding of an RSPO-binding agent to at least one LGR protein is at least about 10%, at least about 25%, at least about 50%, at least about 75%, at least about 90%, or at least about 95%. In certain embodiments, an RSPO-binding agent that inhibits binding of at least one RSPO to at least one LGR protein further inhibits ⁇ -catenin signaling.
- the RSPO-binding agent blocks binding of at least one RSPO to a receptor.
- the RSPO-binding agent blocks binding of a human RSPO protein to one or more of its receptors.
- the RSPO-binding agent blocks binding of an RSPO to at least one LGR protein.
- the RSPO-binding agent blocks binding of at least one RSPO protein to LGR4 (SEQ ID NO:53), LGR5 (SEQ ID NO:54), and/or LGR6 (SEQ ID NO:55).
- the blocking of binding of an RSPO-binding agent to at least one LGR protein is at least about 10%, at least about 25%, at least about 50%, at least about 75%, at least about 90%, or at least about 95%.
- an RSPO-binding agent that blocks binding of at least one RSPO protein to at least one LGR protein further inhibits ⁇ - catenin signaling.
- the RSPO-binding agent inhibits ⁇ -catenin signaling. It is understood that an RSPO-binding agent that inhibits ⁇ -catenin signaling can, in certain embodiments, inhibit signaling by one or more receptors in the ⁇ -catenin signaling pathway but not necessarily inhibit signaling by all receptors. In certain alternative embodiments, ⁇ -catenin signaling by all human receptors can be inhibited. In certain embodiments, ⁇ -catenin signaling by one or more receptors selected from the group consisting of LGR4 (SEQ ID NO:53), LGR5 (SEQ ID NO:54), and/or LGR6 (SEQ ID NO:55) is inhibited.
- LGR4 SEQ ID NO:53
- LGR5 SEQ ID NO:54
- LGR6 SEQ ID NO:55
- the inhibition of ⁇ -catenin signaling by an RSPO-binding agent is a reduction in the level of ⁇ -catenin signaling of at least about 10%, at least about 25%, at least about 50%, at least about 75%, at least about 90%, or at least about 95%.
- the RSPO-binding agent inhibits activation of ⁇ - catenin. It is understood that an RSPO-binding agent that inhibits activation of ⁇ -catenin can, in certain embodiments, inhibit activation of ⁇ -catenin by one or more receptors, but not necessarily inhibit activation of ⁇ -catenin by all receptors. In certain alternative embodiments, activation of ⁇ - catenin by all human receptors can be inhibited.
- activation of ⁇ -catenin by one or more receptors selected from the group consisting of LGR4 (SEQ ID NO:53), LGR5 (SEQ ID NO:54), and LGR6 (SEQ ID NO:55) is inhibited.
- the inhibition of activation of ⁇ -catenin by an RSPO-binding agent is a reduction in the level of activation of ⁇ -catenin of at least about 10%, at least about 25%, at least about 50%, at least about 75%, at least about 90%, or at least about 95%.
- the RSPO or LGR antagonists are agents that bind one or more human LGR proteins. These agents are referred to herein as "LGR-binding agents".
- LGR-binding agents Non-limiting examples of LGR-binding agents can be found in U.S. Patent Nos. 8158758, 8158757, 8802097, and U.S. Patent Publication Nos. 2012/0135422, 2013/0209473, 2014/0044713, each of which are hereby incorporated by reference herein in their entirety for all purposes.
- the LGR-binding agent binds at least one human LGR protein. In alternative embodiments, the LGR-binding agent binds two or more human LGR proteins. In some embodiments, the LGR-binding agent is an antibody. In some embodiments, the LGR-binding agent inhibits (partially or wholly) the binding of at least one RSPO protein (e.g., RSPOl, RSP02, RSP03, and/or RSP04) to at least one LGR protein (e.g., LGR4, LGR5, and/or LGR6). In certain embodiments, RSPO protein (e.g., RSPOl, RSP02, RSP03, and/or RSP04) to at least one LGR protein (e.g., LGR4, LGR5, and/or LGR6). In certain aspects of at least one RSPO protein (e.g., RSPOl, RSP02, RSP03, and/or RSP04) to at least one LGR protein (e.g., LGR
- the LGR-binding agent inhibits RSPO-activated LGR signaling, such as LGR5 signaling. In certain embodiments, the LGR-binding agent inhibits beta-catenin signaling.
- an LGR-binding agent is an antibody, for example, an antibody that binds at least one LGR protein.
- the LGR-binding agent can be an antibody that specifically binds LGR5.
- the LGR-binding agent is an antibody that specifically binds LGR4 or LGR6.
- an LGR-binding agent is an antibody that specifically binds at least one human LGR protein.
- the antibody specifically binds at least one human LGR protein selected from the group consisting of LGR4, LGR5, and LGR6.
- the antibody specifically binds LGR5.
- the antibody specifically binds two or more human LGR proteins selected from the group consisting of LGR4, LGR5, and LGR6.
- the antibody that specifically binds at least one human LGR protein also inhibits binding of at least one RSPO protein (e.g., RSPO l, RSP02, RSP03, and/or RSP04) to the at least one human LGR protein (e.g., LGR5).
- the antibody that specifically binds at least one human LGR protein is characterized by an ability to inhibit RSPO activation of LGR signaling and/or an ability to inhibit beta-catenin signaling.
- the antibody that specifically binds at least one human LGR protein is characterized by the ability to inhibit tumor growth, such as the growth of a solid tumor comprising solid tumor stem cells.
- the antibody that specifically binds at least one human LGR protein disrupts or inhibits RSPO binding to LGR, and inhibits tumor growth.
- the antibody that specifically binds at least one LGR protein also disrupts RSPO activation of LGR signaling and inhibits tumor growth.
- the antibody that specifically binds at least one LGR protein also inhibits RSPO activation of LGR signaling and/or beta-catenin signaling and inhibits tumor growth.
- an LGR-binding agent that inhibits binding of an RSPO protein to an LGR protein, inhibits at least about 25%, at least about 50 %, at least about 60%, at least about 70%, at least about 80%, or at least about 90% of the binding of the RSPO protein to an LGR protein in an in vitro or in vivo assay.
- an LGR-binding agent that inhibits (a) RSPO activation of LGR signaling and/or (b) beta-catenin signaling, inhibits at least about 25%, at least about 50 %, at least about 60%, at least about 70%, at least about 80%, or at least about 90% of the signaling in an in vitro or in vivo assay.
- an LGR-binding agent is an isolated antibody that specifically binds to an extracellular domain of a human LGR protein and inhibits growth of a solid tumor comprising solid tumor stem cells.
- the extracellular domain comprises amino acids 22- 564 of human LGR5 (SEQ ID NO:56).
- the antibody is a monoclonal antibody.
- the antibody is a humanized or human antibody.
- an LGR-binding agent is an isolated antibody that specifically binds to an extracellular domain of a human LGR protein and disrupts RSPO activation of LGR signaling.
- the extracellular domain comprises amino acids 22-564 of human LGR5 (SEQ ID NO:56).
- the antibody is a monoclonal antibody.
- the antibody is a humanized or human antibody.
- an LGR-binding agent is monoclonal anti-LGR5 antibody 88M1.
- the 88M1 monoclonal antibody is produced by a hybridoma cell line deposited with the American Type Culture collection (ATCC), 10801 University Boulevard, Manassas, Virginia, 20110, USA, on July 2, 2008, in accordance with the Budapest Treaty, under ATCC deposit number PTA-9342.
- an LGR-binding agent is an antibody that specifically binds human LGR5 and (a) comprises a heavy chain variable region that has at least about 95% sequence identity (e.g., at least about 98% or about 100% sequence identity) to the heavy chain variable region of 88M1; (b) comprises a light chain variable region that has at least about 95% (e.g., at least about 98% or about 100% sequence identity) sequence identity to the light chain variable region of 88M1; (c) comprises the heavy chain CDRs of 88M1; (d) comprises the light chain CDRs of 88M1; (e) binds to an epitope capable of binding 88M1; and/or (f) competes with 88M1 in a competitive binding assay.
- the LGR5 antibody is BNC101.
- an LGR- binding agent is an antibody that specifically binds human LGR5 and (a) comprises a heavy chain variable region that has at least about 95% sequence identity (e.g., at least about 98% or about 100% sequence identity) to the heavy chain variable region of BNC101; (b) comprises a light chain variable region that has at least about 95% (e.g., at least about 98% or about 100% sequence identity) sequence identity to the light chain variable region of BNC101; (c) comprises the heavy chain CDRs of BNC101; (d) comprises the light chain CDRs of BNC101; (e) binds to an epitope capable of binding BNC101; and/or (f) competes with BNC101 in a competitive binding assay.
- the RSPO-binding agent or LGR binding agent is an antibody.
- the antibody is a recombinant antibody.
- the antibody is a monoclonal antibody.
- the antibody is a chimeric antibody.
- the antibody is a humanized antibody.
- the antibody is a human antibody.
- the antibody is an IgA, IgD, IgE, IgG, or IgM antibody.
- the antibody is an IgGl antibody.
- the antibody is an IgG2 antibody.
- the antibody is an antibody fragment comprising an antigen- binding site.
- the antibody is a bispecific antibody or a multispecific antibody. In some embodiments, the antibody is a monovalent antibody. In some embodiments, the antibody is a monospecific antibody. In some embodiments, the antibody is a bivalent antibody. In some embodiments, the antibody is conjugated to a cytotoxic moiety. In some embodiments, the antibody is isolated. In some embodiments, the antibody is substantially pure.
- RSPO-binding agents and LGR-binding agents can be assayed for specific binding by any method known in the art.
- the immunoassays which can be used include, but are not limited to, competitive and non-competitive assay systems using techniques such as Biacore analysis, FACS analysis, immunofluorescence, immunocytochemistry, Western blot analysis,
- radioimmunoassays ELISAs, "sandwich” immunoassays, immunoprecipitation assays, precipitation reactions, gel diffusion precipitin reactions, immunodiffusion assays, agglutination assays, complement-fixation assays, immunoradiometric assays, fluorescent immunoassays, and protein A immunoassays.
- assays are routine and well-known in the art (see, e.g., Ausubel et al., Editors, 1994-present, Current Protocols in Molecular Biology, John Wiley & Sons, Inc., New York, NY).
- an agent e.g., RSPO-binding agent and LGR-binding agent
- An ELISA assay comprises preparing antigen, coating wells of a 96 well microtiter plate with antigen, adding the RSPO-binding agent or LGR-binding agent conjugated to a detectable compound such as an enzymatic substrate (e.g. horseradish peroxidase or alkaline phosphatase) to the well, incubating for a period of time, and detecting the presence of the agent bound to the antigen.
- an enzymatic substrate e.g. horseradish peroxidase or alkaline phosphatase
- the RSPO-binding agent or LGR-binding agent is not conjugated to a detectable compound, but instead a second antibody that recognizes the RSPO-binding agent or LGR-binding agent (e.g., an anti-Fc antibody) and is conjugated to a detectable compound is added to the well.
- a second antibody that recognizes the RSPO-binding agent or LGR-binding agent e.g., an anti-Fc antibody
- the RSPO-binding agent or LGR-binding agent instead of coating the well with the antigen, can be coated to the well and a second antibody conjugated to a detectable compound can be added following the addition of the antigen to the coated well.
- a second antibody conjugated to a detectable compound can be added following the addition of the antigen to the coated well.
- an agent e.g., RSPO-binding agent and LGR- binding agent
- a FACS screening assay can comprise generating a cDNA construct that expresses an antigen (e.g., LGR), optionally as a fusion protein (e.g., RSPO-CD4TM ), transfecting the construct into cells, expressing the antigen on the surface of the cells, mixing the RSPO-binding agent or LGR-binding agent with the transfected cells, and incubating for a period of time.
- an antigen e.g., LGR
- a fusion protein e.g., RSPO-CD4TM
- the cells bound by the RSPO- binding agent or LGR-binding agent can be identified using a secondary antibody conjugated to a detectable compound (e.g., PE-conjugated anti-Fc antibody) and a flow cytometer.
- a detectable compound e.g., PE-conjugated anti-Fc antibody
- a flow cytometer e.g., a flow cytometer
- the binding affinity of an agent (e.g., RSPO-binding agent and LGR-binding agent) to an antigen and the off-rate of an agent-antigen interaction can be determined by competitive binding assays.
- a competitive binding assay is a radioimmunoassay comprising the incubation of labeled antigen (e.g., labeled with 3H or 1251), or fragment or variant thereof, with a binding agent of interest in the presence of increasing amounts of unlabeled antigen followed by the detection of the agent bound to the labeled antigen.
- labeled antigen e.g., labeled with 3H or 1251
- the affinity of the agent for the antigen and the binding off-rates can be determined from the data by Scatchard plot analysis.
- Biacore kinetic analysis is used to determine the binding on and off rates of agents that bind an antigen. In some embodiments, Biacore kinetic analysis comprises analyzing the binding and dissociation of antibodies from chips with immobilized antigen on their surface. In some embodiments, Biacore kinetic analysis comprises analyzing the binding and dissociation of antigen from chips with immobilized binding agent on their surface.
- the level of ⁇ - catenin signaling in the presence of one or more Wnts e.g., Wnt(s) expressed by transfected cells or provided by Wnt-conditioned media
- Wnts e.g., Wnt(s) expressed by transfected cells or provided by Wnt-conditioned media
- an RSPO protein or RSPO-conditioned media in the presence of an RSPO-binding agent or LGR-binding agent is compared to the level of signaling without the RSPO-binding agent or LGR-binding agent present.
- the effect of an RSPO-binding agent or LGR-binding agent on ⁇ -catenin signaling can be measured in vitro or in vivo by measuring the effect of the agent on the level of expression of ⁇ - catenin-regulated genes, such as c-myc (He et al., 1998, Science, 281 : 1509-12), cyclin Dl (Tetsu et al, 1999, Nature, 398:422-6) and/or fibronectin (Gradl et al. 1999, Mol. Cell Biol., 19:5576-87).
- the effect of an RSPO-binding agent or LGR-binding agent on ⁇ -catenin signaling can also be assessed by measuring the effect of the agent on the phosphorylation state of Dishevelled- 1, Dishevelled-2, Dishevelled-3, LRP5, LRP6, and/or ⁇ -catenin.
- the RSPO or LGR antagonists are polyclonal antibodies.
- Polyclonal antibodies can be prepared by any known method.
- polyclonal antibodies are raised by immunizing an animal (e.g., a rabbit, rat, mouse, goat, donkey) by multiple subcutaneous or intraperitoneal injections of the relevant antigen (e.g., a purified peptide fragment, full-length recombinant protein, or fusion protein).
- the antigen can be optionally conjugated to a carrier such as keyhole limpet hemocyanin (KLH) or serum albumin.
- KLH keyhole limpet hemocyanin
- the antigen (with or without a carrier protein) is diluted in sterile saline and usually combined with an adjuvant (e.g., Complete or Incomplete Freund's Adjuvant) to form a stable emulsion.
- an adjuvant e.g., Complete or Incomplete Freund's Adjuvant
- polyclonal antibodies are recovered from blood and/or ascites of the immunized animal.
- the polyclonal antibodies can be purified from serum or ascites according to standard methods in the art including, but not limited to, affinity chromatography, ion- exchange chromatography, gel electrophoresis, and dialysis.
- the RSPO or LGR antagonists are monoclonal antibodies.
- Monoclonal antibodies can be prepared using hybridoma methods known to one of skill in the art.
- a mouse, hamster, or other appropriate host animal is immunized as described above to elicit from lymphocytes the production of antibodies that will specifically bind the immunizing antigen.
- lymphocytes can be immunized in vitro.
- the immunizing antigen can be a human protein or a portion thereof.
- the immunizing antigen can be a mouse protein or a portion thereof.
- lymphocytes are isolated and fused with a suitable myeloma cell line using, for example, polyethylene glycol, to form hybridoma cells that can then be selected away from unfused lymphocytes and myeloma cells.
- Hybridomas that produce monoclonal antibodies directed specifically against a chosen antigen can be identified by a variety of methods including, but not limited to, immunoprecipitation, immunoblotting, and in vitro binding assay (e.g., flow cytometry, FACS, ELISA, and radioimmunoassay).
- the hybridomas can be propagated either in in vitro culture using standard methods or in vivo as ascites tumors in an animal.
- the monoclonal antibodies can be purified from the culture medium or ascites fluid according to standard methods in the art including, but not limited to, affinity chromatography, ion-exchange chromatography, gel electrophoresis, and dialysis.
- monoclonal antibodies can be made using recombinant DNA techniques known to one skilled in the art.
- the polynucleotides encoding a monoclonal antibody are isolated from mature B-cells or hybridoma cells, such as by RT-PCR using oligonucleotide primers that specifically amplify genes encoding the heavy and light chains of the antibody, and their sequence is determined using conventional techniques.
- the isolated polynucleotides encoding the heavy and light chains are then cloned into suitable expression vectors which produce the monoclonal antibodies when transfected into host cells such as E. coli, simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin proteins.
- suitable expression vectors which produce the monoclonal antibodies when transfected into host cells such as E. coli, simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin proteins.
- recombinant monoclonal antibodies, or fragments thereof can be isolated from phage display libraries.
- the polynucleotide(s) encoding a monoclonal antibody can be further modified in a number of different manners using recombinant DNA technology to generate alternative antibodies.
- the constant domains of the light and heavy chains of, for example, a mouse monoclonal antibody can be substituted for those regions of, for example, a human antibody to generate a chimeric antibody, or for a non-immunoglobulin polypeptide to generate a fusion antibody.
- the constant regions are truncated or removed to generate the desired antibody fragment of a monoclonal antibody.
- site-directed or high-density mutagenesis of the variable region can be used to optimize specificity, affinity, etc. of a monoclonal antibody.
- the RSPO or LGR antagonist e.g., RSPO-binding agent and LGR- binding agent
- RSPO-binding agent and LGR- binding agent is a humanized antibody.
- humanized antibodies are human
- immunoglobulins in which residues from the CDRs are replaced by residues from CDRs of a non-human species (e.g., mouse, rat, rabbit, hamster, etc.) that have the desired specificity, affinity, and/or binding capability using methods known to one skilled in the art.
- the framework region residues of a human immunoglobulin are replaced with the corresponding residues in an antibody from a non-human species.
- the humanized antibody can be further modified by the substitution of additional residues either in the framework region and/or within the replaced non-human residues to refine and optimize antibody specificity, affinity, and/or capability.
- the humanized antibody will comprise variable domain regions containing all, or substantially all, of the CDRs that correspond to the non-human immunoglobulin whereas all, or substantially all, of the framework regions are those of a human immunoglobulin sequence.
- the humanized antibody can also comprise at least a portion of an immunoglobulin constant region or domain (Fc), typically that of a human immunoglobulin.
- Fc immunoglobulin constant region or domain
- such humanized antibodies are used therapeutically because they can reduce antigenicity and HAMA (human anti-mouse antibody) responses when administered to a human subject.
- the RSPO or LGR antagonist is a human antibody.
- Human antibodies can be directly prepared using various techniques known in the art.
- immortalized human B lymphocytes immunized in vitro or isolated from an immunized individual that produces an antibody directed against a target antigen can be generated.
- the human antibody can be selected from a phage library, where that phage library expresses human antibodies.
- phage display technology can be used to produce human antibodies and antibody fragments in vitro, from immunoglobulin variable domain gene repertoires from unimmunized donors.
- Affinity maturation strategies including, but not limited to, chain shuffling and site-directed mutagenesis, are known in the art and can be employed to generate high affinity human antibodies.
- human antibodies can be made in transgenic mice that contain human immunoglobulin loci. These mice are capable, upon immunization, of producing the full repertoire of human antibodies in the absence of endogenous immunoglobulin production.
- the RSPO or LGR antagonist is bispecific antibodies that specifically recognize at least one human RSPO protein or at least one LGR protein.
- Bispecific antibodies are capable of specifically recognizing and binding at least two different epitopes.
- the different epitopes can either be within the same molecule (e.g., two different epitopes on human RSP03) or on different molecules (e.g., one epitope on RSP03 and a different epitope on a second protein).
- the bispecific antibodies are monoclonal human or humanized antibodies.
- the bispecific antibodies are intact antibodies.
- the bispecific antibodies are antibody fragments.
- the antibodies are multi specific.
- the antibodies can specifically recognize and bind a first antigen target, (e.g., a LGR protein) as well as a second antigen target, such as an effector molecule on a leukocyte (e.g., CD2, CD3, CD28, CD80 or CD86) or a Fc receptor (e.g., CD64, CD32, or CD 16) so as to focus cellular defense mechanisms to the cell expressing the first antigen target.
- a first antigen target e.g., a LGR protein
- a second antigen target such as an effector molecule on a leukocyte (e.g., CD2, CD3, CD28, CD80 or CD86) or a Fc receptor (e.g., CD64, CD32, or CD 16) so as to focus cellular defense mechanisms to the cell expressing the first antigen target.
- the antibodies can be used to direct cytotoxic agents to cells which express a particular target antigen.
- antibodies possess an antigen-binding arm and an arm which binds a cytotoxic agent or a radionuclide chelator, such as EOTUBE, DPT A, DOTA, or TETA.
- a radionuclide chelator such as EOTUBE, DPT A, DOTA, or TETA.
- the RSPO or LGR antagonist e.g., RSPO-binding agent and LGR- binding agent
- RSPO-binding agent and LGR- binding agent is a monospecific antibody.
- each of the one or more antigen-binding sites that an antibody contains is capable of binding (or binds) a homologous epitope on different proteins.
- the RSPO or LGR antagonist is an antibody fragment comprising an antigen-binding site.
- Antibody fragments can have different functions or capabilities than intact antibodies; for example, antibody fragments can have increased tumor penetration.
- Various techniques are known for the production of antibody fragments including, but not limited to, proteolytic digestion of intact antibodies.
- antibody fragments include a F(ab')2 fragment produced by pepsin digestion of an antibody molecule.
- antibody fragments include a Fab fragment generated by reducing the disulfide bridges of an F(ab')2 fragment.
- antibody fragments include a Fab fragment generated by the treatment of the antibody molecule with papain and a reducing agent.
- antibody fragments are produced recombinantly.
- antibody fragments include Fv or single chain Fv (scFv) fragments.
- Fab, Fv, and scFv antibody fragments can be expressed in and secreted from E. coli or other host cells, allowing for the production of large amounts of these fragments.
- antibody fragments are isolated from antibody phage libraries as discussed herein. For example, methods can be used for the construction of Fab expression libraries to allow rapid and effective identification of monoclonal Fab fragments with the desired specificity for an RSPO or LGR protein or derivatives, fragments, analogs or homologs thereof.
- antibody fragments are linear antibody fragments.
- antibody fragments are
- the RSPO or LGR antagonist is a scFv.
- Various techniques can be used for the production of single-chain antibodies specific to one or more human RSPO proteins or one or more human LGR proteins.
- an antibody in order to increase its serum half-life. This can be achieved, for example, by incorporation of a salvage receptor binding epitope into the antibody fragment by mutation of the appropriate region in the antibody fragment or by incorporating the epitope into a peptide tag that is then fused to the antibody fragment at either end or in the middle (e.g., by DNA or peptide synthesis).
- an antibody is modified to decrease its serum half-life.
- the RSPO or LGR antagonist is a heteroconjugate antibody.
- Heteroconjugate antibodies are composed of two covalently joined antibodies. Such antibodies have, for example, been proposed to target immune cells to unwanted cells. It is also contemplated that the heteroconjugate antibodies can be prepared in vitro using known methods in synthetic protein chemistry, including those involving crosslinking agents. For example, immunotoxins can be constructed using a disulfide exchange reaction or by forming a thioether bond. Examples of suitable reagents for this purpose include iminothiolate and methyl -4-mercaptobutyrimidate.
- modified antibodies can comprise any type of variable region that provides for the association of the antibody with the target (i.e., a human RSPO protein or a human LGR protein).
- the variable region can comprise or be derived from any type of mammal that can be induced to mount a humoral response and generate immunoglobulins against the desired tumor-associated antigen.
- the variable region of the modified antibodies can be, for example, of human, murine, non-human primate (e.g. cynomolgus monkeys, macaques, etc.) or rabbit origin.
- both the variable and constant regions of the modified immunoglobulins are human.
- variable regions of compatible antibodies can be engineered or specifically tailored to improve the binding properties or reduce the immunogenicity of the molecule.
- variable regions can be humanized or otherwise altered through the inclusion of imported amino acid sequences.
- variable domains in both the heavy and light chains are altered by at least partial replacement of one or more CDRs and, if necessary, by partial framework region replacement and sequence modification and/or alteration.
- the CDRs can be derived from an antibody of the same class or even subclass as the antibody from which the framework regions are derived, it is envisaged that the CDRs will be derived preferably from an antibody from a different species. It may not be necessary to replace all of the CDRs with all of the CDRs from the donor variable region to transfer the antigen binding capacity of one variable domain to another. Rather, it can only be necessary to transfer those residues that are necessary to maintain the activity of the antigen-binding site.
- the modified antibodies will comprise antibodies (e.g., full-length antibodies or immunoreactive fragments thereof) in which at least a fraction of one or more of the constant region domains has been deleted or otherwise altered so as to provide desired biochemical characteristics such as increased tumor localization and/or increased serum half-life when compared with an antibody of approximately the same immunogenicity comprising a native or unaltered constant region.
- the constant region of the modified antibodies will comprise a human constant region. Modifications to the constant region comprise additions, deletions or substitutions of one or more amino acids in one or more domains.
- the modified antibodies disclosed herein can comprise alterations or modifications to one or more of the three heavy chain constant domains (CHI, CH2 or CH3) and/or to the light chain constant domain (CL).
- one or more domains are partially or entirely deleted from the constant regions of the modified antibodies.
- the modified antibodies will comprise domain deleted constructs or variants wherein the entire CH2 domain has been removed (ACH2 constructs).
- the omitted constant region domain is replaced by a short amino acid spacer (e.g., 10 amino acid residues) that provides some of the molecular flexibility typically imparted by the absent constant region.
- the modified antibodies are engineered to fuse the CH3 domain directly to the hinge region of the antibody.
- a peptide spacer is inserted between the hinge region and the modified CH2 and/or CH3 domains.
- constructs can be expressed wherein the CH2 domain has been deleted and the remaining CH3 domain (modified or unmodified) is joined to the hinge region with a 5-20 amino acid spacer.
- spacer can be added to ensure that the regulatory elements of the constant domain remain free and accessible or that the hinge region remains flexible.
- amino acid spacers can, in some cases, prove to be immunogenic and elicit an unwanted immune response against the construct.
- any spacer added to the construct will be relatively non- immunogenic so as to maintain the desired biological qualities of the modified antibodies.
- the modified antibodies can have only a partial deletion of a constant domain or substitution of a few or even a single amino acid.
- the mutation of a single amino acid in selected areas of the CH2 domain can be enough to substantially reduce Fc binding and thereby increase cancer cell localization and/or tumor penetration.
- Such partial deletions of the constant regions can improve selected characteristics of the antibody (serum half-life) while leaving other desirable functions associated with the subject constant region domain intact.
- the constant regions of the disclosed antibodies can be modified through the mutation or substitution of one or more amino acids that enhances the profile of the resulting construct.
- the modified antibodies comprise the addition of one or more amino acids to the constant region to enhance desirable characteristics such as decreasing or increasing effector function or provide for more cytotoxin or carbohydrate attachment sites.
- the constant region mediates several effector functions. For example, binding of the CI component of complement to the Fc region of IgG or IgM antibodies (bound to antigen) activates the complement system. Activation of complement is important in the opsonization and lysis of cell pathogens. The activation of complement also stimulates the inflammatory response and can also be involved in autoimmune hypersensitivity.
- the Fc region of an antibody can bind a cell expressing a Fc receptor (FcR).
- Fc receptors which are specific for different classes of antibody, including IgG (gamma receptors), IgE (epsilon receptors), IgA (alpha receptors) and IgM (mu receptors). Binding of antibody to Fc receptors on cell surfaces triggers a number of important and diverse biological responses including engulfment and destruction of antibody-coated particles, clearance of immune complexes, lysis of antibody-coated target cells by killer cells, release of inflammatory mediators, placental transfer, and control of immunoglobulin production.
- IgG gamma receptors
- IgE epsilon receptors
- IgA alpha receptors
- IgM mi receptors
- the RSPO or LGR antagonists are antibodies that provide for altered effector functions. These altered effector functions can affect the biological profile of the RSPO or LGR antagonists.
- the deletion or inactivation (through point mutations or other means) of a constant region domain can reduce Fc receptor binding of the circulating modified antibody (e.g., anti-RSPO antibody) thereby increasing cancer cell localization and/or tumor penetration.
- the constant region modifications increase or reduce the serum half-life of the antibody.
- the constant region is modified to eliminate disulfide linkages or oligosaccharide moieties. Modifications to the constant region can easily be made using well known biochemical or molecular engineering techniques well within the purview of the skilled artisan.
- an RSPO or LGR antagonist is an antibody that does not have one or more effector functions.
- the antibody has no ADCC activity, and/or no CDC activity.
- the antibody does not bind an Fc receptor, and/or complement factors.
- the antibody has no effector function.
- Variants and equivalents which are substantially homologous to the chimeric, humanized, and human antibodies, or antibody fragments thereof, set forth herein can also be used in the methods described herein. These can contain, for example, conservative substitution mutations.
- the antibodies described herein are isolated. In certain embodiments, the antibodies described herein are substantially pure.
- the RSPO-binding agent is a soluble receptor.
- the RSPO or LGR antagonist is a soluble receptor.
- the soluble receptor comprises the extracellular domain of an LGR protein or fragment of the extracellular domain of an LGR protein.
- the LGR protein is LGR5.
- the RSPO-binding agent is a fusion protein comprising a fragment of the LGR5 receptor and the Fc portion of an antibody.
- the RSPO-binding agent is a soluble receptor comprising an extracellular domain of a human LGR protein that inhibits growth of a solid tumor comprising solid tumor stem cells.
- the extracellular domain comprises amino acids 22-564 of human LGR5 (SEQ ID NO: 56).
- the extracellular domain of human LGR5 is linked in-frame to a non-LGR protein sequence.
- the non-LGR protein is human Fc.
- the RSPO-binding agent is a soluble receptor comprising an extracellular domain of a human LGR protein that inhibits RSPO activation of LGR signaling.
- the extracellular domain comprises amino acids 22-564 of human LGR5 (SEQ ID NO: 56).
- the extracellular domain of human LGR5 is linked in-frame to a non-LGR protein sequence.
- the non-LGR protein is human Fc.
- Non-limiting examples of soluble LGR receptors can be found in can be found in in U.S. Patent Nos. 8158758, and 8158757, each of which are hereby incorporated by reference herein in their entirety for all purposes.
- the RSPO-binding agent is a soluble receptor comprising an extracellular domain of a human LGR protein that inhibits growth of a solid tumor comprising solid tumor stem cells.
- the extracellular domain comprises amino acids 22-564 of human LGR5 (SEQ ID NO: 56).
- the extracellular domain of human LGR5 is linked in-frame to a non-LGR protein sequence.
- the non-LGR protein is human Fc.
- the soluble receptor comprises a variant of the aforementioned extracellular domain of a human LGR protein that comprises one or more (e.g., one, two, three, four, five, six, seven, eight, nine, ten, etc.) conservative substitutions and is capable of binding RSPO protein(s).
- the soluble receptor such as an agent comprising an extracellular domain of a human LGR protein, further comprises a non-LGR (e.g., heterologous) polypeptide.
- a soluble receptor can include a LGR ECD linked to other non-LGR functional and structural polypeptides including, but not limited to, a human Fc region, at least one protein tag (e.g., myc, FLAG, GST, GFP), other endogenous proteins or protein fragments, or any other useful protein sequence including any linker region between a LGR ECD and a second polypeptide.
- the non-LGR polypeptide comprises a human Fc region.
- the Fc region can be obtained from any of the classes of immunoglobulin, IgG, IgA, IgM, IgD and IgE.
- the Fc region is a human IgGl Fc region.
- the Fc region is a human IgG2 Fc region.
- the Fc region is a wild-type Fc region.
- the Fc region is a mutated Fc region.
- the Fc region is truncated at the N-terminal end by 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acids, (e.g., in the hinge domain). In some embodiments, an amino acid in the hinge domain is changed to hinder undesirable disulfide bond formation.
- the non-LGR polypeptide comprises SEQ ID NO:58, SEQ ID NO:59, SEQ ID NO:60, SEQ ID NO:61, or SEQ ID NO:62. In certain embodiments, the non-LGR polypeptide consists essentially of SEQ ID NO:58, SEQ ID NO:59, SEQ ID NO:60, SEQ ID NO:61, or SEQ ID NO: 62. In certain embodiments, the non-LGR polypeptide comprises SEQ ID NO:61. In certain embodiments, the non-LGR polypeptide consists essentially of SEQ ID NO:61.
- a soluble receptor is a fusion protein comprising an extracellular domain of an LGR polypeptide capable of binding an RSPO protein and a Fc region.
- a "fusion protein” is a hybrid protein expressed by a nucleic acid molecule comprising nucleotide sequences of at least two genes.
- the C-terminus of the first polypeptide is linked to the N-terminus of the immunoglobulin Fc region.
- the first polypeptide e.g., an extracellular domain of an LGR polypeptide
- is directly linked to the Fc region i.e. without an intervening peptide linker).
- the first polypeptide is linked to the Fc region via a linker.
- linker refers to a linker inserted between a first polypeptide (e.g., a LGR component) and a second polypeptide (e.g., a Fc region).
- the linker is a peptide linker.
- Linkers should not adversely affect the expression, secretion, or bioactivity of the polypeptide. Linkers should not be antigenic and should not elicit an immune response. Suitable linkers are known to those of skill in the art and often include mixtures of glycine and serine residues and often include amino acids that are sterically unhindered.
- Linkers can range in length, for example from 1-50 amino acids in length, 1-22 amino acids in length, 1-10 amino acids in length, 1-5 amino acids in length, or 1-3 amino acids in length.
- a "linker" is an intervening peptide sequence that does not include amino acid residues from either the C-terminus of the first polypeptide (e.g., LGR component) or the N-terminus of the second polypeptide (e.g., a Fc region).
- LGR proteins contain a signal sequence that directs the transport of the proteins.
- Signal sequences also referred to as signal peptides or leader sequences
- nascent polypeptides e.g., amino acids 1-21 of human LGR5 (SEQ ID NO:54)
- SEQ ID NO:54 amino acids 1-21 of human LGR5
- the cleavage of the signal sequence from the polypeptide usually occurs at a specific site in the amino acid sequence and is dependent upon amino acid residues within the signal sequence . Although there is usually one specific cleavage site, more than one cleavage site can be recognized and/or used by a signal peptidase resulting in a non-homogenous N-terminus of the polypeptide. For example, the use of different cleavage sites within a signal sequence can result in a polypeptide expressed with different N-terminal amino acids. Accordingly, in some embodiments, the polypeptides as described herein can comprise a mixture of polypeptides with different N-termini.
- the N-termini differ in length by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more amino acids. In some embodiments, the N-termini differ in length by 1, 2, 3, 4, or 5 amino acids.
- the polypeptide is substantially homogeneous, i.e., the polypeptides have the same N-terminus.
- the signal sequence of the polypeptide comprises one or more (e.g., one, two, three, four, five, six, seven, eight, nine, ten, etc.) amino acid substitutions and/or deletions. In some embodiments, the signal sequence of the polypeptide comprises amino acid substitutions and/or deletions that allow one cleavage site to be dominant, thereby resulting in a substantially homogeneous polypeptide with one N-terminus.
- an RSPO-binding agent e.g., soluble receptor
- a Fc region of an immunoglobulin comprises a Fc region of an immunoglobulin.
- the binding agents will comprise fusion proteins in which at least a portion of the Fc region has been deleted or otherwise altered so as to provide desired biochemical characteristics, such as increased cancer cell localization, increased tumor penetration, reduced serum half-life, or increased serum half-life, when compared with a fusion protein of approximately the same immunogenicity comprising a native or unaltered constant region.
- Modifications to the Fc region can include additions, deletions, or substitutions of one or more amino acids in one or more domains.
- the modified fusion proteins disclosed herein can comprise alterations or modifications to one or more of the two heavy chain constant domains (CH2 or CH3) or to the hinge region.
- CH2 or CH3 the entire CH2 domain can be removed (ACH2 constructs).
- the omitted constant region domain is replaced by a short amino acid spacer (e.g., 10 residues) that provides some of the molecular flexibility typically imparted by the absent constant region domain.
- the modified fusion proteins are engineered to link the CH3 domain directly to the hinge region.
- a peptide spacer is inserted between the hinge region and the modified CH2 and/or CH3 domains.
- constructs can be expressed wherein the CH2 domain has been deleted and the remaining CH3 domain (modified or unmodified) is joined to the hinge region with a 5-20 amino acid spacer.
- a spacer can be added to ensure that the regulatory elements of the constant domain remain free and accessible or that the hinge region remains flexible.
- amino acid spacers can, in some cases, prove to be immunogenic and elicit an unwanted immune response against the construct. Accordingly, in certain embodiments, any spacer added to the construct will be relatively non-immunogenic so as to maintain the desired biological qualities of the fusion protein.
- the modified fusion proteins can have only a partial deletion of a constant domain or substitution of a few or even a single amino acid.
- the mutation of a single amino acid in selected areas of the CH2 domain can be enough to substantially reduce Fc binding and thereby increase cancer cell localization and/or tumor penetration.
- Such partial deletions of the constant regions can improve selected characteristics of the binding agent (e.g., serum half-life) while leaving other desirable functions associated with the subject constant region domain intact.
- the constant regions of the disclosed fusion proteins can be modified through the mutation or substitution of one or more amino acids that enhances the profile of the resulting construct.
- the modified fusion proteins comprise the addition of one or more amino acids to the constant region to enhance desirable characteristics such as decreasing or increasing effector function, or provide for more cytotoxin or carbohydrate attachment sites.
- the constant region mediates several effector functions. For example, binding of the CI component of complement to the Fc region of IgG or IgM antibodies (bound to antigen) activates the complement system. Activation of complement is important in the opsonization and lysis of cell pathogens. The activation of complement also stimulates the inflammatory response and can also be involved in autoimmune hypersensitivity.
- the Fc region of an immunoglobulin can bind to a cell expressing a Fc receptor (FcR).
- Fc receptors which are specific for different classes of antibody, including IgG (gamma receptors), IgE (epsilon receptors), IgA (alpha receptors) and IgM (mu receptors). Binding of antibody to Fc receptors on cell surfaces triggers a number of important and diverse biological responses including engulfment and destruction of antibody-coated particles, clearance of immune complexes, lysis of antibody-coated target cells by killer cells, release of inflammatory mediators, placental transfer, and control of immunoglobulin production.
- IgG gamma receptors
- IgE epsilon receptors
- IgA alpha receptors
- IgM mi receptors
- the modified fusion proteins provide for altered effector functions that, in turn, affect the biological profile of the administered agent.
- the deletion or inactivation (through point mutations or other means) of a constant region domain can reduce Fc receptor binding of the circulating modified agent, thereby increasing cancer cell localization and/or tumor penetration.
- the constant region modifications increase or reduce the serum half-life of the agent.
- the constant region is modified to eliminate disulfide linkages or oligosaccharide moieties.
- a modified fusion protein does not have one or more effector functions normally associated with an Fc region.
- the agent has no antibody- dependent cell-mediated cytotoxicity (ADCC) activity, and/or no complement-dependent cytotoxicity (CDC) activity.
- ADCC antibody- dependent cell-mediated cytotoxicity
- CDC complement-dependent cytotoxicity
- the agent does not bind to the Fc receptor and/or complement factors.
- the agent has no effector function.
- the RSPO-binding agent e.g., a soluble receptor
- the RSPO-binding agent is modified to reduce immunogenicity.
- immune responses against completely normal human proteins are rare when these proteins are used as therapeutics.
- fusion proteins comprise polypeptides sequences that are the same as the sequences found in nature, several therapeutic fusion proteins have been shown to be immunogenic in mammals.
- a fusion protein comprising a linker has been found to be more immunogenic than a fusion protein that does not contain a linker.
- the polypeptides are analyzed by computation methods to predict immunogenicity.
- the polypeptides are analyzed for the presence of T-cell and/or B-cell epitopes. If any T-cell or B-cell epitopes are identified and/or predicted, modifications to these regions (e.g., amino acid substitutions) can be made to disrupt or destroy the epitopes.
- modifications to these regions e.g., amino acid substitutions
- Various algorithms and software that can be used to predict T-cell and/or B-cell epitopes are known in the art. For example, the software programs SYFPEITHI, HLA Bind, PEPVAC, RANKPEP, DiscoTope, ElliPro, and Antibody Epitope Prediction are all publicly available.
- the RSPO or LGR antagonists are polypeptides.
- polypeptides can be recombinant polypeptides, natural polypeptides, or synthetic polypeptides comprising an antibody, or fragment thereof, that bind at least one human RSPO protein or at least one LGR protein. It will be recognized in the art that some amino acid sequences can be varied without significant effect on the structure or function of the protein. Thus, the methods described herein further encompass using variations of the polypeptides which show substantial activity or which include regions of an antibody, or fragment thereof, against a human RSPO protein or a LGR protein. In some
- amino acid sequence variations of RSPO -binding polypeptides or LGR-binding polypeptides can include deletions, insertions, inversions, repeats, and/or other types of substitutions.
- the polypeptides, analogs and variants thereof can be further modified to contain additional chemical moieties not normally part of the polypeptide.
- the derivatized moieties can improve the solubility, the biological half-life, and/or absorption of the polypeptide.
- the moieties can also reduce or eliminate any undesirable side effects of the polypeptides and variants.
- An overview for chemical moieties can be found in Remington: The Science and Practice of Pharmacy, 22st Edition, 2012, Pharmaceutical Press, London.
- Signal sequences also referred to as signal peptides or leader sequences
- proteins are located at the N-terminus of nascent polypeptides. They target the polypeptide to the endoplasmic reticulum and the proteins are sorted to their destinations, for example, to the inner space of an organelle, to an interior membrane, to the cell's outer membrane, or to the cell exterior via secretion.
- Most signal sequences are cleaved from the protein by a signal peptidase after the proteins are transported to the endoplasmic reticulum.
- the cleavage of the signal sequence from the polypeptide usually occurs at a specific site in the amino acid sequence and is dependent upon amino acid residues within the signal sequence. Although there is usually one specific cleavage site, more than one cleavage site can be recognized and/or can be used by a signal peptidase resulting in a non-homogenous N-terminus of the polypeptide. For example, the use of different cleavage sites within a signal sequence can result in a polypeptide expressed with different N-terminal amino acids. Accordingly, in some embodiments, the polypeptides as described herein can comprise a mixture of polypeptides with different N-termini. In some embodiments, the N-termini differ in length by 1, 2, 3, 4, or 5 amino acids.
- the polypeptide is substantially homogeneous, i.e., the polypeptides have the same N-terminus.
- the signal sequence of the polypeptide comprises one or more (e.g., one, two, three, four, five, six, seven, eight, nine, ten, etc.) amino acid substitutions and/or deletions as compared to a "native" or "parental" signal sequence.
- the signal sequence of the polypeptide comprises amino acid substitutions and/or deletions that allow one cleavage site to be dominant, thereby resulting in a substantially
- a signal sequence of the polypeptide affects the expression level of the polypeptide, e.g., increased expression or decreased expression.
- the isolated polypeptides described herein can be produced by any suitable method known in the art. Such methods range from direct protein synthesis methods to constructing a DNA sequence encoding polypeptide sequences and expressing those sequences in a suitable host.
- a DNA sequence is constructed using recombinant technology by isolating or synthesizing a DNA sequence encoding a wild-type protein of interest.
- the sequence can be mutagenized by site-specific mutagenesis to provide functional analogs thereof.
- a DNA sequence encoding a polypeptide of interest can be constructed by chemical synthesis using an oligonucleotide synthesizer. Oligonucleotides can be designed based on the amino acid sequence of the desired polypeptide and selecting those codons that are favored in the host cell in which the recombinant polypeptide of interest will be produced. Standard methods can be applied to synthesize a polynucleotide sequence encoding an isolated polypeptide of interest. For example, a complete amino acid sequence can be used to construct a back-translated gene. Further, a DNA oligomer containing a nucleotide sequence coding for the particular isolated polypeptide can be synthesized. For example, several small oligonucleotides coding for portions of the desired polypeptide can be synthesized and then ligated. The individual oligonucleotides typically contain 5' or 3' overhangs for complementary assembly.
- the polynucleotide sequences encoding a particular polypeptide of interest can be inserted into an expression vector and operatively linked to an expression control sequence appropriate for expression of the protein in a desired host. Proper assembly can be confirmed by nucleotide sequencing, restriction enzyme mapping, and/or expression of a biologically active polypeptide in a suitable host. As is well-known in the art, in order to obtain high expression levels of a transfected gene in a host, the gene must be operatively linked to transcriptional and translational expression control sequences that are functional in the chosen expression host.
- Recombinant expression vectors can be used to amplify and express DNA encoding agents (e.g., antibodies or soluble receptors), or fragments thereof, which bind a human RSPO protein or a human LGR protein.
- recombinant expression vectors can be replicable DNA constructs which have synthetic or cDNA -derived DNA fragments encoding a polypeptide chain of an RSPO- binding agent, a LGR-binding agent, an anti-RSPO antibody or fragment thereof, an anti-LGR antibody or fragment thereof, or a LGR-Fc soluble receptor operatively linked to suitable transcriptional and/or translational regulatory elements derived from mammalian, microbial, viral or insect genes.
- a transcriptional unit generally comprises an assembly of (1) a genetic element or elements having a regulatory role in gene expression, for example, transcriptional promoters or enhancers, (2) a structural or coding sequence which is transcribed into mRNA and translated into protein, and (3) appropriate transcription and translation initiation and termination sequences.
- DNA regions are "operatively linked" when they are functionally related to each other.
- DNA for a signal peptide secretory leader
- a promoter is operatively linked to a coding sequence if it controls the transcription of the sequence
- a ribosome binding site is operatively linked to a coding sequence if it is positioned so as to permit translation.
- Structural elements intended for use in yeast expression systems can include a leader sequence enabling extracellular secretion of translated protein by a host yeast cell. Where recombinant protein is expressed without a leader or transport sequence, it can include an N-terminal methionine residue. This residue can optionally be subsequently cleaved from the expressed recombinant protein to provide a final product.
- Useful expression vectors for eukaryotic hosts include, for example, vectors comprising expression control sequences from SV40, bovine papilloma virus, adenovirus, and cytomegalovirus.
- Useful expression vectors for bacterial hosts include known bacterial plasmids, such as plasmids from E. coli, including pCRl, pBR322, pMB9 and their derivatives, and wider host range plasmids, such as M13 and other filamentous single -stranded DNA phages.
- Suitable host cells for expression of an RSPO-binding or LGR-binding agent include prokaryotes, yeast cells, insect cells, or higher eukaryotic cells.
- Prokaryotes include gram-negative or gram-positive organisms, for example E. coli or Bacillus.
- Higher eukaryotic cells include established cell lines of mammalian origin as described below. Cell-free translation systems can also be employed. Appropriate cloning and expression vectors for use with bacterial, fungal, yeast, and mammalian cellular hosts are known to those skilled in the art.
- mammalian cell culture systems are used to express recombinant polypeptides. Expression of recombinant proteins in mammalian cells can be preferred because such proteins are generally correctly folded, appropriately modified, and biologically functional.
- suitable mammalian host cell lines include COS-7 (monkey kidney-derived), L-929 (murine fibroblast- derived), C127 (murine mammary tumor-derived), 3T3 (murine fibroblast-derived), CHO (Chinese hamster ovary-derived), HeLa (human cervical cancer-derived), BHK (hamster kidney fibroblast- derived), HEK-293 (human embryonic kidney-derived) cell lines and variants thereof.
- Mammalian expression vectors can comprise non-transcribed elements such as an origin of replication, a suitable promoter and enhancer linked to the gene to be expressed, and other 5' or 3' flanking non -transcribed sequences, and 5' or 3' non-translated sequences, such as necessary ribosome binding sites, a polyadenylation site, splice donor and acceptor sites, and transcriptional termination sequences.
- non-transcribed elements such as an origin of replication, a suitable promoter and enhancer linked to the gene to be expressed, and other 5' or 3' flanking non -transcribed sequences, and 5' or 3' non-translated sequences, such as necessary ribosome binding sites, a polyadenylation site, splice donor and acceptor sites, and transcriptional termination sequences.
- Baculovirus systems for production of heterologous proteins in insect cells are well-known to those of skill in the art.
- the proteins produced by a transformed host can be purified according to any suitable method.
- Standard methods include chromatography (e.g., ion exchange, affinity, and sizing column chromatography), centrifugation, differential solubility, or by any other standard technique for protein purification.
- Affinity tags such as hexa-histidine, maltose binding domain, influenza coat sequence, and glutathione -S -transferase can be attached to the protein to allow easy purification by passage over an appropriate affinity column.
- Isolated proteins can also be physically characterized using such techniques as proteolysis, mass spectrometry (MS), nuclear magnetic resonance (NMR), high performance liquid chromatography (HPLC), and x-ray crystallography.
- supernatants from expression systems which secrete recombinant protein into culture media can be first concentrated using a commercially available protein concentration filter, for example, an Amicon or Millipore Pellicon ultrafiltration unit. Following the concentration step, the concentrate can be applied to a suitable purification matrix.
- a suitable purification matrix for example, an anion exchange resin can be employed, for example, a matrix or substrate having pendant diethylaminoethyl (DEAE) groups.
- the matrices can be acrylamide, agarose, dextran, cellulose, or other types commonly employed in protein purification.
- a cation exchange step can be employed.
- Suitable cation exchangers include various insoluble matrices comprising sulfopropyl or carboxymethyl groups.
- a hydroxyapatite media can be employed, including but not limited to, ceramic hydroxyapatite (CHT).
- CHT ceramic hydroxyapatite
- one or more reverse-phase HPLC steps employing hydrophobic RP-HPLC media, e.g., silica gel having pendant methyl or other aliphatic groups can be employed to further purify a binding agent.
- hydrophobic RP-HPLC media e.g., silica gel having pendant methyl or other aliphatic groups
- Some or all of the foregoing purification steps, in various combinations, can also be employed to provide a homogeneous recombinant protein.
- recombinant protein produced in bacterial culture can be isolated, for example, by initial extraction from cell pellets, followed by one or more concentration, salting-out, aqueous ion exchange, or size exclusion chromatography steps. HPLC can be employed for final purification steps.
- Microbial cells employed in expression of a recombinant protein can be disrupted by any convenient method, including freeze-thaw cycling, sonication, mechanical disruption, or use of cell lysing agents.
- the binding agents can be used in any one of a number of conjugated (i.e. an immunoconjugate or radioconjugate) or non-conjugated forms.
- conjugated i.e. an immunoconjugate or radioconjugate
- non-conjugated forms i.e. antibodies can be used in a non-conjugated form to harness the subject's natural defense mechanisms including complement-dependent cytotoxicity and antibody dependent cellular toxicity to eliminate the malignant or cancer cells.
- the binding agent is conjugated to a cytotoxic agent.
- the cytotoxic agent is a chemotherapeutic agent including, but not limited to, methotrexate, adriamicin, doxorubicin, melphalan, mitomycin C, chlorambucil, daunorubicin or other intercalating agents.
- the cytotoxic agent is an enzymatically active toxin of bacterial, fungal, plant, or animal origin, or fragments thereof, including, but not limited to, diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain, ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAPII, and PAP-S), Momordica charantia inhibitor, curcin, crotin, Sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin, and the tricothecenes.
- diphtheria A chain nonbinding active fragments of diphtheria toxin
- exotoxin A chain ricin A chain
- abrin A chain abrin A chain
- modeccin A chain alpha-s
- the cytotoxic agent is a radioisotope to produce a radioconjugate or a radioconjugated antibody.
- radionuclides are available for the production of radioconjugated antibodies including, but not limited to, 90Y, 1251, 1311, 1231, l l lln, 131In, 105Rh, 153Sm, 67Cu, 67Ga, 166Ho, 177Lu, 186Re, 188Re and 212BL
- conjugates of an antibody and one or more small molecule toxins such as a calicheamicin, maytansinoids, a trichothene, and CC1065, and the derivatives of these toxins that have toxin activity, can be produced.
- conjugates of an antibody and a cytotoxic agent are made using a variety of bifunctional protein-coupling agents such as N-succinimidyl-3-(2-pyridyidithiol) propionate (SPDP), iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipimidate HCL), active esters (such as disuccinimidyl suberate), aldehydes (such as glutareldehyde), bis-azido compounds (such as bis(p-azidobenzoyl) hexanediamine), bis-diazonium derivatives (such as bis-(p- diazoniumbenzoyl)-ethylenediamine), diisocyanates (such as toluene 2,6-diisocyanate), and bis-active fluorine compounds (such as l,5-difluoro-2,4-dinitrobenzene).
- SPDP N-succinimidyl
- the RSPO or LGR antagonist (e.g., antibody or soluble receptor) is an antagonist of at least one RSPO protein (i.e., 1, 2, 3, or 4 RSPO proteins).
- the RSPO or LGR antagonist inhibits activity of the RSPO protein(s) to which it binds.
- the RSPO or LGR antagonist inhibits at least about 10%, at least about 20%, at least about 30%, at least about 50%, at least about 75%, at least about 90%, or about 100% of the activity of the human RSPO protein(s) to which it binds.
- the RSPO or LGR antagonist inhibits activity of RSP03.
- the RSPO or LGR antagonist inhibits binding of at least one human RSPO to an appropriate receptor.
- the RSPO or LGR antagonist inhibits binding of at least one human RSPO protein to one or more human LGR proteins.
- the at least one RSPO protein is selected from the group consisting of: RSPO l, RSP02, RSP03, and RSP04.
- the at least one RSPO protein is RSP03.
- the one or more human LGR proteins are selected from the group consisting of: LGR4, LGR5, and LGR6.
- the RSPO or LGR antagonist inhibits binding of one or more RSPO proteins to LGR4, LGR5, and/or LGR6.
- the inhibition of binding of a particular RSPO to a LGR protein by an RSPO or LGR antagonist is at least about 10%, at least about 25%, at least about 50%, at least about 75%, at least about 90%, or at least about 95%.
- an RSPO or LGR antagonist is an antibody, for example, an anti-RSPO antibody such as an anti-RSP03 antibody.
- an RSPO or LGR antagonist is 131R10.
- an RSPO or LGR antagonist is an antibody comprising the 6 CDRs of 131R10.
- an RSPO or LGR antagonist an anti-LGR antibody.
- an RSPO or LGR antagonist is a LGR-Fc soluble receptor.
- an RSPO or LGR antagonist is a LGR5-Fc soluble receptor.
- the LGR5-Fc soluble receptor comprises amino acid sequence of SEQ ID NO:57.
- the RSPO or LGR antagonists are antagonists of at least one human RSPO protein and inhibit RSPO activity.
- the RSPO or LGR antagonist inhibits RSPO activity by at least about 10%, at least about 20%, at least about 30%, at least about 50%, at least about 75%, at least about 90%, or about 100%.
- the RSPO or LGR antagonist inhibits activity of one, two, three, or four RSPO proteins.
- the RSPO or LGR antagonist inhibits activity of at least one human RSPO protein selected from the group consisting of: RSPOl, RSP02, RSP03, and RSP04.
- the RSPO-binding agent binds at least RSP03.
- an RSPO or LGR antagonist that inhibits human RSPO activity is an antibody. In certain embodiments, an RSPO or LGR antagonist that inhibits human RSPO activity is an anti-RSPO antibody. In certain embodiments, an RSPO or LGR antagonist that inhibits human RSPO activity is an anti-RSP03 antibody. In certain embodiments, an RSPO or LGR antagonist that inhibits human RSPO activity is 131R10. In certain embodiments, an RSPO or LGR antagonist that inhibits human RSPO activity is an antibody comprising the 6 CDRs of 131R10. In certain embodiments, an RSPO or LGR antagonist that inhibits human RSPO activity is a LGR-Fc soluble receptor. In certain embodiments, an RSPO or LGR antagonist that inhibits human RSPO activity is a LGR5-Fc soluble receptor. In certain embodiments, the LGR5-Fc soluble receptor comprises amino acid sequence of SEQ ID NO: 57.
- the RSPO or LGR antagonist described herein is LGR antagonist of at least one human LGR protein.
- the RSPO or LGR antagonist inhibits activity of at least one human LGR protein selected from the group consisting of: LGR4, LGR5, and LGR6.
- the RSPO or LGR antagonist is an LGR5 antagonist.
- the LGR antagonist is an anti-LGR antibody.
- the LGR antagonist is anti- LGR antibody comprising the 3 heavy chain CDRs of 88M1, and/or the 3 light chain CDRs of 88M1.
- the anti-LGR antibody comprises the heavy chain variable region of 88M1, and/or the light chain variable region of 88M1. In certain embodiments, the anti-LGR antibody comprises the 3 heavy chain CDRs of BNC101, and/or the 3 light chain CDRs of BNC101. In some embodiments, the anti-LGR antibody comprises the heavy chain variable region of BNC101, and/or the light chain variable region of BNC101.
- an RSPO or LGR antagonist described herein is an antagonist of ⁇ - catenin signaling.
- the RSPO or LGR antagonist inhibits ⁇ -catenin signaling by at least about 10%, at least about 20%, at least about 30%, at least about 50%, at least about 75%, at least about 90%, or about 100%.
- an RSPO or LGR antagonist that inhibits ⁇ -catenin signaling is an antibody.
- an RSPO or LGR antagonist that inhibits ⁇ -catenin signaling is an anti-RSPO antibody.
- an RSPO or LGR antagonist that inhibits ⁇ -catenin signaling is an anti-RSP03 antibody.
- an RSPO or LGR antagonist that inhibits ⁇ -catenin signaling is 131R10.
- an RSPO or LGR antagonist that inhibits ⁇ -catenin signaling is 131R10. In certain embodiments, an RSPO or
- LGR antagonist that inhibits ⁇ -catenin signaling is an antibody comprising the 6 CDRs of 131R10.
- an RSPO or LGR antagonist that inhibits ⁇ -catenin signaling is an anti-LGR antibody.
- the anti-LGR antibody comprises the 3 heavy chain CDRs of 88M1, and/or the 3 light chain CDRs of 88M1.
- the anti-LGR antibody comprises the heavy chain variable region of 88M1, and/or the light chain variable region of 88M1.
- the anti-LGR antibody comprises the 3 heavy chain CDRs of BNC101, and/or the 3 light chain CDRs of BNC101.
- the anti-LGR antibody comprises the heavy chain variable region of BNC101, and/or the light chain variable region of BNClOl .
- an RSPO or LGR antagonist that inhibits ⁇ -catenin signaling is a soluble receptor.
- the soluble receptor is a LGR-Fc soluble receptor.
- the soluble receptor is a LGR5-Fc soluble receptor.
- the LGR5-Fc soluble receptor comprises amino acid sequence of SEQ ID NO:57.
- the RSPO or LGR antagonist described herein inhibits binding of at least one RSPO protein to a receptor. In certain embodiments, the RSPO or LGR antagonist inhibits binding of at least one human RSPO protein to one or more of its receptors. In some embodiments, the RSPO or LGR antagonist inhibits binding of at least one RSPO protein to at least one LGR protein. In some embodiments, the RSPO-binding agent inhibits binding of at least one RSPO protein to LGR4, LGR5, and/or LGR6.
- the inhibition of binding of at least one RSPO to at least one LGR protein is at least about 10%, at least about 25%, at least about 50%, at least about 75%, at least about 90%, or at least about 95%.
- an RSPO or LGR antagonist that inhibits binding of at least one RSPO to at least one LGR protein further inhibits ⁇ - catenin signaling.
- an RSPO or LGR antagonist that inhibits binding of at least one human RSPO to at least one LGR protein is an antibody.
- an RSPO or LGR antagonist that inhibits binding of at least one human RSPO to at least one LGR protein is an anti-LGR antibody.
- an RSPO or LGR antagonist that inhibits binding of at least one human RSPO to at least one LGR protein is an anti-LGR antibody comprising the 3 heavy chain CDRs of 88M1, and/or the 3 light chain CDRs of 88M1.
- the anti-LGR antibody comprises the heavy chain variable region of 88M1, and/or the light chain variable region of 88M1.
- the anti-LGR antibody comprises the 3 heavy chain CDRs of BNC101, and/or the 3 light chain CDRs of BNC 101.
- the anti-LGR antibody comprises the heavy chain variable region of BNC101, and/or the light chain variable region of
- an RSPO or LGR antagonist that inhibits binding of at least one human RSPO to at least one LGR protein is a soluble receptor.
- an RSPO or LGR antagonist that inhibits binding of at least one human RSPO to at least one LGR protein is a LGR-Fc soluble receptor.
- an RSPO or LGR antagonist that inhibits binding of at least one human RSPO to at least one LGR protein is a LGR5-Fc soluble receptor.
- the LGR5-Fc soluble receptor comprises amino acid sequence of SEQ ID NO:57.
- the RSPO or LGR antagonist described herein inhibits activation of ⁇ -catenin.
- activation of ⁇ -catenin by one or more receptors selected from the group consisting of LGR4, LGR5, and LGR6 is inhibited.
- the inhibition of activation of ⁇ -catenin by an RSPO-binding agent or LGR-binding agent is a reduction in the level of activation of ⁇ -catenin of at least about 10%, at least about 25%, at least about 50%, at least about 75%, at least about 90%, or at least about 95%.
- an RSPO or LGR antagonist that inhibits activation of ⁇ -catenin is an antibody.
- an RSPO or LGR antagonist that inhibits activation of ⁇ -catenin is an anti-LGR antibody.
- an RSPO or LGR antagonist that inhibits activation of ⁇ -catenin is an anti-LGR antibody comprising the 3 heavy chain CDRs of 88M1, and/or the 3 light chain CDRs of 88M1.
- the anti-LGR antibody comprises the heavy chain variable region of 88M1, and/or the light chain variable region of 88M1.
- the anti-LGR antibody comprises the 3 heavy chain CDRs of BNC 101, and/or the 3 light chain CDRs of BNC 101.
- the anti-LGR antibody comprises the heavy chain variable region of BNC 101, and/or the light chain variable region of
- an RSPO or LGR antagonist that inhibits activation of ⁇ -catenin is a soluble receptor.
- an RSPO or LGR antagonist that inhibits activation of ⁇ - catenin is a LGR-Fc soluble receptor.
- an RSPO or LGR antagonist that inhibits activation of ⁇ -catenin is a LGR5-Fc soluble receptor.
- the LGR5-Fc soluble receptor comprises amino acid sequence of SEQ ID NO:57.
- an RSPO or LGR antagonist has one or more of the following effects: inhibit proliferation of tumor cells, inhibit tumor growth, reduce the frequency of cancer stem cells in a tumor, reduce the tumorigenicity of a tumor, reduce the tumorigenicity of a tumor by reducing the frequency of cancer stem cells in the tumor, trigger cell death of tumor cells, induce cells in a tumor to differentiate, differentiate tumorigenic cells to a non-tumorigenic state, induce expression of differentiation markers in the tumor cells, prevent metastasis of tumor cells, or decrease survival of tumor cells.
- an RSPO or LGR antagonist is capable of inhibiting tumor growth.
- an RSPO or LGR antagonist is capable of inhibiting tumor growth in vivo (e.g., in a xenograft mouse model and/or in a human having cancer).
- the tumor is a tumor selected from the group consisting of colorectal tumor, colon tumor, pancreatic tumor, lung tumor, ovarian tumor, liver tumor, breast tumor, kidney tumor, prostate tumor, gastrointestinal tumor, melanoma, cervical tumor, bladder tumor, glioblastoma, and head and neck tumor.
- the tumor is a breast tumor.
- the tumor is an ovarian tumor.
- the tumor is a lung tumor.
- the tumor is a pancreatic tumor.
- the tumor is an RSPO-dependent tumor, LGR-dependent tumor, or ⁇ - catenin-dependent tumor.
- an RSPO or LGR antagonist is capable of reducing the
- an RSPO or LGR antagonist is capable of reducing the tumorigenicity of a tumor comprising cancer stem cells in an animal model, such as a mouse xenograft model.
- the number or frequency of cancer stem cells in a tumor is reduced by at least about two-fold, about three-fold, about five-fold, about ten-fold, about 50- fold, about 100-fold, or about 1000-fold.
- the reduction in the number or frequency of cancer stem cells is determined by limiting dilution assay using an animal model.
- an RSPO or LGR antagonist is active in vivo for at least 1 hour, at least about 2 hours, at least about 5 hours, at least about 10 hours, at least about 24 hours, at least about 2 days, at least about 3 days, at least about 1 week, or at least about 2 weeks.
- the RSPO or LGR antagonist is an IgG (e.g., IgGl or IgG2) antibody that is active in vivo for at least 1 hour, at least about 2 hours, at least about 5 hours, at least about 10 hours, at least about 24 hours, at least about 2 days, at least about 3 days, at least about 1 week, or at least about 2 weeks.
- the RSPO or LGR antagonist is a fusion protein that is active in vivo for at least 1 hour, at least about 2 hours, at least about 5 hours, at least about 10 hours, at least about 24 hours, at least about 2 days, at least about 3 days, at least about 1 week, or at least about 2 weeks.
- an RSPO or LGR antagonist has a circulating half-life in mice, cynomolgus monkeys, or humans of at least about 5 hours, at least about 10 hours, at least about 24 hours, at least about 2 days, at least about 3 days, at least about 1 week, or at least about 2 weeks.
- the RSPO or LGR antagonist is an IgG (e.g., IgGl or IgG2) antibody that has a circulating half-life in mice, cynomolgus monkeys, or humans of at least about 5 hours, at least about 10 hours, at least about 24 hours, at least about 2 days, at least about 3 days, at least about 1 week, or at least about 2 weeks.
- the RSPO or LGR antagonist is a fusion protein that has a circulating half-life in mice, cynomolgus monkeys, or humans of at least about 5 hours, at least about 10 hours, at least about 24 hours, at least about 2 days, at least about 3 days, at least about 1 week, or at least about 2 weeks.
- Methods of increasing (or decreasing) the half-life of agents such as polypeptides and antibodies are known in the art.
- known methods of increasing the circulating half-life of IgG antibodies include the introduction of mutations in the Fc region which increase the pH-dependent binding of the antibody to the neonatal Fc receptor (FcRn).
- FcRn neonatal Fc receptor
- Known methods of increasing the circulating half-life of antibody fragments lacking the Fc region include such techniques as PEGylation.
- the present invention provides RSPO or LGR antagonists for use in combination therapy with immunotherapeutic agents for modulating immune responses, inhibiting tumor growth, and/or for the treatment of cancer.
- a RSPO or LGR antagonists for use in combination therapy with immunotherapeutic agents for modulating immune responses, inhibiting tumor growth, and/or for the treatment of cancer.
- immunotherapeutic agent is selected from the group consisting of: a modulator of PD-1 activity, a modulator of PD-Ll activity, a modulator of PD-L2 activity, a modulator of CTLA-4 activity, a modulator of CD28 activity, a modulator of CD80 activity, a modulator of CD86 activity, a modulator of 4- IBB activity, an modulator of OX40 activity, a modulator of KIR activity, a modulator of Tim-3 activity, a modulator of LAG3 activity, a modulator of CD27 activity, a modulator of CD40 activity, a modulator of GITR activity, a modulator of TIGIT activity, a modulator of CD20 activity, a modulator of CD96 activity, a modulator of IDOl activity, a cytokine, a chemokine, an interferon, an interleukin, a lymphokine, a member of the tumor necrosis factor (TNF) family, and an
- an immunotherapeutic agent is selected from the group consisting of: a PD-1 antagonist, a PD-Ll antagonist, a PD-L2 antagonist, a CTLA-4 antagonist, a CD80 antagonist, a CD86 antagonist, a KIR antagonist, a Tim-3 antagonist, a LAG3 antagonist, a TIGIT antagonist, a CD20 antagonist, a CD96 antagonist, and/or an IDOl antagonist.
- the PD-1 antagonist is an antibody that specifically binds PD-1.
- the antibody that binds PD-1 is Merck (KEYTRUDA, MK-3475; Merck), pidilizumab (CT-011; Curetech Ltd.), nivolumab (OPDIVO, BMS-936558, MDX-1106; Bristol Myer Squibb), MEDI0680 (AMP-514; AstraZenenca/Medlmmune), REGN2810 (Regeneron
- BGB-A317 (BeiGene Ltd.), PDR-001 (Novartis), or STI-A1110 (Sorrento
- the antibody that binds PD-1 is described in PCT Publication WO 2014/179664, for example, an antibody identified as APE2058, APE1922, APE1923, APE1924, APE 1950, or APE 1963 (Anaptysbio), or an antibody containing the CDR regions of any of these antibodies.
- the PD-1 antagonist is a fusion protein that includes PD-L2, for example, AMP-224 (AstraZeneca/Medlmmune).
- the PD-1 antagonist is a peptide inhibitor, for example, AU P-12 (Aurigene).
- the PD-L1 antagonist is an antibody that specifically binds PD-L1.
- the antibody that binds PD-L1 is atezolizumab (RG7446, MPDL3280A;
- the antibody that binds PD- LI is described in PCT Publication WO 2014/055897, for example, Ab-14, Ab-16, Ab-30, Ab-31, Ab-42, Ab-50, Ab-52, or Ab-55, or an antibody that contains the CDR regions of any of these antibodies.
- the CTLA-4 antagonist is an antibody that specifically binds CTLA-4.
- the antibody that binds CTLA-4 is ipilimumab (YERVOY) or tremelimumab (CP-675,206).
- the CTLA-4 antagonist a CTLA-4 fusion protein, for example, KAHR-102 (Kahr Medical Ltd.).
- the LAG3 antagonist is an antibody that specifically binds LAG3.
- the antibody that binds LAG3 is IMP701 (Prima BioMed), IMP731 (Prima BioMed/GlaxoSmithKline), BMS-986016 (Bristol Myer Squibb), LAG525 (Novartis), and
- the LAG3 antagonist includes a soluble LAG3 receptor, for example, IMP321 (Prima BioMed).
- the KIR antagonist is an antibody that specifically binds KIR.
- the antibody that binds KIR is lirilumab.
- an immunotherapeutic agent is selected from the group consisting of: a CD28 agonist, a 4-lBB agonist, an OX40 agonist, a CD27 agonist, a CD80 agonist, a CD86 agonist, a CD40 agonist, and a GITR agonist.
- the OX40 agonist includes OX40 ligand, or an OX40-binding portion thereof.
- the OX40 agonist may be MEDI6383 (AstraZeneca).
- the OX40 agonist is an antibody that specifically binds OX40.
- the antibody that binds OX40 is MEDI6469 (AstraZeneca/Medlmmune), MEDI0562 (AstraZeneca/Medlmmune), or MOXR0916 (RG7888; Genentech).
- the OX40 agonist is a vector (e.g., an expression vector or virus, such as an adenovirus) capable of expressing OX40 ligand.
- the OX40-expressing vector is Delta-24-RGDOX (DNAtrix) or DNX2401 (DNAtrix).
- the 4-1BB (CD137) agonist is a binding molecule, such as an anticalin.
- the anticalin is PRS-343 (Pieris AG).
- the 4- IBB agonist is an antibody that specifically binds 4-1BB.
- antibody that binds 4-1BB is PF-2566 (PF-05082566; Pfizer) or urelumab (BMS-663513; Bristol Myer Squibb).
- the CD27 agonist is an antibody that specifically binds CD27.
- the antibody that binds CD27 is varlilumab (CDX-1127; Celldex).
- the GITR agonist comprises GITR ligand or a GITR-binding portion thereof.
- the GITR agonist is an antibody that specifically binds GITR.
- the antibody that binds GITR is TRX518 (GITR, Inc.), MK-4166 (Merck), or INBRX-110 (Five Prime Therapeutics/Inhibrx).
- immunotherapeutic agents include, but are not limited to, cytokines such as chemokines, interferons, interleukins, lymphokines, and members of the tumor necrosis factor (TNF) family.
- immunotherapeutic agents include immunostimulatory oligonucleotides, such as CpG dinucleotides.
- a immunotherapeutic agent includes, but is not limited to, anti-PD-1 antibodies, anti-PD-Ll antibodies, anti-PD-L2 antibodies, anti-CTLA-4 antibodies, anti-CD28 antibodies, anti-CD80 antibodies, anti-CD86 antibodies, anti-4-lBB antibodies, anti-OX40 antibodies, anti-KIR antibodies, anti-Tim-3 antibodies, anti-LAG3 antibodies, anti-CD27 antibodies, anti-CD40 antibodies, anti-GITR antibodies, anti-TIGIT antibodies, anti-CD20 antibodies, anti-CD96 antibodies, or anti-IDO l antibodies.
- Anti-CTLA-4 clone 9D9 (BioXCell; West Lebanon, NH) was dosed on days 5, 8, and 12.
- Anti-PD-Ll clone 10F.9G2 (BioXCell) was dosed on days 5, 8, 12, 14, 19, 22, and 26, and either 1B7.11 isotype or 131R10 were administered days 5, 12, 19, and 26 following parental B16F1 cell implantation.
- FBS+penn/strep at a concentration of 10 6 cells/ml in the presence of lug/ml hgplOO peptide.
- Cells were plated on pre-coated ELISpot plates, incubated overnight and processed according to manufacturer's instructions (MabTech, Cincinnati, OH). Developed plates were read on a BioSys BioReader 6000-F b. The results from this assay are shown in Figure 2A (IFN-gamma) and Figure 2B (IL-2). Values shown are total optical density. As shown in these figures, IFN-gamma and IL-2 were increased by addition of 131R10 therapy.
- a T-cell cytotoxicity assay was also performed. Briefly, splenocytes were harvested from a minimum of four mice per group, filtered, and the red blood cells lysed and re-suspended in
- RPMI+10% FBS+penn/strep at a concentration of 2 x 10 6 cells/ml.
- Splenocytes were incubated with ⁇ g/ml hgplOO peptide for nine days.
- B16F1 cells in culture were incubated with lOuM calcein AM viability dye per 10 6 cells at 37°C for one hour.
- Cells were then incubated with ⁇ g/ml hgp lOO for an additional hour at 37°C before being washed to remove excess dye.
- Splenocytes were re-suspended at 2.5xl0 6 cells/ml, B 16F1 cells were re-suspended at 10 5 cells/ml and ⁇ of each combined in each well of a V-bottom plate for an effectortarget ratio of 25: 1, with splenocytes from each individual mouse plated in triplicate.
- Labeled B 16F1 cells were incubated in 5% SDS to determine maximum lysis conditions, while labeled cells were incubated in medium alone to determine minimum lysis conditions. The plate was then centrifuged at lOOOrpm for four minutes and then incubated at 37°C for four hours. Culture supematants were then harvested and fluorescence of released calcein AM was read at 485nm.
- Percent specific lysis was determined by dividing the value of the experimental sample by the difference in values between maximum and minimum lysis conditions. The results from these experiments, which are shown in Figure 3, show an increase in T cell cytotoxocity from the combination of the anti-RSPO antibody with anti-CTLA-4 + anti-PD-Ll as compared to controls.
- T-cell tumor infiltration was also measured.
- B16F1 tumors were isolated from control antibody, anti-CTLA-4 and anti -mouse PD-L1 combination; and 131R10 + anti -mouse anti-CTLA-4 + anti-mouse PD-L1 combination antibody-treated mice.
- Single cell suspensions were acquired from 4-6 independently treated tumors and were stained for tumor infiltrating immune cells using fluorescently-labeled anti-CD45, anti-CD4, and anti-CD8 antibodies.
- Flow cytometry analysis (FACS) was performed and the relative percentage populations of CD45+/CD4+ and CD45+/CD8+ T cells are shown.
- FIGs 4A and 4B addition of 131R10 increased CD4 + and CD8 + T cell infiltration as compared to treatment with immune checkpoint inhibitors alone.
- splenocytes were harvested from a minimum of four mice per group, filtered, the red blood cells lysed and re-suspended in RPMI+10% FBS+pen/strep at a concentration of 10 6 cells/ml in the presence of 0.2ug/ml AH1 peptide.
- Cells were plated on pre- coated ELISpot plates, incubated overnight, and processed according to manufacturer's instructions (MabTech, Cincinnati, OH). Developed plates were read on a BioSys BioReader ® 6000-F b macroscope.
- mice taken from the three treatment groups were cultured in RPMI culture medium supplemented with 10% (v/v) fetal bovine serum (FBS), 2mM L-glutamine, and 100 U/mL penicillin at 37°C in a humidified atmosphere of 5% C0 2 .
- FBS fetal bovine serum
- 2mM L-glutamine 100 U/mL penicillin
- penicillin 0.5 ⁇ g/mL AH1 peptide
- T cell cytotoxicity was increased in the 13 lRlO+anti-PDl combination relative to both control and anti-PD l alone.
- a digestion solution containing Collagenase in MEM medium (Cambrex, East Rutherford, NJ) with a 1: 100 dilution of DNAsel (Worthington, Lakewood, NJ) was mixed with the tumor suspension and incubated for 1 hour at 37°C for enzymatic dissociation with mechanical agitation with a pipette every 15 min.
- the reaction was inactivated by adding equal volume of FACS buffer (HBSS medium supplemented with 2% heat-inactivated fetal bovine serum and 20mM Hepes) and filtered through a 40um mesh to remove aggregated and undigested tissues.
- mice were randomized for treatment with an anti-RSPO antibody (131R10; 25 mg/kg, Q1W starting day 1), an anti-PD-1 antibody (319R1; 25 mg/kg, Q 1W starting day 1), and/or docetaxel (33 mg/kg, Q 1W starting day 4). Changes in tumor size in this experiment are shown in Figure 16. The largest effect was observed in the mice receiving all three agents (131R10+anti-PD-l+docetaxel).
- an anti-RSPO antibody 131R10; 25 mg/kg, Q1W starting day 1
- an anti-PD-1 antibody 319R1; 25 mg/kg, Q 1W starting day 1
- docetaxel 33 mg/kg, Q 1W starting day 4
- mice Changes in frequency, infiltration, and activation of dendritic cells, as well as frequency of T regulatory cells were measured in 4T1 tumor-implanted mice. Further, selected cytokine levels (IL- 17a and IL-2) were measured as well.
- 4T1 cells were injected subcutaneously into BALB/c mice. At a mean tumor volume of -150 mm 3 , mice were randomized for treatment with the anti-RSP03 antibody 131R10 (25 mg/kg, day 0), an anti-PD-1 antibody (25 mg/kg, day 0), and/or docetaxel (33 mg/kg, day 3). Seven days following antibody administration, mice were euthanized and tissues harvested.
- tumor cells were brought to a single cell suspension and the red blood cells lysed. Tumor cells were incubated with Fc block and then stained for cell surface markers shown (antibodies purchased from Affymetrix, BD Biosciences, and BioLegend), washed, and stained with fixable viability dye. Treg samples were fixed and permeabilized with Mouse Regulatory T Cell Staining Kit 1, then stained for Foxp3, per
- splenocytes were pressed through a 40 ⁇ filter using a syringe plunger. Red blood cells were then lysed to form splenocyte cell suspensions. Two-hundred thousand cells per well were plated in the presence of AH1 peptide onto IL-2 and IL-17a ELISpot plates, incubated overnight, and processed per manufacturer's instructions (Mabtech). Total optical density was determined using a BlOreader ELISpot reader.
- treatment groups show increases in tumor dendritic cell frequency as compared to controls.
- Figure 17C shows increases in tumor cell infiltration of CD8a + cells as compared to control, and
- Figure 17D shows increased tumor dendritic cell activation in treatment groups as compared to control.
- Figure 18A shows changes in splenic dendritic cells, and
- Figure 18B shows decreases in T regulatory cells in the spleen in treatment groups as compared to controls.
- Murine colon adenocarcinoma MC38 cells were injected subcutaneously into C57BL/6 mice At a mean tumor volume of ⁇ 110mm 3 , mice were randomized for treatment with an anti-RSPO antibody (131R10; 25 mg/kg, Q1W starting day 1) and/or an anti-PD-1 antibody (319R1; 25 mg/kg, Q1W starting day 1).
- an anti-RSPO antibody 131R10; 25 mg/kg, Q1W starting day 1
- an anti-PD-1 antibody 319R1; 25 mg/kg, Q1W starting day 1
- red blood cells were lysed.
Abstract
The present invention provides methods comprising combination therapy for modulating immune responses, for inhibiting tumor growth, and/or for treating cancer. In particular, the present invention provides RSPO or LGR antagonists in combination with immunotherapeutic agents for the treatment of cancer and other diseases.
Description
COMBINATION THERAPY FOR TREATMENT OF DISEASE
CROSS-REFERENCE TO RELATED APPLICATONS
[0001] This application claims the priority benefit of U.S. Provisional Application No. 62/212,471, filed August 31, 2015, which is hereby incorporated by reference herein in its entirety.
FIELD OF THE INVENTION
[0002] The present invention provides methods comprising combination therapy for modulating immune responses and treating cancer and other diseases. In particular, the present invention provides RSPO or LGR antagonists in combination with at least one additional immunotherapeutic agent for the treatment of cancer.
BACKGROUND OF THE INVENTION
[0003] The R-spondin (RSPO) family of proteins is conserved among vertebrates and comprises four members, RSPOl, RSP02, RSP03, and RSP04. These proteins have been referred to by a variety of names, including roof plate-specific spondins, hPWTSR (hRSP03), THS2D (RSP03), Cristin 1-4, and Futrin 1-4. The RSPOs are small secreted proteins that overall share approximately 40-60% sequence homology and domain organization. All RSPO proteins contain two furin-like cysteine-rich domains at the N-terminus followed by a thrombospondin domain and a basic charged C-terminal tail (Kim et al, 2006, Cell Cycle, 5:23-26).
[0004] Studies have shown that RSPO proteins have a role during vertebrate development (Kamata et al., 2004, Biochim. Biophys Acta, 1676:51-62) and inXenopus myogenesis (Kazanskaya et al., 2004, Dev. Cell, 7:525-534). RSPO 1 has also been shown to function as a potent mitogen for
gastrointestinal epithelial cells (Kim et al., 2005, Science, 309: 1256-1259). It has been reported that RSP03 is prominently expressed in or close by endothelial cells and their cellular precursors in Xenopus and mouse. Furthermore, it has been suggested that RSP03 may act as an angiogenic factor in embryogenesis (Kazanskaya et al., 2008, Development, 135:3655-3664). RSPO proteins are known to activate β-catenin signaling similar to Wnt signaling, however the relationship between RSPO proteins and Wnt signaling is still being investigated. It has been reported that RSPO proteins possess a positive modulatory activity on Wnt ligands (Nam et al., 2006, JBC 281 : 13247-57). This study also reported that RSPO proteins could function as Frizzled8 and LRP6 receptor ligands and induce β- catenin signaling (Nam et al., 2006, JBC 281 : 13247-57). Recent studies have identified an interaction between RSPO proteins and LGR (leucine-rich repeat containing, G protein-coupler receptor) proteins, such as LGR5 (U.S. Patent Publication Nos. 2009/0074782 and 2009/0191205), and these data present an alternative pathway for the activation of β-catenin signaling.
[0005] The focus of cancer drug research is shifting toward targeted therapies aimed at genes, proteins, and pathways involved in human cancer. There is a need for new agents targeting signaling
pathways and new combinations of agents that target multiple pathways that could provide therapeutic benefit for cancer patients. Thus, biomolecules (e.g., anti-RSP03 antibodies) that disrupt β-catenin signaling are a potential source of new therapeutic agents for cancer, as well as other β-catenin- associated diseases.
[0006] It is one of the objectives of the present invention to provide improved methods for cancer treatment, particularly methods using RSPO or LGR antagonists in combination with
immunotherapeutic agents.
BRIEF SUMMARY OF THE INVENTION
[0007] The present invention provides methods for treating diseases such as cancer, where the methods include administering to a subject an RPSO or LGR antagonist, such as an anti-RSPO antibody or anti-LGR antibody, or a soluble LGR receptor, in combination with an
immunotherapeutic agent. Combination therapy can employ at least two different agents that work by different mechanisms of action and/or target different pathways. The combination may result in additive or synergetic effects. Combination therapy may allow for a lower dose of each agent than used in monotherapy, thereby reducing toxic side effects and/or increasing the therapeutic index of the agent(s). Combination therapy may decrease the likelihood that resistance to an agent will develop. Combination therapy may allow one agent to sensitize tumor cells (including cancer stem cells) to enhanced activity by a second agent. Combination therapy comprising an immunotherapeutic agent may allow one agent to enhance the immune response to a tumor or tumor cells while the second agent may be effective at killing tumor cells more directly. In addition, the order and/or timing of the administration of each therapeutic agent may affect the overall efficacy of a drug combination.
[0008] The invention provides an RPSO or LGR antagonist, including but not limited to, antibodies and other polypeptides that bind to at least one RPSO or LGR protein, small molecules that bind at least one RSPO or LGR protein, and soluble LGR proteins. The RSPO protein (e.g., human protein) may be one of RPSO 1, RSP02, RSP03, and RSP04. The LGR protein may be LGR5.
[0009] The invention provides immunotherapeutic agents, including but not limited to, a modulator of PD-1 activity, a modulator of PD-L 1 activity, a modulator of PD-L2 activity, a modulator of CTLA-4 activity, a modulator of CD28 activity, a modulator of CD 80 activity, a modulator of CD 86 activity, a modulator of 4- IBB activity, an modulator of OX40 activity, a modulator of KIR activity, a modulator of Tim-3 activity, a modulator of LAG3 activity, a modulator of CD27 activity, a modulator of CD40 activity, a modulator of GITR activity, a modulator of TIGIT activity, a modulator of CD20 activity, a modulator of CD96 activity, a modulator of IDO 1 activity, a cytokine, a chemokine, an interferon, an interleukin, a lymphokine, a member of the tumor necrosis factor (TNF) family, and an immunostimulatory oligonucleotide.
[0010] Compositions comprising an RSPO or LGR antagonist (e.g., an anti-RSPO, anti-LGR antibody, or soluble LGR receptor) and/or at least one additional immunotherapeutic agent are
provided. Pharmaceutical compositions comprising the RSPO or LGR antagonist and/or the immunotherapeutic agents are provided.
[0011] In one aspect, the invention provides methods of inhibiting tumor growth. In some embodiments, a method comprises contacting tumor cells with an effective amount of a RSPO or LGR antagonist (e.g., an anti-RSPO, anti-LGR antibody, or soluble LGR receptor) in combination with an effective amount of an immunotherapeutic agent. The method may be in vivo or in vitro. In certain embodiments, the tumor is in a subject, and contacting tumor cells with the RSPO or LGR antagonist and the immunotherapeutic agent comprises administering a therapeutically effective amount of each of the agents to the subject.
[0012] In another aspect, the invention provides a method of treating cancer. In some embodiments, a method of treating cancer comprises administering to a subject a therapeutically effective amount of a RSPO or LGR antagonist (e.g., an anti-RSPO, anti-LGR antibody, or soluble LGR receptor) in combination with a therapeutically effective amount of an immunotherapeutic agent.
[0013] In another aspect, the invention provides a method of inhibiting the activity of regulatory T- cells (Tregs). In some embodiments, a method of inhibiting the activity of Tregs comprises administering to a subject a therapeutically effective amount of a RSPO or LGR antagonist (e.g., an anti-RSPO, anti-LGR antibody, or soluble LGR receptor) in combination with a therapeutically effective amount of an immunotherapeutic agent. In some embodiments, the inhibition of Treg activity comprises inhibiting the suppression of immune responses. In some embodiments, the inhibition of Treg activity results in the inhibition of suppression of immune responses.
[0014] In another aspect, the invention provides a method of increasing T cell infiltration into a tumor. In some embodiments, a method of increasing T cell infiltration into a tumor comprises administering to a subject a therapeutically effective amount of a RSPO or LGR antagonist (e.g., an anti-RSPO, anti-LGR antibody, or soluble LGR receptor) in combination with a therapeutically effective amount of an immunotherapeutic agent.
[0015] In another aspect, the invention provides a method of increasing T cell cytotoxicity to a tumor. In some embodiments, a method of increasing T cell cytotoxicity to a tumor comprises administering to a subject a therapeutically effective amount of a RSPO or LGR antagonist (e.g., an anti-RSPO, anti-LGR antibody, or soluble LGR receptor) in combination with a therapeutically effective amount of an immunotherapeutic agent.
[0016] In another aspect, the invention provides a method of increasing tumor cell lysis. In some embodiments, a method of increasing tumor cell lysis comprises administering to a subject a therapeutically effective amount of a RSPO or LGR antagonist (e.g., an anti-RSPO, anti-LGR antibody, or soluble LGR receptor) in combination with a therapeutically effective amount of an immunotherapeutic agent.
[0017] In another aspect, the invention provides a method to increase the efficacy of an immune checkpoint modulator. In some embodiments, a method to increase the efficacy of an immune checkpoint modulator comprises administering to a subject a therapeutically effective amount of a RSPO or LGR antagonist (e.g., an anti-RSPO, anti-LGR antibody, or soluble LGR receptor) in combination with a therapeutically effective amount of an immune checkpoint modulator. In some embodiments, the immune checkpoint modulator is an immune checkpoint inhibitor. In some embodiments, the immune checkpoint modulator is an immune checkpoint enhancer or stimulator.
[0018] In another aspect, the invention provides a method of reducing or preventing metastasis in a subject. In some embodiments, a method of reducing or preventing metastasis in a subject comprises administering to the subject a therapeutically effective amount of a RSPO or LGR antagonist (e.g., an anti-RSPO, anti-LGR antibody, or soluble LGR receptor) and a therapeutically effective amount of an immunotherapeutic agent.
[0019] In another aspect, the invention provides a method of enhancing treatment for a subject who is being treated with an immune checkpoint inhibitor, the method comprising administering to the subject a therapeutically effective amount of a RSPO or LGR antagonist (e.g., an anti-RSPO, anti- LGR antibody, or soluble LGR receptor).
[0020] In another aspect, the invention provides a method of enhancing or inducing an anti-tumor immune response in a subject, the method comprising administering to the subject a therapeutically effective amount of a RSPO or LGR antagonist (e.g., an anti-RSPO, anti-LGR antibody, or soluble LGR receptor).
[0021] In some embodiments, the RSPO or LGR antagonist is an RSPO-binding agent. In some embodiments, the RSPO or LGR antagonist is an LGR-binding agent. In some embodiments, the RSPO or LGR antagonist is an antibody. In some embodiments, the RSPO or LGR antagonist is an anti-RSPO antibody. In some embodiments, the RSPO or LGR antagonist is an anti-LGR antibody. In some embodiments, the RSPO or LGR antagonist is the antibody OMP-131R10 (also referred to as OMP-131R010, 131R10, or 131R010). In some embodiments, the RSPO or LGR antagonist is a soluble receptor. In some embodiments, the RSPO or LGR antagonist is an LGR-Fc soluble receptor. In some embodiments, the RSPO or LGR antagonist is an LGR5-Fc soluble receptor. In certain embodiments, the LGR5-Fc soluble receptor comprises amino acid sequence of SEQ ID NO:57.
[0022] In some embodiments, the RSPO or LGR antagonist is an antibody that specifically binds at least one RSPO protein or portion thereof. In some embodiments, the antibody specifically binds at least one human RSPO protein selected from the group consisting of: RSPOl, RSP02, RSP03, and RSP04. In some embodiments, the antibody specifically binds at least one human RSP03.
[0023] In some embodiments, the antibody specifically binds at least human RSPOl . In some embodiments, the antibody includes (a) a heavy chain CDR1 including TGYTMH (SEQ ID NO:5), a heavy chain CDR2 including GINPN GGTTYNQNFKG (SEQ ID NO:6), and a heavy chain CDR3
including KEFSDGYYFFAY (SEQ ID NO:7); and/or (b) a light chain CDR1 including KASQDVIFAVA (SEQ ID NO: 8), a light chain CDR2 including WASTRHT (SEQ ID NO:9), and a light chain CDR3 including QQHYSTPW (SEQ ID NO: 10). In some embodiments, the antibody includes a heavy chain variable region including an amino acid sequence at least 80%, 85%, 90%, 90%, 95%, or 100% identical to SEQ ID NO: 11 or 44 (e.g., including one, two or three of the heavy chain CDRs mentioned above), and a light chain variable region including an amino acid sequence at least 80%, 85%, 90%, 90%, 95%, or 100% identical to SEQ ID NO: 12 or 45 (e.g., including one, two, or three of the light chain CDRs mentioned above). In some embodiments, the antibody includes a heavy chain variable region including SEQ ID NO: 1 1 and a light chain variable region including SEQ ID NO: 12.
[0024] In some embodiments, the antibody specifically binds at least human RSP02. In some embodiments, the antibody includes (a) a heavy chain CDR1 including SSYAMS (SEQ ID NO: 17), a heavy chain CDR2 including SISSGGSTYYPDSVKG (SEQ ID NO: 18), and a heavy chain CDR3 including RGGDPGVYNGDYEDAMDY (SEQ ID NO: 19); and (b) a light chain CDR1 including KASQDVSSAVA (SEQ ID NO:20), a light chain CDR2 including WASTRHT (SEQ ID NO:21), and a light chain CDR3 including QQHYSTP (SEQ ID NO:22). In some embodiments, the antibody includes a heavy chain variable region including an amino acid sequence at least 80%, 85%, 90%, 90%, 95%, or 100% identical to SEQ ID NO:23 (e.g., including one, two, or three of the heavy chain CDRs mentioned above)and a light chain variable region including an amino acid sequence at least 80%, 85%, 90%, 90%, 95%, or 100% identical to SEQ ID NO:24 (e.g., including one, two, or three of the light CDRs mentioned above).
[0025] In some embodiments, the antibody specifically binds at least human RSP03. In some embodiments, the antibody includes (a) a heavy chain CDR1 including DYSIH (SEQ ID NO:29), a heavy chain CDR2 including YIYPSNGDSGYNQKFK (SEQ ID NO:30), and a heavy chain CDR3 including TYFANNFD (SEQ ID NO:31) or ATYF ANNTD Y( SEQ ID NO:32); and (b) a light chain CDR1 including KASQSVDYDGDSYMN (SEQ ID NO:33), a light chain CDR2 including
AASNLES (SEQ ID NO:34) or AAS (SEQ ID NO:35), and a light chain CDR3 including
QQSNEDPLT (SEQ ID NO:36) or QQSNEDPLTF (SEQ ID NO:37). In some embodiments, the antibody includes (a) a heavy chain CDR1 including DYSIH (SEQ ID NO:29), a heavy chain CDR2 including YIYPSNGDSGYNQKFK (SEQ ID NO:30), and a heavy chain CDR3 including
TYFANNFD (SEQ ID NO:31); and (b) a light chain CDR1 including KASQSVDYDGDSYMN (SEQ ID NO:33), a light chain CDR2 including AASNLES (SEQ ID NO:34), and a light chain CDR3 including QQSNEDPLT (SEQ ID NO:36). In some embodiments, the antibody includes a heavy chain variable region including an amino acid sequence at least 80%, 85%, 90%, 90%, 95%, or 100% identical to SEQ ID NO:38 (e.g., including one, two, or three of the heavy chain CDRs mentioned above), and a light chain variable region including an amino acid sequence at least 80%, 85%, 90%,
90%, 95%, or 100% identical to SEQ ID NO:39 (e.g., including one, two, or three of the light chain CDRs mentioned above). In some embodiments, the antibody is 131R10.
[0026] In some embodiments, the RSPO or LGR antagonist is an antibody that specifically binds at least one human LGR protein (e.g., LGR4, LGR5, and LGR6). In some embodiments, the antibody specifically binds at least human LGR5. In certain embodiments, the antibody includes (a) the heavy chain CDR1, CDR2, and CDR3 sequences of the monoclonal antibody produced by the 88M1 hybridoma having the ATCC deposit number PTA-9342; and (b) the light chain CDR1, CDR2, and CDR3 sequences of the monoclonal antibody produced by the 88M1 hybridoma having the ATCC deposit number PTA-9342. In some embodiments, the antibody includes the heavy chain variable region and light chain variable region of the monoclonal antibody produced by the 88M1 hybridoma having the ATCC deposit number PTA-9342.
[0027] In some embodiments, the antibody is a monoclonal antibody, a recombinant antibody, a chimeric antibody, a humanized antibody, a human antibody, or an antibody fragment including an antigen-binding site. In some embodiments, the antibody is a monospecific antibody or a bispecific antibody. In some embodiments, the antibody is an IgGl antibody or an IgG2 antibody.
[0028] In some embodiments, the RSPO or LGR antagonist is a soluble receptor including an extracellular domain of a human LGR protein (e.g., LGR5), where the extracellular domain is capable of binding a human RSPO protein. In some embodiments, the extracellular domain of a human LGR protein includes amino acids 22-564 of human LGR5 (SEQ ID NO:56). In some embodiments, the soluble receptor includes a non-LGR polypeptide. In some embodiments, the non-LGR polypeptide is directly linked to the extracellular domain of the human LGR protein or is connected to the extracellular domain of the human LGR protein by a linker. In some embodiments, the non-LGR polypeptide includes a human Fc region (e.g., includes SEQ ID NO:58, SEQ ID NO:59, SEQ ID NO:60, SEQ ID NO:61, or SEQ ID NO:62, or an amino acid sequence at least 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO:58, SEQ ID NO:59, SEQ ID NO:60, SEQ ID NO:61, or SEQ ID NO:62).
[0029] In certain embodiments of each of the aforementioned aspects, as well as other aspects and embodiments described elsewhere herein, the RSPO or LGR antagonist enhances the activity of the immunotherapeutic agent.
[0030] In certain embodiments of each of the aforementioned aspects, as well as other aspects and embodiments described elsewhere herein, the immunotherapeutic agent enhances the activity of the RSPO or LGR antagonist.
[0031] In certain embodiments of each of the aforementioned aspects, as well as other aspects and embodiments described elsewhere herein, the RSPO or LGR antagonist and the immunotherapeutic agent act synergistically.
[0032] In certain embodiments of each of the aforementioned aspects, as well as other aspects and embodiments described elsewhere herein, the immunotherapeutic agent is an agent that modulates immune responses. In some embodiments, the immunotherapeutic agent is an agent that enhances anti-tumor immune responses. In some embodiments, the immunotherapeutic agent is an agent that increases cell-mediated immunity. In some embodiments, the immunotherapeutic agent is an agent that increases T-cell activity. In some embodiments, the immunotherapeutic agent is an agent that increases cytolytic T-cell (CTL) activity. In some embodiments, the immunotherapeutic agent is an agent that increases natural killer (NK) cell activity. In some embodiments, the immunotherapeutic agent is an agent that inhibits suppression of an immune response. In some embodiments, the immunotherapeutic agent is an agent that inhibits suppressor cells or suppressor cell activity. In some embodiments, the immunotherapeutic agent is an agent that inhibits Treg activity. In some embodiments, the immunotherapeutic agent is an agent that inhibits the activity of inhibitory immune checkpoint receptors.
[0033] In some embodiments, the immunotherapeutic agent is a modulator of PD-1 activity, a modulator of PD-Ll activity, a modulator of PD-L2 activity, a modulator of CTLA-4 activity, a modulator of CD28 activity, a modulator of CD80 activity, a modulator of CD86 activity, a modulator of 4- IBB activity, an modulator of OX40 activity, a modulator of KIR activity, a modulator of Tim-3 activity, a modulator of LAG3 activity, a modulator of CD27 activity, a modulator of CD40 activity, a modulator of GITR activity, a modulator of TIGIT activity, a modulator of CD20 activity, a modulator of CD96 activity, a modulator of IDOl activity, a cytokine, a chemokine, an interferon, an interleukin, a lymphokine, a member of the tumor necrosis factor (TNF) family, or an
immunostimulatory oligonucleotide. In some embodiments, the immunotherapeutic agent is an immune checkpoint modulator (e.g., an immune checkpoint inhibitor).
[0034] In some embodiments, the immunotherapeutic agent is an agent that inhibits the activity of PD-1. In some embodiments, the immunotherapeutic agent is an agent that inhibits the activity of PD-Ll and/or PD-L2. In some embodiments, the immunotherapeutic agent is an agent that inhibits the activity of CTLA-4. In some embodiments, the immunotherapeutic agent is an agent that inhibits the activity of CD80 and/or CD86. In some embodiments, the immunotherapeutic agent is an agent that inhibits the activity of TIGIT. In some embodiments, the immunotherapeutic agent is an agent that inhibits the activity of KIR. In some embodiments, the immunotherapeutic agent is an agent that enhances or stimulates the activity of activating immune checkpoint receptors.
[0035] In some of the embodiments of the methods described herein, the immunotherapeutic agent is a PD-1 antagonist, a PD-Ll antagonist, a PD-L2 antagonist, a CTLA-4 antagonist, a CD80 antagonist, a CD86 antagonist, a KIR antagonist, a Tim-3 antagonist, a LAG3 antagonist, a TIGIT antagonist, a CD20 antagonist, a CD96 antagonist, or an IDOl antagonist.
[0036] In some embodiments, the PD-1 antagonist is an antibody that specifically binds PD-1. In some embodiments, the antibody that binds PD-1 is pembrolizumab (KEYTRUDA, MK-3475;
Merck), pidilizumab (CT-01 1 ; Curetech Ltd.), nivolumab (OPDIVO, BMS-936558, MDX-1 106; Bristol Myer Squibb), MEDI0680 (AMP-514; AstraZenenca/Medlmmune), REGN2810 (Regeneron Pharmaceuticals), BGB-A3 17 (BeiGene Ltd.), PDR-001 (Novartis), or STI-A 1 1 10 (Sorrento
Therapeutics). In some embodiments, the antibody that binds PD-1 is described in PCT Publication WO 2014/179664, for example, an antibody identified as APE2058, APE1922, APE1923, APE1924, APE 1950, or APE 1963 (Anaptysbio), or an antibody containing the CDR regions of any of these antibodies. In other embodiments, the PD-1 antagonist is a fusion protein that includes the extracellular domain of PD-Ll or PD-L2, for example, AMP-224 (AstraZeneca/Medlmmune). In other embodiments, the PD-1 antagonist is a peptide inhibitor, for example, AUNP-12 (Aurigene).
[0037] In some embodiments, the PD-Ll antagonist is an antibody that specifically binds PD-Ll . In some embodiments, the antibody that binds PD-Ll is atezolizumab (RG7446, MPDL3280A;
Genentech), MEDI4736 (AstraZeneca/Medlmmune), BMS-936559 (MDX-1 105; Bristol Myers Squibb), avelumab (MSB0010718C; Merck KGaA), KD033 (Kadmon), the antibody portion of
KD033, or STI-A 1014 (Sorrento Therapeutics). In some embodiments, the antibody that binds PD- L l is described in PCT Publication WO 2014/055897, for example, Ab-14, Ab-16, Ab-30, Ab-31, Ab-42, Ab-50, Ab-52, or Ab-55, or an antibody that contains the CDR regions of any of these antibodies.
[0038] In some embodiments, the CTLA-4 antagonist is an antibody that specifically binds CTLA-4. In some embodiments, the antibody that binds CTLA-4 is ipilimumab (YERVOY; Bristol Myer Squibb) or tremelimumab (CP -675,206; Pfizer). In some embodiments, the CTLA-4 antagonist a CTLA-4 fusion protein or soluble CTLA-4 receptor, for example, KAHR-102 (Kahr Medical Ltd.).
[0039] In some embodiments, the LAG3 antagonist is an antibody that specifically binds LAG3. In some embodimetns, the antibody that binds LAG3 is IMP701 (Prima BioMed), IMP731 (Prima BioMed/GlaxoSmithKline), BMS-986016 (Bristol Myer Squibb), LAG525 (Novartis), and
GSK2831781 (Glaxo SmithKline). In some embodiments, the LAG3 antagonist includes a soluble LAG3 receptor, for example, IMP321 (Prima BioMed).
[0040] In some embodiments, the KIR antagonist is an antibody that specifically binds KIR. In some embodiments, the antibody that binds KIR is lirilumab (Bristol Myer Squibb/Innate Pharma).
[0041] In some embodiments, the immune checkpoint enhancer or stimulator is a CD28 agonist, a 4- 1BB agonist, an OX40 agonist, a CD27 agonist, a CD80 agonist, a CD86 agonist, a CD40 agonist, or a GITR agonist.
[0042] In some embodiments, the OX40 agonist includes OX40 ligand, or an OX40-binding portion thereof. For example, the OX40 agonist may be MEDI6383 (AstraZeneca). In some embodiments, the OX40 agonist is an antibody that specifically binds OX40. In some embodiments, the antibody
that binds OX40 is MEDI6469 (AstraZeneca/Medlmmune), MEDI0562 (AstraZeneca/Medlmmune), or MOXR0916 (RG7888; Genentech). In some embodiments, the OX40 agonist is a vector (e.g., an expression vector or virus, such as an adenovirus) capable of expressing OX40 ligand. In some embodiments the OX40-expressing vector is Delta-24-RGDOX (DNAtrix) or DNX2401 (DNAtrix).
[0043] In some embodiments, the 4-1BB (CD137) agonist is a binding molecule, such as an anticalin. In some embodiments, the anticalin is PRS-343 (Pieris AG). In some embodiments, the 4- 1BB agonist is an antibody that specifically binds 4-1BB. In some embodiments, antibody that binds 4-1BB is PF-2566 (PF-05082566; Pfizer) or urelumab (BMS-663513; Bristol Myer Squibb).
[0044] In some embodiments, the CD27 agonist is an antibody that specifically binds CD27. In some embodiments, the antibody that binds CD27 is varlilumab (CDX-1127; Celldex).
[0045] In some embodiments, the GITR agonist comprises GITR ligand or a GITR-binding portion thereof. In some embodiments, the GITR agonist is an antibody that specifically binds GITR. In some embodiments, the antibody that binds GITR is TRX518 (GITR, Inc.), MK-4166 (Merck), or INBRX-110 (Five Prime Therapeutics/Inhibrx).
[0046] In some embodiments, where the RSPO or LGR antagonist and immunotherapeutic agent together are a bispecific antibody. For example, the bispecific antibody may specifically bind a RSPO or LGR protein and immune checkpoint (e.g., any described herein, such as PD-1, PD-L1, PD-L2, or CTLA-4, LAG-3, OX40, or CD27). In particular embodiments, the bispecific antibody specifically binds a human RSPO protein and one of PD-1, PD-L1, and CTLA-4. In other embodiments, the bispecific antibody does not have both RSP03 as a first antigen target and an effector molecule on a leukocyte of (e.g., CD2, CD3, CD28, CTLA-4, CD80, or CD86) or a Fc receptor (e.g., CD64, CD32, or CD 16) as a second antigen target.
[0047] In some embodiments, the immunotherapeutic agent is a cytokine, for example, a chemokine, an interferon, an interleukin, lymphokine, or a member of the tumor necrosis factor family. In some embodiments, the cytokine is IL-2, IL15, or interferon-gamma.
[0048] In some embodiments of any of the above aspects or those described elsewhere herein, the cancer is selected from the group consisting of lung cancer, pancreatic cancer, breast cancer, colon cancer, colorectal cancer, melanoma, gastrointestinal cancer, gastric cancer, renal cancer, ovarian cancer, liver cancer, endometrial cancer, kidney cancer, prostate cancer, thyroid cancer,
neuroblastoma, glioma, glioblastoma, glioblastoma multiforme, cervical cancer, stomach cancer, bladder cancer, head and neck cancer, and hepatoma.
[0049] In some embodiments of any of the above aspects or those described elsewhere herein, the tumor is selected from the group consisting of lung tumor, pancreatic tumor, breast tumor, colon tumor, colorectal tumor, melanoma, gastrointestinal tumor, gastric tumor, renal tumor, ovarian tumor, liver tumor, endometrial tumor, kidney tumor, prostate tumor, thyroid tumor, neuroblastoma, glioma, glioblastoma, glioblastoma multiforme, cervical tumor, stomach tumor, bladder tumor, head and neck
tumor, and hepatoma. In some embodiments, the cancer expresses an RSPO protein (e.g., RSP03). In other embodiments, the cancer does not express an RSPO protein, for example, does not express RSPO l, RSP02, RSP03, or RSP04. In some embodiments, the cancer does not express RSP03.
[0050] In some embodiments of any of the above aspects or those described elsewhere herein, the subject's cancer or tumor does not respond to immune checkpoint inhibition (e.g., to any immune checkpoint inhibitor described herein, such as a PD-1 antagonist or PD-Ll antagonist) or the subject's cancer or tumor has progressed following an initial response to immune checkpoint inhibition (e.g., to any immune checkpoint inhibitor described herein, such as a PD-1 antagonist or PD-Ll antagonist).
[0051] In some embodiments of any of the above aspects or those described elsewhere herein, the subj ect is a human.
BRIEF DESCRIPTION OF THE DRAWINGS
[0052] Figures 1A-1D show the effect of anti-CTLA-4 and anti -PD-Ll antibody treatment on tumor growth in the presence or absence of the anti-RSP03 antibody 131R10. Figure 1A shows average results. Figures IB-ID show tumor measure growth measurements from individual control animals, animals receiving a control antibody with anti-CTLA-4 and anti -PD-Ll antibodies, and animals receiving 131R10 with anti-CTLA-4 and anti-PD-Ll antibodies, respectively.
[0053] Figures 2A and 2B show changes in interferon-gamma (Figure 2A) and IL-2 (Figure 2B) in splenocytes following treatment with control antibodies, anti-CTLA-4 and anti-PD-Ll antibodies, or 131R10 with anti-CTLA-4 and anti-PD-Ll antibodies.
[0054] Figure 3 shows changes in T cell cytotoxicity following treatment with control antibodies, anti-CTLA-4 and anti-PD-Ll antibodies, or 131R10 with anti-CTLA-4 and anti-PD-Ll antibodies.
[0055] Figures 4A and 4B show increases in tumor-infiltrating CD4+ (Figure 4A) and CD8+ (Figure 4B) T-cells in cells receiving 131R10 with anti-CTLA-4 and anti-PD-Ll antibodies, as compared to those receiving anti-CTLA-4 and anti-PD-Ll antibodies without 131R10 or control antibodies.
[0056] Figures 5A-5C show reduction in breast tumor cell growth in mice receiving anti-RSP03 antibody 131R10. Figure 5A shows the average in the control group (left) and 131R10 group (right). Figures 5B and 5C show the individual results from the control and 131R10 treatment groups, respectively.
[0057] Figures 6A-6D show changes in splenocyte cytokine expression of interferon gamma (Figure 6A), IL-2 (Figure 6B), IL-10 (Figure 6C), and IL-17A (Figure 6D) in mice implanted with breast tumor cells and receiving either control or 131R10.
[0058] Figures 7A-7C show changes in splenic CD8+ T cells (Figure 7A), splenic CD4+ T cells (Figure 7B), and splenic regulatory T cells (Tregs; Figure 7C) in mice implanted with breast tumor cells and receiving either saline control or 131R10.
[0059] Figures 8A-8D show reduction in breast tumor cell growth in mice receiving (left to right) control, anti-PD 1 , or anti-PD 1+131R10. Figure 8 A shows the average of each treatment group .
Figures 8B-8D show the individual results from the control, anti-PDl, and 131R10+anti-PD l treatment groups, respectively.
[0060] Figures 9A-9D show changes in splenocyte cytokine expression of interferon gamma (Figure 9A), IL-10 (Figure 9B), IL-2 (Figure 9C), and IL-17A (Figure 9D) in mice implanted with breast tumor cells and receiving control, anti-PDl, or 13 lRlO+anti-PDl treatment.
[0061] Figure 10A shows changes in T cell cytotoxicity in mice implanted with breast tumor cells and receiving control, anti-PDl, or 131R10+anti-PDl treatment.
[0062] Figures 10B and IOC show changes in tumor T cell numbers in mice implanted with breast tumor cells and receiving control, anti-PDl, or 131R10+anti-PDl treatment.
[0063] Figures 10D-10F show changes in splenic CD8+ T cells (Figure 7A), splenic CD4+ T cells (Figure 7B), and splenic regulatory T cells (Tregs; Figure 7C) in mice implanted with breast tumor cells and receiving control, anti-PDl, or 131R10+anti-PD l treatment.
[0064] Figures 11A-11D show reduction in breast tumor cell growth in mice receiving (left to right) control, anti-CTLA-4, or anti-CTLA-4+131R10. Figure 11A shows the average of each treatment group. Figures 1 lB-1 ID show the individual results from the control, anti-CTLA-4, and
13 lRlO+anti-CTLA-4 treatment groups, respectively.
[0065] Figures 12A-12D show changes in splenocyte cytokine expression of interferon gamma (Figure 12A), IL-10 (Figure 12B), IL-2 (Figure 12C), and IL-17A (Figure 12D) in mice implanted with breast tumor cells and receiving control, anti-CLTA-4, or 13 lRlO+anti-CTLA-4 treatment.
[0066] Figure 13 shows changes in T cell cytotoxicity in mice implanted with breast tumor cells and receiving control, anti-CTLA-4, or 131R10+anti-CTLA-4 treatment.
[0067] Figures 14A-14C show changes in splenic CD8+ T cells (Figure 14A), splenic CD4+ T cells (Figure 14B), and splenic regulatory T cells (Tregs; Figure 14C) in mice implanted with breast tumor cells and receiving the control, anti-CLTA-4, or 131R10+anti-CTLA-4.
[0068] Figure 15 shows changes in colon tumor size in mice receiving (left to right) saline, 5- fluorouracil (5-FU), 131R10+5-FU, anti-PD l+5-FU, or 131R10+anti-PD l+5-FU.
[0069] Figure 16 shows changes in 4T1 tumor size in mice receiving saline, 131R10, anti-PD-1 antibody, docetaxel, anti-PDl+docetaxel, or 131R10+anti-PDl+docetaxel. The lower six graphs show the results from each individual animal treated.
[0070] Figures 17A-17D show changes in tumor dendritic cell frequency (CD103+ and CD8a+CD3+; Figures 17A and 17B), CD8a+ cell tumor infiltration (Figure 17C), and expression of the activation marker CD69 on CD8a+ cells (Figure 17D) in 4T1 tumor-implanted mice receiving saline, 131R10, anti-PDl antibody, docetaxel, anti-PDl+docetaxel, or 131R10+anti-PD l+docetaxel.
[0071] Figures 18A-18B show changes in splenic dendritic cells (Figure 18A) and T regulatory cells (Figure 18B) in 4T1 tumor-implanted mice receiving saline, 131R10, anti-PDl antibody, docetaxel, anti-PDl+docetaxel, or 131R10+anti-PDl+docetaxel.
[0072] Figures 19A-19D show changes in IL-17a (Figures 19A and 19B) and IL-2 (Figures 19C and Figure 19D) secreted by splenocytes from 4T1 tumor-implanted mice.
[0073] Figure 20 shows changes in MC38 tumor size in mice receiving saline, 131R10, anti-PDl antibody, or 13 lRlO+anti-PD 1. The lower four graphs show the results from each individual animal treated.
[0074] Figure 21 shows the percentage of tumors in each experimental group that were below 500 mm3 in volume following treatment in MC38-implated mice.
[0075] Figures 22A-22B show changes in IL-2 (Figure 22A) and IL-17a (Figure 22B) secreted by splenocytes from MC38-implanted mice.
DETAILED DESCRIPTION OF THE INVENTION
[0076] The present invention provides methods of modulating immune responses, particularly antitumor immune responses, methods of inhibiting tumor growth, and methods of treating cancer. The methods provided herein comprise administering to a subject a therapeutically effective amount of a RSPO or LGR antagonist in combination with a therapeutically effective amount of an
immunotherapeutic agent. In some embodiments, the RSPO or LGR antagonist is an antibody that specifically binds a human RSPO protein (e.g., RSP03), an antibody that specifically binds a human LGR protein (e.g., LGR5), or an LGR soluble receptor (e.g., an LGR5 soluble receptor). In some embodiments, the anti-RSP03 antibody is 131R10 or an antibody containing the CDR regions of 131R10. In some embodiments, the immunotherapeutic agent includes but is not limited to, a modulator of PD-1 activity, a modulator of PD-L1 activity, a modulator of PD-L2 activity, a modulator of CTLA-4 activity, a modulator of CD28 activity, a modulator of CD80 activity, a modulator of CD86 activity, a modulator of 4-1BB activity, an modulator of OX40 activity, a modulator of KIR activity, a modulator of Tim -3 activity, a modulator of LAG3 activity, a modulator of CD27 activity, a modulator of CD40 activity, a modulator of GITR activity, a modulator of TIGIT activity, a modulator of CD20 activity, a modulator of CD96 activity, a modulator of IDO 1 activity, a cytokine, a chemokine, an interferon, an interleukin, a lymphokine, a member of the tumor necrosis factor (TNF) family, and an immunostimulatory oligonucleotide.
I. Definitions
[0077] To facilitate an understanding of the present invention, a number of terms and phrases are defined below.
[0078] The terms "antagonist" and "antagonistic" as used herein refer to any molecule that partially or fully blocks, inhibits, reduces, or neutralizes a biological activity of a target and/or signaling pathway. The term "antagonist" is used herein to include any molecule that partially or fully blocks, inhibits, reduces, or neutralizes the activity of a protein. Suitable antagonist molecules include, but are not limited to, antagonist antibodies, antibody fragments, soluble receptors, and small molecules.
[0079] The terms "agonist" and "agonistic" as used herein refer to or describe an agent that is capable of, directly or indirectly, substantially inducing, activating, promoting, increasing, or enhancing the biological activity of a target and/or a signaling pathway. The term "agonist" is used herein to include any agent that partially or fully induces, activates, promotes, increases, or enhances the activity of a protein. Suitable agonists specifically include, but are not limited to, agonist antibodies or fragments thereof, soluble receptors, other fusion proteins, and small molecules.
[0080] The term "biomarker" as used herein may include but is not limited to, nucleic acids and proteins, and variants and fragments thereof. A biomarker may include DNA comprising the entire or partial nucleic acid sequence encoding the biomarker, or the complement of such a sequence.
Biomarker nucleic acids useful in the invention are considered to include both DNA and RNA comprising the entire or partial sequence of any of the nucleic acid sequences of interest. Biomarker proteins are considered to comprise the entire or partial amino acid sequence of any of the biomarker proteins or polypeptides.
[0081] The term "antibody" as used herein refers to an immunoglobulin molecule that recognizes and specifically binds a target, such as a protein, polypeptide, peptide, carbohydrate, polynucleotide, lipid, or combinations of the foregoing, through at least one antigen-binding site within the variable region of the immunoglobulin molecule. As used herein, the term encompasses intact polyclonal antibodies, intact monoclonal antibodies, antibody fragments comprising an antigen-binding site (such as Fab, Fab', F(ab')2, and Fv fragments), single chain Fv (scFv) antibodies, multispecific antibodies such as bispecific antibodies, monospecific antibodies, monovalent antibodies, chimeric antibodies, humanized antibodies, human antibodies, fusion proteins comprising an antigen-binding site of an antibody, and any other modified immunoglobulin molecule comprising an antigen-binding site as long as the antibodies exhibit the desired biological activity. An antibody can be any of the five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, or subclasses (isotypes) thereof (e.g., IgGl, IgG2, IgG3, IgG4, IgA l and IgA2), based on the identity of their heavy-chain constant domains referred to as alpha, delta, epsilon, gamma, and mu, respectively. The different classes of immunoglobulins have different and well -characterized subunit structures and three-dimensional configurations. Antibodies can be naked or conjugated to other molecules, including but not limited to, toxins and radioisotopes.
[0082] The term "antibody fragment" as used herein refers to a portion of an intact antibody and generally includes the antigenic determining variable region or antigen-binding site of an intact antibody. Examples of antibody fragments include, but are not limited to, Fab, Fab', F(ab')2, and Fv fragments, linear antibodies, single chain antibodies, and multispecific antibodies formed from antibody fragments. "Antibody fragment" as used herein comprises at least one antigen-binding site or epitope -binding site.
[0083] The term "variable region" of an antibody as used herein refers to the variable region of the antibody light chain, or the variable region of the antibody heavy chain, either alone or in
combination. The variable region of the heavy or light chain generally consists of four framework regions connected by three complementarity determining regions (CDRs), also known as
"hypervariable regions". The CDRs in each chain are held together in close proximity by the framework regions and, with the CDRs from the other chain, contribute to the formation of the antigen-binding site of the antibody. There are at least two techniques for determining CDRs: (1) an approach based on cross-species sequence variability (i.e., Kabat et al., 1991, Sequences of Proteins of Immunological Interest, 5th Edition, National Institutes of Health, Bethesda MD), and (2) an approach based on crystallographic studies of antigen-antibody complexes (Al-Lazikani et al., 1997, J. Mol. Biol, 273:927-948). Combinations of these two approaches are sometimes used in the art to determine CDRs.
[0084] The term "monoclonal antibody" as used herein refers to a homogenous antibody population involved in the highly specific recognition and binding of a single antigenic determinant or epitope. This is in contrast to polyclonal antibodies that typically include a mixture of different antibodies directed against different antigenic determinants. The term "monoclonal antibody" encompasses both intact and full-length antibodies as well as antibody fragments (e.g., Fab, Fab', F(ab')2, Fv), single chain (scFv) antibodies, fusion proteins comprising an antibody portion, and any other modified immunoglobulin molecule comprising at least one antigen-binding site. Furthermore, "monoclonal antibody" refers to such antibodies made by any number of techniques, including but not limited to, hybridoma production, phage selection, recombinant expression, and transgenic animals.
[0085] The term "humanized antibody" as used herein refers to antibodies that are specific immunoglobulin chains, chimeric immunoglobulins, or fragments thereof that contain minimal non- human sequences. Typically, humanized antibodies are human immunoglobulins in which amino acid residues of the CDRs are replaced by amino acid residues from the CDRs of a non-human species (e.g., mouse, rat, rabbit, or hamster) that have the desired specificity, affinity, and/or binding capability.
[0086] The term "human antibody" as used herein refers to an antibody produced by a human or an antibody having an amino acid sequence corresponding to an antibody produced by a human made using any of the techniques known in the art.
[0087] The term "chimeric antibody" as used herein refers to an antibody where the amino acid sequence of the immunoglobulin molecule is derived from two or more species. Typically, the variable region of both light and heavy chains corresponds to the variable region of antibodies derived from one species of mammals (e.g., mouse, rat, rabbit, etc.) with the desired specificity, affinity, and/or binding capability, while the constant regions are homologous to the sequences in antibodies derived from another species (usually human).
[0088] The term "affinity-matured antibody" as used herein refers to an antibody with one or more alterations in one or more CDRs that result in an improvement in the affinity of the antibody for antigen, compared to a parent antibody that does not possess those alterations(s). In some instances, alterations are made in the framework regions. Preferred affinity-matured antibodies will have nanomolar or even picomolar affinities for the target antigen. Affinity-matured antibodies are produced by procedures known in the art including heavy chain and light chain variable region shuffling, random mutagenesis of CDR and/or framework residues, or site-directed mutagenesis of CDR and/or framework residues.
[0089] The terms "epitope" and "antigenic determinant" are used interchangeably herein and refer to that portion of an antigen capable of being recognized and specifically bound by a particular antibody. When the antigen is a polypeptide, epitopes can be formed both from contiguous amino acids and non-contiguous amino acids juxtaposed by tertiary folding of a protein. Epitopes formed from contiguous amino acids (also referred to as linear epitopes) are typically retained upon protein denaturing, whereas epitopes formed by tertiary folding (also referred to as conformational epitopes) are typically lost upon protein denaturing. An epitope typically includes at least 3, and more usually, at least 5, or 8-10 amino acids in a unique spatial conformation.
[0090] The terms "selectively binds" or "specifically binds" as used herein mean that a binding agent or an antibody reacts or associates more frequently, more rapidly, with greater duration, with greater affinity, or with some combination of the above to the epitope, protein, or target molecule than with alternative substances, including unrelated or related proteins. In certain embodiments "specifically binds" means, for instance, that an antibody binds a target with a KD of about 0. ImM or less, but more usually less than about Ι μΜ. In certain embodiments, "specifically binds" means that an antibody binds a target with a KD of at least about 0. Ι μΜ or less, at least about 0.0 Ι μΜ or less, or at least about InM or less. Because of the sequence identity between homologous proteins in different species, specific binding can include an antibody that recognizes a protein in more than one species.
Likewise, because of homology within certain regions of polypeptide sequences of different proteins, specific binding can include an antibody (or other polypeptide or binding agent) that recognizes more than one protein. It is understood that, in certain embodiments, an antibody or binding agent that specifically binds a first target may or may not specifically bind a second target. As such, "specific binding" does not necessarily require (although it can include) exclusive binding, i.e. binding to a single target. Thus, an antibody may, in certain embodiments, specifically bind more than one target. In certain embodiments, multiple targets may be bound by the same antigen-binding site on the antibody. For example, an antibody may, in certain instances, comprise two identical antigen-binding sites, each of which specifically binds the same epitope on two or more proteins. In certain alternative embodiments, an antibody may be bispecific and comprise at least two antigen-binding sites with differing specificities. Generally, but not necessarily, reference to binding means specific binding.
[0091] The term "soluble receptor" as used herein refers to an extracellular fragment (or a portion thereof) of a receptor protein preceding the first transmembrane domain of the receptor that can be secreted from a cell in soluble form.
[0092] The terms "polypeptide" and "peptide" and "protein" are used interchangeably herein and refer to polymers of amino acids of any length. The polymer may be linear or branched, it may comprise modified amino acids, and it may be interrupted by non-amino acids. The terms also encompass an amino acid polymer that has been modified naturally or by intervention; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation or modification, such as conjugation with a labeling component. Also included within the definition are, for example, polypeptides containing one or more analogs of an amino acid
(including, for example, unnatural amino acids), as well as other modifications known in the art. It is understood that, because the polypeptides of this invention may be based upon antibodies, in certain embodiments, the polypeptides can occur as single chains or associated chains.
[0093] The term "amino acid" as used herein refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function similarly to the naturally occurring amino acids. Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, gamma-carboxyglutamate, and O-phosphoserine. The phrase "amino acid analog" refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, e.g., an alpha carbon that is bound to an hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs can have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid. The phrase "amino acid mimetic" refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that function similarly to a naturally occurring amino acid.
[0094] The terms "polynucleotide" and "nucleic acid" are used interchangeably herein and refer to polymers of nucleotides of any length, and include DNA and RNA. The nucleotides can be deoxyribonucleotides, ribonucleotides, modified nucleotides or bases, and/or their analogs, or any substrate that can be incorporated into a polymer by DNA or RNA polymerase.
[0095] The terms "identical" or percent "identity" in the context of two or more nucleic acids or polypeptides, refer to two or more sequences or subsequences that are the same or have a specified percentage of nucleotides or amino acid residues that are the same, when compared and aligned (introducing gaps, if necessary) for maximum correspondence, not considering any conservative amino acid substitutions as part of the sequence identity. The percent identity may be measured using sequence comparison software or algorithms or by visual inspection. Various algorithms and software that may be used to obtain alignments of amino acid or nucleotide sequences are well-known
in the art. These include, but are not limited to, BLAST and BLAST variations, ALIGN and ALIGN variations, Megalign, BestFit, GCG Wisconsin Package, etc. In some embodiments, two nucleic acids or polypeptides of the invention are substantially identical, meaning they have at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, and in some embodiments at least 95%, 96%, 97%, 98%, 99% nucleotide or amino acid residue identity, when compared and aligned for maximum correspondence, as measured using a sequence comparison algorithm or by visual inspection. In some embodiments, identity exists over a region of the sequences that is at least about 10, at least about 20, at least about 40-60, at least about 60-80 nucleotides or amino acid residues in length or any integral value therebetween. In some embodiments, identity exists over a longer region than 60-80 nucleotides or amino acid residues, such as at least about 80-100 nucleotides or amino acid residues, and in some embodiments the sequences are substantially identical over the full length of the sequences being compared, such as the coding region of a nucleotide sequence.
[0096] The term "conservative amino acid substitution" as used herein refers to a substitution in which one amino acid residue is replaced with another amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art, including basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), non-polar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine). For example, substitution of a phenylalanine for a tyrosine is a conservative substitution. Preferably, conservative substitutions in the sequences of the polypeptides and antibodies of the invention do not abrogate the binding of the polypeptide or antibody containing the amino acid sequence to the antigen(s). Methods of identifying nucleotide and amino acid conservative substitutions which do not eliminate antigen binding are well- known in the art.
[0097] The term "vector" as used herein means a construct, which is capable of delivering, and usually expressing, one or more gene(s) or sequence(s) of interest in a host cell. Examples of vectors include, but are not limited to, viral vectors, naked DNA or RNA expression vectors, plasmid, cosmid, or phage vectors, DNA or RNA expression vectors associated with cationic condensing agents, and DNA or RNA expression vectors encapsulated in liposomes.
[0098] As used herein, a polypeptide, antibody, polynucleotide, vector, cell, or composition which is "isolated" is a polypeptide, antibody, polynucleotide, vector, cell, or composition which is in a form not found in nature. Isolated polypeptides, antibodies, polynucleotides, vectors, cells, or compositions include those which have been purified to a degree that they are no longer in a form in which they are found in nature. In some embodiments, a polypeptide, antibody, polynucleotide, vector, cell, or composition which is isolated is substantially pure.
[0099] The term "substantially pure" as used herein refers to material which is at least 50% pure (i.e., free from contaminants), at least 90% pure, at least 95% pure, at least 98% pure, or at least 99% pure.
[00100] The terms "cancer" and "cancerous" as used herein refer to or describe the physiological condition in mammals in which a population of cells is characterized by unregulated cell growth. Examples of cancer include, but are not limited to, carcinoma, blastema, sarcoma, and hematologic cancers such as lymphoma and leukemia.
[00101] The terms "proliferative disorder" and "proliferative disease" as used herein refer to disorders associated with abnormal cell proliferation such as cancer.
[00102] The terms "tumor" and "neoplasm" as used herein refer to any mass of tissue that results from excessive cell growth or proliferation, either benign (non -cancerous) or malignant (cancerous), including pre-cancerous lesions.
[00103] The term "metastasis" as used herein refers to the process by which a cancer spreads or transfers from the site of origin to other regions of the body with the development of a similar cancerous lesion at the new location. A "metastatic" or "metastasizing" cell is generally one that loses adhesive contacts with neighboring cells and migrates from the primary site of disease to invade neighboring tissue sites.
[00104] The terms "cancer stem cell" and "CSC" and "tumor stem cell" and "tumor initiating cell" are used interchangeably herein and refer to cells from a cancer or tumor that: ( 1) have extensive proliferative capacity; 2) are capable of asymmetric cell division to generate one or more types of differentiated cell progeny where the differentiated cells have reduced proliferative or developmental potential; and (3) are capable of symmetric cell divisions for self-renewal or self-maintenance. These properties confer on the cancer stem cells the ability to form or establish a tumor or cancer upon serial transplantation into an immunocompromised host (e.g., a mouse) compared to the majority of tumor cells that fail to form tumors. Cancer stem cells undergo self-renewal versus differentiation in a chaotic manner to form tumors with abnormal cell types that can change over time as mutations occur.
[00105] The terms "cancer cell" and "tumor cell" as used herein refer to the total population of cells derived from a cancer or tumor or pre-cancerous lesion, including both non-tumorigenic cells, which comprise the bulk of the cancer cell population, and tumorigenic cells (cancer stem cells). As used herein, the terms "cancer cell" or "tumor cell" will be modified by the term "non-tumorigenic" when referring solely to those cells lacking the capacity to renew and differentiate to distinguish those tumor cells from cancer stem cells.
[00106] The term "subject" as used herein refers to any animal (e.g., a mammal), including, but not limited to, humans, non-human primates, canines, felines, rodents, and the like, which is to be the recipient of a particular treatment. Typically, the terms "subject" and "patient" are used
interchangeably herein in reference to a human subject.
[00107] The term "pharmaceutically acceptable" refers to an agent, compound, molecule, etc.
approved or approvable by a regulatory agency of the Federal government, a state government, and/or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in animals, including humans.
[00108] The phrases "pharmaceutically acceptable excipient, carrier or adjuvant" and "acceptable pharmaceutical carrier" refer to an excipient, carrier, or adjuvant that can be administered to a subject, together with a therapeutic agent, and which does not destroy the pharmacological activity thereof and is nontoxic when administered in doses sufficient to deliver a therapeutic effect. In general, those of skill in the art and the FDA consider a pharmaceutically acceptable excipient, carrier, or adjuvant to be an inactive ingredient of any formulation or pharmaceutical composition.
[00109] The terms "effective amount" and "therapeutically effective amount" and "therapeutic effect" as used herein refer to an amount of a binding agent, an antibody, a polypeptide, a polynucleotide, a small molecule, or other therapeutic agent effective to "treat" a disease or disorder in a subject or mammal. In the case of cancer, the therapeutically effective amount of an agent (e.g., an antibody) has a therapeutic effect and as such can reduce the number of cancer cells; decrease tumorigenicity, tumorigenic frequency, or tumorigenic capacity; reduce the number or frequency of cancer stem cells; reduce tumor size; reduce the cancer cell population; inhibit and/or stop cancer cell infiltration into peripheral organs including, for example, the spread of cancer into soft tissue and bone; inhibit and stop tumor or cancer cell metastasis; inhibit and/or stop tumor or cancer cell growth; relieve to some extent one or more of the symptoms associated with the cancer; reduce morbidity and mortality; improve quality of life; or a combination of such effects. To the extent the agent prevents growth and/or kills existing cancer cells, it can be referred to as cytostatic and/or cytotoxic.
[00110] The terms "treating" and "treatment" and "to treat" and "alleviating" and "to alleviate" refer to both 1) therapeutic measures that cure, slow down, lessen symptoms of, and/or halt progression of a diagnosed pathologic condition or disorder and 2) prophylactic or preventative measures that prevent or slow the development of a targeted pathologic condition or disorder. Thus, those in need of treatment include those who already have a disorder; those prone to have a disorder; and those in whom a disorder is to be prevented. In some embodiments, a subject is successfully "treated" according to the methods of the present invention if the patient shows one or more of the following: a reduction in the number of or complete absence of cancer cells; a reduction in tumor size; inhibition of or an absence of cancer cell infiltration into peripheral organs including the spread of cancer cells into soft tissue and bone; inhibition of or an absence of tumor or cancer cell metastasis; inhibition or an absence of cancer growth; inhibition or an absence of tumor growth; relief of one or more symptoms associated with the specific cancer; reduced morbidity and mortality; improvement in quality of life; reduction in tumorigenicity; reduction in the number or frequency of cancer stem cells; or some combination of effects.
[00111] The term "biomarker" as used herein may include but is not limited to, nucleic acids and proteins, and variants and fragments thereof. A biomarker may include DNA comprising the entire or partial nucleic acid sequence encoding the biomarker, or the complement of such a sequence.
Biomarker nucleic acids useful in the invention are considered to include both DNA and RNA comprising the entire or partial sequence of any of the nucleic acid sequences of interest. Biomarker proteins are considered to comprise the entire or partial amino acid sequence of any of the biomarker proteins or polypeptides.
[00112] As used in the present disclosure and claims, the singular forms "a", "an" and "the" include plural forms unless the context clearly dictates otherwise.
[00113] It is understood that wherever embodiments are described herein with the language
"comprising" otherwise analogous embodiments described in terms of "consisting of and/or
"consisting essentially of are also provided. It is also understood that wherever embodiments are described herein with the language "consisting essentially of otherwise analogous embodiments described in terms of "consisting of are also provided.
[00114] The term "and/or" as used in a phrase such as "A and/or B" herein is intended to include both A and B; A or B; A (alone); and B (alone). Likewise, the term "and/or" as used in a phrase such as "A, B, and/or C" is intended to encompass each of the following embodiments: A, B, and C; A, B, or C; A or C; A or B; B or C; A and C; A and B; B and C; A (alone); B (alone); and C (alone). II. Methods of use and pharmaceutical compositions
[00115] A RSPO or LGR antagonist described herein in combination with an immunotherapeutic agent is useful in a variety of applications including, but not limited to, therapeutic treatment methods, such as immunotherapy for cancer. In certain embodiments, the combination of a RSPO or LGR antagonist (e.g., an anti-RSPO or anti-LGR antibody or a soluble LGR receptor) with an
immunotherapeutic agent, is useful for activating, promoting, increasing, and/or enhancing an immune response, inhibiting tumor growth, reducing tumor volume, increasing tumor cell apoptosis, and/or reducing the tumorigenicity of a tumor. The methods of use may be in vitro, ex vivo, or in vivo methods. In some embodiments, the combination of a RSPO or LGR antagonist (e.g., an anti-RSPO or anti-LGR antibody or a soluble LGR receptor) with an immunotherapeutic agent acts as an agonist of an immune response. In some embodiments, the combination of a RSPO or LGR antagonist (e.g., an anti-RSPO or anti-LGR antibody or a soluble LGR receptor) with an immunotherapeutic agent acts as an enhancer, activator, or stimulator of an immune response. In some embodiments, the combination of a RSPO or LGR antagonist (e.g., an anti-RSPO or anti-LGR antibody or a soluble LGR receptor) with an immunotherapeutic agent acts as an agonist of an anti-tumor immune response. In some embodiments, the combination of a RSPO or LGR antagonist (e.g., an anti-RSPO or anti- LGR antibody or a soluble LGR receptor) with an immunotherapeutic agent works as an antagonist of
the PD-1 pathway. In some embodiments, the combination of a RSPO or LGR antagonist (e.g., an anti-RSPO or anti-LGR antibody or a soluble LGR receptor) with an immunotherapeutic agent works as an antagonist of PD-1 or PD-1 activity. In some embodiments, the combination of a RSPO or LGR antagonist (e.g., an anti-RSPO or anti-LGR antibody or a soluble LGR receptor) with an
immunotherapeutic agent works as an antagonist of PD-L1 or PD-L1 activity. In some embodiments, the combination of a RSPO or LGR antagonist (e.g., an anti-RSPO or anti-LGR antibody or a soluble LGR receptor) with an immunotherapeutic agent works as an antagonist of the CTLA-4 pathway. In some embodiments, the combination of a RSPO or LGR antagonist (e.g., an anti-RSPO or anti-LGR antibody or a soluble LGR receptor) with an immunotherapeutic agent works as an antagonist of CTLA-4 or CTLA-4 activity. In some embodiments, the combination of a RSPO or LGR antagonist (e.g., an anti-RSPO or anti-LGR antibody or a soluble LGR receptor) with an immunotherapeutic agent works as an antagonist of Tim -3 or Tim-3 activity. In some embodiments, the combination of a RSPO or LGR antagonist (e.g., an anti-RSPO or anti-LGR antibody or a soluble LGR receptor) with an immunotherapeutic agent works as an antagonist of LAG3 or LAG3 activity. In some
embodiments, the combination of a RSPO or LGR antagonist (e.g., an anti-RSPO or anti-LGR antibody or a soluble LGR receptor) with an immunotherapeutic agent works as an antagonist of TIGIT or TIGIT activity. In some embodiments, the combination of a RSPO or LGR antagonist (e.g., an anti-RSPO or anti-LGR antibody or a soluble LGR receptor) with an immunotherapeutic agent works as an antagonist of KIR or KIR activity. In any of these embodiments, the RSPO antagonist may be an anti-RSP03 antibody, such as 131R10 or an antibody containing the 131R10 CDR regions.
[00116] In certain embodiments of the methods described herein, a method of inhibiting tumor growth comprises contacting tumor cells with an effective amount of a RSPO or LGR antagonist in combination with an effective amount of an immunotherapeutic agent. The method may be in vivo or in vitro. In certain embodiments, the tumor is in a subject, and contacting tumor cells with the RSPO or LGR antagonist and the immunotherapeutic agent comprises administering a therapeutically effective amount of each of the agents to the subject. In some embodiments, a method of inhibiting tumor growth comprises administering to a subject a therapeutically effective amount of a RSPO or LGR antagonist and a therapeutically effective amount of an immunotherapeutic agent, where the RSPO or LGR antagonist is an anti-RSPO or anti-LGR antibody or a soluble LGR receptor. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent inhibit tumor growth by inhibiting or suppressing regulatory T-cell (Treg) activity. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent inhibit tumor growth by increasing cytolytic cell activity. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent inhibit tumor growth by increasing NK cell activity. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent inhibit tumor growth by increasing the number of CD4+ or CD8+ T-cells. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent inhibit tumor
growth by increasing cytolytic T-cell activity. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent inhibit tumor growth by increasing CD8+ cytolytic T-cell activity. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent inhibit tumor growth by decreasing PD-1 expression on T-cells. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent inhibit tumor growth by decreasing the number or percentage of PD-1 expressing T-cells. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent inhibit tumor growth by decreasing the number or percentage of myeloid- derived suppressor cells (M-MDSCs). In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent inhibit tumor growth by increasing the number or percentage of activated myeloid cells. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent inhibit tumor growth by increasing the number or percentage of memory T-cells. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent inhibit tumor growth by increasing IFN-gamma production. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent inhibit tumor growth by increasing IL-2 production. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent inhibit tumor growth by increasing IL- 10 production. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent inhibit tumor growth by increasing IL-17 production. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent inhibit tumor growth by decreasing IL-6 production.
[00117] In certain embodiments of the methods described herein, a method of treating cancer comprises administering to a subject a therapeutically effective amount of a RSPO or LGR antagonist in combination with a therapeutically effective amount of an immunotherapeutic agent. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent treat cancer by inhibiting or suppressing Treg activity. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent treat cancer by increasing cytolytic cell activity. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent treat cancer by increasing NK cell activity. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent treat cancer by increasing the number of CD4+ or CD8+ T-cells. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent treat cancer by increasing cytolytic T-cell activity. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent treat cancer by increasing CD8+ cytolytic T-cell activity. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent treat cancer by decreasing PD-1 expression on T-cells. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent treat cancer by decreasing the number or percentage of PD-1 expressing T-cells. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent treat cancer by decreasing the number or percentage of M-MDSCs. In some embodiments, the RSPO or LGR antagonist and the
immunotherapeutic agent treat cancer by increasing the number or percentage of activated myeloid
cells. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent treat cancer by increasing the number or percentage of memory T-cells. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent treat cancer by increasing IFN-gamma production. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent treat cancer by increasing IL-2 production. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent treat cancer by increasing IL-10 production. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent treat cancer by increasing IL-17 production. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent treat cancer by decreasing IL-6 production.
[00118] In certain embodiments of the methods described herein, a method of cancer immunotherapy comprises administering to a subject a therapeutically effective amount of a RSPO or LGR antagonist in combination with a therapeutically effective amount of an immunotherapeutic agent, and where the combination results in enhanced therapeutic efficacy as compared to administration of either agent alone. In some embodiments, the RSPO or LGR antagonist is an anti-RSPO or anti-LGR antibody or a soluble LGR receptor.
[00119] In certain embodiments of the methods described herein, a method of inhibiting the activity of Tregs comprises administering to a subject a therapeutically effective amount of a RSPO or LGR antagonist in combination with a therapeutically effective amount of an immunotherapeutic agent. In some embodiments, a method of inhibiting the activity of Tregs comprises administering to a subject a therapeutically effective amount of a RSPO or LGR antagonist and a therapeutically effective amount of an immunotherapeutic agent, where the RSPO or LGR antagonist is an anti-RSPO or anti- LGR antibody or a soluble LGR receptor.
[00120] In certain embodiments of the methods described herein, a method of inhibiting the suppression of immune responses by Tregs comprises administering to a subject a therapeutically effective amount of a RSPO or LGR antagonist (e.g., an anti-RSPO antibody, anti-LGR antibody, or soluble LGR receptor) in combination with a therapeutically effective amount of an
immunotherapeutic agent.
[00121] In certain embodiments of the methods described herein, a method of increasing T cell infiltration into a tumor comprises administering to a subject a therapeutically effective amount of a RSPO or LGR antagonist (e.g., an anti-RSPO antibody, anti-LGR antibody, or soluble LGR receptor) in combination with a therapeutically effective amount of an immunotherapeutic agent.
[00122] In certain embodiments of the methods described herein, a method of increasing T cell cytotoxicity to a tumor comprises administering to a subject a therapeutically effective amount of a RSPO or LGR antagonist (e.g., an anti-RSPO antibody, anti-LGR antibody, or soluble LGR receptor) in combination with a therapeutically effective amount of an immunotherapeutic agent.
[00123] In certain embodiments of the methods described herein, a method of increasing tumor cell lysis comprises administering to a subject a therapeutically effective amount of a RSPO or LGR antagonist (e.g., an anti-RSPO antibody, anti-LGR antibody, or soluble LGR receptor) and an immunotherapeutic agent.
[00124] In certain embodiments of the methods described herein, a method of inhibiting tumor relapse or tumor regrowth comprises administering to a subject a therapeutically effective amount of a RSPO or LGR antagonist (e.g., an anti-RSPO antibody, anti-LGR antibody, or soluble LGR receptor) in combination with a therapeutically effective amount of an immunotherapeutic agent.
[00125] In certain embodiments of the methods described herein, a method to increase the efficacy of an immune checkpoint modulator comprises administering to a subject a therapeutically effective amount of a RSPO or LGR antagonist (e.g., an anti-RSPO antibody, anti-LGR antibody, or soluble LGR receptor) in combination with a therapeutically effective amount of an immune checkpoint modulator. In some embodiments, the immune checkpoint modulator is an immune checkpoint inhibitor. In some embodiments, the immune checkpoint modulator is an immune checkpoint enhancer or stimulator.
[00126] In certain embodiments of the methods described herein, a method of enhancing treatment for a subject who is being treated with an immune checkpoint modulator comprises administering to the subject a therapeutically effective amount of a RSPO or LGR antagonist, such as an anti-RSPO or anti-LGR antibody or a soluble LGR receptor. In some embodiments, the immune checkpoint modulator is an immune checkpoint inhibitor. In some embodiments, the immune checkpoint inhibitor is a PD-1 antagonist. In some embodiments, the immune checkpoint inhibitor is an antibody that specifically binds PD-1. In some embodiments, the immune checkpoint inhibitor is a PD-L 1 antagonist. In some embodiments, immune checkpoint inhibitor is an antibody that specifically binds PD-L1. In some embodiments, the immune checkpoint inhibitor is a CTLA-4 antagonist. In some embodiments, the immune checkpoint inhibitor is an antibody that specifically binds CTLA-4.
[00127] In some embodiments, the method of inhibiting tumor growth comprises contacting the tumor or tumor cells with a RSPO or LGR antagonist, such as an anti-RSPO or anti-LGR antibody or a soluble LGR receptor and an immunotherapeutic agent in vivo. In certain embodiments, contacting a tumor or tumor cell with a RSPO or LGR antagonist and an immunotherapeutic agent is undertaken in an animal model. For example, a RSPO or LGR antagonist and an immunotherapeutic agent may be administered to mice which have tumors. In some embodiments, a RSPO or LGR antagonist and an immunotherapeutic agent increases, promotes, and/or enhances the activity of immune cells in the mice. In some embodiments, a RSPO or LGR antagonist and an immunotherapeutic agent are administered to an animal to inhibit growth of tumors. In some embodiments, a RSPO or LGR antagonist and an immunotherapeutic agent are administered at the same time or shortly after introduction of tumor cells into the animal (preventative model). In some embodiments, a RSPO or
LGR antagonist and an immunotherapeutic agent are administered after the tumor cells have become established and grown to a tumor of specific size (therapeutic model).
[00128] In certain embodiments, a method of inhibiting growth of a tumor comprises administering to a subject a therapeutically effective amount of a RSPO or LGR antagonist, such as an anti-RSPO or anti-LGR antibody or a soluble LGR receptor and a therapeutically effective amount of an immunotherapeutic agent. In certain embodiments, the subject is a human. In certain embodiments, the subject has a tumor or has had a tumor which was removed. In certain embodiments, the tumor comprises cancer stem cells. In certain embodiments, the frequency of cancer stem cells in the tumor is reduced by administration of the RSPO or LGR antagonist.
[00129] The invention also provides a method of reducing or preventing metastasis in a subject comprising administering to the subject a therapeutically effective amount of a RSPO or LGR antagonist (e.g., an anti-RSPO antibody, anti-LGR antibody, or soluble LGR receptor) and a therapeutically effective amount of an immunotherapeutic agent. In some embodiments, the reduction or prevention of metastasis comprises inhibiting invasiveness of a tumor. In certain embodiments, the subject is a human. In certain embodiments, the subject has a tumor or has had a tumor removed.
[00130] In addition, the invention provides a method of reducing the tumorigenicity of a tumor in a subject, comprising administering to a subject a therapeutically effective amount of a RSPO or LGR antagonist (e.g., an anti-RSPO antibody, anti-LGR antibody, or soluble LGR receptor) and a therapeutically effective amount of an immunotherapeutic agent. In certain embodiments, the tumor comprises cancer stem cells. In some embodiments, the tumorigenicity of a tumor is reduced by reducing the frequency of cancer stem cells in the tumor. In certain embodiments, the frequency of cancer stem cells in the tumor is reduced by administration of the RSPO or LGR antagonist and the immunotherapeutic agent. In some embodiments, the tumorigenicity of the tumor is reduced by inducing apoptosis of the tumor cells. In some embodiments, the tumorigenicity of the tumor is reduced by increasing apoptosis of the tumor cells.
[00131] The invention also provides a method of reducing cancer stem cell frequency in a tumor comprising cancer stem cells, the method comprising administering to a subject a therapeutically effective amount of a RSPO or LGR antagonist (e.g., an anti-RSPO antibody, anti-LGR antibody, or soluble LGR receptor)and a therapeutically effective amount of an immunotherapeutic agent. In certain embodiments, the RSPO or LGR antagonist in combination with an immunotherapeutic agent is capable of reducing the tumorigenicity of a tumor comprising cancer stem cells in an animal model, such as a mouse model. In certain embodiments, the number or frequency of cancer stem cells in a treated tumor is reduced by at least about two-fold, about three-fold, about five-fold, about ten-fold, about 50-fold, about 100-fold, or about 1000-fold as compared to the number or frequency of cancer stem cells in an untreated tumor. In certain embodiments, the reduction in the number or frequency of cancer stem cells is determined by limiting dilution assay using an animal model.
[00132] In some embodiments of the methods described herein the cancer is a cancer selected from the group consisting of lung cancer, pancreatic cancer, breast cancer, colon cancer, colorectal cancer, melanoma, gastrointestinal cancer, gastric cancer, renal cancer, ovarian cancer, liver cancer, endometrial cancer, kidney cancer, prostate cancer, thyroid cancer, neuroblastoma, glioma, glioblastoma, glioblastoma multiforme, cervical cancer, stomach cancer, bladder cancer, head and neck cancer, and hepatoma. In some embodiments, the cancer is lung cancer. In some embodiments, the cancer is ovarian cancer.
[00133] In some embodiments, the RSPO or LGR antagonist is an RSPO-binding agent. In some embodiments, the RSPO or LGR antagonist is an LGR-binding agent. In some embodiments, the RSPO or LGR antagonist is an antibody. In some embodiments, the RSPO or LGR antagonist is an anti-RSPO antibody. In some embodiments, the RSPO or LGR antagonist is an anti-LGR antibody. In some embodiments, the RSPO or LGR antagonist is the antibody 131R10. In some embodiments, the RSPO or LGR antagonist is a soluble receptor. In some embodiments, the RSPO or LGR antagonist is an LGR-Fc soluble receptor. In some embodiments, the RSPO or LGR antagonist is an LGR5-Fc soluble receptor. In certain embodiments, the LGR5-Fc soluble receptor comprises amino acid sequence of SEQ ID NO: 57.
[00134] In some embodiments, the RSPO or LGR antagonist is an antibody that specifically binds at least one RSPO protein or portion thereof. In some embodiments, the antibody specifically binds at least one human RSPO protein selected from the group consisting of: RSPOl, RSP02, RSP03, and RSP04. In some embodiments, the antibody specifically binds at least one human RSP03.
[00135] In some embodiments, the antibody specifically binds at least human RSPO 1. In some embodiments, the antibody includes (a) a heavy chain CDR1 including TGYTMH (SEQ ID NO:5), a heavy chain CDR2 including GINPNNGGTTYNQNFKG (SEQ ID NO:6), and a heavy chain CDR3 including KEFSDGYYFFAY (SEQ ID NO:7); and/or (b) a light chain CDR1 including
KASQDVIFAVA (SEQ ID NO: 8), a light chain CDR2 including WASTRHT (SEQ ID NO:9), and a light chain CDR3 including QQHYSTPW (SEQ ID NO: 10). In some embodiments, the antibody includes a heavy chain variable region including an amino acid sequence at least 80%, 85%, 90%, 90%, 95%, or 100% identical to SEQ ID NO: 11 or 44 (e.g., including one, two or three of the heavy chain CDRs mentioned above), and a light chain variable region including an amino acid sequence at least 80%, 85%, 90%, 90%, 95%, or 100% identical to SEQ ID NO: 12 or 45 (e.g., including one, two, or three of the light chain CDRs mentioned above). In some embodiments, the antibody includes a heavy chain variable region including SEQ ID NO: 1 1 and a light chain variable region including SEQ ID NO: 12.
[00136] In some embodiments, the antibody specifically binds at least human RSP02. In some embodiments, the antibody includes (a) a heavy chain CDR1 including SSYAMS (SEQ ID NO: 17), a heavy chain CDR2 including SISSGGSTYYPDSVKG (SEQ ID NO: 18), and a heavy chain CDR3
including RGGDPGVYNGDYEDAMDY (SEQ ID NO: 19); and (b) a light chain CDR1 including KASQDVSSAVA (SEQ ID NO:20), a light chain CDR2 including WASTRHT (SEQ ID NO:21), and a light chain CDR3 including QQHYSTP (SEQ ID NO:22). In some embodiments, the antibody includes a heavy chain variable region including an amino acid sequence at least 80%, 85%, 90%, 90%, 95%, or 100% identical to SEQ ID NO:23 (e.g., including one, two, or three of the heavy chain CDRs mentioned above)and a light chain variable region including an amino acid sequence at least 80%, 85%, 90%, 90%, 95%, or 100% identical to SEQ ID NO:24 (e.g., including one, two, or three of the light CDRs mentioned above).
[00137] In some embodiments, the antibody specifically binds at least human RSP03. In some embodiments, the antibody includes (a) a heavy chain CDR1 including DYSIH (SEQ ID NO:29), a heavy chain CDR2 including YIYPSNGDSGYNQKFK (SEQ ID NO:30), and a heavy chain CDR3 including TYFANNFD (SEQ ID NO:31) or ATYF ANNTD Y( SEQ ID NO:32); and (b) a light chain CDR1 including KASQSVDYDGDSYMN (SEQ ID NO:33), a light chain CDR2 including
AASNLES (SEQ ID NO:34) or AAS (SEQ ID NO:35), and a light chain CDR3 including
QQSNEDPLT (SEQ ID NO:36) or QQSNEDPLTF (SEQ ID NO:37). In some embodiments, the antibody includes (a) a heavy chain CDR1 including DYSIH (SEQ ID NO:29), a heavy chain CDR2 including YIYPSNGDSGYNQKFK (SEQ ID NO:30), and a heavy chain CDR3 including
TYFANNFD (SEQ ID NO:31); and (b) a light chain CDR1 including KASQSVDYDGDSYMN (SEQ ID NO:33), a light chain CDR2 including AASNLES (SEQ ID NO:34), and a light chain CDR3 including QQSNEDPLT (SEQ ID NO:36). In some embodiments, the antibody includes a heavy chain variable region including an amino acid sequence at least 80%, 85%, 90%, 90%, 95%, or 100% identical to SEQ ID NO:38 (e.g., including one, two, or three of the heavy chain CDRs mentioned above), and a light chain variable region including an amino acid sequence at least 80%, 85%, 90%, 90%, 95%, or 100% identical to SEQ ID NO:39 (e.g., including one, two, or three of the light chain CDRs mentioned above). In some embodiments, the antibody is 131R10.
[00138] In some embodiments, the RSPO or LGR antagonist is an antibody that specifically binds at least one human LGR protein (e.g., LGR4, LGR5, and LGR6). In some embodiments, the antibody specifically binds at least human LGR5. In certain embodiments, the antibody includes (a) the heavy chain CDR1, CDR2, and CDR3 sequences of the monoclonal antibody produced by the 88M1 hybridoma having the ATCC deposit number PTA-9342; and (b) the light chain CDR1, CDR2, and CDR3 sequences of the monoclonal antibody produced by the 88M1 hybridoma having the ATCC deposit number PTA-9342. In some embodiments, the antibody includes the heavy chain variable region and light chain variable region of the monoclonal antibody produced by the 88M1 hybridoma having the ATCC deposit number PTA-9342.
[00139] In some embodiments, the antibody is a monoclonal antibody, a recombinant antibody, a chimeric antibody, a humanized antibody, a human antibody, or an antibody fragment comprising an
antigen-binding site. In some embodiments, the antibody is a monospecific antibody or a bispecific antibody. In some embodiments, the antibody is an IgGl antibody or an IgG2 antibody. In some embodiments, the RSPO or LGR antagonist is the antibody 131R10 or an antibody that contains the 131R10 CDR regions.
[00140] In some embodiments, the RSPO or LGR antagonist is a soluble receptor including an extracellular domain of a human LGR protein (e.g., LGR5), where the extracellular domain is capable of binding a human RSPO protein. In some embodiments, the extracellular domain of a human LGR protein includes amino acids 22-564 of human LGR5 (SEQ ID NO:56). In some embodiments, the soluble receptor includes a non-LGR polypeptide. In some embodiments, the non-LGR polypeptide is directly linked to the extracellular domain of the human LGR protein or is connected to the extracellular domain of the human LGR protein by a linker. In some embodiments, the non-LGR polypeptide includes a human Fc region (e.g., includes SEQ ID NO:58, SEQ ID NO:59, SEQ ID NO:60, SEQ ID NO:61, or SEQ ID NO:62, or an amino acid sequence at least 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO:58, SEQ ID NO:59, SEQ ID NO:60, SEQ ID NO:61, or SEQ ID NO:62).
[00141] In certain embodiments of any of the methods described herein, the RSPO or LGR antagonist is an antibody that specifically binds at least one human RSPO protein and the immunotherapeutic agent is a PD-1 antagonist. In some embodiments, the RSPO or LGR antagonist is an antibody that specifically binds at least one human RSPO protein and the immunotherapeutic agent is a PD-L 1 antagonist. In some embodiments, the RSPO or LGR antagonist is an antibody that specifically binds at least one human RSPO protein and the immunotherapeutic agent is a PD-L2 antagonist. In some embodiments, the RSPO or LGR antagonist is an antibody that specifically binds human at least one human RSPO protein and the immunotherapeutic agent is a CTLA-4 antagonist. In some
embodiments, the RSPO or LGR antagonist is an antibody that specifically binds at least one human RSPO protein and the immunotherapeutic agent is a CD80 antagonist. In some embodiments, the
RSPO or LGR antagonist is an antibody that specifically binds at least one human RSPO protein and the immunotherapeutic agent is a CD86 antagonist. In some embodiments, the RSPO or LGR antagonist is an antibody that specifically binds at least one human RSPO protein and the
immunotherapeutic agent is a KIR antagonist. In some embodiments, the RSPO or LGR antagonist is an antibody that specifically binds at least one human RSPO protein and the immunotherapeutic agent is a Tim-3 antagonist. In some embodiments, the RSPO or LGR antagonist is an antibody that specifically binds at least one human RSPO protein and the immunotherapeutic agent is a LAG3 antagonist. In some embodiments, the RSPO or LGR antagonist is an antibody that specifically binds at least one human RSPO protein and the immunotherapeutic agent is a TIGIT antagonist. In some embodiments, the RSPO or LGR antagonist is an antibody that specifically binds at least one human RSPO protein and the immunotherapeutic agent is a CD96 antagonist. In some embodiments, the
RSPO or LGR antagonist is an antibody that specifically binds at least one human RSPO protein and the immunotherapeutic agent is an IDOl antagonist. In some embodiments, the RSPO or LGR antagonist is an antibody that specifically binds at least one human RSPO protein and the
immunotherapeutic agent is a CD28 agonist. In some embodiments, the RSPO or LGR antagonist is an antibody that specifically binds at least one human RSPO protein and the immunotherapeutic agent is a 4-1BB agonist. In some embodiments, the RSPO or LGR antagonist is an antibody that specifically binds at least one human RSPO protein and the immunotherapeutic agent is an OX40 agonist. In some embodiments, the RSPO or LGR antagonist is an antibody that specifically binds at least one human RSPO protein and the immunotherapeutic agent is a CD27 agonist. In some embodiments, the RSPO or LGR antagonist is an antibody that specifically binds at least one human RSPO protein and the immunotherapeutic agent is a CD80 agonist. In some embodiments, the RSPO or LGR antagonist is an antibody that specifically binds at least one human RSPO protein and the immunotherapeutic agent is a CD86 agonist. In some embodiments, the RSPO or LGR antagonist is an antibody that specifically binds at least one human RSPO protein and the immunotherapeutic agent is a CD40 agonist. In some embodiments, the RSPO or LGR antagonist is an antibody that specifically binds at least one human RSPO protein and the immunotherapeutic agent is a GITR agonist. In some embodiments, the RSPO or LGR antagonist is an antibody that specifically binds at least one human RSPO protein and the immunotherapeutic agent is a cytokine. In some
embodiments, the RSPO or LGR antagonist is an antibody that specifically binds at least one human RSPO protein and the immunotherapeutic agent is an interferon. In some embodiments, the RSPO or LGR antagonist is an antibody that specifically binds at least one human RSPO protein and the immunotherapeutic agent is a lymphokine. In any of these embodiments, the RSPO protein is RPS03.
[00142] The present invention further provides compositions comprising RSPO or LGR antagonists and compositions comprising immunotherapeutic agents. In some embodiments, a composition comprises a RSPO or LGR antagonist described herein. In some embodiments, a composition comprises an antibody that specifically binds at least one human RSPO or LGR protein described herein. In some embodiments, the composition comprises a soluble receptor comprising the extracellular domain of human LGR protein (e.g., human LGR5) described herein. In some embodiments, a composition comprises an immunotherapeutic agent described herein. In some embodiments, a composition is a pharmaceutical composition comprising a RSPO or LGR antagonist and a pharmaceutically acceptable vehicle. In some embodiments, a composition is a pharmaceutical composition comprising an immunotherapeutic agent and a pharmaceutically acceptable vehicle. The pharmaceutical compositions find use in modulating immune responses in human patients, particularly immune responses to tumors. The pharmaceutical compositions find use in inhibiting tumor cell growth and treating cancer in human patients. The pharmaceutical compositions find use
in any of the methods described herein. In some embodiments, a RSPO or LGR antagonist described herein finds use in the manufacture of a medicament for the treatment of cancer in combination with at least one immunotherapeutic agent. In some embodiments, a RSPO or LGR antagonist described herein finds use in the manufacture of a medicament for the treatment of cancer in combination with at least one immunotherapeutic agent.
[00143] Formulations and/or pharmaceutical compositions are prepared for storage and use by combining a therapeutic agent of the present invention with a pharmaceutically acceptable carrier, excipient, and/or stabilizer as a sterile lyophilized powder, aqueous solution, etc. (Remington: The Science and Practice of Pharmacy, 22nd Edition, 2012, Pharmaceutical Press, London). Those of skill in the art generally consider pharmaceutically acceptable carriers, excipients, and/or stabilizers to be inactive ingredients of a formulation or pharmaceutical composition.
[00144] Suitable carriers, excipients, or stabilizers comprise nontoxic buffers such as phosphate, citrate, and other organic acids; salts such as sodium chloride; antioxidants including ascorbic acid and methionine; preservatives (e.g. octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride; benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens, such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m- cresol); low molecular weight polypeptides (such as less than about 10 amino acid residues); proteins such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as
polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; carbohydrates such as monosaccharides, disaccharides, glucose, mannose, or dextrins;
chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose, or sorbitol; salt-forming counter-ions such as sodium; metal complexes (e.g. Zn-protein complexes); and/or non-ionic surfactants such as polysorbate (TWEEN) or polyethylene glycol (PEG).
[00145] The therapeutic formulation can be in unit dosage form. Such formulations include tablets, pills, capsules, powders, granules, solutions or suspensions in water or non-aqueous media, or suppositories for oral, parenteral, or rectal administration or for administration by inhalation. In solid compositions such as tablets the principal active ingredient is mixed with a pharmaceutical carrier. As described herein, pharmaceutical carriers are considered to be inactive ingredients of a formulation or composition. Conventional tableting ingredients include corn starch, lactose, sucrose, sorbitol, talc, stearic acid, magnesium stearate, dicalcium phosphate or gums, and other diluents (e.g. water) to form a solid pre -formulation composition containing a homogeneous mixture of a compound of the present invention, or a non-toxic pharmaceutically acceptable salt thereof. The solid pre-formulation composition is then subdivided into unit dosage forms of the type described above. The tablets, pills, etc., of the novel composition can be coated or otherwise compounded to provide a dosage form affording the advantage of prolonged action. For example, the tablet or pill can comprise an inner composition covered by an outer component. Furthermore, the two components can be separated by
an enteric layer that serves to resist disintegration and permits the inner component to pass intact through the stomach or to be delayed in release. A variety of materials can be used for such enteric layers or coatings, including a number of polymeric acids and mixtures of polymeric acids with such materials as shellac, cetyl alcohol and cellulose acetate.
[00146] Pharmaceutical formulations may include the RSPO or LGR antagonists and/or the immunotherapeutic agents of the present invention complexed with liposomes. Liposomes can be generated by the reverse phase evaporation with a lipid composition comprising phosphatidylcholine, cholesterol, and PEG-derivatized phosphatidyl ethanolamine (PEG-PE). Liposomes are extruded through filters of defined pore size to yield liposomes with the desired diameter.
[00147] The RSPO or LGR antagonists and/or immunotherapeutic agents can also be entrapped in microcapsules. Such microcapsules are prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly- (methylmethacylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nanoparticles and nanocapsules) or in
macroemulsions as described in Remington: The Science and Practice of Pharmacy, 22nd Edition, 2012, Pharmaceutical Press, London.
[00148] In addition, sustained-release preparations comprising RSPO or LGR antagonists and/or immunotherapeutic agents can be prepared. Suitable examples of sustained-release preparations include semi-permeable matrices of solid hydrophobic polymers containing the agent, which matrices are in the form of shaped articles (e.g., films or microcapsules). Examples of sustained-release matrices include polyesters, hydrogels such as poly(2-hydroxyethyl-methacrylate) or
poly(vinylalcohol), polylactides, copolymers of L-glutamic acid and 7 ethyl-L-glutamate, non- degradable ethylene -vinyl acetate, degradable lactic acid-glycolic acid copolymers such as the LUPRON DEPOT™ (injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate), sucrose acetate isobutyrate, and poly-D-(-)-3-hydroxybutyric acid.
[00149] The RSPO or LGR antagonists and immunotherapeutic agents are administered as appropriate pharmaceutical compositions to a human patient according to known methods. The pharmaceutical compositions can be administered in any number of ways for either local or systemic treatment.
Suitable methods of administration include, but are not limited to, intravenous (administration as a bolus or by continuous infusion over a period of time), intraarterial, intramuscular (injection or infusion), intratumoral, intraperitoneal, intracerobrospinal, subcutaneous, intra-articular, intrasynovial, intracranial (e.g., intrathecal or intraventricular), or oral. In additional, administration can be topical, (e.g., transdermal patches, ointments, lotions, creams, gels, drops, suppositories, sprays, liquids and powders) or pulmonary (e.g., by inhalation or insufflation of powders or aerosols, including by nebulizer; intratracheal, intranasal, epidermal and transdermal).
[00150] For the treatment of a disease, the appropriate dosage(s) of a RSPO or LGR antagonist in combination with an immunotherapeutic agent of the present invention depends on the type of disease to be treated, the severity and course of the disease, the responsiveness of the disease, whether the inhibitors are administered for therapeutic or preventative purposes, previous therapy, the patient's clinical history, and so on, all at the discretion of the treating physician. The RSPO or LGR antagonist can be administered one time or as a series of treatments spread over several days to several months, or until a cure is effected or a diminution of the disease state is achieved (e.g., reduction in tumor size). The immunotherapeutic agent can be administered one time or as a series of treatments spread over several days to several months, or until a cure is effected or a diminution of the disease state is achieved (e.g., reduction in tumor size). Optimal dosing schedules for each agent can be calculated from measurements of drug accumulation in the body of the patient and will vary depending on the relative potency of an individual agent. The administering physician can determine optimum dosages, dosing methodologies, and repetition rates.
[00151] In some embodiments, combined administration includes co-administration in a single pharmaceutical formulation. In some embodiments, combined administration includes using separate formulations and consecutive administration in either order but generally within a time period such that all active agents can exert their biological activities simultaneously. In some embodiments, combined administration includes using separate formulations and a staggered dosing regimen. In some embodiments, combined administration includes using separate formulations and administration in a specific order. In some embodiments, combined administration includes using separate formulations and administration of the agents in a specific order and in a staggered dosing regimen.
[00152] In certain embodiments, dosage of a RSPO or LGR antagonist is from about 0.0 ^g to about lOOmg/kg of body weight, from about O. ^g to about lOOmg/kg of body weight, from about ^g to about lOOmg/kg of body weight, from about lmg to about lOOmg/kg of body weight, about lmg to about 80mg/kg of body weight from about lOmg to about lOOmg/kg of body weight, from about lOmg to about 75mg/kg of body weight, or from about lOmg to about 50mg/kg of body weight. In certain embodiments, the dosage of the RSPO or LGR antagonist is from about 0. lmg to about 20mg/kg of body weight. In some embodiments, the RSPO or LGR antagonist is administered to the subject at a dosage of about 2mg/kg to about 15mg/kg. In some embodiments, the RSPO or LGR antagonist is administered to the subject at a dosage of about 5mg/kg to about 15mg/kg. In certain embodiments, the RSPO or LGR antagonist is administered once or more daily, weekly, monthly, or yearly. In certain embodiments, the RSPO or LGR antagonist is administered once every week, once every two weeks, once every three weeks, or once every four weeks.
[00153] In certain embodiments, dosage of an immunotherapeutic agent is from about O.O^g to about lOOmg/kg of body weight, from about O. ^g to about lOOmg/kg of body weight, from about ^g to about lOOmg/kg of body weight, from about lmg to about lOOmg/kg of body weight, about lmg to
about 80mg/kg of body weight from about lOmg to about lOOmg/kg of body weight, from about lOmg to about 75mg/kg of body weight, or from about lOmg to about 50mg/kg of body weight. In certain embodiments, the dosage of an immunotherapeutic agent is from about 0. lmg to about 20mg/kg of body weight. In some embodiments, an immunotherapeutic agent is administered to the subject at a dosage of about 2mg/kg to about 15mg/kg. In some embodiments, the RSPO or LGR antagonist is administered to the subject at a dosage of about 5mg/kg to about 15mg/kg. In certain embodiments, an immunotherapeutic agent is administered once or more daily, weekly, monthly, or yearly. In certain embodiments, an immunotherapeutic agent is administered once every week, once every two weeks, once every three weeks, or once every four weeks.
[00154] In some embodiments, dosage of an immunotherapeutic agent is determined by what is considered "standard-of-care" for a particular agent by those of skill in the art (e.g., treating physicians).
[00155] In some embodiments, an inhibitor may be administered at an initial higher "loading" dose, followed by one or more lower doses. In some embodiments, the frequency of administration may also change. In some embodiments, a dosing regimen may comprise administering an initial dose, followed by additional doses (or "maintenance" doses) once a week, once every two weeks, once every three weeks, or once every month. For example, a dosing regimen may comprise administering an initial loading dose, followed by a weekly maintenance dose of, for example, one-half of the initial dose. Or a dosing regimen may comprise administering an initial loading dose, followed by maintenance doses of, for example one-half of the initial dose every other week. Or a dosing regimen may comprise administering three initial doses for 3 weeks, followed by maintenance doses of, for example, the same amount every other week.
[00156] As is known to those of skill in the art, administration of any therapeutic agent may lead to side effects and/or toxicities. In some cases, the side effects and/or toxicities are so severe as to preclude administration of the particular agent at a therapeutically effective dose. In some cases, drug therapy must be discontinued, and other agents may be tried. However, many agents in the same therapeutic class often display similar side effects and/or toxicities, meaning that the patient either has to stop therapy, or if possible, suffer from the unpleasant side effects associated with the therapeutic agent.
[00157] The present invention provides methods of treating cancer in a subject comprising using a dosing strategy for administering two or more agents that may reduce side effects and/or toxicities associated with administration of a RSPO or LGR antagonist and/or an immunotherapeutic agent. In some embodiments, a method for treating cancer in a human subject comprises administering to the subject a therapeutically effective dose of a RSPO or LGR antagonist in combination with a therapeutically effective dose of an immunotherapeutic agent, where one or both of the inhibitors are administered according to an intermittent dosing strategy. In some embodiments, the intermittent
dosing strategy comprises administering an initial dose of a RSPO or LGR antagonist to the subject, and administering subsequent doses of the RSPO or LGR antagonist about once every 2 weeks. In some embodiments, the intermittent dosing strategy comprises administering an initial dose of a RSPO or LGR antagonist to the subject, and administering subsequent doses of the RSPO or LGR antagonist about once every 3 weeks. In some embodiments, the intermittent dosing strategy comprises administering an initial dose of a RSPO or LGR antagonist to the subject, and
administering subsequent doses of the RSPO or LGR antagonist about once every 4 weeks. In some embodiments, the RSPO or LGR antagonist is administered using an intermittent dosing strategy and the immunotherapeutic agent is administered weekly or every week for 3 weeks out of 4.
[00158] Combination therapy with two or more therapeutic agents often uses agents that work by different mechanisms of action, although this is not required. Combination therapy using agents with different mechanisms of action may result in additive or synergetic effects. Combination therapy may allow for a lower dose of each agent than is used in monotherapy, thereby reducing toxic side effects and/or increasing the therapeutic index of the agent(s). Combination therapy may decrease the likelihood that resistant cancer cells will develop. Combination therapy comprising an
immunotherapeutic agent may allow one agent to enhance the immune response to a tumor or tumor cells while the other agent may be effective at killing tumor cells more directly.
[00159] In some embodiments, the combination of a RSPO or LGR antagonist and an
immunotherapeutic agent results in additive or synergetic results. In some embodiments, the combination therapy results in an increase in the therapeutic index of the RSPO or LGR antagonist. In some embodiments, the combination therapy results in an increase in the therapeutic index of the immunotherapeutic agent. In some embodiments, the combination therapy results in a decrease in the toxicity and/or side effects of the RSPO or LGR antagonist. In some embodiments, the combination therapy results in a decrease in the toxicity and/or side effects of the immunotherapeutic agent.
[00160] The treating physician can estimate repetition rates for dosing based on measured residence times and concentrations of the drug in bodily fluids or tissues. The progress of therapy can be monitored by conventional techniques and assays.
[00161] In certain embodiments, in addition to administering a RSPO or LGR antagonist in combination with an immunotherapeutic agent, treatment methods may further comprise
administering at least one additional therapeutic agent prior to, concurrently with, and/or subsequently to administration of the RSPO or LGR antagonist and/or the immunotherapeutic agent.
[00162] In some embodiments, the additional therapeutic agent(s) will be administered substantially simultaneously or concurrently with the RSPO or LGR antagonist or the immunotherapeutic agent.
For example, a subject may be given the RSPO or LGR antagonist and the immunotherapeutic agent while undergoing a course of treatment with the additional therapeutic agent (e.g., additional chemotherapeutic agent). In certain embodiments, the RSPO or LGR antagonist and the
immunotherapeutic agent will be administered within 1 year of the treatment with the additional therapeutic agent. In certain alternative embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent will be administered within 10, 8, 6, 4, or 2 months of any treatment with the additional therapeutic agent. In certain other embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent will be administered within 4, 3, 2, or 1 week of any treatment with the additional therapeutic agent. In some embodiments, the RSPO or LGR antagonist and the immunotherapeutic agent will be administered within 5, 4, 3, 2, or 1 days of any treatment with the additional therapeutic agent. It will further be appreciated that the agents or treatment may be administered to the subject within a matter of hours or minutes (i.e., substantially simultaneously) with the RSPO or LGR antagonist or the immunotherapeutic agent.
[00163] Therapeutic agents that may be administered in combination with a RSPO or LGR antagonist and an immunotherapeutic agent include chemotherapeutic agents. Thus, in some embodiments, the method or treatment involves the administration of a RSPO or LGR antagonist and
immunotherapeutic agent of the present invention in combination with a chemotherapeutic agent or cocktail of multiple different chemotherapeutic agents. Treatment with a RSPO or LGR antagonist and immunotherapeutic agent can occur prior to, concurrently with, or subsequent to administration of chemotherapies. Preparation and dosing schedules for such chemotherapeutic agents can be used according to manufacturers' instructions or as determined empirically by the skilled practitioner. Preparation and dosing schedules for such chemotherapy are also described in Chemotherapy Service, 1992, M. C. Perry, Editor, Williams & Wilkins, Baltimore, MD.
[00164] Chemotherapeutic agents useful in the instant invention include, but are not limited to, alkylating agents such as thiotepa and cyclosphosphamide; alkyl sulfonates such as busulfan, improsulfan, and piposulfan; aziridines such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylamelamines including altretamine, triethylenemelamine,
trietylenephosphoramide, triethylenethiophosphaoramide and trimethylolomelamime; nitrogen mustards such as chlorambucil, chlornaphazine, cholophosphamide, estramustine, ifosfamide, mechlorethamine, mechlorethamine oxide hydrochloride, melphalan, novembichin, phenesterine, prednimustine, trofosfamide, uracil mustard; nitrosureas such as carmustine, chlorozotocin, fotemustine, lomustine, nimustine, ranimustine; antibiotics such as aclacinomysins, actinomycin, authramycin, azaserine, bleomycins, cactinomycin, calicheamicin, carabicin, caminomycin, carzinophilin, chromomycins, dactinomycin, daunorubicin, detorubicin, 6-diazo-5-oxo-L-norleucine, doxorubicin, epirubicin, esorubicin, idarubicin, marcellomycin, mitomycins, mycophenolic acid, nogalamycin, olivomycins, peplomycin, potfiromycin, puromycin, quelamycin, rodorubicin, streptonigrin, streptozocin, tubercidin, ubenimex, zinostatin, zorubicin; anti-metabolites such as methotrexate and 5-fluorouracil (5-FU); folic acid analogues such as denopterin, methotrexate, pteropterin, trimetrexate; purine analogs such as fludarabine, 6-mercaptopurine, thiamiprine,
thioguanine; pyrimidine analogs such as ancitabine, azacitidine, 6-azauridine, carmofur, cytarabine, dideoxyuridine, doxifluridine, enocitabine, floxuridine, 5-FU; androgens such as calusterone, dromostanolone propionate, epitiostanol, mepitiostane, testolactone; anti-adrenals such as aminoglutethimide, mitotane, trilostane; folic acid replenisher such as frolinic acid; aceglatone;
aldophosphamide glycoside; aminolevulinic acid; amsacrine; bestrabucil; bisantrene; edatraxate; defofamine; demecolcine; diaziquone; elformithine; elliptinium acetate; etoglucid; gallium nitrate; hydroxyurea; lentinan; lonidamine; mitoguazone; mitoxantrone; mopidamol; nitracrine; pentostatin; phenamet; pirarubicin; podophyllinic acid; 2-ethylhydrazide; procarbazine; PSK.; razoxane;
sizofuran; spirogermanium; tenuazonic acid; triaziquone; 2,2',2"-trichlorotriethylamine; urethan; vindesine; dacarbazine; mannomustine; mitobronitol; mitolactol; pipobroman; gacytosine; arabinoside ("Ara-C"); cyclophosphamide; thiotepa; chlorambucil; gemcitabine; 6-thioguanine; mercaptopurine; methotrexate; platinum analogs such as cisplatin and carboplatin; platinum; etoposide (VP-16);
ifosfamide; mitomycin C; mitoxantrone; novantrone; teniposide; daunomycin; aminopterin; xeloda; ibandronate; CPT1 1 ; topoisomerase inhibitor RFS 2000; difluoromethylornithine (DMFO); retinoic acid; esperamicins; capecitabine; and pharmaceutically acceptable salts, acids or derivatives of any of the above. Chemotherapeutic agents also include anti-hormonal agents that act to regulate or inhibit hormone action on tumors such as anti-estrogens including for example tamoxifen, raloxifene, aromatase inhibiting 4(5)-imidazoles, 4-hydroxytamoxifen, trioxifene, keoxifene, LY1 17018, onapristone, and toremifene; and antiandrogens such as flutamide, nilutamide, bicalutamide, leuprolide, and goserelin; and pharmaceutically acceptable salts, acids or derivatives of any of the above.
[00165] In certain embodiments, the chemotherapeutic agent is a topoisomerase inhibitor.
Topoisomerase inhibitors are chemotherapy agents that interfere with the action of a topoisomerase enzyme (e.g., topoisomerase I or II). Topoisomerase inhibitors include, but are not limited to, doxorubicin HC1, daunorubicin citrate, mitoxantrone HC1, actinomycin D, etoposide, topotecan HC1, teniposide (VM-26), and irinotecan.
[00166] In certain embodiments, the chemotherapeutic agent is an anti -metabolite. An anti -metabolite is a chemical with a structure that is similar to a metabolite required for normal biochemical reactions, yet different enough to interfere with one or more normal functions of cells, such as cell division. Anti-metabolites include, but are not limited to, gemcitabine, fluorouracil, capecitabine, methotrexate sodium, ralitrexed, pemetrexed, tegafur, cytosine arabinoside, thioguanine, 5-azacytidine, 6- mercaptopurine, azathioprine, 6-thioguanine, pentostatin, fludarabine phosphate, and cladribine, as well as pharmaceutically acceptable salts, acids, or derivatives of any of these.
[00167] In certain embodiments, the chemotherapeutic agent is an antimitotic agent, including, but not limited to, agents that bind tubulin. In some embodiments, the agent is a taxane. In certain embodiments, the agent is paclitaxel or docetaxel, or a pharmaceutically acceptable salt, acid, or
derivative of paclitaxel or docetaxel. In certain embodiments, the agent is paclitaxel (TAXOL), docetaxel (TAXOTERE), albumin-bound paclitaxel (ABRAXANE®), DHA-paclitaxel, or PG- paclitaxel. In certain alternative embodiments, the antimitotic agent comprises a vinca alkaloid, such as vincristine, binblastine, vinorelbine, or vindesine, or pharmaceutically acceptable salts, acids, or derivatives thereof. In some embodiments, the antimitotic agent is an inhibitor of kinesin Eg5 or an inhibitor of a mitotic kinase such as Aurora A or Plkl .
[00168] In some embodiments, an additional therapeutic agent that may be administered in combination with a RSPO or LGR antagonist and an immunotherapeutic agent comprises an agent such as a small molecule. For example, treatment can involve the combined administration of a RSPO or LGR antagonist and an immunotherapeutic agent with a small molecule that acts as an inhibitor against tumor-associated antigens including, but not limited to, EGFR, HER2 (ErbB2), and/or VEGF. In some embodiments, a RSPO or LGR antagonist and an immunotherapeutic agent are administered in combination with a protein kinase inhibitor selected from the group consisting of: gefitinib (IRESSA), erlotinib (TARCEVA), sunitinib (SUTENT), lapatanib, vandetanib (ZACTIMA), AEE788, CI-1033, cediranib (RECENTIN), sorafenib (NEXAVAR), and pazopanib (GW786034B). In some embodiments, an additional therapeutic agent comprises an mTOR inhibitor.
[00169] In some embodiments, an additional therapeutic agent comprises a biological molecule, such as an antibody. For example, treatment can involve the combined administration of a RSPO or LGR antagonist and an immunotherapeutic agent with antibodies against tumor-associated antigens including, but not limited to, antibodies that bind EGFR, HER2/ErbB2, and/or VEGF. In certain embodiments, the additional therapeutic agent is an antibody specific for a cancer stem cell marker. In certain embodiments, the additional therapeutic agent is an antibody that inhibits a cancer stem cell pathway. In certain embodiments, the additional therapeutic agent is an antibody that is an angiogenesis inhibitor (e.g., an anti-VEGF or VEGF receptor antibody). In certain embodiments, the additional therapeutic agent is bevacizumab (AVASTIN), ramucirumab, trastuzumab (HERCEPTIN), pertuzumab (OMNITARG), panitumumab (VECTIBIX), nimotuzumab, zalutumumab, or cetuximab (ERBITUX).
[00170] Furthermore, treatment can involve the combined administration of a RSPO or LGR antagonist and an immunotherapeutic agent with other biologic molecules, such as one or more cytokines (e.g., lymphokines, interleukins, tumor necrosis factors, and/or growth factors) or can be accompanied by surgical removal of tumors, removal of cancer cells, or any other therapy deemed necessary by a treating physician.
[00171] In some embodiments, treatment can involve the combined administration of a RSPO or LGR antagonist and an immunotherapeutic agent with a growth factor selected from the group consisting of, but not limited to: adrenomedullin (AM), angiopoietin (Ang), BMPs, BDNF, EGF, erythropoietin (EPO), FGF, GDNF, G-CSF, GM-CSF, GDF9, HGF, HDGF, IGF, migration-stimulating factor,
myostatin (GDF-8), NGF, neurotrophins, PDGF, thrombopoietin, TGF-a, TGF-β, TNF-a, VEGF, P1GF, IL-1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-12, IL-15, and IL-18.
[00172] In certain embodiments, treatment can involve the combined administration of a RSPO or LGR antagonist and an immunotherapeutic agent with radiation therapy. Treatment with a RSPO or LGR antagonist and an immunotherapeutic agent can occur prior to, concurrently with, or subsequent to administration of radiation therapy. Dosing schedules for such radiation therapy can be determined by the skilled medical practitioner.
III. RSPO and LGR antagonists
[00173] Described herein are methods, including, for example, methods of inhibiting tumor growth or treating cancer, comprising administering an RSPO or LGR antagonist in combination with an immunotherapeutic .
[00174] In certain embodiments, the RSPO or LGR antagonist binds one or more RSPO or LGR proteins. In certain embodiments, the RSPO or LGR antagonist binds one or more extracellular region(s) of LGR. In certain embodiments, the RSPO or LGR antagonist inhibits β-catenin signaling. In certain embodiments, the RSPO or LGR antagonist modulates Wnt mediated β-catenin signaling.
[00175] In certain embodiments, the RSPO or LGR antagonist binds one or more human RSPO proteins. These agents are referred to herein as "RSPO-binding agents". Non-limiting examples of RSPO-binding agents can be found in U.S. Patent Nos. 8158758, 8158757, 8802097, 8088374, and U.S. Patent Publication Nos. 2014/0017253, 2014/0134703, 2013/0337533, 2014/0186917,
2012/0263730, 2012/0039912, 2009/0220495, 2012/0088727, and 2014/0056894, each of which are hereby incorporated by reference herein in their entirety for all purposes.
[00176] In some embodiments, the RSPO-binding agent is an antibody. In some embodiments, the RSPO-binding agent is a polypeptide. In certain embodiments, the RSPO-binding agent binds RSPO l ("RSPOl -binding agents"). In certain embodiments, the RSPO-binding agent binds RSP02 ("RSP02- binding agents"). In certain embodiments, the RSPO-binding agent binds RSP03 ("RSP03-binding agents"). In certain embodiments, the RSPO-binding agent specifically binds one or more human RSPO proteins. The full-length amino acid (aa) sequences for human RSPOl, RSP02, RSP03, and RSP04 are known in the art and are provided herein as SEQ ID NO: 1 (RSPO l), SEQ ID NO:2 (RSP02), SEQ ID NO:3 (RSP03), and SEQ ID NO:4 (RSP04).
[00177] In certain embodiments, the antigen-binding site of an RSPO-binding agent (e.g., an antibody or a bispecific antibody) described herein is capable of binding (or binds) one, two, three, or four RSPOs. In certain embodiments, the antigen-binding site of an RSPO-binding agent (e.g., an antibody or a bispecific antibody) described herein is capable of binding (or binds) a first RSPO protein (e.g., RSPO 1) as well as one, two, or three other RSPOs (e.g., RSP02, RSP03, and/or RSP04). In some
embodiments, the RSPO-binding agent (e.g., antibody) specifically binds both human RSPO and mouse RSPO.
[00178] In certain embodiments, the RSPO-binding agent is an antibody that specifically binds within amino acids 21-263 of human RSPOl (SEQ ID NO: l). In certain embodiments, the RSPO-binding agent is an antibody that specifically binds within amino acids 31-263 of human RSPOl (SEQ ID NO: 1). In certain embodiments, the RSPO-binding agent is an antibody that specifically binds within amino acids 34-135 of human RSPOl (SEQ ID NO: 1). In certain embodiments, the RSPO-binding agent is an antibody that specifically binds within amino acids 34-85 of human RSPO l (SEQ ID NO: 1). In certain embodiments, the RSPO-binding agent is an antibody that specifically binds within amino acids 91-135 of human RSPOl (SEQ ID NO: 1). In certain embodiments, the RSPO-binding agent is an antibody that specifically binds within amino acids 147-207 of human RSPOl (SEQ ID NO: 1). In certain embodiments, the RSPO-binding agent binds a furin-like cysteine-rich domain of RSPOl. In some embodiments, the RSPO-binding agent binds at least one amino acid within a furin- like cysteine-rich domain of RSPO l . In some embodiments, the RSPO-binding agent binds the thrombospondin domain of RSPO 1. In some embodiments, the RSPO-binding agent binds at least one amino acid within the thrombospondin domain of RSPO 1.
[00179] In certain embodiments, the RSPO-binding agent is an antibody that specifically binds within amino acids 22-243 of human RSP02 (SEQ ID NO:2). hi certain embodiments, the RSPO-binding agent is an antibody that specifically binds within amino acids 22-205 of human RSP02 (SEQ ID NO:2). In certain embodiments, the RSPO-binding agent is an antibody that specifically binds within amino acids 35-134 of human RSP02 (SEQ ID NO:2). In certain embodiments, the RSPO-binding agent is an antibody that specifically binds within amino acids 34-84 of human RSP02 (SEQ ID NO:2). In certain embodiments, the RSPO-binding agent is an antibody that specifically binds within amino acids 90-134 of human RSP02 (SEQ ID NO:2). hi certain embodiments, the RSPO-binding agent binds a furin-like cysteine-rich domain of RSP02. hi some embodiments, the RSPO-binding agent binds at least one amino acid within a furin-like cysteine-rich domain of RSP02. In some embodiments, the RSPO-binding agent binds the thrombospondin domain of RSP02. In some embodiments, the RSPO-binding agent binds at least one amino acid within the thrombospondin domain of RSP02.
[00180] In certain embodiments, the RSPO-binding agent is an antibody that specifically binds within amino acids 22-272 of human RSP03 (SEQ ID NO:3). hi certain embodiments, the RSPO-binding agent is an antibody that specifically binds within amino acids 22-207 of human RSP03 (SEQ ID NO:3). In certain embodiments, the RSPO-binding agent is an antibody that specifically binds within amino acids 35-135 of human RSP03 (SEQ ID NO:3). In certain embodiments, the RSPO-binding agent is an antibody that specifically binds within amino acids 35-86 of human RSP03 (SEQ ID
NO:3). In certain embodiments, the RSPO-binding agent is an antibody that specifically binds within
amino acids 92-135 of human RSP03 (SEQ ID NO:3). In certain embodiments, the RSPO-binding agent binds a furin-like cysteine-rich domain of RSP03. In some embodiments, the RSPO-binding agent binds at least one amino acid within a furin-like cysteine-rich domain of RSP03. In some embodiments, the RSPO-binding agent binds the thrombospondin domain of RSP03. In some embodiments, the RSPO-binding agent binds at least one amino acid within the thrombospondin domain of RSP03.
[00181] In certain embodiments, the RSPO-binding agent or antibody binds at least one RSPO protein with a dissociation constant (KD) of about ΙμΜ or less, about lOOnM or less, about 40nM or less, about 20nM or less, about ΙΟηΜ or less, about InM or less, or about O. lnM or less. In certain embodiments, an RSPO-binding agent or antibody binds at least one RSPO protein with a dissociation constant (KD) of about ΙμΜ or less, about lOOnM or less, about 40nM or less, about 20nM or less, about ΙΟηΜ or less, about InM or less, or about 0. InM or less. In some embodiments, an RSPO- binding agent or antibody binds at least one RSPO protein with a KD of about 20nM or less. In some embodiments, an RSPO-binding agent or antibody binds at least one RSPO protein with a KD of about ΙΟηΜ or less. In some embodiments, an RSPO-binding agent or antibody binds at least one RSPO protein with a KD of about InM or less. In some embodiments, an RSPO-binding agent or antibody binds at least one RSPO protein with a KD of about 0.5nM or less. In some embodiments, an RSPO-binding agent or antibody binds at least one RSPO protein with a KD of about O. lnM or less. In certain embodiments, an RSPO-binding agent or antibody described herein binds at least two
RSPO proteins. In some embodiments, the RSPO-binding agent binds both human RSPO and mouse RSPO with a KD of about ΙΟηΜ or less. In some embodiments, an RSPO-binding agent binds both human RSPO and mouse RSPO with a KD of about InM or less. In some embodiments, an RSPO- binding agent binds both human RSPO and mouse RSPO with a KD of about O. lnM or less. In some embodiments, the dissociation constant of a binding agent (e.g., an antibody) to an RSPO protein is the dissociation constant determined using an RSPO fusion protein comprising at least a portion of the RSPO protein immobilized on a Biacore chip. In some embodiments, the dissociation constant of a binding agent (e.g., an antibody) to an RSPO protein is the dissociation constant determined using the binding agent captured by an anti-human IgG antibody on a Biacore chip and an RSPO protein.
[00182] In certain embodiments, the RSPO-binding agent (e.g., an antibody) binds to at least one human RSPO protein with a half maximal effective concentration (EC50) of about ΙμΜ or less, about lOOnM or less, about 40nM or less, about 20nM or less, about ΙΟηΜ or less, about InM or less, or about 0. InM or less. In certain embodiments, an RSPO-binding agent (e.g., an antibody) binds to at least one human RSPO with a half maximal effective concentration (EC50) of about ΙμΜ or less, about lOOnM or less, about 40nM or less, about 20nM or less, about ΙΟηΜ or less, about InM or less, or about 0. InM or less.
[00183] In certain embodiments, the RSPO-binding agent is an RSPO l-binding agent (e.g., an antibody) that specifically binds human RSPO l, wherein the RSPOl-binding agent (e.g., an antibody) comprises one, two, three, four, five, and/or six of the CDRs of antibody 89M5 (see Table 1).
Table 1
[00184] In certain embodiments, the RSPO-binding agent is an RSPO l-binding agent (e.g., an antibody) that specifically binds human RSPO 1 , wherein the RSPO 1 -binding agent comprises a heavy chain CDR1 comprising TGYTMH (SEQ ID NO:5), a heavy chain CDR2 comprising
GINPNNGGTTYNQNFKG (SEQ ID NO: 6), and a heavy chain CDR3 comprising
KEFSDGYYFFAY (SEQ ID NO: 7). In some embodiments, the RSPO 1 -binding agent further comprises a light chain CDR1 comprising KASQDVIFAVA (SEQ ID NO: 8), a light chain CDR2 comprising WASTRHT (SEQ ID NO:9), and a light chain CDR3 comprising QQHYSTPW (SEQ ID NO: 10). In some embodiments, the RSPOl-binding agent comprises a light chain CDR1 comprising KASQDVIFAVA (SEQ ID NO: 8), a light chain CDR2 comprising WASTRHT (SEQ ID NO:9), and a light chain CDR3 comprising QQHYSTPW (SEQ ID NO: 10). In certain embodiments, the RSPO 1- binding agent comprises: (a) a heavy chain CDR1 comprising TGYTMH (SEQ ID NO:5), a heavy chain CDR2 comprising GINPNNGGTTYNQNFKG (SEQ ID NO:6), and a heavy chain CDR3
comprising KEFSDGYYFFAY (SEQ ID NO:7); and (b) a light chain CDR1 comprising KASQDVIFAVA (SEQ ID NO: 8), a light chain CDR2 comprising WASTRHT (SEQ ID NO:9), and a light chain CDR3 comprising QQHYSTPW (SEQ ID NO: 10).
[00185] In certain embodiments, the RSPO-binding agent is an RSPO l-binding agent (e.g., an antibody or bispecific antibody) that specifically binds human RSPO 1 , wherein the RSPO 1 -binding agent comprises: (a) a heavy chain CDR1 comprising TGYTMH (SEQ ID NO:5) or a variant thereof comprising 1, 2, 3, or 4 amino acid substitutions; (b) a heavy chain CDR2 comprising
GINPNNGGTTYNQNFKG (SEQ ID NO:6) or a variant thereof comprising 1, 2, 3, or 4 amino acid substitutions; (c) a heavy chain CDR3 comprising KEFSDGYYFFAY (SEQ ID NO:7) or a variant thereof comprising 1, 2, 3, or 4 amino acid substitutions; (d) a light chain CDR1 comprising
KASQDVIFAVA (SEQ ID NO: 8) or a variant thereof comprising 1, 2, 3, or 4 amino acid substitutions; (e) a light chain CDR2 comprising WASTRHT (SEQ ID NO: 9) or a variant thereof comprising 1, 2, 3, or 4 amino acid substitutions; and (f) a light chain CDR3 comprising
QQHYSTPW (SEQ ID NO: 10) or a variant thereof comprising 1, 2, 3, or 4 amino acid substitutions. In certain embodiments, the amino acid substitutions are conservative substitutions. In some embodiments, the substitutions are made as part of a germline humanization process.
[00186] In certain embodiments, the RSPO-binding agent is an RSPO l-binding agent (e.g., an antibody) that specifically binds RSPOl, wherein the RSPOl-binding agent comprises a heavy chain variable region having at least about 80% sequence identity to SEQ ID NO: 11 and/or a light chain variable region having at least 80% sequence identity to SEQ ID NO: 12. In certain embodiments, the RSPOl-binding agent comprises a heavy chain variable region having at least about 85%, at least about 90%, at least about 95%, at least about 97%, or at least about 99% sequence identity to SEQ ID NO: 11. In certain embodiments, the RSPO l-binding agent comprises a light chain variable region having at least about 85%, at least about 90%, at least about 95%, at least about 97%, or at least about 99% sequence identity to SEQ ID NO: 12. In certain embodiments, the RSPOl-binding agent comprises a heavy chain variable region having at least about 95% sequence identity to SEQ ID NO: 11 and/or a light chain variable region having at least about 95% sequence identity to SEQ ID NO: 12. In certain embodiments, the RSPO l-binding agent comprises a heavy chain variable region comprising SEQ ID NO: 11, and/or a light chain variable region comprising SEQ ID NO: 12. In certain embodiments, the RSPOl-binding agent comprises a heavy chain variable region comprising SEQ ID NO: 11 and a light chain variable region comprising SEQ ID NO: 12. In certain embodiments, the RSPOl-binding agent comprises a heavy chain variable region consisting of SEQ ID NO: 11 and a light chain variable region consisting of SEQ ID NO: 12.
[00187] In certain embodiments, the RSPO-binding agent is an RSPO l-binding agent (e.g., an antibody) that specifically binds RSPOl, wherein the RSPOl-binding agent comprises a heavy chain variable region having at least about 80% sequence identity to SEQ ID NO:44 and/or a light chain
variable region having at least 80% sequence identity to SEQ ID NO:45. In certain embodiments, the RSPOl-binding agent comprises a heavy chain variable region having at least about 85%, at least about 90%, at least about 95%, at least about 97%, or at least about 99% sequence identity to SEQ ID NO: 44. In certain embodiments, the RSPO l-binding agent comprises a light chain variable region having at least about 85%, at least about 90%, at least about 95%, at least about 97%, or at least about 99% sequence identity to SEQ ID NO:45. In certain embodiments, the RSPOl-binding agent comprises a heavy chain variable region having at least about 95% sequence identity to SEQ ID NO: 44 and/or a light chain variable region having at least about 95% sequence identity to SEQ ID NO: 45. In certain embodiments, the RSPO l-binding agent comprises a heavy chain variable region comprising SEQ ID NO:44 and/or a light chain variable region comprising SEQ ID NO:45. In certain embodiments, the RSPOl-binding agent comprises a heavy chain variable region comprising SEQ ID NO:44 and a light chain variable region comprising SEQ ID NO:45. In certain embodiments, the RSPOl-binding agent comprises a heavy chain variable region consisting of SEQ ID NO:44 and a light chain variable region consisting of SEQ ID NO:45.
[00188] In certain embodiments, the RSPO-binding agent is an RSPO 1-binding agent (e.g., an antibody) that specifically binds RSPOl, wherein the RSPOl-binding agent comprises: (a) a heavy chain having at least 90% sequence identity to SEQ ID NO: 13 or SEQ ID NO: 14; and/or (b) a light chain having at least 90% sequence identity to SEQ ID NO: 15 or SEQ ID NO: 16. In some embodiments, the RSPOl-binding agent comprises: (a) a heavy chain having at least 95% sequence identity to SEQ ID NO: 13 or SEQ ID NO: 14; and/or (b) a light chain having at least 95% sequence identity to SEQ ID NO: 15 or SEQ ID NO: 16. In some embodiments, the RSPOl-binding agent comprises a heavy chain comprising SEQ ID NO: 14 and/or a light chain comprising SEQ ID NO: 16. In some embodiments, the RSPO l-binding agent comprises a heavy chain comprising SEQ ID NO: 14 and a light chain comprising SEQ ID NO: 16.
[00189] In certain embodiments, the RSPO-binding agent is an RSPO 1-binding agent (e.g., an antibody) that specifically binds RSPOl, wherein the RSPOl-binding agent comprises: (a) a heavy chain having at least 90% sequence identity to SEQ ID NO:46 or SEQ ID NO:47; and/or (b) a light chain having at least 90% sequence identity to SEQ ID NO:48 or SEQ ID NO:49. In some embodiments, the RSPOl-binding agent comprises: (a) a heavy chain having at least 95% sequence identity to SEQ ID NO:46 or SEQ ID NO:47; and/or (b) a light chain having at least 95% sequence identity to SEQ ID NO:48 or SEQ ID NO:49. In some embodiments, the RSPOl-binding agent comprises a heavy chain comprising SEQ ID NO:47 and/or a light chain comprising SEQ ID NO:49. In some embodiments, the RSPO l-binding agent comprises a heavy chain comprising SEQ ID NO:47 and a light chain comprising SEQ ID NO: 49.
[00190] In certain embodiments, an RSPOl-binding agent comprises the heavy chain variable region and light chain variable region of antibody h89M5-H8L5. In certain embodiments, an RSPOl-binding
agent comprises the heavy chain and light chain of antibody h89M5-H8L5 (with or without the leader sequence). In certain embodiments, an RSPOl-binding agent is antibody h89M5-H8L5. In certain embodiments, an RSPO l-binding agent comprises the heavy chain variable region and/or light chain variable region of antibody h89M5-H8L5 in a chimeric form of the antibody. In some embodiments, the anti-RSPO 1 antibody is h89M5-H8L5.
[00191] In certain embodiments, an RSPOl-binding agent comprises the heavy chain variable region and light chain variable region of antibody h89M5-H2L2. In certain embodiments, an RSPOl-binding agent comprises the heavy chain and light chain of antibody h89M5-H2L2 (with or without the leader sequence). In certain embodiments, an RSPOl-binding agent is antibody h89M5-H2L2. In certain embodiments, an RSPO 1 -binding agent comprises the heavy chain variable region and/or light chain variable region of antibody h89M5-H2L2 in a chimeric form of the antibody. In some embodiments, the anti-RSPO 1 antibody is h89M5-H2L2.
[00192] In certain embodiments, an RSPOl-binding agent comprises the heavy chain CDRs and/or light chain CDRs of antibody 89M5. The hybridoma cell line producing the 89M5 antibody was deposited with American Type Culture Collection (ATCC), 10801 University Boulevard, Manassas, VA, USA, under the conditions of the Budapest Treaty on June 30, 2011 and assigned ATCC deposit designation number PTA-11970.
[00193] Plasmids encoding the heavy chain and light chain of antibody h89M5-H8L5 were deposited with ATCC, 10801 University Boulevard, Manassas, VA, USA, under the conditions of the Budapest Treaty on August 15, 2014 and assigned ATCC deposit designation number PTA-121494 and PTA- 121495. In some embodiments, the RSPO l-binding agent comprises a heavy chain variable region encoded by the plasmid deposited with ATCC and designated PTA-121494. In some embodiments, the RSPOl-binding agent comprises a light chain variable region encoded by the plasmid deposited with ATCC and designated PTA-121495. In some embodiments, the RSPOl-binding agent comprises a heavy chain variable region encoded by the plasmid deposited with ATCC and designated PTA- 121494 and a light chain variable region encoded by the plasmid deposited with ATCC and designated PTA-121495. In some embodiments, the RSPOl-binding agent comprises a heavy chain encoded by the plasmid deposited with ATCC and designated PTA-121494. In some embodiments, the RSPOl-binding agent comprises a light chain encoded by the plasmid deposited with ATCC and designated PTA-121495. In some embodiments, the RSPOl-binding agent comprises a heavy chain encoded by the plasmid deposited with ATCC and designated PTA-121494 and a light chain encoded by the plasmid deposited with ATCC and designated PTA-121495.
[00194] In certain embodiments, an RSPOl-binding agent comprises, consists essentially of, or consists of, antibody h89M5-H8L5. In certain embodiments, an RSPOl-binding agent comprises, consists essentially of, or consists of, a variant of antibody 89M5. In certain embodiments, an RSPOl- binding agent comprises, consists essentially of, or consists of, a variant of antibody h89M5-H8L5.
[00195] In certain embodiments, an RSPOl -binding agent comprises, consists essentially of, or consists of, antibody h89M5-H2L2. In certain embodiments, an RSPO l-binding agent comprises, consists essentially of, or consists of, a variant of antibody 89M5. In certain embodiments, an RSPOl- binding agent comprises, consists essentially of, or consists of, a variant of antibody h89M5-H2L2.
[00196] In certain embodiments of the methods described herein, the RSPO-binding agent is an
RSP02-binding agent (e.g., an antibody) that specifically binds human RSP02, wherein the RSP02- binding agent (e.g., an antibody) comprises one, two, three, four, five, and/or six of the CDRs of antibody 130M23 (see Table 1).
[00197] In certain embodiments, the RSPO-binding agent is an RSP02-binding agent (e.g., an antibody) that specifically binds human RSP02, wherein the RSP02-binding agent comprises a heavy chain CDRl comprising SSYAMS (SEQ ID NO: 17), a heavy chain CDR2 comprising
SISSGGSTYYPDSVKG (SEQ ID NO: 18), and a heavy chain CDR3 comprising
RGGDPGVYNGDYEDAMDY (SEQ ID NO: 19). In some embodiments, the RSP02-binding agent further comprises a light chain CDRl comprising KASQDVSSAVA (SEQ ID NO:20), a light chain CDR2 comprising WASTRHT (SEQ ID NO:21), and a light chain CDR3 comprising QQHYSTP (SEQ ID NO:22). In some embodiments, the RSP02-binding agent comprises a light chain CDRl comprising KASQDVSSAVA (SEQ ID NO:20), a light chain CDR2 comprising WASTRHT (SEQ ID NO:21), and a light chain CDR3 comprising QQHYSTP (SEQ ID NO:22). In certain
embodiments, the RSP02-binding agent comprises: (a) a heavy chain CDRl comprising SSYAMS (SEQ ID NO: 17), a heavy chain CDR2 comprising SISSGGSTYYPDSVKG (SEQ ID NO: 18), and a heavy chain CDR3 comprising RGGDPGVYNGDYEDAMDY (SEQ ID NO: 19); and (b) a light chain CDRl comprising KASQDVSSAVA (SEQ ID NO:20), a light chain CDR2 comprising WASTRHT (SEQ ID NO:21), and a light chain CDR3 comprising QQHYSTP (SEQ ID NO:22).
[00198] In certain embodiments, the RSPO-binding agent is an RSP02-binding agent (e.g., an antibody or bispecific antibody) that specifically binds human RSP02, wherein the RSP02-binding agent comprises: (a) a heavy chain CDRl comprising SSYAMS (SEQ ID NO: 17) or a variant thereof comprising 1, 2, 3, or 4 amino acid substitutions; (b) a heavy chain CDR2 comprising
SISSGGSTYYPDSVKG (SEQ ID NO: 18) or a variant thereof comprising 1, 2, 3, or 4 amino acid substitutions; (c) a heavy chain CDR3 comprising RGGDPGVYNGDYEDAMDY (SEQ ID NO: 19) or a variant thereof comprising 1, 2, 3, or 4 amino acid substitutions; (d) a light chain CDRl comprising KASQDVSSAVA (SEQ ID NO:20) or a variant thereof comprising 1, 2, 3, or 4 amino acid substitutions; (e) a light chain CDR2 comprising WASTRHT (SEQ ID NO:21) or a variant thereof comprising 1, 2, 3, or 4 amino acid substitutions; and (f) a light chain CDR3 comprising QQHYSTP (SEQ ID NO:22) or a variant thereof comprising 1, 2, 3, or 4 amino acid substitutions. In certain embodiments, the amino acid substitutions are conservative substitutions. In some
embodiments, the substitutions are made as part of a germline humanization process.
[00199] In certain embodiments, the RSPO-binding agent is an RSP02-binding agent (e.g., an antibody) that specifically binds RSP02, wherein the RSP02-binding agent comprises a heavy chain variable region having at least about 80% sequence identity to SEQ ID NO:23 and/or a light chain variable region having at least 80% sequence identity to SEQ ID NO:24 or SEQ ID NO:50. In certain embodiments, the RSP02-binding agent comprises a heavy chain variable region having at least about 85%, at least about 90%, at least about 95%, at least about 97%, or at least about 99% sequence identity to SEQ ID NO:23. In certain embodiments, the RSP02-binding agent comprises a light chain variable region having at least about 85%, at least about 90%, at least about 95%, at least about 97%, or at least about 99% sequence identity to SEQ ID NO:24. In certain embodiments, the RSP02- binding agent comprises a light chain variable region having at least about 85%, at least about 90%, at least about 95%, at least about 97%, or at least about 99% sequence identity to SEQ ID NO:50. In certain embodiments, the RSP02-binding agent comprises a heavy chain variable region having at least about 95% sequence identity to SEQ ID NO: 23 and/or a light chain variable region having at least about 95% sequence identity to SEQ ID NO: 24 or SEQ ID NO: 50. In certain embodiments, the RSP02-binding agent comprises a heavy chain variable region comprising SEQ ID NO:23 and/or a light chain variable region comprising SEQ ID NO:24 or SEQ ID NO:50. In certain embodiments, the RSP02-binding agent comprises a heavy chain variable region comprising SEQ ID NO:23 and a light chain variable region comprising SEQ ID NO:24. In certain embodiments, the RSP02-binding agent comprises a heavy chain variable region comprising SEQ ID NO:23 and a light chain variable region comprising SEQ ID NO: 50. In certain embodiments, the RSP02-binding agent comprises a heavy chain variable region consisting of SEQ ID NO: 23 and a light chain variable region consisting of SEQ ID NO:24. In certain embodiments, the RSP02-binding agent comprises a heavy chain variable region consisting of SEQ ID NO: 23 and a light chain variable region consisting of SEQ ID NO: 50.
[00200] In certain embodiments, the RSPO-binding agent is an RSP02-binding agent (e.g., an antibody) that specifically binds RSP02, wherein the RSP02-binding agent comprises: (a) a heavy chain having at least 90% sequence identity to SEQ ID NO:25 or SEQ ID NO:26; and/or (b) a light chain having at least 90% sequence identity to SEQ ID NO:31 or SEQ ID NO:32. In some embodiments, the RSP02-binding agent comprises: (a) a heavy chain having at least 95% sequence identity to SEQ ID NO:25 or SEQ ID NO:26; and/or (b) a light chain having at least 95% sequence identity to SEQ ID NO:27 or SEQ ID NO:28. In some embodiments, the RSP02-binding agent comprises a heavy chain comprising SEQ ID NO:26 and/or a light chain comprising SEQ ID NO:28. In some embodiments, the RSP02-binding agent comprises a heavy chain comprising SEQ ID NO:26 and a light chain comprising SEQ ID NO:28.
[00201] In certain embodiments, the RSPO-binding agent is an RSP02-binding agent (e.g., an antibody) that specifically binds RSP02, wherein the RSP02-binding agent comprises: (a) a heavy chain having at least 90% sequence identity to SEQ ID NO:25 or SEQ ID NO:26; and/or (b) a light
chain having at least 90% sequence identity to SEQ ID NO:51 or SEQ ID NO:52. In some embodiments, the RSP02-binding agent comprises: (a) a heavy chain having at least 95% sequence identity to SEQ ID NO:25 or SEQ ID NO:26; and/or (b) a light chain having at least 95% sequence identity to SEQ ID NO:51 or SEQ ID NO:52. In some embodiments, the RSP02-binding agent comprises a heavy chain comprising SEQ ID NO:26 and/or a light chain comprising SEQ ID NO:52. In some embodiments, the RSP02-binding agent comprises a heavy chain comprising SEQ ID NO:26 and a light chain comprising SEQ ID NO:52.
[00202] In certain embodiments, an RSP02-binding agent comprises the heavy chain variable region and light chain variable region of antibody hl30M23-HlL6. In certain embodiments, an RSP02- binding agent comprises the heavy chain and light chain of antibody hl30M23-HlL6 (with or without the leader sequence). In certain embodiments, an RSP02-binding agent is antibody hl30M23-HlL6. In certain embodiments, an RSP02-binding agent comprises the heavy chain variable region and/or light chain variable region of antibody hl30M23-HlL6 in a chimeric form of the antibody. In some embodiments, the anti-RSP02 antibody is hl30M23-HlL6.
[00203] In certain embodiments, an RSP02-binding agent comprises the heavy chain variable region and light chain variable region of antibody hl30M23-HlL2. In certain embodiments, an RSP02- binding agent comprises the heavy chain and light chain of antibody hl30M23-HlL2 (with or without the leader sequence). In certain embodiments, an RSP02-binding agent is antibody hl30M23-HlL2. In certain embodiments, an RSP02-binding agent comprises the heavy chain variable region and/or light chain variable region of antibody hl30M23-HlL2 in a chimeric form of the antibody. In some embodiments, the anti-RSP02 antibody is hl30M23-HlL2.
[00204] In certain embodiments of the methods described herein, an RSP02-binding agent comprises the heavy chain CDRs and/or light chain CDRs of antibody 130M23. The hybridoma cell line producing the 130M23 antibody was deposited with ATCC, 10801 University Boulevard, Manassas, VA, USA, under the conditions of the Budapest Treaty on August 10, 2011 and assigned ATCC deposit designation number PTA-12021.
[00205] In certain embodiments, an RSP02-binding agent comprises, consists essentially of, or consists of, antibody hl30M23-HlL6. In certain embodiments, an RSP02-binding agent comprises, consists essentially of, or consists of, a variant of antibody 130M23. In certain embodiments, an RSP02-binding agent comprises, consists essentially of, or consists of, a variant of antibody hl30M23-HlL6.
[00206] In certain embodiments, an RSP02-binding agent comprises, consists essentially of, or consists of, antibody hl30M23-HlL2. In certain embodiments, an RSP02-binding agent comprises, consists essentially of, or consists of, a variant of antibody 130M23. In certain embodiments, an RSP02 -binding agent comprises, consists essentially of, or consists of, a variant of antibody hl30M23-HlL2.
[00207] In certain embodiments of the methods described herein, the RSPO-binding agent is an RSP03-binding agent (e.g., an antibody) that specifically binds human RSP03, wherein the RSP03- binding agent (e.g., an antibody) comprises one, two, three, four, five, and/or six of the CDRs of antibody 131R10 (see Table 1 herein).
[00208] In certain embodiments, the RSPO-binding agent is an RSP03-binding agent (e.g., an antibody) that specifically binds human RSP03, wherein the RSP03-binding agent comprises a heavy chain CDR1 comprising DYSIH (SEQ ID NO:29), a heavy chain CDR2 comprising
YIYPSNGDSGYNQKFK (SEQ ID NO:30), and a heavy chain CDR3 comprising TYFANNFD (SEQ ID NO:31) or ATYFANNFDY (SEQ ID NO:32). In some embodiments, the RSP03-binding agent further comprises a light chain CDR1 comprising KASQSVDYDGDSYMN (SEQ ID NO:33), a light chain CDR2 comprising AASNLES (SEQ ID NO:34) or AAS (SEQ ID NO:35), and a light chain CDR3 comprising QQSNEDPLT (SEQ ID NO:36) or QQSNEDPLTF (SEQ ID NO:37). In some embodiments, the RSP03-binding agent comprises a light chain CDR1 comprising
KASQSVDYDGDSYMN (SEQ ID NO:33), a light chain CDR2 comprising AASNLES (SEQ ID NO:34) or AAS (SEQ ID NO:35), and a light chain CDR3 comprising QQSNEDPLT (SEQ ID NO:36) or QQSNEDPLTF (SEQ ID NO:37). In certain embodiments, the RSP03-binding agent comprises: (a) a heavy chain CDR1 comprising DYSIH (SEQ ID NO:29), a heavy chain CDR2 comprising YIYPSNGDSGYNQKFK (SEQ ID NO:30), and a heavy chain CDR3 comprising TYFANNFD (SEQ ID NO:31); and (b) a light chain CDR1 comprising KASQSVDYDGDSYMN (SEQ ID NO:33), a light chain CDR2 comprising AASNLES (SEQ ID NO:34), and a light chain CDR3 comprising QQSNEDPLT (SEQ ID NO:36).
[00209] In certain embodiments, the RSPO-binding agent is an RSP03-binding agent (e.g., an antibody or bispecific antibody) that specifically binds human RSP03, wherein the RSP03-binding agent comprises: (a) a heavy chain CDR1 comprising DYSIH (SEQ ID NO:29) or a variant thereof comprising 1, 2, 3, or 4 amino acid substitutions; (b) a heavy chain CDR2 comprising
YIYPSNGDSGYNQKFK (SEQ ID NO: 30) or a variant thereof comprising 1, 2, 3, or 4 amino acid substitutions; (c) a heavy chain CDR3 comprising TYFANNFD (SEQ ID NO:31), ATYFANNFDY (SEQ ID NO:32), or a variant thereof comprising 1, 2, 3, or 4 amino acid substitutions; (d) a light chain CDR1 comprising KASQSVDYDGDSYMN (SEQ ID NO:33) or a variant thereof comprising 1, 2, 3, or 4 amino acid substitutions; (e) a light chain CDR2 comprising AASNLES (SEQ ID NO:34), AAS (SEQ ID NO:35), or a variant thereof comprising 1, 2, 3, or 4 amino acid substitutions; and (f a light chain CDR3 comprising QQSNEDPLT (SEQ ID NO:36), QQSNEDPLTF (SEQ ID NO:37), or a variant thereof comprising 1, 2, 3, or 4 amino acid substitutions. In certain embodiments, the amino acid substitutions are conservative substitutions. In some embodiments, the substitutions are made as part of a germline humanization process.
[00210] In certain embodiments, the RSPO-binding agent is an RSP03-binding agent (e.g., an antibody) that specifically binds RSP03, wherein the RSP03-binding agent comprises a heavy chain variable region having at least about 80% sequence identity to SEQ ID NO:38 and/or a light chain variable region having at least 80% sequence identity to SEQ ID NO:39. In certain embodiments, the RSP03-binding agent comprises a heavy chain variable region having at least about 85%, at least about 90%, at least about 95%, at least about 97%, or at least about 99% sequence identity to SEQ ID NO:38. In certain embodiments, the RSP03-binding agent comprises a light chain variable region having at least about 85%, at least about 90%, at least about 95%, at least about 97%, or at least about 99% sequence identity to SEQ ID NO:39. In certain embodiments, the RSP03-binding agent comprises a heavy chain variable region having at least about 95% sequence identity to SEQ ID NO:38 and/or a light chain variable region having at least about 95% sequence identity to SEQ ID NO:39. In certain embodiments, the RSP03-binding agent comprises a heavy chain variable region comprising SEQ ID NO:38, and/or a light chain variable region comprising SEQ ID NO:39. In certain embodiments, the RSP03-binding agent comprises a heavy chain variable region comprising SEQ ID NO:38 and a light chain variable region comprising SEQ ID NO:39. In certain embodiments, the RSP03-binding agent comprises a heavy chain variable region consisting of SEQ ID NO:38 and a light chain variable region consisting of SEQ ID NO:39.
[00211] In certain embodiments, the RSPO-binding agent is an RSP03-binding agent (e.g., an antibody) that specifically binds RSP03, wherein the RSP03-binding agent comprises: (a) a heavy chain having at least 90% sequence identity to SEQ ID NO: 40 or SEQ ID NO: 41 ; and/or (b) a light chain having at least 90% sequence identity to SEQ ID NO: 42 or SEQ ID NO: 43. In some embodiments, the RSP03 -binding agent comprises: (a) a heavy chain having at least 95% sequence identity to SEQ ID NO: 40 or SEQ ID NO:41; and/or (b) a light chain having at least 95% sequence identity to SEQ ID NO:42 or SEQ ID NO:43. In some embodiments, the RSP03-binding agent comprises a heavy chain comprising SEQ ID NO:41 and/or a light chain comprising SEQ ID NO:43. In some embodiments, the RSP03-binding agent comprises a heavy chain comprising SEQ ID NO:41 and a light chain comprising SEQ ID NO:43.
[00212] In certain embodiments, an RSP03-binding agent comprises the heavy chain variable region and light chain variable region of antibody 131R10. In certain embodiments, an RSP03-binding agent comprises the heavy chain and light chain of antibody 131R10 (with or without the leader sequence). In certain embodiments, an RSP03 -binding agent is antibody 131R10. In certain embodiments, an RSP03 -binding agent comprises the heavy chain variable region and/or light chain variable region of antibody 131R10 in a chimeric form of the antibody. In certain embodiments, an RSP03-binding agent comprises the heavy chain CDRs and/or light chain CDRs of antibody 131R10. In some embodiments, the anti-RSP03 antibody is 131R10.
[00213] Plasmids encoding the heavy chain and light chain of antibody 131R10 were deposited with the American Type Culture Collection (ATCC), 10801 University Boulevard, Manassas, VA, USA, under the conditions of the Budapest Treaty on June 18, 2013 and assigned ATCC deposit designation number PTA-120420 and PTA-120421. In some embodiments, the RSP03-binding agent comprises a heavy chain variable region encoded by the plasmid deposited with ATCC and designated PTA- 120420. In some embodiments, the RSP03-binding agent comprises a light chain variable region encoded by the plasmid deposited with ATCC and designated PTA-120421. In some embodiments, the RSP03-binding agent comprises a heavy chain variable region encoded by the plasmid deposited with ATCC and designated PTA-120420 and a light chain variable region encoded by the plasmid deposited with ATCC and designated PTA-120421. In some embodiments, the RSP03 -binding agent comprises a heavy chain encoded by the plasmid deposited with ATCC and designated PTA-120420. In some embodiments, the RSP03-binding agent comprises a light chain encoded by the plasmid deposited with ATCC and designated PTA-120421. In some embodiments, the RSP03-binding agent comprises a heavy chain encoded by the plasmid deposited with ATCC and designated PTA-120420 and a light chain encoded by the plasmid deposited with ATCC and designated PTA-120421.
[00214] In certain embodiments, an RSP03-binding agent comprises, consists essentially of, or consists of, antibody 131R10. In certain embodiments, an RSP03-binding agent comprises, consists essentially of, or consists of, a variant of antibody 131R10.
[00215] Described herein are methods comprising polypeptides, including, but not limited to, antibodies that specifically bind human at least one RSPO protein. In some embodiments, a polypeptide binds human RSPOl . In some embodiments, a polypeptide binds human RSP02. In some embodiments, a polypeptide binds human RSP03.
[00216] In certain embodiments, the polypeptide comprises one, two, three, four, five, and/or six of the CDRs of antibody 89M5 (see Table 1 herein). In certain embodiments, the polypeptide comprises one, two, three, four, five, and/or six of the CDRs of antibody 130M23 (see Table 1 herein). In certain embodiments, the polypeptide comprises one, two, three, four, five, and/or six of the CDRs of antibody 131R10 (see Table 1 herein). In some embodiments, the polypeptide comprises CDRs with up to four (i.e., 0, 1, 2, 3, or 4) amino acid substitutions per CDR. In certain embodiments, the heavy chain CDR(s) are contained within a heavy chain variable region. In certain embodiments, the light chain CDR(s) are contained within a light chain variable region.
[00217] In some embodiments, the RSPO-binding agent is a polypeptide that specifically binds a human RSPOl, wherein the polypeptide comprises an amino acid sequence having at least about 80% sequence identity to SEQ ID NO: 11 and/or SEQ ID NO: 12. In some embodiments, the polypeptide comprises an amino acid sequence having at least about 80% sequence identity to SEQ ID NO: 13 and/or an amino acid sequence having at least about 80% sequence identity to SEQ ID NO: 15. In some embodiments, the polypeptide comprises an amino acid sequence having at least about 80%
sequence identity to SEQ ID NO: 14 and/or an amino acid sequence having at least about 80% sequence identity to SEQ ID NO: 16. In certain embodiments, the polypeptide comprises an amino acid sequence having at least about 85%, at least about 90%, at least about 95%, at least about 97%, or at least about 99% sequence identity to SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, or SEQ ID NO: 16. In certain embodiments, the polypeptide comprises an amino acid sequence having at least about 95% sequence identity to SEQ ID NO: 11 and/or an amino acid sequence having at least about 95% sequence identity to SEQ ID NO: 12. In certain embodiments, the polypeptide comprises an amino acid sequence having at least about 95% sequence identity to SEQ ID NO: 13 and/or an amino acid sequence having at least about 95% sequence identity to SEQ ID NO: 15. In certain embodiments, the polypeptide comprises an amino acid sequence having at least about 95% sequence identity to SEQ ID NO: 14 and/or an amino acid sequence having at least about 95% sequence identity to SEQ ID NO: 16. In certain embodiments, the polypeptide comprises an amino acid sequence of SEQ ID NO: 11 and/or an amino acid sequence of SEQ ID NO: 12. In certain embodiments, the polypeptide comprises an amino acid sequence of SEQ ID NO: 13 and/or an amino acid sequence of SEQ ID NO: 15. In certain embodiments, the polypeptide comprises an amino acid sequence of SEQ ID NO: 14 and/or an amino acid sequence of SEQ ID NO: 16.
[00218] In some embodiments, the RSPO-binding agent is a polypeptide that specifically binds a human RSPO l, wherein the polypeptide comprises an amino acid sequence having at least about 80% sequence identity to SEQ ID NO:44 and/or SEQ ID NO:45. In some embodiments, the polypeptide comprises an amino acid sequence having at least about 80% sequence identity to SEQ ID NO:46 and/or an amino acid sequence having at least about 80% sequence identity to SEQ ID NO:48. In some embodiments, the polypeptide comprises an amino acid sequence having at least about 80% sequence identity to SEQ ID NO:47 and/or an amino acid sequence having at least about 80% sequence identity to SEQ ID NO:49. In certain embodiments, the polypeptide comprises an amino acid sequence having at least about 85%, at least about 90%, at least about 95%, at least about 97%, or at least about 99% sequence identity to SEQ ID NO:44, SEQ ID NO:45, SEQ ID NO:46, SEQ ID NO:47, SEQ ID NO:48, or SEQ ID NO:49. In certain embodiments, the polypeptide comprises an amino acid sequence having at least about 95% sequence identity to SEQ ID NO:44 and/or an amino acid sequence having at least about 95% sequence identity to SEQ ID NO:45. In certain embodiments, the polypeptide comprises an amino acid sequence having at least about 95% sequence identity to
SEQ ID NO:46 and/or an amino acid sequence having at least about 95% sequence identity to SEQ ID NO:48. In certain embodiments, the polypeptide comprises an amino acid sequence having at least about 95% sequence identity to SEQ ID NO: 47 and/or an amino acid sequence having at least about 95% sequence identity to SEQ ID NO:49. In certain embodiments, the polypeptide comprises an amino acid sequence of SEQ ID NO:44 and/or an amino acid sequence of SEQ ID NO:45. In certain embodiments, the polypeptide comprises an amino acid sequence of SEQ ID NO:46 and/or an amino
acid sequence of SEQ ID NO:48. In certain embodiments, the polypeptide comprises an amino acid sequence of SEQ ID NO:47 and/or an amino acid sequence of SEQ ID NO:49.
[00219] In some embodiments, the RSPO-binding agent is a polypeptide that specifically binds a human RSP02, wherein the polypeptide comprises an amino acid sequence having at least about 80% sequence identity to SEQ ID NO:23 and/or SEQ ID NO:24. In some embodiments, the RSPO-binding agent is a polypeptide that specifically binds a human RSP02, wherein the polypeptide comprises an amino acid sequence having at least about 80% sequence identity to SEQ ID NO:23 and/or SEQ ID NO:50. In some embodiments, the polypeptide comprises an amino acid sequence having at least about 80% sequence identity to SEQ ID NO:25 and/or an amino acid sequence having at least about 80% sequence identity to SEQ ID NO:27 or SEQ ID NO:51. In some embodiments, the polypeptide comprises an amino acid sequence having at least about 80% sequence identity to SEQ ID NO:26 and/or an amino acid sequence having at least about 80% sequence identity to SEQ ID NO:28 or SEQ ID NO: 52. In certain embodiments, the polypeptide comprises an amino acid sequence having at least about 85%, at least about 90%, at least about 95%, at least about 97%, or at least about 99% sequence identity to SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:28, SEQ ID NO:50, SEQ ID NO:51, or SEQ ID NO:52. In certain embodiments, the polypeptide comprises an amino acid sequence having at least about 95% sequence identity to SEQ ID NO:23 and/or an amino acid sequence having at least about 95% sequence identity to SEQ ID NO: 24 or SEQ ID NO: 50. In certain embodiments, the polypeptide comprises an amino acid sequence having at least about 95% sequence identity to SEQ ID NO: 25 and/or an amino acid sequence having at least about 95% sequence identity to SEQ ID NO:27 or SEQ ID NO: 51. In certain embodiments, the polypeptide comprises an amino acid sequence having at least about 95% sequence identity to SEQ ID NO: 26 and/or an amino acid sequence having at least about 95% sequence identity to SEQ ID NO:28 or SEQ ID NO:52. In certain embodiments, the polypeptide comprises an amino acid sequence of SEQ ID NO:23 and/or an amino acid sequence of SEQ ID NO:24. In certain embodiments, the polypeptide comprises an amino acid sequence of SEQ ID NO:23 and/or an amino acid sequence of SEQ ID NO: 50. In certain embodiments, the polypeptide comprises an amino acid sequence of SEQ ID NO:25 and/or an amino acid sequence of SEQ ID NO:27. In certain embodiments, the polypeptide comprises an amino acid sequence of SEQ ID NO: 25 and/or an amino acid sequence of SEQ ID NO: 51. In certain embodiments, the polypeptide comprises an amino acid sequence of SEQ ID NO: 26 and/or an amino acid sequence of SEQ ID NO:28. In certain embodiments, the polypeptide comprises an amino acid sequence of SEQ ID NO:26 and/or an amino acid sequence of SEQ ID NO:52.
[00220] In some embodiments, the RSPO-binding agent is a polypeptide that specifically binds a human RSP03, wherein the polypeptide comprises an amino acid sequence having at least about 80% sequence identity to SEQ ID NO:38 and/or SEQ DI NO:47. In some embodiments, the polypeptide comprises an amino acid sequence having at least about 80% sequence identity to SEQ ID NO:40
and/or an amino acid sequence having at least about 80% sequence identity to SEQ ID NO:42. In some embodiments, the polypeptide comprises an amino acid sequence having at least about 80% sequence identity to SEQ ID NO:41 and/or an amino acid sequence having at least about 80% sequence identity to SEQ ID NO:43. In certain embodiments, the polypeptide comprises an amino acid sequence having at least about 85%, at least about 90%, at least about 95%, at least about 97%, or at least about 99% sequence identity to SEQ ID NO:38, SEQ ID NO:39, SEQ ID NO:40, SEQ ID NO:41, SEQ ID NO:42, or SEQ ID NO:43. In certain embodiments, the polypeptide comprises an amino acid sequence having at least about 95% sequence identity to SEQ ID NO:38 and/or an amino acid sequence having at least about 95% sequence identity to SEQ ID NO: 39. In certain embodiments, the polypeptide comprises an amino acid sequence having at least about 95% sequence identity to
SEQ ID NO:40 and/or an amino acid sequence having at least about 95% sequence identity to SEQ ID NO: 42. In certain embodiments, the polypeptide comprises an amino acid sequence having at least about 95% sequence identity to SEQ ID NO:41 and/or an amino acid sequence having at least about 95% sequence identity to SEQ ID NO:43. In certain embodiments, the polypeptide comprises an amino acid sequence of SEQ ID NO:38 and/or an amino acid sequence of SEQ ID NO: 39. In certain embodiments, the polypeptide comprises an amino acid sequence of SEQ ID NO:40 and/or an amino acid sequence of SEQ ID NO:42. In certain embodiments, the polypeptide comprises an amino acid sequence of SEQ ID NO:41 and/or an amino acid sequence of SEQ ID NO:43.
[00221] In certain embodiments, the RSPO-binding agent is an RSPO l-binding agent (e.g., antibody) that competes for specific binding to RSPOl with an antibody that comprises the CDRs of antibody 89M5. In certain embodiments, the RSPO-binding agent is an RSP02-binding agent (e.g., antibody) that competes for specific binding to RSP02 with an antibody that comprises the CDRs of antibody 130M23. In certain embodiments, the RSPO-binding agent is an RSP03-binding agent (e.g., antibody) that competes for specific binding to RSP03 with an antibody that comprises the CDRs of antibody 131R10.
[00222] In certain embodiments, the RSPO-binding agent is an RSPOl-binding agent (e.g., an antibody) that binds the same epitope, or essentially the same epitope on RSPOl, as an antibody that comprises the CDRs of antibody 89M5. In certain embodiments, the RSPO-binding agent is an RSP02-binding agent (e.g., an antibody) that binds the same epitope, or essentially the same epitope on RSP02, as an antibody that comprises the CDRs of antibody 89M5. In certain embodiments, the RSPO-binding agent is an RSP03-binding agent (e.g., an antibody) that binds the same epitope, or essentially the same epitope on RSP03, as an antibody that comprises the CDRs of antibody 131R10.
[00223] In certain embodiments, the RSPO-binding agent is an RSPOl-binding agent (e.g., an antibody) that binds an epitope on RSPO 1 that overlaps with the epitope on RSPO 1 bound by an antibody comprising the CDRs of antibody 89M5. In certain embodiments, the RSPO-binding agent is an RSP02-binding agent (e.g., an antibody) that binds an epitope on RSP02 that overlaps with the
epitope on RSP02 bound by an antibody comprising the CDRs of antibody 130M23. In certain embodiments, the RSPO-binding agent is an RSP03-binding agent (e.g., an antibody) that binds an epitope on RSP03 that overlaps with the epitope on RSP03 bound by an antibody comprising the CDRs of antibody 131R10.
[00224] In certain embodiments of the methods described herein, an RSPO-binding agent (e.g., an antibody) binds at least one human RSPO protein and modulates RSPO activity. In some
embodiments, the RSPO-binding agent is an RSPO antagonist and decreases RSPO activity. In some embodiments, the RSPO-binding agent is an RSPO antagonist and decreases β-catenin activity.
[00225] In certain embodiments, an RSPOl-binding agent (e.g., an antibody) binds human RSPOl and modulates RSPO l activity. In some embodiments, an RSPOl-binding agent is an RSPOl antagonist and decreases RSPOl activity. In some embodiments, an RSPOl-binding agent is an RSPOl antagonist and decreases β-catenin activity. In certain embodiments, an RSP02-binding agent (e.g., an antibody) binds human RSP02 and modulates RSP02 activity. In some embodiments, an RSP02 -binding agent is an RSP02 antagonist and decreases RSP02 activity. In some embodiments, an RSP02-binding agent is an RSP02 antagonist and decreases β-catenin activity. In certain embodiments, an RSP03-binding agent (e.g., an antibody) binds human RSP03 and modulates RSP03 activity. In some embodiments, an RSP03-binding agent is an RSP03 antagonist and decreases RSP03 activity. In some embodiments, an RSP03-binding agent is an RSP03 antagonist and decreases β-catenin activity.
[00226] In certain embodiments, the RSPO-binding agent (e.g., an antibody) is an antagonist of at least one human RSPO protein. In some embodiments, the RSPO-binding agent is an antagonist of at least one RSPO and inhibits RSPO activity. In certain embodiments, the RSPO-binding agent inhibits RSPO activity by at least about 10%, at least about 20%, at least about 30%, at least about 50%, at least about 75%, at least about 90%, or about 100%. In some embodiments, the RSPO-binding agent inhibits activity of one, two, three, or four RSPO proteins. In some embodiments, the RSPO-binding agent inhibits activity of human RSPOl, RSP02, RSP03, and/or RSP04.
[00227] In certain embodiments, the RSPO-binding agent (e.g., antibody) is an antagonist of at least one human RSPO protein. In certain embodiments, the RSPO-binding agent inhibits RSPO signaling by at least about 10%, at least about 20%, at least about 30%, at least about 50%, at least about 75%, at least about 90%, or about 100%. In some embodiments, the RSPO-binding agent inhibits signaling by one, two, three, or four RSPO proteins. In some embodiments, the RSPO-binding agent inhibits signaling of human RSPO l, RSP02, RSP03, and/or RSP04.
[00228] In certain embodiments, the RSPO-binding agent (e.g., antibody) is an antagonist of β-catenin signaling. In certain embodiments, the RSPO-binding agent inhibits β-catenin signaling by at least about 10%, at least about 20%, at least about 30%, at least about 50%, at least about 75%, at least about 90%, or about 100%.
[00229] In certain embodiments, the RSPO-binding agent (e.g., antibody) inhibits binding of at least one RSPO protein to a receptor. In certain embodiments, the RSPO-binding agent inhibits binding of a human RSPO protein to one or more of its receptors. In some embodiments, the RSPO-binding agent inhibits binding of an RSPO protein to at least one LGR protein. In some embodiments, the RSPO-binding agent inhibits binding of an RSPO protein to LGR4 (SEQ ID NO: 53), LGR5 (SEQ ID NO:54), and/or LGR6 (SEQ ID NO:55). In certain embodiments, the inhibition of binding of an RSPO-binding agent to at least one LGR protein is at least about 10%, at least about 25%, at least about 50%, at least about 75%, at least about 90%, or at least about 95%. In certain embodiments, an RSPO-binding agent that inhibits binding of at least one RSPO to at least one LGR protein further inhibits β-catenin signaling.
[00230] In certain embodiments, the RSPO-binding agent (e.g., antibody) blocks binding of at least one RSPO to a receptor. In certain embodiments, the RSPO-binding agent blocks binding of a human RSPO protein to one or more of its receptors. In some embodiments, the RSPO-binding agent blocks binding of an RSPO to at least one LGR protein. In some embodiments, the RSPO-binding agent blocks binding of at least one RSPO protein to LGR4 (SEQ ID NO:53), LGR5 (SEQ ID NO:54), and/or LGR6 (SEQ ID NO:55). In certain embodiments, the blocking of binding of an RSPO-binding agent to at least one LGR protein is at least about 10%, at least about 25%, at least about 50%, at least about 75%, at least about 90%, or at least about 95%. In certain embodiments, an RSPO-binding agent that blocks binding of at least one RSPO protein to at least one LGR protein further inhibits β- catenin signaling.
[00231] In certain embodiments, the RSPO-binding agent (e.g., an antibody) inhibits β-catenin signaling. It is understood that an RSPO-binding agent that inhibits β-catenin signaling can, in certain embodiments, inhibit signaling by one or more receptors in the β-catenin signaling pathway but not necessarily inhibit signaling by all receptors. In certain alternative embodiments, β-catenin signaling by all human receptors can be inhibited. In certain embodiments, β-catenin signaling by one or more receptors selected from the group consisting of LGR4 (SEQ ID NO:53), LGR5 (SEQ ID NO:54), and/or LGR6 (SEQ ID NO:55) is inhibited. In certain embodiments, the inhibition of β-catenin signaling by an RSPO-binding agent is a reduction in the level of β-catenin signaling of at least about 10%, at least about 25%, at least about 50%, at least about 75%, at least about 90%, or at least about 95%.
[00232] In certain embodiments, the RSPO-binding agent (e.g., an antibody) inhibits activation of β- catenin. It is understood that an RSPO-binding agent that inhibits activation of β-catenin can, in certain embodiments, inhibit activation of β-catenin by one or more receptors, but not necessarily inhibit activation of β-catenin by all receptors. In certain alternative embodiments, activation of β- catenin by all human receptors can be inhibited. In certain embodiments, activation of β-catenin by one or more receptors selected from the group consisting of LGR4 (SEQ ID NO:53), LGR5 (SEQ ID
NO:54), and LGR6 (SEQ ID NO:55) is inhibited. In certain embodiments, the inhibition of activation of β-catenin by an RSPO-binding agent is a reduction in the level of activation of β-catenin of at least about 10%, at least about 25%, at least about 50%, at least about 75%, at least about 90%, or at least about 95%.
[00233] In certain embodiments, the RSPO or LGR antagonists are agents that bind one or more human LGR proteins. These agents are referred to herein as "LGR-binding agents". Non-limiting examples of LGR-binding agents can be found in U.S. Patent Nos. 8158758, 8158757, 8802097, and U.S. Patent Publication Nos. 2012/0135422, 2013/0209473, 2014/0044713, each of which are hereby incorporated by reference herein in their entirety for all purposes.
[00234] In some embodiments, the LGR-binding agent binds at least one human LGR protein. In alternative embodiments, the LGR-binding agent binds two or more human LGR proteins. In some embodiments, the LGR-binding agent is an antibody. In some embodiments, the LGR-binding agent inhibits (partially or wholly) the binding of at least one RSPO protein (e.g., RSPOl, RSP02, RSP03, and/or RSP04) to at least one LGR protein (e.g., LGR4, LGR5, and/or LGR6). In certain
embodiments, the LGR-binding agent inhibits RSPO-activated LGR signaling, such as LGR5 signaling. In certain embodiments, the LGR-binding agent inhibits beta-catenin signaling.
[00235] In certain embodiments, an LGR-binding agent is an antibody, for example, an antibody that binds at least one LGR protein. Thus, the LGR-binding agent can be an antibody that specifically binds LGR5. In certain alternative embodiments, the LGR-binding agent is an antibody that specifically binds LGR4 or LGR6.
[00236] In certain embodiments, an LGR-binding agent is an antibody that specifically binds at least one human LGR protein. In certain embodiments, the antibody specifically binds at least one human LGR protein selected from the group consisting of LGR4, LGR5, and LGR6. In certain embodiments, the antibody specifically binds LGR5. In certain embodiments, the antibody specifically binds two or more human LGR proteins selected from the group consisting of LGR4, LGR5, and LGR6. In certain embodiments, the antibody that specifically binds at least one human LGR protein, also inhibits binding of at least one RSPO protein (e.g., RSPO l, RSP02, RSP03, and/or RSP04) to the at least one human LGR protein (e.g., LGR5). In certain embodiments, the antibody that specifically binds at least one human LGR protein is characterized by an ability to inhibit RSPO activation of LGR signaling and/or an ability to inhibit beta-catenin signaling. In certain embodiments, the antibody that specifically binds at least one human LGR protein is characterized by the ability to inhibit tumor growth, such as the growth of a solid tumor comprising solid tumor stem cells. For example, in some embodiments, the antibody that specifically binds at least one human LGR protein, disrupts or inhibits RSPO binding to LGR, and inhibits tumor growth. In certain alternative embodiments, the antibody that specifically binds at least one LGR protein, also disrupts RSPO activation of LGR signaling and inhibits tumor growth. In certain alternative embodiments, the antibody that specifically binds at least
one LGR protein, also inhibits RSPO activation of LGR signaling and/or beta-catenin signaling and inhibits tumor growth.
[00237] In certain embodiments, an LGR-binding agent that inhibits binding of an RSPO protein to an LGR protein, inhibits at least about 25%, at least about 50 %, at least about 60%, at least about 70%, at least about 80%, or at least about 90% of the binding of the RSPO protein to an LGR protein in an in vitro or in vivo assay.
[00238] Likewise, in certain embodiments, an LGR-binding agent that inhibits (a) RSPO activation of LGR signaling and/or (b) beta-catenin signaling, inhibits at least about 25%, at least about 50 %, at least about 60%, at least about 70%, at least about 80%, or at least about 90% of the signaling in an in vitro or in vivo assay.
[00239] In certain embodiments, an LGR-binding agent is an isolated antibody that specifically binds to an extracellular domain of a human LGR protein and inhibits growth of a solid tumor comprising solid tumor stem cells. In certain embodiments, the extracellular domain comprises amino acids 22- 564 of human LGR5 (SEQ ID NO:56). In certain embodiments, the antibody is a monoclonal antibody. In certain embodiments, the antibody is a humanized or human antibody.
[00240] In certain embodiments, an LGR-binding agent is an isolated antibody that specifically binds to an extracellular domain of a human LGR protein and disrupts RSPO activation of LGR signaling. In certain embodiments, the extracellular domain comprises amino acids 22-564 of human LGR5 (SEQ ID NO:56). In certain embodiments, the antibody is a monoclonal antibody. In certain embodiments, the antibody is a humanized or human antibody.
[00241] In certain embodiments, an LGR-binding agent is monoclonal anti-LGR5 antibody 88M1. The 88M1 monoclonal antibody is produced by a hybridoma cell line deposited with the American Type Culture collection (ATCC), 10801 University Blvd, Manassas, Virginia, 20110, USA, on July 2, 2008, in accordance with the Budapest Treaty, under ATCC deposit number PTA-9342. In certain embodiments, an LGR-binding agent is an antibody that specifically binds human LGR5 and (a) comprises a heavy chain variable region that has at least about 95% sequence identity (e.g., at least about 98% or about 100% sequence identity) to the heavy chain variable region of 88M1; (b) comprises a light chain variable region that has at least about 95% (e.g., at least about 98% or about 100% sequence identity) sequence identity to the light chain variable region of 88M1; (c) comprises the heavy chain CDRs of 88M1; (d) comprises the light chain CDRs of 88M1; (e) binds to an epitope capable of binding 88M1; and/or (f) competes with 88M1 in a competitive binding assay.
[00242] In certain embodiments, the LGR5 antibody is BNC101. In certain embodiments, an LGR- binding agent is an antibody that specifically binds human LGR5 and (a) comprises a heavy chain variable region that has at least about 95% sequence identity (e.g., at least about 98% or about 100% sequence identity) to the heavy chain variable region of BNC101; (b) comprises a light chain variable region that has at least about 95% (e.g., at least about 98% or about 100% sequence identity) sequence
identity to the light chain variable region of BNC101; (c) comprises the heavy chain CDRs of BNC101; (d) comprises the light chain CDRs of BNC101; (e) binds to an epitope capable of binding BNC101; and/or (f) competes with BNC101 in a competitive binding assay.
[00243] In certain embodiments, the RSPO-binding agent or LGR binding agent is an antibody. In some embodiments, the antibody is a recombinant antibody. In some embodiments, the antibody is a monoclonal antibody. In some embodiments, the antibody is a chimeric antibody. In some embodiments, the antibody is a humanized antibody. In some embodiments, the antibody is a human antibody. In some embodiments, the antibody is an IgA, IgD, IgE, IgG, or IgM antibody. In certain embodiments, the antibody is an IgGl antibody. In certain embodiments, the antibody is an IgG2 antibody. In certain embodiments, the antibody is an antibody fragment comprising an antigen- binding site. In some embodiments, the antibody is a bispecific antibody or a multispecific antibody. In some embodiments, the antibody is a monovalent antibody. In some embodiments, the antibody is a monospecific antibody. In some embodiments, the antibody is a bivalent antibody. In some embodiments, the antibody is conjugated to a cytotoxic moiety. In some embodiments, the antibody is isolated. In some embodiments, the antibody is substantially pure.
[00244] RSPO-binding agents and LGR-binding agents (e.g., antibodies) can be assayed for specific binding by any method known in the art. The immunoassays which can be used include, but are not limited to, competitive and non-competitive assay systems using techniques such as Biacore analysis, FACS analysis, immunofluorescence, immunocytochemistry, Western blot analysis,
radioimmunoassays, ELISAs, "sandwich" immunoassays, immunoprecipitation assays, precipitation reactions, gel diffusion precipitin reactions, immunodiffusion assays, agglutination assays, complement-fixation assays, immunoradiometric assays, fluorescent immunoassays, and protein A immunoassays. Such assays are routine and well-known in the art (see, e.g., Ausubel et al., Editors, 1994-present, Current Protocols in Molecular Biology, John Wiley & Sons, Inc., New York, NY).
[00245] For example, the specific binding of an agent (e.g., RSPO-binding agent and LGR-binding agent) to a human RSPO protein or human LGR protein can be determined using ELISA. An ELISA assay comprises preparing antigen, coating wells of a 96 well microtiter plate with antigen, adding the RSPO-binding agent or LGR-binding agent conjugated to a detectable compound such as an enzymatic substrate (e.g. horseradish peroxidase or alkaline phosphatase) to the well, incubating for a period of time, and detecting the presence of the agent bound to the antigen. In some embodiments, the RSPO-binding agent or LGR-binding agent is not conjugated to a detectable compound, but instead a second antibody that recognizes the RSPO-binding agent or LGR-binding agent (e.g., an anti-Fc antibody) and is conjugated to a detectable compound is added to the well. In some embodiments, instead of coating the well with the antigen, the RSPO-binding agent or LGR-binding agent can be coated to the well and a second antibody conjugated to a detectable compound can be added following the addition of the antigen to the coated well. One of skill in the art would be
knowledgeable as to the parameters that can be modified to increase the signal detected as well as other variations of ELISAs known in the art.
[00246] In another example, the specific binding of an agent (e.g., RSPO-binding agent and LGR- binding agent) to a human RSPO protein or human LGR protein can be determined using FACS. A FACS screening assay can comprise generating a cDNA construct that expresses an antigen (e.g., LGR), optionally as a fusion protein (e.g., RSPO-CD4TM ), transfecting the construct into cells, expressing the antigen on the surface of the cells, mixing the RSPO-binding agent or LGR-binding agent with the transfected cells, and incubating for a period of time. The cells bound by the RSPO- binding agent or LGR-binding agent can be identified using a secondary antibody conjugated to a detectable compound (e.g., PE-conjugated anti-Fc antibody) and a flow cytometer. One of skill in the art would be knowledgeable as to the parameters that can be modified to optimize the signal detected as well as other variations of FACS that can enhance screening (e.g., screening for blocking antibodies).
[00247] The binding affinity of an agent (e.g., RSPO-binding agent and LGR-binding agent) to an antigen and the off-rate of an agent-antigen interaction can be determined by competitive binding assays. One example of a competitive binding assay is a radioimmunoassay comprising the incubation of labeled antigen (e.g., labeled with 3H or 1251), or fragment or variant thereof, with a binding agent of interest in the presence of increasing amounts of unlabeled antigen followed by the detection of the agent bound to the labeled antigen. The affinity of the agent for the antigen and the binding off-rates can be determined from the data by Scatchard plot analysis. In some embodiments, Biacore kinetic analysis is used to determine the binding on and off rates of agents that bind an antigen. In some embodiments, Biacore kinetic analysis comprises analyzing the binding and dissociation of antibodies from chips with immobilized antigen on their surface. In some embodiments, Biacore kinetic analysis comprises analyzing the binding and dissociation of antigen from chips with immobilized binding agent on their surface.
[00248] In vivo and in vitro assays for determining whether an RSPO-binding agent or LGR-binding agent inhibits β-catenin signaling are known in the art. For example, cell-based, luciferase reporter assays utilizing a TCF/Luc reporter vector containing multiple copies of the TCF -binding domain upstream of a firefly luciferase reporter gene can be used to measure β-catenin signaling levels in vitro (Gazit et al., 1999, Oncogene, 18; 5959-66; TOPflash, Millipore, Billerica MA). The level of β- catenin signaling in the presence of one or more Wnts (e.g., Wnt(s) expressed by transfected cells or provided by Wnt-conditioned media) with or without an RSPO protein or RSPO-conditioned media in the presence of an RSPO-binding agent or LGR-binding agent is compared to the level of signaling without the RSPO-binding agent or LGR-binding agent present. In addition to the TCF/Luc reporter assay, the effect of an RSPO-binding agent or LGR-binding agent on β-catenin signaling can be measured in vitro or in vivo by measuring the effect of the agent on the level of expression of β-
catenin-regulated genes, such as c-myc (He et al., 1998, Science, 281 : 1509-12), cyclin Dl (Tetsu et al, 1999, Nature, 398:422-6) and/or fibronectin (Gradl et al. 1999, Mol. Cell Biol., 19:5576-87). In certain embodiments, the effect of an RSPO-binding agent or LGR-binding agent on β-catenin signaling can also be assessed by measuring the effect of the agent on the phosphorylation state of Dishevelled- 1, Dishevelled-2, Dishevelled-3, LRP5, LRP6, and/or β-catenin.
[00249] In some embodiments, the RSPO or LGR antagonists (e.g., RSPO-binding agent and LGR- binding agent) are polyclonal antibodies. Polyclonal antibodies can be prepared by any known method. In some embodiments, polyclonal antibodies are raised by immunizing an animal (e.g., a rabbit, rat, mouse, goat, donkey) by multiple subcutaneous or intraperitoneal injections of the relevant antigen (e.g., a purified peptide fragment, full-length recombinant protein, or fusion protein). The antigen can be optionally conjugated to a carrier such as keyhole limpet hemocyanin (KLH) or serum albumin. The antigen (with or without a carrier protein) is diluted in sterile saline and usually combined with an adjuvant (e.g., Complete or Incomplete Freund's Adjuvant) to form a stable emulsion. After a sufficient period of time, polyclonal antibodies are recovered from blood and/or ascites of the immunized animal. The polyclonal antibodies can be purified from serum or ascites according to standard methods in the art including, but not limited to, affinity chromatography, ion- exchange chromatography, gel electrophoresis, and dialysis.
[00250] In some embodiments, the RSPO or LGR antagonists (e.g., RSPO-binding agent and LGR- binding agent) are monoclonal antibodies. Monoclonal antibodies can be prepared using hybridoma methods known to one of skill in the art. In some embodiments, using the hybridoma method, a mouse, hamster, or other appropriate host animal, is immunized as described above to elicit from lymphocytes the production of antibodies that will specifically bind the immunizing antigen. In some embodiments, lymphocytes can be immunized in vitro. In some embodiments, the immunizing antigen can be a human protein or a portion thereof. In some embodiments, the immunizing antigen can be a mouse protein or a portion thereof.
[00251] Following immunization, lymphocytes are isolated and fused with a suitable myeloma cell line using, for example, polyethylene glycol, to form hybridoma cells that can then be selected away from unfused lymphocytes and myeloma cells. Hybridomas that produce monoclonal antibodies directed specifically against a chosen antigen can be identified by a variety of methods including, but not limited to, immunoprecipitation, immunoblotting, and in vitro binding assay (e.g., flow cytometry, FACS, ELISA, and radioimmunoassay). The hybridomas can be propagated either in in vitro culture using standard methods or in vivo as ascites tumors in an animal. The monoclonal antibodies can be purified from the culture medium or ascites fluid according to standard methods in the art including, but not limited to, affinity chromatography, ion-exchange chromatography, gel electrophoresis, and dialysis.
[00252] In certain embodiments, monoclonal antibodies can be made using recombinant DNA techniques known to one skilled in the art. The polynucleotides encoding a monoclonal antibody are isolated from mature B-cells or hybridoma cells, such as by RT-PCR using oligonucleotide primers that specifically amplify genes encoding the heavy and light chains of the antibody, and their sequence is determined using conventional techniques. The isolated polynucleotides encoding the heavy and light chains are then cloned into suitable expression vectors which produce the monoclonal antibodies when transfected into host cells such as E. coli, simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin proteins. In other embodiments, recombinant monoclonal antibodies, or fragments thereof, can be isolated from phage display libraries.
[00253] The polynucleotide(s) encoding a monoclonal antibody can be further modified in a number of different manners using recombinant DNA technology to generate alternative antibodies. In some embodiments, the constant domains of the light and heavy chains of, for example, a mouse monoclonal antibody can be substituted for those regions of, for example, a human antibody to generate a chimeric antibody, or for a non-immunoglobulin polypeptide to generate a fusion antibody. In some embodiments, the constant regions are truncated or removed to generate the desired antibody fragment of a monoclonal antibody. In some embodiments, site-directed or high-density mutagenesis of the variable region can be used to optimize specificity, affinity, etc. of a monoclonal antibody.
[00254] In some embodiments, the RSPO or LGR antagonist (e.g., RSPO-binding agent and LGR- binding agent) is a humanized antibody. Typically, humanized antibodies are human
immunoglobulins in which residues from the CDRs are replaced by residues from CDRs of a non- human species (e.g., mouse, rat, rabbit, hamster, etc.) that have the desired specificity, affinity, and/or binding capability using methods known to one skilled in the art. In some embodiments, the framework region residues of a human immunoglobulin are replaced with the corresponding residues in an antibody from a non-human species. In some embodiments, the humanized antibody can be further modified by the substitution of additional residues either in the framework region and/or within the replaced non-human residues to refine and optimize antibody specificity, affinity, and/or capability. In general, the humanized antibody will comprise variable domain regions containing all, or substantially all, of the CDRs that correspond to the non-human immunoglobulin whereas all, or substantially all, of the framework regions are those of a human immunoglobulin sequence. In some embodiments, the humanized antibody can also comprise at least a portion of an immunoglobulin constant region or domain (Fc), typically that of a human immunoglobulin. In certain embodiments, such humanized antibodies are used therapeutically because they can reduce antigenicity and HAMA (human anti-mouse antibody) responses when administered to a human subject.
[00255] In certain embodiments, the RSPO or LGR antagonist (e.g., RSPO-binding agent and LGR- binding agent) is a human antibody. Human antibodies can be directly prepared using various
techniques known in the art. In some embodiments, immortalized human B lymphocytes immunized in vitro or isolated from an immunized individual that produces an antibody directed against a target antigen can be generated. In some embodiments, the human antibody can be selected from a phage library, where that phage library expresses human antibodies. Alternatively, phage display technology can be used to produce human antibodies and antibody fragments in vitro, from immunoglobulin variable domain gene repertoires from unimmunized donors. Techniques for the generation and use of antibody phage libraries are well-known in the art and antibody phage libraries are commercially available. Affinity maturation strategies including, but not limited to, chain shuffling and site-directed mutagenesis, are known in the art and can be employed to generate high affinity human antibodies.
[00256] In some embodiments, human antibodies can be made in transgenic mice that contain human immunoglobulin loci. These mice are capable, upon immunization, of producing the full repertoire of human antibodies in the absence of endogenous immunoglobulin production.
[00257] In certain embodiments, the RSPO or LGR antagonist (e.g., RSPO-binding agent and LGR- binding agent) is bispecific antibodies that specifically recognize at least one human RSPO protein or at least one LGR protein. Bispecific antibodies are capable of specifically recognizing and binding at least two different epitopes. The different epitopes can either be within the same molecule (e.g., two different epitopes on human RSP03) or on different molecules (e.g., one epitope on RSP03 and a different epitope on a second protein). In some embodiments, the bispecific antibodies are monoclonal human or humanized antibodies. In some embodiments, the bispecific antibodies are intact antibodies. In some embodiments, the bispecific antibodies are antibody fragments. In certain embodiments, the antibodies are multi specific. In some embodiments, the antibodies can specifically recognize and bind a first antigen target, (e.g., a LGR protein) as well as a second antigen target, such as an effector molecule on a leukocyte (e.g., CD2, CD3, CD28, CD80 or CD86) or a Fc receptor (e.g., CD64, CD32, or CD 16) so as to focus cellular defense mechanisms to the cell expressing the first antigen target. In some embodiments, the antibodies can be used to direct cytotoxic agents to cells which express a particular target antigen. These antibodies possess an antigen-binding arm and an arm which binds a cytotoxic agent or a radionuclide chelator, such as EOTUBE, DPT A, DOTA, or TETA. Techniques for making bispecific or multispecific antibodies are known by those skilled in the art.
[00258] In certain embodiments, the RSPO or LGR antagonist (e.g., RSPO-binding agent and LGR- binding agent) is a monospecific antibody. For example, in certain embodiments, each of the one or more antigen-binding sites that an antibody contains is capable of binding (or binds) a homologous epitope on different proteins.
[00259] In certain embodiments, the RSPO or LGR antagonist is an antibody fragment comprising an antigen-binding site. Antibody fragments can have different functions or capabilities than intact antibodies; for example, antibody fragments can have increased tumor penetration. Various techniques are known for the production of antibody fragments including, but not limited to,
proteolytic digestion of intact antibodies. In some embodiments, antibody fragments include a F(ab')2 fragment produced by pepsin digestion of an antibody molecule. In some embodiments, antibody fragments include a Fab fragment generated by reducing the disulfide bridges of an F(ab')2 fragment. In other embodiments, antibody fragments include a Fab fragment generated by the treatment of the antibody molecule with papain and a reducing agent. In certain embodiments, antibody fragments are produced recombinantly. In some embodiments, antibody fragments include Fv or single chain Fv (scFv) fragments. Fab, Fv, and scFv antibody fragments can be expressed in and secreted from E. coli or other host cells, allowing for the production of large amounts of these fragments. In some embodiments, antibody fragments are isolated from antibody phage libraries as discussed herein. For example, methods can be used for the construction of Fab expression libraries to allow rapid and effective identification of monoclonal Fab fragments with the desired specificity for an RSPO or LGR protein or derivatives, fragments, analogs or homologs thereof. In some embodiments, antibody fragments are linear antibody fragments. In certain embodiments, antibody fragments are
monospecific or bispecific. In certain embodiments, the RSPO or LGR antagonist is a scFv. Various techniques can be used for the production of single-chain antibodies specific to one or more human RSPO proteins or one or more human LGR proteins.
[00260] It can further be desirable, especially in the case of antibody fragments, to modify an antibody in order to increase its serum half-life. This can be achieved, for example, by incorporation of a salvage receptor binding epitope into the antibody fragment by mutation of the appropriate region in the antibody fragment or by incorporating the epitope into a peptide tag that is then fused to the antibody fragment at either end or in the middle (e.g., by DNA or peptide synthesis). In some embodiments, an antibody is modified to decrease its serum half-life.
[00261] In certain embodiments, the RSPO or LGR antagonist is a heteroconjugate antibody.
Heteroconjugate antibodies are composed of two covalently joined antibodies. Such antibodies have, for example, been proposed to target immune cells to unwanted cells. It is also contemplated that the heteroconjugate antibodies can be prepared in vitro using known methods in synthetic protein chemistry, including those involving crosslinking agents. For example, immunotoxins can be constructed using a disulfide exchange reaction or by forming a thioether bond. Examples of suitable reagents for this purpose include iminothiolate and methyl -4-mercaptobutyrimidate.
[00262] It should be appreciated that modified antibodies can comprise any type of variable region that provides for the association of the antibody with the target (i.e., a human RSPO protein or a human LGR protein). In this regard, the variable region can comprise or be derived from any type of mammal that can be induced to mount a humoral response and generate immunoglobulins against the desired tumor-associated antigen. As such, the variable region of the modified antibodies can be, for example, of human, murine, non-human primate (e.g. cynomolgus monkeys, macaques, etc.) or rabbit origin. In some embodiments, both the variable and constant regions of the modified
immunoglobulins are human. In other embodiments, the variable regions of compatible antibodies (usually derived from a non-human source) can be engineered or specifically tailored to improve the binding properties or reduce the immunogenicity of the molecule. In this respect, variable regions can be humanized or otherwise altered through the inclusion of imported amino acid sequences.
[00263] In certain embodiments, the variable domains in both the heavy and light chains are altered by at least partial replacement of one or more CDRs and, if necessary, by partial framework region replacement and sequence modification and/or alteration. Although the CDRs can be derived from an antibody of the same class or even subclass as the antibody from which the framework regions are derived, it is envisaged that the CDRs will be derived preferably from an antibody from a different species. It may not be necessary to replace all of the CDRs with all of the CDRs from the donor variable region to transfer the antigen binding capacity of one variable domain to another. Rather, it can only be necessary to transfer those residues that are necessary to maintain the activity of the antigen-binding site.
[00264] Alterations to the variable region notwithstanding, those skilled in the art will appreciate that the modified antibodies will comprise antibodies (e.g., full-length antibodies or immunoreactive fragments thereof) in which at least a fraction of one or more of the constant region domains has been deleted or otherwise altered so as to provide desired biochemical characteristics such as increased tumor localization and/or increased serum half-life when compared with an antibody of approximately the same immunogenicity comprising a native or unaltered constant region. In some embodiments, the constant region of the modified antibodies will comprise a human constant region. Modifications to the constant region comprise additions, deletions or substitutions of one or more amino acids in one or more domains. The modified antibodies disclosed herein can comprise alterations or modifications to one or more of the three heavy chain constant domains (CHI, CH2 or CH3) and/or to the light chain constant domain (CL). In some embodiments, one or more domains are partially or entirely deleted from the constant regions of the modified antibodies. In some embodiments, the modified antibodies will comprise domain deleted constructs or variants wherein the entire CH2 domain has been removed (ACH2 constructs). In some embodiments, the omitted constant region domain is replaced by a short amino acid spacer (e.g., 10 amino acid residues) that provides some of the molecular flexibility typically imparted by the absent constant region.
[00265] In some embodiments, the modified antibodies are engineered to fuse the CH3 domain directly to the hinge region of the antibody. In other embodiments, a peptide spacer is inserted between the hinge region and the modified CH2 and/or CH3 domains. For example, constructs can be expressed wherein the CH2 domain has been deleted and the remaining CH3 domain (modified or unmodified) is joined to the hinge region with a 5-20 amino acid spacer. Such a spacer can be added to ensure that the regulatory elements of the constant domain remain free and accessible or that the hinge region remains flexible. However, it should be noted that amino acid spacers can, in some
cases, prove to be immunogenic and elicit an unwanted immune response against the construct.
Accordingly, in certain embodiments, any spacer added to the construct will be relatively non- immunogenic so as to maintain the desired biological qualities of the modified antibodies.
[00266] In some embodiments, the modified antibodies can have only a partial deletion of a constant domain or substitution of a few or even a single amino acid. For example, the mutation of a single amino acid in selected areas of the CH2 domain can be enough to substantially reduce Fc binding and thereby increase cancer cell localization and/or tumor penetration. Similarly, it can be desirable to simply delete the part of one or more constant region domains that control a specific effector function (e.g. complement C lq binding). Such partial deletions of the constant regions can improve selected characteristics of the antibody (serum half-life) while leaving other desirable functions associated with the subject constant region domain intact. Moreover, as alluded to above, the constant regions of the disclosed antibodies can be modified through the mutation or substitution of one or more amino acids that enhances the profile of the resulting construct. In this respect it can be possible to disrupt the activity provided by a conserved binding site (e.g., Fc binding) while substantially maintaining the configuration and immunogenic profile of the modified antibody. In certain embodiments, the modified antibodies comprise the addition of one or more amino acids to the constant region to enhance desirable characteristics such as decreasing or increasing effector function or provide for more cytotoxin or carbohydrate attachment sites.
[00267] It is known in the art that the constant region mediates several effector functions. For example, binding of the CI component of complement to the Fc region of IgG or IgM antibodies (bound to antigen) activates the complement system. Activation of complement is important in the opsonization and lysis of cell pathogens. The activation of complement also stimulates the inflammatory response and can also be involved in autoimmune hypersensitivity. In addition, the Fc region of an antibody can bind a cell expressing a Fc receptor (FcR). There are a number of Fc receptors which are specific for different classes of antibody, including IgG (gamma receptors), IgE (epsilon receptors), IgA (alpha receptors) and IgM (mu receptors). Binding of antibody to Fc receptors on cell surfaces triggers a number of important and diverse biological responses including engulfment and destruction of antibody-coated particles, clearance of immune complexes, lysis of antibody-coated target cells by killer cells, release of inflammatory mediators, placental transfer, and control of immunoglobulin production.
[00268] In certain embodiments, the RSPO or LGR antagonists are antibodies that provide for altered effector functions. These altered effector functions can affect the biological profile of the
administered antibody. For example, in some embodiments, the deletion or inactivation (through point mutations or other means) of a constant region domain can reduce Fc receptor binding of the circulating modified antibody (e.g., anti-RSPO antibody) thereby increasing cancer cell localization and/or tumor penetration. In other embodiments, the constant region modifications increase or reduce
the serum half-life of the antibody. In some embodiments, the constant region is modified to eliminate disulfide linkages or oligosaccharide moieties. Modifications to the constant region can easily be made using well known biochemical or molecular engineering techniques well within the purview of the skilled artisan.
[00269] In certain embodiments, an RSPO or LGR antagonist is an antibody that does not have one or more effector functions. For instance, in some embodiments, the antibody has no ADCC activity, and/or no CDC activity. In certain embodiments, the antibody does not bind an Fc receptor, and/or complement factors. In certain embodiments, the antibody has no effector function.
[00270] Variants and equivalents which are substantially homologous to the chimeric, humanized, and human antibodies, or antibody fragments thereof, set forth herein can also be used in the methods described herein. These can contain, for example, conservative substitution mutations.
[00271] In certain embodiments, the antibodies described herein are isolated. In certain embodiments, the antibodies described herein are substantially pure.
[00272] In certain embodiments, the RSPO-binding agent is a soluble receptor. In some embodiments, the RSPO or LGR antagonist is a soluble receptor. In certain embodiments, the soluble receptor comprises the extracellular domain of an LGR protein or fragment of the extracellular domain of an LGR protein. In certain embodiments, the LGR protein is LGR5. For example, in some embodiments, the RSPO-binding agent is a fusion protein comprising a fragment of the LGR5 receptor and the Fc portion of an antibody.
[00273] In certain embodiments, the RSPO-binding agent is a soluble receptor comprising an extracellular domain of a human LGR protein that inhibits growth of a solid tumor comprising solid tumor stem cells. In certain embodiments, the extracellular domain comprises amino acids 22-564 of human LGR5 (SEQ ID NO: 56). In certain embodiments, the extracellular domain of human LGR5 is linked in-frame to a non-LGR protein sequence. In certain embodiments, the non-LGR protein is human Fc.
[00274] In certain embodiments, the RSPO-binding agent is a soluble receptor comprising an extracellular domain of a human LGR protein that inhibits RSPO activation of LGR signaling. In certain embodiments, the extracellular domain comprises amino acids 22-564 of human LGR5 (SEQ ID NO: 56). In certain embodiments, the extracellular domain of human LGR5 is linked in-frame to a non-LGR protein sequence. In certain embodiments, the non-LGR protein is human Fc. Non-limiting examples of soluble LGR receptors can be found in can be found in in U.S. Patent Nos. 8158758, and 8158757, each of which are hereby incorporated by reference herein in their entirety for all purposes.
[00275] In certain embodiments, the RSPO-binding agent is a soluble receptor comprising an extracellular domain of a human LGR protein that inhibits growth of a solid tumor comprising solid tumor stem cells. In certain embodiments, the extracellular domain comprises amino acids 22-564 of human LGR5 (SEQ ID NO: 56). In certain embodiments, the extracellular domain of human LGR5 is
linked in-frame to a non-LGR protein sequence. In certain embodiments, the non-LGR protein is human Fc.
[00276] In certain embodiments, the soluble receptor comprises a variant of the aforementioned extracellular domain of a human LGR protein that comprises one or more (e.g., one, two, three, four, five, six, seven, eight, nine, ten, etc.) conservative substitutions and is capable of binding RSPO protein(s).
[00277] In certain embodiments, the soluble receptor, such as an agent comprising an extracellular domain of a human LGR protein, further comprises a non-LGR (e.g., heterologous) polypeptide. In some embodiments, a soluble receptor can include a LGR ECD linked to other non-LGR functional and structural polypeptides including, but not limited to, a human Fc region, at least one protein tag (e.g., myc, FLAG, GST, GFP), other endogenous proteins or protein fragments, or any other useful protein sequence including any linker region between a LGR ECD and a second polypeptide. In certain embodiments, the non-LGR polypeptide comprises a human Fc region. The Fc region can be obtained from any of the classes of immunoglobulin, IgG, IgA, IgM, IgD and IgE. In some embodiments, the Fc region is a human IgGl Fc region. In some embodiments, the Fc region is a human IgG2 Fc region. In some embodiments, the Fc region is a wild-type Fc region. In some embodiments, the Fc region is a mutated Fc region. In some embodiments, the Fc region is truncated at the N-terminal end by 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acids, (e.g., in the hinge domain). In some embodiments, an amino acid in the hinge domain is changed to hinder undesirable disulfide bond formation. In some embodiments, a cysteine is replaced with a serine to hinder undesirable disulfide bond formation. In some embodiments, the Fc region is truncated at the C-terminal end by 1, 2, 3, or more amino acids. In some embodiments, the Fc region is truncated at the C-terminal end by 1 amino acid. In certain embodiments, the non-LGR polypeptide comprises SEQ ID NO:58, SEQ ID NO:59, SEQ ID NO:60, SEQ ID NO:61, or SEQ ID NO:62. In certain embodiments, the non-LGR polypeptide consists essentially of SEQ ID NO:58, SEQ ID NO:59, SEQ ID NO:60, SEQ ID NO:61, or SEQ ID NO: 62. In certain embodiments, the non-LGR polypeptide comprises SEQ ID NO:61. In certain embodiments, the non-LGR polypeptide consists essentially of SEQ ID NO:61.
[00278] In certain embodiments, a soluble receptor is a fusion protein comprising an extracellular domain of an LGR polypeptide capable of binding an RSPO protein and a Fc region. As used herein, a "fusion protein" is a hybrid protein expressed by a nucleic acid molecule comprising nucleotide sequences of at least two genes. In some embodiments, the C-terminus of the first polypeptide is linked to the N-terminus of the immunoglobulin Fc region. In some embodiments, the first polypeptide (e.g., an extracellular domain of an LGR polypeptide) is directly linked to the Fc region (i.e. without an intervening peptide linker). In some embodiments, the first polypeptide is linked to the Fc region via a linker.
[00279] As used herein, the term "linker" refers to a linker inserted between a first polypeptide (e.g., a LGR component) and a second polypeptide (e.g., a Fc region). In some embodiments, the linker is a peptide linker. Linkers should not adversely affect the expression, secretion, or bioactivity of the polypeptide. Linkers should not be antigenic and should not elicit an immune response. Suitable linkers are known to those of skill in the art and often include mixtures of glycine and serine residues and often include amino acids that are sterically unhindered. Other amino acids that can be incorporated into useful linkers include threonine and alanine residues. Linkers can range in length, for example from 1-50 amino acids in length, 1-22 amino acids in length, 1-10 amino acids in length, 1-5 amino acids in length, or 1-3 amino acids in length. As used herein, a "linker" is an intervening peptide sequence that does not include amino acid residues from either the C-terminus of the first polypeptide (e.g., LGR component) or the N-terminus of the second polypeptide (e.g., a Fc region).
[00280] LGR proteins contain a signal sequence that directs the transport of the proteins. Signal sequences (also referred to as signal peptides or leader sequences) are generally located at the N- terminus of nascent polypeptides (e.g., amino acids 1-21 of human LGR5 (SEQ ID NO:54)). They target the polypeptide to the endoplasmic reticulum and the proteins are sorted to their destinations, for example, to the inner space of an organelle, to an interior membrane, to the cell outer membrane, or to the cell exterior via secretion. Most signal sequences are cleaved from the protein by a signal peptidase after the proteins are transported to the endoplasmic reticulum. The cleavage of the signal sequence from the polypeptide usually occurs at a specific site in the amino acid sequence and is dependent upon amino acid residues within the signal sequence . Although there is usually one specific cleavage site, more than one cleavage site can be recognized and/or used by a signal peptidase resulting in a non-homogenous N-terminus of the polypeptide. For example, the use of different cleavage sites within a signal sequence can result in a polypeptide expressed with different N-terminal amino acids. Accordingly, in some embodiments, the polypeptides as described herein can comprise a mixture of polypeptides with different N-termini. In some embodiments, the N-termini differ in length by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more amino acids. In some embodiments, the N-termini differ in length by 1, 2, 3, 4, or 5 amino acids. In some embodiments, the polypeptide is substantially homogeneous, i.e., the polypeptides have the same N-terminus. In some embodiments, the signal sequence of the polypeptide comprises one or more (e.g., one, two, three, four, five, six, seven, eight, nine, ten, etc.) amino acid substitutions and/or deletions. In some embodiments, the signal sequence of the polypeptide comprises amino acid substitutions and/or deletions that allow one cleavage site to be dominant, thereby resulting in a substantially homogeneous polypeptide with one N-terminus.
[00281] In certain embodiments, an RSPO-binding agent (e.g., soluble receptor) comprises a Fc region of an immunoglobulin. Those skilled in the art will appreciate that some of the binding agents will comprise fusion proteins in which at least a portion of the Fc region has been deleted or otherwise altered so as to provide desired biochemical characteristics, such as increased cancer cell localization,
increased tumor penetration, reduced serum half-life, or increased serum half-life, when compared with a fusion protein of approximately the same immunogenicity comprising a native or unaltered constant region. Modifications to the Fc region can include additions, deletions, or substitutions of one or more amino acids in one or more domains. The modified fusion proteins disclosed herein can comprise alterations or modifications to one or more of the two heavy chain constant domains (CH2 or CH3) or to the hinge region. In other embodiments, the entire CH2 domain can be removed (ACH2 constructs). In some embodiments, the omitted constant region domain is replaced by a short amino acid spacer (e.g., 10 residues) that provides some of the molecular flexibility typically imparted by the absent constant region domain.
[00282] In some embodiments, the modified fusion proteins are engineered to link the CH3 domain directly to the hinge region. In other embodiments, a peptide spacer is inserted between the hinge region and the modified CH2 and/or CH3 domains. For example, constructs can be expressed wherein the CH2 domain has been deleted and the remaining CH3 domain (modified or unmodified) is joined to the hinge region with a 5-20 amino acid spacer. Such a spacer can be added to ensure that the regulatory elements of the constant domain remain free and accessible or that the hinge region remains flexible. However, it should be noted that amino acid spacers can, in some cases, prove to be immunogenic and elicit an unwanted immune response against the construct. Accordingly, in certain embodiments, any spacer added to the construct will be relatively non-immunogenic so as to maintain the desired biological qualities of the fusion protein.
[00283] In some embodiments, the modified fusion proteins can have only a partial deletion of a constant domain or substitution of a few or even a single amino acid. For example, the mutation of a single amino acid in selected areas of the CH2 domain can be enough to substantially reduce Fc binding and thereby increase cancer cell localization and/or tumor penetration. Similarly, it can be desirable to simply delete that part of one or more constant region domains that control a specific effector function (e.g., complement Clq binding). Such partial deletions of the constant regions can improve selected characteristics of the binding agent (e.g., serum half-life) while leaving other desirable functions associated with the subject constant region domain intact. Moreover, as alluded to above, the constant regions of the disclosed fusion proteins can be modified through the mutation or substitution of one or more amino acids that enhances the profile of the resulting construct. In this respect it can be possible to disrupt the activity provided by a conserved binding site (e.g., Fc binding) while substantially maintaining the configuration and immunogenic profile of the modified fusion protein. In certain embodiments, the modified fusion proteins comprise the addition of one or more amino acids to the constant region to enhance desirable characteristics such as decreasing or increasing effector function, or provide for more cytotoxin or carbohydrate attachment sites.
[00284] It is known in the art that the constant region mediates several effector functions. For example, binding of the CI component of complement to the Fc region of IgG or IgM antibodies
(bound to antigen) activates the complement system. Activation of complement is important in the opsonization and lysis of cell pathogens. The activation of complement also stimulates the inflammatory response and can also be involved in autoimmune hypersensitivity. In addition, the Fc region of an immunoglobulin can bind to a cell expressing a Fc receptor (FcR). There are a number of Fc receptors which are specific for different classes of antibody, including IgG (gamma receptors), IgE (epsilon receptors), IgA (alpha receptors) and IgM (mu receptors). Binding of antibody to Fc receptors on cell surfaces triggers a number of important and diverse biological responses including engulfment and destruction of antibody-coated particles, clearance of immune complexes, lysis of antibody-coated target cells by killer cells, release of inflammatory mediators, placental transfer, and control of immunoglobulin production.
[00285] In some embodiments, the modified fusion proteins provide for altered effector functions that, in turn, affect the biological profile of the administered agent. For example, in some embodiments, the deletion or inactivation (through point mutations or other means) of a constant region domain can reduce Fc receptor binding of the circulating modified agent, thereby increasing cancer cell localization and/or tumor penetration. In other embodiments, the constant region modifications increase or reduce the serum half-life of the agent. In some embodiments, the constant region is modified to eliminate disulfide linkages or oligosaccharide moieties.
[00286] In certain embodiments, a modified fusion protein does not have one or more effector functions normally associated with an Fc region. In some embodiments, the agent has no antibody- dependent cell-mediated cytotoxicity (ADCC) activity, and/or no complement-dependent cytotoxicity (CDC) activity. In certain embodiments, the agent does not bind to the Fc receptor and/or complement factors. In certain embodiments, the agent has no effector function.
[00287] In some embodiments, the RSPO-binding agent (e.g., a soluble receptor) described herein is modified to reduce immunogenicity. In general, immune responses against completely normal human proteins are rare when these proteins are used as therapeutics. However, although many fusion proteins comprise polypeptides sequences that are the same as the sequences found in nature, several therapeutic fusion proteins have been shown to be immunogenic in mammals. In some studies, a fusion protein comprising a linker has been found to be more immunogenic than a fusion protein that does not contain a linker. Accordingly, in some embodiments, the polypeptides are analyzed by computation methods to predict immunogenicity. In some embodiments, the polypeptides are analyzed for the presence of T-cell and/or B-cell epitopes. If any T-cell or B-cell epitopes are identified and/or predicted, modifications to these regions (e.g., amino acid substitutions) can be made to disrupt or destroy the epitopes. Various algorithms and software that can be used to predict T-cell and/or B-cell epitopes are known in the art. For example, the software programs SYFPEITHI, HLA Bind, PEPVAC, RANKPEP, DiscoTope, ElliPro, and Antibody Epitope Prediction are all publicly available.
[00288] In some embodiments, the RSPO or LGR antagonists are polypeptides. The polypeptides can be recombinant polypeptides, natural polypeptides, or synthetic polypeptides comprising an antibody, or fragment thereof, that bind at least one human RSPO protein or at least one LGR protein. It will be recognized in the art that some amino acid sequences can be varied without significant effect on the structure or function of the protein. Thus, the methods described herein further encompass using variations of the polypeptides which show substantial activity or which include regions of an antibody, or fragment thereof, against a human RSPO protein or a LGR protein. In some
embodiments, amino acid sequence variations of RSPO -binding polypeptides or LGR-binding polypeptides can include deletions, insertions, inversions, repeats, and/or other types of substitutions.
[00289] The polypeptides, analogs and variants thereof, can be further modified to contain additional chemical moieties not normally part of the polypeptide. The derivatized moieties can improve the solubility, the biological half-life, and/or absorption of the polypeptide. The moieties can also reduce or eliminate any undesirable side effects of the polypeptides and variants. An overview for chemical moieties can be found in Remington: The Science and Practice of Pharmacy, 22st Edition, 2012, Pharmaceutical Press, London.
[00290] Many proteins, including antibodies and soluble receptors, contain a signal sequence that directs the transport of the proteins to various locations. Signal sequences (also referred to as signal peptides or leader sequences) are located at the N-terminus of nascent polypeptides. They target the polypeptide to the endoplasmic reticulum and the proteins are sorted to their destinations, for example, to the inner space of an organelle, to an interior membrane, to the cell's outer membrane, or to the cell exterior via secretion. Most signal sequences are cleaved from the protein by a signal peptidase after the proteins are transported to the endoplasmic reticulum. The cleavage of the signal sequence from the polypeptide usually occurs at a specific site in the amino acid sequence and is dependent upon amino acid residues within the signal sequence. Although there is usually one specific cleavage site, more than one cleavage site can be recognized and/or can be used by a signal peptidase resulting in a non-homogenous N-terminus of the polypeptide. For example, the use of different cleavage sites within a signal sequence can result in a polypeptide expressed with different N-terminal amino acids. Accordingly, in some embodiments, the polypeptides as described herein can comprise a mixture of polypeptides with different N-termini. In some embodiments, the N-termini differ in length by 1, 2, 3, 4, or 5 amino acids. In some embodiments, the polypeptide is substantially homogeneous, i.e., the polypeptides have the same N-terminus. In some embodiments, the signal sequence of the polypeptide comprises one or more (e.g., one, two, three, four, five, six, seven, eight, nine, ten, etc.) amino acid substitutions and/or deletions as compared to a "native" or "parental" signal sequence. In some embodiments, the signal sequence of the polypeptide comprises amino acid substitutions and/or deletions that allow one cleavage site to be dominant, thereby resulting in a substantially
homogeneous polypeptide with one N-terminus. In some embodiments, a signal sequence of the
polypeptide affects the expression level of the polypeptide, e.g., increased expression or decreased expression.
[00291] The isolated polypeptides described herein can be produced by any suitable method known in the art. Such methods range from direct protein synthesis methods to constructing a DNA sequence encoding polypeptide sequences and expressing those sequences in a suitable host. In some embodiments, a DNA sequence is constructed using recombinant technology by isolating or synthesizing a DNA sequence encoding a wild-type protein of interest. Optionally, the sequence can be mutagenized by site-specific mutagenesis to provide functional analogs thereof.
[00292] In some embodiments, a DNA sequence encoding a polypeptide of interest can be constructed by chemical synthesis using an oligonucleotide synthesizer. Oligonucleotides can be designed based on the amino acid sequence of the desired polypeptide and selecting those codons that are favored in the host cell in which the recombinant polypeptide of interest will be produced. Standard methods can be applied to synthesize a polynucleotide sequence encoding an isolated polypeptide of interest. For example, a complete amino acid sequence can be used to construct a back-translated gene. Further, a DNA oligomer containing a nucleotide sequence coding for the particular isolated polypeptide can be synthesized. For example, several small oligonucleotides coding for portions of the desired polypeptide can be synthesized and then ligated. The individual oligonucleotides typically contain 5' or 3' overhangs for complementary assembly.
[00293] Once assembled (by synthesis, site-directed mutagenesis, or another method), the polynucleotide sequences encoding a particular polypeptide of interest can be inserted into an expression vector and operatively linked to an expression control sequence appropriate for expression of the protein in a desired host. Proper assembly can be confirmed by nucleotide sequencing, restriction enzyme mapping, and/or expression of a biologically active polypeptide in a suitable host. As is well-known in the art, in order to obtain high expression levels of a transfected gene in a host, the gene must be operatively linked to transcriptional and translational expression control sequences that are functional in the chosen expression host.
[00294] Recombinant expression vectors can be used to amplify and express DNA encoding agents (e.g., antibodies or soluble receptors), or fragments thereof, which bind a human RSPO protein or a human LGR protein. For example, recombinant expression vectors can be replicable DNA constructs which have synthetic or cDNA -derived DNA fragments encoding a polypeptide chain of an RSPO- binding agent, a LGR-binding agent, an anti-RSPO antibody or fragment thereof, an anti-LGR antibody or fragment thereof, or a LGR-Fc soluble receptor operatively linked to suitable transcriptional and/or translational regulatory elements derived from mammalian, microbial, viral or insect genes. A transcriptional unit generally comprises an assembly of (1) a genetic element or elements having a regulatory role in gene expression, for example, transcriptional promoters or enhancers, (2) a structural or coding sequence which is transcribed into mRNA and translated into
protein, and (3) appropriate transcription and translation initiation and termination sequences.
Regulatory elements can include an operator sequence to control transcription. The ability to replicate in a host, usually conferred by an origin of replication, and a selection gene to facilitate recognition of transformants can additionally be incorporated. DNA regions are "operatively linked" when they are functionally related to each other. For example, DNA for a signal peptide (secretory leader) is operatively linked to DNA for a polypeptide if it is expressed as a precursor which participates in the secretion of the polypeptide; a promoter is operatively linked to a coding sequence if it controls the transcription of the sequence; or a ribosome binding site is operatively linked to a coding sequence if it is positioned so as to permit translation. Structural elements intended for use in yeast expression systems can include a leader sequence enabling extracellular secretion of translated protein by a host yeast cell. Where recombinant protein is expressed without a leader or transport sequence, it can include an N-terminal methionine residue. This residue can optionally be subsequently cleaved from the expressed recombinant protein to provide a final product.
[00295] The choice of an expression control sequence and an expression vector depends upon the choice of host. A wide variety of expression host/vector combinations can be employed. Useful expression vectors for eukaryotic hosts include, for example, vectors comprising expression control sequences from SV40, bovine papilloma virus, adenovirus, and cytomegalovirus. Useful expression vectors for bacterial hosts include known bacterial plasmids, such as plasmids from E. coli, including pCRl, pBR322, pMB9 and their derivatives, and wider host range plasmids, such as M13 and other filamentous single -stranded DNA phages.
[00296] Suitable host cells for expression of an RSPO-binding or LGR-binding agent (or a protein to use as an antigen) include prokaryotes, yeast cells, insect cells, or higher eukaryotic cells. Prokaryotes include gram-negative or gram-positive organisms, for example E. coli or Bacillus. Higher eukaryotic cells include established cell lines of mammalian origin as described below. Cell-free translation systems can also be employed. Appropriate cloning and expression vectors for use with bacterial, fungal, yeast, and mammalian cellular hosts are known to those skilled in the art.
[00297] Various mammalian cell culture systems are used to express recombinant polypeptides. Expression of recombinant proteins in mammalian cells can be preferred because such proteins are generally correctly folded, appropriately modified, and biologically functional. Examples of suitable mammalian host cell lines include COS-7 (monkey kidney-derived), L-929 (murine fibroblast- derived), C127 (murine mammary tumor-derived), 3T3 (murine fibroblast-derived), CHO (Chinese hamster ovary-derived), HeLa (human cervical cancer-derived), BHK (hamster kidney fibroblast- derived), HEK-293 (human embryonic kidney-derived) cell lines and variants thereof. Mammalian expression vectors can comprise non-transcribed elements such as an origin of replication, a suitable promoter and enhancer linked to the gene to be expressed, and other 5' or 3' flanking non -transcribed
sequences, and 5' or 3' non-translated sequences, such as necessary ribosome binding sites, a polyadenylation site, splice donor and acceptor sites, and transcriptional termination sequences.
[00298] Expression of recombinant proteins in insect cell culture systems (e.g., baculovirus) also offers a robust method for producing correctly folded and biologically functional proteins.
Baculovirus systems for production of heterologous proteins in insect cells are well-known to those of skill in the art.
[00299] The proteins produced by a transformed host can be purified according to any suitable method. Standard methods include chromatography (e.g., ion exchange, affinity, and sizing column chromatography), centrifugation, differential solubility, or by any other standard technique for protein purification. Affinity tags such as hexa-histidine, maltose binding domain, influenza coat sequence, and glutathione -S -transferase can be attached to the protein to allow easy purification by passage over an appropriate affinity column. Isolated proteins can also be physically characterized using such techniques as proteolysis, mass spectrometry (MS), nuclear magnetic resonance (NMR), high performance liquid chromatography (HPLC), and x-ray crystallography.
[00300] In some embodiments, supernatants from expression systems which secrete recombinant protein into culture media can be first concentrated using a commercially available protein concentration filter, for example, an Amicon or Millipore Pellicon ultrafiltration unit. Following the concentration step, the concentrate can be applied to a suitable purification matrix. In some embodiments, an anion exchange resin can be employed, for example, a matrix or substrate having pendant diethylaminoethyl (DEAE) groups. The matrices can be acrylamide, agarose, dextran, cellulose, or other types commonly employed in protein purification. In some embodiments, a cation exchange step can be employed. Suitable cation exchangers include various insoluble matrices comprising sulfopropyl or carboxymethyl groups. In some embodiments, a hydroxyapatite media can be employed, including but not limited to, ceramic hydroxyapatite (CHT). In certain embodiments, one or more reverse-phase HPLC steps employing hydrophobic RP-HPLC media, e.g., silica gel having pendant methyl or other aliphatic groups, can be employed to further purify a binding agent. Some or all of the foregoing purification steps, in various combinations, can also be employed to provide a homogeneous recombinant protein.
[00301] In some embodiments, recombinant protein produced in bacterial culture can be isolated, for example, by initial extraction from cell pellets, followed by one or more concentration, salting-out, aqueous ion exchange, or size exclusion chromatography steps. HPLC can be employed for final purification steps. Microbial cells employed in expression of a recombinant protein can be disrupted by any convenient method, including freeze-thaw cycling, sonication, mechanical disruption, or use of cell lysing agents.
[00302] In certain embodiments, the binding agents can be used in any one of a number of conjugated (i.e. an immunoconjugate or radioconjugate) or non-conjugated forms. In certain embodiments,
antibodies can be used in a non-conjugated form to harness the subject's natural defense mechanisms including complement-dependent cytotoxicity and antibody dependent cellular toxicity to eliminate the malignant or cancer cells.
[00303] In some embodiments, the binding agent is conjugated to a cytotoxic agent. In some embodiments, the cytotoxic agent is a chemotherapeutic agent including, but not limited to, methotrexate, adriamicin, doxorubicin, melphalan, mitomycin C, chlorambucil, daunorubicin or other intercalating agents. In some embodiments, the cytotoxic agent is an enzymatically active toxin of bacterial, fungal, plant, or animal origin, or fragments thereof, including, but not limited to, diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain, ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAPII, and PAP-S), Momordica charantia inhibitor, curcin, crotin, Sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin, and the tricothecenes. In some embodiments, the cytotoxic agent is a radioisotope to produce a radioconjugate or a radioconjugated antibody. A variety of radionuclides are available for the production of radioconjugated antibodies including, but not limited to, 90Y, 1251, 1311, 1231, l l lln, 131In, 105Rh, 153Sm, 67Cu, 67Ga, 166Ho, 177Lu, 186Re, 188Re and 212BL In some embodiments, conjugates of an antibody and one or more small molecule toxins, such as a calicheamicin, maytansinoids, a trichothene, and CC1065, and the derivatives of these toxins that have toxin activity, can be produced. In certain embodiments, conjugates of an antibody and a cytotoxic agent are made using a variety of bifunctional protein-coupling agents such as N-succinimidyl-3-(2-pyridyidithiol) propionate (SPDP), iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipimidate HCL), active esters (such as disuccinimidyl suberate), aldehydes (such as glutareldehyde), bis-azido compounds (such as bis(p-azidobenzoyl) hexanediamine), bis-diazonium derivatives (such as bis-(p- diazoniumbenzoyl)-ethylenediamine), diisocyanates (such as toluene 2,6-diisocyanate), and bis-active fluorine compounds (such as l,5-difluoro-2,4-dinitrobenzene).
[00304] In certain embodiments, the RSPO or LGR antagonist (e.g., antibody or soluble receptor) is an antagonist of at least one RSPO protein (i.e., 1, 2, 3, or 4 RSPO proteins). In certain embodiments, the RSPO or LGR antagonist inhibits activity of the RSPO protein(s) to which it binds. In certain embodiments, the RSPO or LGR antagonist inhibits at least about 10%, at least about 20%, at least about 30%, at least about 50%, at least about 75%, at least about 90%, or about 100% of the activity of the human RSPO protein(s) to which it binds. In certain embodiments, the RSPO or LGR antagonist inhibits activity of RSP03.
[00305] In certain embodiments, the RSPO or LGR antagonist (e.g., antibody or soluble receptor) inhibits binding of at least one human RSPO to an appropriate receptor. In certain embodiments, the RSPO or LGR antagonist inhibits binding of at least one human RSPO protein to one or more human LGR proteins. In some embodiments, the at least one RSPO protein is selected from the group
consisting of: RSPO l, RSP02, RSP03, and RSP04. In some embodiments, the at least one RSPO protein is RSP03. In some embodiments, the one or more human LGR proteins are selected from the group consisting of: LGR4, LGR5, and LGR6. In certain embodiments, the RSPO or LGR antagonist inhibits binding of one or more RSPO proteins to LGR4, LGR5, and/or LGR6. In certain
embodiments, the inhibition of binding of a particular RSPO to a LGR protein by an RSPO or LGR antagonist is at least about 10%, at least about 25%, at least about 50%, at least about 75%, at least about 90%, or at least about 95%. In certain embodiments, an RSPO or LGR antagonist is an antibody, for example, an anti-RSPO antibody such as an anti-RSP03 antibody. In certain embodiments, an RSPO or LGR antagonist is 131R10. In certain embodiments, an RSPO or LGR antagonist is an antibody comprising the 6 CDRs of 131R10. In certain embodiments, an RSPO or LGR antagonist an anti-LGR antibody. In certain embodiments, an RSPO or LGR antagonist is a LGR-Fc soluble receptor. In certain embodiments, an RSPO or LGR antagonist is a LGR5-Fc soluble receptor. In certain embodiments, the LGR5-Fc soluble receptor comprises amino acid sequence of SEQ ID NO:57.
[00306] In certain embodiments, the RSPO or LGR antagonists (e.g., antibody or soluble receptor) described herein are antagonists of at least one human RSPO protein and inhibit RSPO activity. In certain embodiments, the RSPO or LGR antagonist inhibits RSPO activity by at least about 10%, at least about 20%, at least about 30%, at least about 50%, at least about 75%, at least about 90%, or about 100%. In some embodiments, the RSPO or LGR antagonist inhibits activity of one, two, three, or four RSPO proteins. In some embodiments, the RSPO or LGR antagonist inhibits activity of at least one human RSPO protein selected from the group consisting of: RSPOl, RSP02, RSP03, and RSP04. In some embodiments, the RSPO-binding agent binds at least RSP03. In certain
embodiments, an RSPO or LGR antagonist that inhibits human RSPO activity is an antibody. In certain embodiments, an RSPO or LGR antagonist that inhibits human RSPO activity is an anti-RSPO antibody. In certain embodiments, an RSPO or LGR antagonist that inhibits human RSPO activity is an anti-RSP03 antibody. In certain embodiments, an RSPO or LGR antagonist that inhibits human RSPO activity is 131R10. In certain embodiments, an RSPO or LGR antagonist that inhibits human RSPO activity is an antibody comprising the 6 CDRs of 131R10. In certain embodiments, an RSPO or LGR antagonist that inhibits human RSPO activity is a LGR-Fc soluble receptor. In certain embodiments, an RSPO or LGR antagonist that inhibits human RSPO activity is a LGR5-Fc soluble receptor. In certain embodiments, the LGR5-Fc soluble receptor comprises amino acid sequence of SEQ ID NO: 57.
[00307] In certain embodiments, the RSPO or LGR antagonist described herein is LGR antagonist of at least one human LGR protein. In some embodiments, the RSPO or LGR antagonist inhibits activity of at least one human LGR protein selected from the group consisting of: LGR4, LGR5, and LGR6. In certain embodiments, the RSPO or LGR antagonist is an LGR5 antagonist. In some embodiments,
the LGR antagonist is an anti-LGR antibody. In certain embodiments, the LGR antagonist is anti- LGR antibody comprising the 3 heavy chain CDRs of 88M1, and/or the 3 light chain CDRs of 88M1. In some embodiments, the anti-LGR antibody comprises the heavy chain variable region of 88M1, and/or the light chain variable region of 88M1. In certain embodiments, the anti-LGR antibody comprises the 3 heavy chain CDRs of BNC101, and/or the 3 light chain CDRs of BNC101. In some embodiments, the anti-LGR antibody comprises the heavy chain variable region of BNC101, and/or the light chain variable region of BNC101.
[00308] In certain embodiments, an RSPO or LGR antagonist described herein is an antagonist of β- catenin signaling. In certain embodiments, the RSPO or LGR antagonist inhibits β-catenin signaling by at least about 10%, at least about 20%, at least about 30%, at least about 50%, at least about 75%, at least about 90%, or about 100%. In certain embodiments, an RSPO or LGR antagonist that inhibits β-catenin signaling is an antibody. In certain embodiments, an RSPO or LGR antagonist that inhibits β-catenin signaling is an anti-RSPO antibody. In certain embodiments, an RSPO or LGR antagonist that inhibits β-catenin signaling is an anti-RSP03 antibody. In certain embodiments, an RSPO or LGR antagonist that inhibits β-catenin signaling is 131R10. In certain embodiments, an RSPO or
LGR antagonist that inhibits β-catenin signaling is an antibody comprising the 6 CDRs of 131R10. In certain embodiments, an RSPO or LGR antagonist that inhibits β-catenin signaling is an anti-LGR antibody. In certain embodiments, the anti-LGR antibody comprises the 3 heavy chain CDRs of 88M1, and/or the 3 light chain CDRs of 88M1. In some embodiments, the anti-LGR antibody comprises the heavy chain variable region of 88M1, and/or the light chain variable region of 88M1. In certain embodiments, the anti-LGR antibody comprises the 3 heavy chain CDRs of BNC101, and/or the 3 light chain CDRs of BNC101. In some embodiments, the anti-LGR antibody comprises the heavy chain variable region of BNC101, and/or the light chain variable region of BNClOl .In certain embodiments, an RSPO or LGR antagonist that inhibits β-catenin signaling is a soluble receptor. In certain embodiments, the soluble receptor is a LGR-Fc soluble receptor. In certain embodiments, the soluble receptor is a LGR5-Fc soluble receptor. In certain embodiments, the LGR5-Fc soluble receptor comprises amino acid sequence of SEQ ID NO:57.
[00309] In certain embodiments, the RSPO or LGR antagonist described herein inhibits binding of at least one RSPO protein to a receptor. In certain embodiments, the RSPO or LGR antagonist inhibits binding of at least one human RSPO protein to one or more of its receptors. In some embodiments, the RSPO or LGR antagonist inhibits binding of at least one RSPO protein to at least one LGR protein. In some embodiments, the RSPO-binding agent inhibits binding of at least one RSPO protein to LGR4, LGR5, and/or LGR6. In certain embodiments, the inhibition of binding of at least one RSPO to at least one LGR protein is at least about 10%, at least about 25%, at least about 50%, at least about 75%, at least about 90%, or at least about 95%. In certain embodiments, an RSPO or LGR antagonist that inhibits binding of at least one RSPO to at least one LGR protein further inhibits β-
catenin signaling. In certain embodiments, an RSPO or LGR antagonist that inhibits binding of at least one human RSPO to at least one LGR protein is an antibody. In certain embodiments, an RSPO or LGR antagonist that inhibits binding of at least one human RSPO to at least one LGR protein is an anti-LGR antibody. In certain embodiments, an RSPO or LGR antagonist that inhibits binding of at least one human RSPO to at least one LGR protein is an anti-LGR antibody comprising the 3 heavy chain CDRs of 88M1, and/or the 3 light chain CDRs of 88M1. In some embodiments, the anti-LGR antibody comprises the heavy chain variable region of 88M1, and/or the light chain variable region of 88M1. In certain embodiments, the anti-LGR antibody comprises the 3 heavy chain CDRs of BNC101, and/or the 3 light chain CDRs of BNC 101. In some embodiments, the anti-LGR antibody comprises the heavy chain variable region of BNC101, and/or the light chain variable region of
BNC101. In certain embodiments, an RSPO or LGR antagonist that inhibits binding of at least one human RSPO to at least one LGR protein is a soluble receptor. In certain embodiments, an RSPO or LGR antagonist that inhibits binding of at least one human RSPO to at least one LGR protein is a LGR-Fc soluble receptor. In certain embodiments, an RSPO or LGR antagonist that inhibits binding of at least one human RSPO to at least one LGR protein is a LGR5-Fc soluble receptor. In certain embodiments, the LGR5-Fc soluble receptor comprises amino acid sequence of SEQ ID NO:57.
[00310] In certain embodiments, the RSPO or LGR antagonist described herein inhibits activation of β-catenin. In certain embodiments, activation of β-catenin by one or more receptors selected from the group consisting of LGR4, LGR5, and LGR6 is inhibited. In certain embodiments, the inhibition of activation of β-catenin by an RSPO-binding agent or LGR-binding agent is a reduction in the level of activation of β-catenin of at least about 10%, at least about 25%, at least about 50%, at least about 75%, at least about 90%, or at least about 95%. In some embodiments, an RSPO or LGR antagonist that inhibits activation of β-catenin is an antibody. In some embodiments, an RSPO or LGR antagonist that inhibits activation of β-catenin is an anti-LGR antibody. In some embodiments, an RSPO or LGR antagonist that inhibits activation of β-catenin is an anti-LGR antibody comprising the 3 heavy chain CDRs of 88M1, and/or the 3 light chain CDRs of 88M1. In some embodiments, the anti-LGR antibody comprises the heavy chain variable region of 88M1, and/or the light chain variable region of 88M1. In certain embodiments, the anti-LGR antibody comprises the 3 heavy chain CDRs of BNC 101, and/or the 3 light chain CDRs of BNC 101. In some embodiments, the anti-LGR antibody comprises the heavy chain variable region of BNC 101, and/or the light chain variable region of
BNC 101. In some embodiments, an RSPO or LGR antagonist that inhibits activation of β-catenin is a soluble receptor. In some embodiments, an RSPO or LGR antagonist that inhibits activation of β- catenin is a LGR-Fc soluble receptor. In some embodiments, an RSPO or LGR antagonist that inhibits activation of β-catenin is a LGR5-Fc soluble receptor. In certain embodiments, the LGR5-Fc soluble receptor comprises amino acid sequence of SEQ ID NO:57.
[00311] In certain embodiments, an RSPO or LGR antagonist has one or more of the following effects: inhibit proliferation of tumor cells, inhibit tumor growth, reduce the frequency of cancer stem cells in a tumor, reduce the tumorigenicity of a tumor, reduce the tumorigenicity of a tumor by reducing the frequency of cancer stem cells in the tumor, trigger cell death of tumor cells, induce cells in a tumor to differentiate, differentiate tumorigenic cells to a non-tumorigenic state, induce expression of differentiation markers in the tumor cells, prevent metastasis of tumor cells, or decrease survival of tumor cells.
[00312] In certain embodiments, an RSPO or LGR antagonist is capable of inhibiting tumor growth. In certain embodiments, an RSPO or LGR antagonist is capable of inhibiting tumor growth in vivo (e.g., in a xenograft mouse model and/or in a human having cancer). In some embodiments, the tumor is a tumor selected from the group consisting of colorectal tumor, colon tumor, pancreatic tumor, lung tumor, ovarian tumor, liver tumor, breast tumor, kidney tumor, prostate tumor, gastrointestinal tumor, melanoma, cervical tumor, bladder tumor, glioblastoma, and head and neck tumor. In certain embodiments, the tumor is a breast tumor. In certain embodiments, the tumor is an ovarian tumor. In certain embodiments, the tumor is a lung tumor. In certain embodiments, the tumor is a pancreatic tumor. In certain embodiments, the tumor is an RSPO-dependent tumor, LGR-dependent tumor, or β- catenin-dependent tumor.
[00313] In certain embodiments, an RSPO or LGR antagonist is capable of reducing the
tumorigenicity of a tumor. In certain embodiments, an RSPO or LGR antagonist is capable of reducing the tumorigenicity of a tumor comprising cancer stem cells in an animal model, such as a mouse xenograft model. In certain embodiments, the number or frequency of cancer stem cells in a tumor is reduced by at least about two-fold, about three-fold, about five-fold, about ten-fold, about 50- fold, about 100-fold, or about 1000-fold. In certain embodiments, the reduction in the number or frequency of cancer stem cells is determined by limiting dilution assay using an animal model.
Additional examples and guidance regarding the use of limiting dilution assays to determine a reduction in the number or frequency of cancer stem cells in a tumor can be found, e.g., in
International Publication Number WO 2008/042236, and U.S. Patent Publication Nos. 2008/0064049, and 2008/0178305, each of which are hereby incorporated by reference herein in their entirety for all purposes.
[00314] In certain embodiments, an RSPO or LGR antagonist is active in vivo for at least 1 hour, at least about 2 hours, at least about 5 hours, at least about 10 hours, at least about 24 hours, at least about 2 days, at least about 3 days, at least about 1 week, or at least about 2 weeks. In certain embodiments, the RSPO or LGR antagonist is an IgG (e.g., IgGl or IgG2) antibody that is active in vivo for at least 1 hour, at least about 2 hours, at least about 5 hours, at least about 10 hours, at least about 24 hours, at least about 2 days, at least about 3 days, at least about 1 week, or at least about 2 weeks. In certain embodiments, the RSPO or LGR antagonist is a fusion protein that is active in vivo
for at least 1 hour, at least about 2 hours, at least about 5 hours, at least about 10 hours, at least about 24 hours, at least about 2 days, at least about 3 days, at least about 1 week, or at least about 2 weeks.
[00315] In certain embodiments, an RSPO or LGR antagonist has a circulating half-life in mice, cynomolgus monkeys, or humans of at least about 5 hours, at least about 10 hours, at least about 24 hours, at least about 2 days, at least about 3 days, at least about 1 week, or at least about 2 weeks. In certain embodiments, the RSPO or LGR antagonist is an IgG (e.g., IgGl or IgG2) antibody that has a circulating half-life in mice, cynomolgus monkeys, or humans of at least about 5 hours, at least about 10 hours, at least about 24 hours, at least about 2 days, at least about 3 days, at least about 1 week, or at least about 2 weeks. In certain embodiments, the RSPO or LGR antagonist is a fusion protein that has a circulating half-life in mice, cynomolgus monkeys, or humans of at least about 5 hours, at least about 10 hours, at least about 24 hours, at least about 2 days, at least about 3 days, at least about 1 week, or at least about 2 weeks. Methods of increasing (or decreasing) the half-life of agents such as polypeptides and antibodies are known in the art. For example, known methods of increasing the circulating half-life of IgG antibodies include the introduction of mutations in the Fc region which increase the pH-dependent binding of the antibody to the neonatal Fc receptor (FcRn). Known methods of increasing the circulating half-life of antibody fragments lacking the Fc region include such techniques as PEGylation.
IV. Immunotherapeutic agents
[00316] The present invention provides RSPO or LGR antagonists for use in combination therapy with immunotherapeutic agents for modulating immune responses, inhibiting tumor growth, and/or for the treatment of cancer. In some embodiments of the methods described herein, a
immunotherapeutic agent is selected from the group consisting of: a modulator of PD-1 activity, a modulator of PD-Ll activity, a modulator of PD-L2 activity, a modulator of CTLA-4 activity, a modulator of CD28 activity, a modulator of CD80 activity, a modulator of CD86 activity, a modulator of 4- IBB activity, an modulator of OX40 activity, a modulator of KIR activity, a modulator of Tim-3 activity, a modulator of LAG3 activity, a modulator of CD27 activity, a modulator of CD40 activity, a modulator of GITR activity, a modulator of TIGIT activity, a modulator of CD20 activity, a modulator of CD96 activity, a modulator of IDOl activity, a cytokine, a chemokine, an interferon, an interleukin, a lymphokine, a member of the tumor necrosis factor (TNF) family, and an
immunostimulatory oligonucleotide.
[00317] In some embodiments, an immunotherapeutic agent is selected from the group consisting of: a PD-1 antagonist, a PD-Ll antagonist, a PD-L2 antagonist, a CTLA-4 antagonist, a CD80 antagonist, a CD86 antagonist, a KIR antagonist, a Tim-3 antagonist, a LAG3 antagonist, a TIGIT antagonist, a CD20 antagonist, a CD96 antagonist, and/or an IDOl antagonist.
[00318] In some embodiments, the PD-1 antagonist is an antibody that specifically binds PD-1. In some embodiments, the antibody that binds PD-1 is Merck (KEYTRUDA, MK-3475; Merck),
pidilizumab (CT-011; Curetech Ltd.), nivolumab (OPDIVO, BMS-936558, MDX-1106; Bristol Myer Squibb), MEDI0680 (AMP-514; AstraZenenca/Medlmmune), REGN2810 (Regeneron
Pharmaceuticals), BGB-A317 (BeiGene Ltd.), PDR-001 (Novartis), or STI-A1110 (Sorrento
Therapeutics). In some embodiments, the antibody that binds PD-1 is described in PCT Publication WO 2014/179664, for example, an antibody identified as APE2058, APE1922, APE1923, APE1924, APE 1950, or APE 1963 (Anaptysbio), or an antibody containing the CDR regions of any of these antibodies. In other embodiments, the PD-1 antagonist is a fusion protein that includes PD-L2, for example, AMP-224 (AstraZeneca/Medlmmune). In other embodiments, the PD-1 antagonist is a peptide inhibitor, for example, AU P-12 (Aurigene).
[00319] In some embodiments, the PD-L1 antagonist is an antibody that specifically binds PD-L1. In some embodiments, the antibody that binds PD-L1 is atezolizumab (RG7446, MPDL3280A;
Genentech), MEDI4736 (AstraZeneca Medlmmune), BMS-936559 (MDX-1105; Bristol Myers Squibb), avelumab (MSB0010718C; Merck KGaA), KD033 (Kadmon), the antibody portion of KD033, or STI-A1014 (Sorrento Therapeutics). In some embodiments, the antibody that binds PD- LI is described in PCT Publication WO 2014/055897, for example, Ab-14, Ab-16, Ab-30, Ab-31, Ab-42, Ab-50, Ab-52, or Ab-55, or an antibody that contains the CDR regions of any of these antibodies.
[00320] In some embodiments, the CTLA-4 antagonist is an antibody that specifically binds CTLA-4. In some embodiments, the antibody that binds CTLA-4 is ipilimumab (YERVOY) or tremelimumab (CP-675,206). In some embodiments, the CTLA-4 antagonist a CTLA-4 fusion protein, for example, KAHR-102 (Kahr Medical Ltd.).
[00321] In some embodiments, the LAG3 antagonist is an antibody that specifically binds LAG3. In some embodimetns, the antibody that binds LAG3 is IMP701 (Prima BioMed), IMP731 (Prima BioMed/GlaxoSmithKline), BMS-986016 (Bristol Myer Squibb), LAG525 (Novartis), and
GSK2831781 (Glaxo SmithKline). In some embodiments, the LAG3 antagonist includes a soluble LAG3 receptor, for example, IMP321 (Prima BioMed).
[00322] In some embodiments, the KIR antagonist is an antibody that specifically binds KIR. In some embodiments, the antibody that binds KIR is lirilumab.
[00323] In some embodiments, an immunotherapeutic agent is selected from the group consisting of: a CD28 agonist, a 4-lBB agonist, an OX40 agonist, a CD27 agonist, a CD80 agonist, a CD86 agonist, a CD40 agonist, and a GITR agonist.
[00324] In some embodiments, the OX40 agonist includes OX40 ligand, or an OX40-binding portion thereof. For example, the OX40 agonist may be MEDI6383 (AstraZeneca). In some embodiments, the OX40 agonist is an antibody that specifically binds OX40. In some embodiments, the antibody that binds OX40 is MEDI6469 (AstraZeneca/Medlmmune), MEDI0562 (AstraZeneca/Medlmmune), or MOXR0916 (RG7888; Genentech). In some embodiments, the OX40 agonist is a vector (e.g., an
expression vector or virus, such as an adenovirus) capable of expressing OX40 ligand. In some embodiments the OX40-expressing vector is Delta-24-RGDOX (DNAtrix) or DNX2401 (DNAtrix).
[00325] In some embodiments, the 4-1BB (CD137) agonist is a binding molecule, such as an anticalin. In some embodiments, the anticalin is PRS-343 (Pieris AG). In some embodiments, the 4- IBB agonist is an antibody that specifically binds 4-1BB. In some embodiments, antibody that binds 4-1BB is PF-2566 (PF-05082566; Pfizer) or urelumab (BMS-663513; Bristol Myer Squibb).
[00326] In some embodiments, the CD27 agonist is an antibody that specifically binds CD27. In some embodiments, the antibody that binds CD27 is varlilumab (CDX-1127; Celldex).
[00327] In some embodiments, the GITR agonist comprises GITR ligand or a GITR-binding portion thereof. In some embodiments, the GITR agonist is an antibody that specifically binds GITR. In some embodiments, the antibody that binds GITR is TRX518 (GITR, Inc.), MK-4166 (Merck), or INBRX-110 (Five Prime Therapeutics/Inhibrx).
[00328] In some embodiments, immunotherapeutic agents include, but are not limited to, cytokines such as chemokines, interferons, interleukins, lymphokines, and members of the tumor necrosis factor (TNF) family. In some embodiments, immunotherapeutic agents include immunostimulatory oligonucleotides, such as CpG dinucleotides.
[00329] In some embodiments, a immunotherapeutic agent includes, but is not limited to, anti-PD-1 antibodies, anti-PD-Ll antibodies, anti-PD-L2 antibodies, anti-CTLA-4 antibodies, anti-CD28 antibodies, anti-CD80 antibodies, anti-CD86 antibodies, anti-4-lBB antibodies, anti-OX40 antibodies, anti-KIR antibodies, anti-Tim-3 antibodies, anti-LAG3 antibodies, anti-CD27 antibodies, anti-CD40 antibodies, anti-GITR antibodies, anti-TIGIT antibodies, anti-CD20 antibodies, anti-CD96 antibodies, or anti-IDO l antibodies.
EXAMPLES
Example 1
Effect of adding anti-RSPO antibodies on immune checkpoint inhibitor therapy in melanoma
[00330] The effect of the anti-RSP03 antibody, 131R10, on melanoma cell line tumor growth was tested animals receiving the combination of anti-CTLA-4 and anti-PD-Ll antibodies. In these experiments, ten thousand B16F1 melanoma cells, which does not express RSP03, were injected subcutaneously into C57BL6J mice. On days 4, 7, and 10 post-implantation, "GVAX" tumor vaccine was administered by the injection of 2 million mitomycin C-treated cells of a B16F1 subclone stably transfected with a plasmid encoding m-GM-CSF (with GM-CSF expression confirmed by ELISA), as previously described by Curran and Allison, Cancer Res 69:7747, 2009. Anti-CTLA-4 clone 9D9 (BioXCell; West Lebanon, NH) was dosed on days 5, 8, and 12. Anti-PD-Ll clone 10F.9G2
(BioXCell) was dosed on days 5, 8, 12, 14, 19, 22, and 26, and either 1B7.11 isotype or 131R10 were administered days 5, 12, 19, and 26 following parental B16F1 cell implantation.
[00331] As shown in Figures 1A-1D, the addition of 131R10 decreased tumor growth as compared to administration of the anti-CTLA-4 and anti-PD-Ll antibodies without 131R10.
Example 2
Effect of adding anti-RSPO antibodies on cytokine secretion during immune checkpoint inhibitor therapy
[00332] Using the ELISpot cytokine secretion assay, secretion of IFN-gamma and IL-2 was measured following 131R10 treatment. In these assays, splenocytes were harvested from a minimum of four mice per group, filtered, and the red blood cells lysed and re-suspended in RPMI+10%
FBS+penn/strep at a concentration of 106 cells/ml in the presence of lug/ml hgplOO peptide. Cells were plated on pre-coated ELISpot plates, incubated overnight and processed according to manufacturer's instructions (MabTech, Cincinnati, OH). Developed plates were read on a BioSys BioReader 6000-F b. The results from this assay are shown in Figure 2A (IFN-gamma) and Figure 2B (IL-2). Values shown are total optical density. As shown in these figures, IFN-gamma and IL-2 were increased by addition of 131R10 therapy.
Example 3
Effect of adding anti-RSPO antibodies on T-cell cytotoxicity during immune checkpoint inhibitor therapy
[00333] A T-cell cytotoxicity assay was also performed. Briefly, splenocytes were harvested from a minimum of four mice per group, filtered, and the red blood cells lysed and re-suspended in
RPMI+10% FBS+penn/strep at a concentration of 2 x 106 cells/ml. Splenocytes were incubated with ^g/ml hgplOO peptide for nine days. On day 9 after plating splenocytes, B16F1 cells in culture were incubated with lOuM calcein AM viability dye per 106 cells at 37°C for one hour. Cells were then incubated with ^g/ml hgp lOO for an additional hour at 37°C before being washed to remove excess dye. Splenocytes were re-suspended at 2.5xl06 cells/ml, B 16F1 cells were re-suspended at 105 cells/ml and ΙΟΟμΙ of each combined in each well of a V-bottom plate for an effectortarget ratio of 25: 1, with splenocytes from each individual mouse plated in triplicate. Labeled B 16F1 cells were incubated in 5% SDS to determine maximum lysis conditions, while labeled cells were incubated in medium alone to determine minimum lysis conditions. The plate was then centrifuged at lOOOrpm for four minutes and then incubated at 37°C for four hours. Culture supematants were then harvested and fluorescence of released calcein AM was read at 485nm. Percent specific lysis was determined by dividing the value of the experimental sample by the difference in values between maximum and minimum lysis conditions. The results from these experiments, which are shown in Figure 3, show an
increase in T cell cytotoxocity from the combination of the anti-RSPO antibody with anti-CTLA-4 + anti-PD-Ll as compared to controls.
Example 4
Effect of adding anti-RSPO antibodies on T-cell tumor infiltration during immune checkpoint inhibitor therapy
[00334] The change is T-cell tumor infiltration was also measured. Here, B16F1 tumors were isolated from control antibody, anti-CTLA-4 and anti -mouse PD-L1 combination; and 131R10 + anti -mouse anti-CTLA-4 + anti-mouse PD-L1 combination antibody-treated mice. Single cell suspensions were acquired from 4-6 independently treated tumors and were stained for tumor infiltrating immune cells using fluorescently-labeled anti-CD45, anti-CD4, and anti-CD8 antibodies. Flow cytometry analysis (FACS) was performed and the relative percentage populations of CD45+/CD4+ and CD45+/CD8+ T cells are shown. As shown in Figures 4A and 4B, addition of 131R10 increased CD4+ and CD8+ T cell infiltration as compared to treatment with immune checkpoint inhibitors alone.
[00335] We also observed increases in CD45+ and CD3 T cell infiltration (data not shown).
Example 5
Effect of anti-RSPO antibodies on breast tumor cells
[00336] We tested the effect of anti-RSPO antibodies on growth of 4T1 breast tumor cells. In a first set of experiments, one million 4T1 breast tumor cells were injected subcutaneously into BALB/c mice. Mice were randomized for antibody treatment when tumor volumes reached 111mm3. 131R10 was administered once weekly by IP injection (25mg/kg). As shown in Figures 5A-5C,
administration of 131R10 resulted in decreased tumor volumes as compared to saline control.
[00337] We also measured cytokine expression level in splenocytes taken from mice. Here, ELISpot Cytokine Secretion Assays were used. Briefly, splenocytes were harvested from a minimum of four mice per group, filtered, the red blood cells lysed and re-suspended in RPMI+10% FBS+pen/strep at a concentration of 106 cells/ml in the presence of 0.2ug/ml AH1 peptide. Cells were plated on pre- coated ELISpot plates, incubated overnight, and processed according to manufacturer's instructions (MabTech, Cincinnati, OH). Developed plates were read on a BioSys BioReader® 6000-F b macroscope. As shown in Figures 6A-6D treatment with the anti-RSPO antibody increased secretion of interferon gamma (Figure 6A), IL-2 (Figure 6B), IL-10 (Figure 6C), and IL-17A (Figure 6D). Values shown are total optical density.
[00338] We also measured the number of splenic CD4+, CD8+, and Tregs in the mice. Briefly, single cell suspensions were acquired from 5-6 spleens from each treatment group and were stained for immune cells using fluorescently-labeled anti-CD45, anti-CD4, anti-CD8, anti-FoxP3, and anti-CD25 antibodies. Flow cytometry analysis (FACS) was performed and the relative percentage populations
of CD4+, CD8+, and CD4+CD25+FoxP3+ Treg T cells were measured. These results are shown in Figures 7A-7C, respectively. Increases in all three classes of T cells were observed in mice receiving 13 lRlO as compared to control. Example 6
Effect of adding anti-RSPO antibodies on anti-PD 1 therapy in breast cancer
[00339] We tested the effects of anti-RSPO antibodies in combination with an anti-PD 1 antibody on breast tumor cells injected into mice. Briefly, one million 4T1 breast tumor cells were injected subcutaneously into BALB/c mice. Mice were randomized for antibody treatment when tumor volumes reached 111mm3. 131R10 was administered once weekly by IP injection (25mg/kg), 25C^g a-Pdl (BioXCell, clone RMPl-14) twice weekly and 33mg/kg docetaxel once weekly. 250ug purified mouse IgG2b (BioXCell, clone MPC-11) was administered once weekly to control mice.
[00340] As shown in Figures 8A-8D, the combination of 131R10 and anti-PDl was significantly more effective than control or anti-PDl alone.
[00341] We also measured splenocyte cytokine expression as described in Example 5 above. As shown in Figures 9A, interferon gamma for the 13 IRlO+anti-PD 1 combination appeared to decrease slightly relative to anti-PDl alone or control. As shown in Figure 9B, IL-10 levels were similar in both the 13 IRlO+anti-PD 1 as compared to anti-PD 1 alone. As shown in Figures 9C and 9D, IL-2 and IL-17A levels, respectively, for the 131R10+anti-PDl combination were increased relative both to control as well as anti-PDl alone.
[00342] We also measured T cell cytotoxicity in mice taken from the three treatment groups. Briefly, the mouse breast tumor cell line 4T1 was cultured in RPMI culture medium supplemented with 10% (v/v) fetal bovine serum (FBS), 2mM L-glutamine, and 100 U/mL penicillin at 37°C in a humidified atmosphere of 5% C02. Total splenocytes from were cultured for 7 days in RPMI 1640 medium supplemented with 10% FBS, 2 mM L-glutamine, 100 U/mL penicillin, and 0.5 μg/mL AH1 peptide (Anaspec). 4T1 target cells were labeled with 10 μΜ calcein AM (Life Technologies) for 1 hour at 37°C, pulsed with AH1 peptide for an additional hour at 37°C and then combined with the splenocytes at an effectortarget ratio of 12.5: 1. Following a four-hour incubation at 37°C, cell-free supernatants were harvested and calcein release was quantified on a fluorometer at an excitation of 485 nm and an emission of 535 nm. The percentage of specific cell lysis was determined as: % lysis = 100 x (ER-SR)/(MR-SR), where ER, SR, and MR represent experimental, spontaneous, and maximum calcein release, respectively. Spontaneous release is the fluorescence emitted by target cells incubated in media alone (i.e., in the absence of effector cells), while maximum release is determined by lysing target cells with an equal volume of 10% SDS.
[00343] As shown in Figure 10A, T cell cytotoxicity was increased in the 13 lRlO+anti-PDl combination relative to both control and anti-PD l alone.
[00344] We also measured T cells in the tumor. In these experiments, at the termination of the experiments mice were euthanized, xenograft tumors were removed, cut into small pieces with a scalpel and minced with a sterile razor blade after removing necrotic portion and connective tissues. To obtain single cell suspension, a digestion solution containing Collagenase in MEM medium (Cambrex, East Rutherford, NJ) with a 1: 100 dilution of DNAsel (Worthington, Lakewood, NJ) was mixed with the tumor suspension and incubated for 1 hour at 37°C for enzymatic dissociation with mechanical agitation with a pipette every 15 min. The reaction was inactivated by adding equal volume of FACS buffer (HBSS medium supplemented with 2% heat-inactivated fetal bovine serum and 20mM Hepes) and filtered through a 40um mesh to remove aggregated and undigested tissues. Cells were centrifuged and re-suspended in 1 ml of ACK medium (0.15 M NH4C1, 10 mM KHC03, and 0.1 mM Na2EDTA in distilled water) on ice for 2 minutes to remove red blood cells. The reaction was terminated by adding FACS buffer and cells were centrifuged and re-suspended in FACS buffer. The cells were stained using fluorescently-labeled anti-CD45, anti-CD4 and anti- CD 8, antibodies. Flow cytometry analysis (FACS) was performed and the relative percentage populations of CD8+ and CD4+ T cells are shown, respectively, in Figures 10B and IOC. Increased number of both CD8+ and CD4+ were seen in mice receiving the combination of anti-PDl antibodies and 131R10, as compared to mice receiving either control or anti-PD 1 antibodies alone.
[00345] We also measured the number of splenic CD4+, CD8+, and Tregs in the mice. Briefly, single cell suspensions were acquired from 5-6 spleens from each treatment group and were stained for immune cells using fluorescently-labeled anti-CD45, anti-CD4, anti-CD8, anti-FoxP3, and anti-CD25 antibodies. Flow cytometry analysis (FACS) was performed and the relative percentage populations of CD4+, CD8+, and CD4+CD25+FoxP3+ Treg T cells were measured. These results are shown in Figures 10D-10F, respectively. Increases in all three classes of T cells were observed in subjects receiving the combination of anti-PDl antibodies and 131R10, as compared to mice receiving anti- PD1 antibodies alone.
Example 7
Effect of adding anti-RSPO antibodies on anti-CTLA-4 therapy in breast cancer
[00346] We tested the effects of anti-RSPO antibodies in combination with an anti-CTLA-4 antibody on breast tumor cells injected into mice. Briefly, one million 4T1 breast tumor cells were injected subcutaneously into BALB/c mice. Mice were randomized for antibody treatment when tumor volumes reached 111mm3. OMP-131R10 was administered once weekly by IP injection (25mg/kg), 100μg anti-CTLA-4 (BioXCell, clone 9D9) twice weekly and 33mg/kg docetaxel once weekly. Control 100μg purified rat IgG2a (BioXCell, clone 2A3) was administered once weekly.
[00347] As shown in Figures 1 lA-1 ID, the combination of 131R10 and anti-CTLA-4 was significantly more effective than control or anti-CTLA-4 alone.
[00348] We also measured splenocyte cytokine expression as described in Example 5 above. As shown in Figures 12A, interferon gamma for the 131R10+anti-PD l combination appeared to decrease slightly relative to anti-PDl alone or control. As shown in Figures 12B and 12C, IL-10 and IL-2 levels, respectively, were similar in the 13 lRlO+anti-CTLA-4 as compared to anti-CTLA-4 alone or control. As shown in Figure 12D, IL-17A levels for the 131R10+anti-CLTA-4 combination were increased relative both to control and anti-CTLA-4 alone.
[00349] We also measured T cell cytotoxicity in mice taken from the three treatment groups following the procedure described in Example 6. As shown in Figure 13, no significant difference was observed among the three groups.
[00350] We also measured the number of splenic CD4+, CD8+, and Tregs in the mice. As described above, single cell suspensions were acquired from 5-6 spleens from each treatment group and were stained for immune cells using fluorescently-labeled anti-CD45, anti-CD4, anti-CD8, anti-FoxP3, and anti-CD25 antibodies. Flow cytometry analysis (FACS) was performed and the relative percentage populations of CD8+, CD4+, and CD4+CD25+FoxP3+ Treg T cells were measured. These results are shown in Figures 14A-14C, respectively, which show a statistically significant increase in Tregs and small increases in CD8+ and CD4+ cells in the 13 lRlO+anti-CTLA-4 group compared to other groups.
Example 8
Effect of combined anti-RSPO and anti-PD-1 therapy in colon cancer
[00351] We also tested the effect of anti-RSPO and anti-PD 1 antibodies on colon tumor growth in mice separately and in combination. Briefly, 30,000 colon tumor cells were injected subcutaneously into BALB/c mice. Mice were randomized for antibody treatment 10 days after cell implantation when tumor volumes reached approximately 100mm3. 25 mg/kg 131R10 and 30 mg/kg 5-FU was administered once weekly by IP injection as indicated. 250ug anti-PD l was administered twice weekly by IP injection.
[00352] As shown in Figure 15, the combination of 131R10 with anti-PDl resulted in a significant decrease in tumor volume as compared to the single antibody treatment groups or to the controls.
Example 9
Effect of combined anti-RSPO and anti-PD-1 therapy in a breast cancer cell line
[00353] 4T1 cells were injected subcutaneously into BALB/c mice. At a mean tumor volume of ~80mm3, mice were randomized for treatment with an anti-RSPO antibody (131R10; 25 mg/kg, Q1W starting day 1), an anti-PD-1 antibody (319R1; 25 mg/kg, Q 1W starting day 1), and/or docetaxel (33 mg/kg, Q 1W starting day 4). Changes in tumor size in this experiment are shown in Figure 16. The largest effect was observed in the mice receiving all three agents (131R10+anti-PD-l+docetaxel).
[00354] Changes in frequency, infiltration, and activation of dendritic cells, as well as frequency of T regulatory cells were measured in 4T1 tumor-implanted mice. Further, selected cytokine levels (IL- 17a and IL-2) were measured as well. For these experiments, 4T1 cells were injected subcutaneously into BALB/c mice. At a mean tumor volume of -150 mm3, mice were randomized for treatment with the anti-RSP03 antibody 131R10 (25 mg/kg, day 0), an anti-PD-1 antibody (25 mg/kg, day 0), and/or docetaxel (33 mg/kg, day 3). Seven days following antibody administration, mice were euthanized and tissues harvested. For the flow cytometry experiments, tumor cells were brought to a single cell suspension and the red blood cells lysed. Tumor cells were incubated with Fc block and then stained for cell surface markers shown (antibodies purchased from Affymetrix, BD Biosciences, and BioLegend), washed, and stained with fixable viability dye. Treg samples were fixed and permeabilized with Mouse Regulatory T Cell Staining Kit 1, then stained for Foxp3, per
manufacturer's instructions (Affymetrix). All other samples were briefly fixed with
paraformaldehyde, washed, and stored in PBS until analysis on an LSR II cytometer (BD
Biosciences.) To measure cytokine levels, splenocytes were pressed through a 40 μΜ filter using a syringe plunger. Red blood cells were then lysed to form splenocyte cell suspensions. Two-hundred thousand cells per well were plated in the presence of AH1 peptide onto IL-2 and IL-17a ELISpot plates, incubated overnight, and processed per manufacturer's instructions (Mabtech). Total optical density was determined using a BlOreader ELISpot reader.
[00355] As shown in Figures 17A and 17B, treatment groups show increases in tumor dendritic cell frequency as compared to controls. Figure 17C shows increases in tumor cell infiltration of CD8a+ cells as compared to control, and Figure 17D shows increased tumor dendritic cell activation in treatment groups as compared to control. Figure 18A shows changes in splenic dendritic cells, and Figure 18B shows decreases in T regulatory cells in the spleen in treatment groups as compared to controls.
[00356] Changes in IL-17a and IL-2 levels were measured in control and treatment animals (Figures 19A-19D). 131R10 appeared to decrease IL-2 levels as compared to both controls (saline or anti-PD- 1+docetaxel), but did not have a consistent effect on IL-17a levels.
Example 10
Effect of combined anti-RSPO and anti-PD-1 therapy in a colon adenocarcinoma
[00357] Murine colon adenocarcinoma MC38 cells were injected subcutaneously into C57BL/6 mice At a mean tumor volume of ~110mm3, mice were randomized for treatment with an anti-RSPO antibody (131R10; 25 mg/kg, Q1W starting day 1) and/or an anti-PD-1 antibody (319R1; 25 mg/kg, Q1W starting day 1). To measure cytokine levels, splenocytes were pressed through a 40 μΜ filter using a syringe plunger, and red blood cells were lysed. Two-hundred thousand cells per well were plated in the presence of ADPGK peptide onto IL-2 and IL-17a ELISpot plates, incubated overnight,
and processed per manufacturer's instructions (Mabtech). Total optical density was determined using a BlOreader ELISpot reader.
[00358] As shown in Figure 20, the greatest effect on tumor growth was observed in mice receiving the combination of the anti-RSP03 and anti-PD-1 antibodies. As shown in Figure 21, the anti- PvSP03/anti-PD 1 combination also resulted in the smallest number of tumor samples greater than 500 mm3.
[00359] Results from cytokine measurement experiments are shown in Figures 22A and 22B. No difference in IL-2 was observed between the mice receiving anti-PD-1 and those receiving anti-PD- l+anti-RPS03 was observed (Figure 22A), whereas a decrease in IL-17a was observed in mice receiving anti-PDl+anti-RPS03 as compared to mice receiving anti-PD-1 (Figure 22B).
[00360] It is understood that the examples and embodiments described herein are for illustrative purposes only and that various modifications or changes in light thereof will be suggested to person skilled in the art and are to be included within the spirit and purview of this application.
[00361] All publications, patents, patent applications, internet sites, and accession numbers/database sequences including both polynucleotide and polypeptide sequences cited herein are hereby incorporated by reference herein in their entirety for all purposes to the same extent as if each individual publication, patent, patent application, internet site, or accession number/database sequence were specifically and individually indicated to be so incorporated by reference.
[0264] Following are the sequences disclosed in the application:
Human RSPO l amino acid sequence with signal sequence (SEQ ID NO: 1)
MRLGLCVVALVLSWTHL I SSRGI KGKRQRRI SAEGSQACAKGCELCSEVNGCLKCS PKL FILLERNDIRQVGVCLPSCPPGY FDARNPDMNKCI KCKI EHCEAC FSHNFCTKCKEGLYL HKGRCYPACPEGSSAA GTMECSS PAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVL HAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKE SKEAGAGSR RRKGQQQQQQQGTVGPL SAGPA
Human RSP02 amino acid sequence with signal sequence (SEQ ID NO: 2)
MQFRL FS FAL I ILNCMDY SHCQGNRWRRSKRASYVSNPICKGCLSCSKDNGCSRCQQKL F FFLRREGMRQYGECLHSCPSGYYGHRAPDMNRCARCRIENCDSCFSKDFCTKCKVGFYLH RGRC FDECPDGFAPLEETMECVEGCEVGHWSEWGTCSRNNRTCGFKWGLE R RQ IVKKP VKD I PCPT IAESRRCKMTMRHCPGGKRTPKAKEKRNKKKKRKLI ERAQEQHSVFLATDR ANQ
Human RSP03 amino acid sequence with signal sequence (SEQ ID NO:3)
MHLRL I SWLFI IL FMEY IGSQNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPR L FFALERIGMKQIGVCLS SCPSGYYGTRYPDINKCTKCKADCDTC FNK FCTKCKSGFYL HLGKCLDNCPEGLEANNHTMECVS IVHCEVSEWNPWS PCTKKGKTCGFKRGTETRVRE I I
QHPSAKGNLCPPTNETRKCTVQRKKCQKGERGKKGRERKRKKPNKGESKEAIPDSKSLES
SKEIPEQRENKQQQKKRKVQDKQKSVSVSTVH
Human RSP04 amino acid sequence with signal sequence (SEQ ID NO: 4)
MRAPLCLLLLVAHAVDMLALNRRKKQVGTGLGGNCTGCI ICSEENGCSTCQQRLFLFIRR EGIRQYGKCLHDCPPGYFGIRGQEVNRCKKCGATCESCFSQDFCIRCKRQFYLYKGKCLP TCPPGTLAHQNTRECQGECELGPWGGWSPCTHNGKTCGSAWGLESRVREAGRAGHEEAAT CQVLSESRKCPIQRPCPGERSPGQKKGRKDRRPRKDRKLDRRLDVRPRQPGLQP
89M5 Heavy chain CDR1 (SEQ ID NO:5)
TGYTMH
89M5 Heavy chain CDR2 (SEQ ID NO:6)
GINPNNGGTTYNQNFKG
89M5 Heavy chain CDR3 (SEQ ID NO:7)
KEFSDGYYFFAY
89M5 Light chain CDR1 (SEQ ID NO: 8)
KASQDVIFAVA
89M5 Light chain CDR2 (SEQ ID NO:9)
WASTRHT
89M5 Light chain CDR3 (SEQ ID NO: 10)
QQHYSTPW h89M5-H8L5 Heavy chain variable region amino acid sequence (SEQ ID NO: 11)
EVQLVQSGAEVKKPGESLRISCKGSGYSFTGYTMHWVRQMPGKGLEWMGGINPNNGGTTY NQNFKGHVTISADKSISTAYLQWSSLKASDTAMYYCARKEFSDGYYFFAYWGQGTLVTVS
S
h89M5-H8L5 Light chain variable region amino acid sequence (SEQ ID NO: 12)
DIVMTQSPDSLAVSLGERA INCKASQDVI FAVAWYQQKPGQPPKLLIYWAS RHTGVPD RFSGSGSGTDFTL ISSLQAEDVAVYYCQQHYS PW FGGGTKVEIK
h89M5-H8L5 Heavy chain amino acid sequence with predicted signal sequence underlined (SEQ ID NO: 13)
MDWTWRILFLVAAATGAHSEVQLVQSGAEVKKPGESLRISCKGSGYSFTGYTMHWVRQMP GKGLEWMGGINPNNGGTTYNQNFKGHVTISADKSISTAYLQWSSLKASDTAMYYCARKEF SDGYYFFAYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVS WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP KSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNW YVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSREEMTK QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPV LDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK h89M5-H8L5 Heavy chain amino acid sequence without predicted signal sequence (SEQ ID NO: 14)
EVQLVQSGAEVKKPGESLRISCKGSGYSFTGYTMHWVRQMPGKGLEWMGGINPNNGGTTY NQNFKGHVTISADKSISTAYLQWSSLKASDTAMYYCARKEFSDGYYFFAYWGQGTLVTVS SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLG GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRE EMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
h89M5-H8L5 Light chain amino acid sequence with predicted signal sequence underlined (SEQ ID NO: 15)
MVLQTQVFISLLLWISGAYGDIVMTQSPDSLAVSLGERATINCKASQDVI FAVAWYQQKP GQPPKLLIYWASTRHTGVPDRFSGSGSGTDFTL ISSLQAEDVAVYYCQQHYS PW FGG GTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ ESVTEQDSKDSTYSLSNTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
h89M5-H8L5 Light chain amino acid sequence without predicted signal sequence (SEQ ID NO: 16)
DIVMTQSPDSLAVSLGERA INCKASQDVI FAVAWYQQKPGQPPKLLIYWAS RHTGVPD RFSGSGSGTDFTL ISSLQAEDVAVYYCQQHYS PW FGGGTKVEIKRTVAAPSVFI FPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSNTLT LSKADYEKHKVYACEVTHQGLSSPV KSFNRGEC
130M23 Heavy chain CDR1 (SEQ ID NO: 17)
SSYAMS
130M23 Heavy chain CDR2 (SEQ ID NO: 18)
SISSGGSTYYPDSVKG
130M23 Heavy chain CDR3 (SEQ ID NO: 19)
RGGDPGVYNGDYEDAMDY
130M23 Light chain CDR1 (SEQ ID NO: 20)
KASQDVSSAVA
130M23 Light chain CDR2 (SEQ ID NO:21)
WASTRHT
130M23 Light chain CDR3 (SEQ ID NO: 22)
QQHYSTP
hl30M23-HlL6 Heavy chain variable region amino acid sequence (SEQ ID NO:23)
EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSSISSGGSTYYP DSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARGGDPGVYNGDYEDAMDYWGQGTT VTVSS
hl30M23-HlL6 Light chain variable region amino acid sequence (SEQ ID NO:24)
DIQMTQSPSSLSASVGDRVTITCKASQDVSSAVAWYQQKPGKAPKLLIYWASTRHTGVPS RFSGSGSGTDFTL ISSLQPEDFA YYCQQHYS PW FGQGTKVEIK hl30M23-HlL6 Heavy chain amino acid sequence with predicted signal sequence underlined (SEQ ID NO:25)
MELGLRWVFLVAILEGVQCEVQLVESGGGLVKPGGSLRLSCAASGFTFSSYAMSWVRQAP GKGLEWVSSISSGGSTYYPDSVKGRFTISRDNAK SLYLQMNSLRAEDTAVYYCARGGDP GVYNGDYEDAMDYWGQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEP VTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSNFGTQTYTCNVDHKPSNTKVDK TVERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNW YVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTIS KTKGQPREPQVYTLPPSREEMTK QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPM LDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK hl30M23-HlL6 Heavy chain amino acid sequence without predicted signal sequence (SEQ ID NO:26)
EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSSISSGGSTYYP
DSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARGGDPGVYNGDYEDAMDYWGQGTT VTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPA VLQSSGLYSLSSVVTVPSSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVA GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQF NSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSRE EMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK hl30M23-HlL6 Light chain amino acid sequence with predicted signal sequence underlined (SEQ ID NO:27)
MGIKMESQIQAFVFVFLWLSGVDGDIQMTQSPSSLSASVGDRVTITCKASQDVSSAVAWY QQKPGKAPKLLIYWASTRHTGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQHYSTPW TFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQS GNSQESVTEQDSKDSTYSLSNTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC hl30M23-HlL6 Light chain amino acid sequence without predicted signal sequence (SEQ ID NO:28)
DIQMTQSPSSLSASVGDRVTITCKASQDVSSAVAWYQQKPGKAPKLLIYWASTRHTGVPS RFSGSGSGTDFTL ISSLQPEDFA YYCQQHYS PW FGQGTKVEIKRTVAAPSVFI FPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSNTLT LSKADYEKHKVYACEVTHQGLSSPV KSFNRGEC
131R10 Heavy chain CDR1 (SEQ ID NO:29)
DYSIH
131R10 Heavy chain CDR2 (SEQ ID NO:30)
YIYPSNGDSGYNQKFK13R10
131R10 Heavy chain CDR3 (SEQ ID NO:31)
TYFANNFD
131R10 Alternative Heavy chain CDR3 (SEQ ID NO:32)
A YFANNFDY
131R10 Light chain CDR1 (SEQ ID NO:33)
KASQSVDYDGDSYMN
131R10 Light chain CDR2 (SEQ ID NO:34)
AASNLES
131R10 Alternative Light chain CDR2 (SEQ ID NO:35)
AAS
131R10 Light chain CDR3 (SEQ ID NO:36)
QQSNEDPLT
131R10 Alternative Light chain CDR3 (SEQ ID NO:37)
QQSNEDPLTF
131R10 Heavy chain variable region amino acid sequence (SEQ ID NO: 38)
QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYSIHWVRQAPGQGLEWIGYIYPSNGDSGY NQKFKNRVTMTRDTSTSTAYMELSRLRSEDTAVYYCATYFA NFDYWGQGTTLTVSS
131R10 Light chain variable region amino acid sequence (SEQ ID NO:39)
DIQMTQSPSSLSASVGDRV ITCKASQSVDYDGDSYMNWYQQKPGKAPKLLIYAASNLES
GVPSRFSGSGSGTDFTL ISPVQAEDFATYYCQQSNEDPLTFGAGTKLELKR
131R10 Heavy chain amino acid sequence with predicted signal sequence underlined (SEQ ID NO:40)
MKHLWFFLLLVAAPRWVLSQVQLVQSGAEVKKPGASVKVSCKASGYTFTDYSIHWVRQAP GQGLEWIGYIYPSNGDSGYNQKFKNRVTMTRDTSTSTAYMELSRLRSEDTAVYYCATYFA NNFDYWGQGTTLTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSG ALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCD KTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG VEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG QPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
131R10 Heavy chain amino acid sequence without predicted signal sequence (SEQ ID NO:41) QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYSIHWVRQAPGQGLEWIGYIYPSNGDSGY NQKFKNRVTM RD S S AYMELSRLRSEDTAVYYCATYFAN FDYWGQGTTLTVSSAST KGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLY SLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSV FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTY RVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTK NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT PPVLDSDGSFFLYSKLTVDKSRWQQG NVFSCSVMHEALHNHYTQKSLSLSPGK
131R10 Light chain amino acid sequence with predicted signal sequence underlined (SEQ ID NO:42) MKHLWFFLLLVAAPRWVLSDIQMTQSPSSLSASVGDRVTITCKASQSVDYDGDSYMNWYQ QKPGKAPKLLIYAASNLESGVPSRFSGSGSGTDFTL ISPVQAEDFA YYCQQSNEDPLT FGAGTKLELKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSG NSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPV KSFNRGEC
131R10 Light chain amino acid sequence without predicted signal sequence (SEQ ID NO:43)
DIQMTQSPSSLSASVGDRVTITCKASQSVDYDGDSYMNWYQQKPGKAPKLLIYAASNLES GVPSRFSGSGSGTDFTL ISPVQAEDFATYYCQQSNEDPLTFGAGTKLELKRTVAAPSVF I FPPSDEQLKSGTASVVCLLN FYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLS STLTLSKADYEKHKVYACEVTHQGLSSPV KSFNRGEC
h89M5-H2L2 Heavy chain variable region amino acid sequence (SEQ ID NO:44)
QVQLVQSGAEVKKPGASVKVSCKTSGYTFTGYTMHWVRQAPGQRLEWMGGINPNNGGTTY NQNFKGRVTITRDTSASTAYMELSSLRSEDTAVYYCARKEFSDGYYFFAYWGQGTLVTVS
S
h89M5-H2L2 Light chain variable region amino acid sequence (SEQ ID NO:45)
DIQMTQSPSSLSASVGDRV ITCKASQDVI FAVAWYQQKPGKAPKLLIYWAS RHTGVPS RFSGSGSGTDYTL ISSLQPEDFA YYCQQHYS PW FGGGTKVEIK h89M5-H2L2 Heavy chain amino acid sequence with predicted signal sequence underlined (SEQ ID NO:46)
MDWTWRILFLVAAATGAHSQVQLVQSGAEVKKPGASVKVSCKTSGYTFTGYTMHWVRQAP GQRLEWMGGINPNNGGTTYNQNFKGRVTITRDTSASTAYMELSSLRSEDTAVYYCARKEF SDGYYFFAYWGQGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVS WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSNFGTQTYTCNVDHKPSNTKVDKTVER KCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDG VEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKG QPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSD GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
h89M5-H2L2 Heavy chain amino acid sequence without predicted signal sequence (SEQ ID NO:47)
QVQLVQSGAEVKKPGASVKVSCKTSGYTFTGYTMHWVRQAPGQRLEWMGGINPNNGGTTY NQNFKGRVTITRDTSASTAYMELSSLRSEDTAVYYCARKEFSDGYYFFAYWGQGTLVTVS SASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS SGLYSLSSVVTVPSSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSV FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTF RVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTK NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT PPMLDSDGSFFLYSKLTVDKSRWQQG NVFSCSVMHEALHNHYTQKSLSLSPGK h89M5-H2L2 Light chain amino acid sequence with predicted signal sequence underlined (SEQ ID NO:48)
MDMRVPAQLLGLLLLWLRGARCDIQMTQSPSSLSASVGDRVTITCKASQDVI FAVAWYQQ KPGKAPKLLIYWAS RHTGVPSRFSGSGSG DYTL ISSLQPEDFATYYCQQHYS PW F GGG KVEIKRTVAAPSVFI FPPSDEQLKSG ASVVCLLNNFYPREAKVQWKVDNALQSGN SQESVTEQDSKDSTYSLSNTLTLSKADYEKHKVYACEVTHQGLSSPV KSFNRGEC h89M5-H2L2 Light chain amino acid sequence without predicted signal sequence (SEQ ID NO:49)
DIQMTQSPSSLSASVGDRV ITCKASQDVI FAVAWYQQKPGKAPKLLIYWAS RHTGVPS RFSGSGSGTDYTL ISSLQPEDFA YYCQQHYS PW FGGGTKVEIKRTVAAPSVFI FPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSNTLT LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
hl30M23-HlL2 Light chain variable region amino acid sequence (SEQ ID NO:50)
DIQMTQSPSSLSASVGDRVTITCKASQDVSSAVAWYQQKPGKAPKLLIYWASTRHTGVPS RFSGSGSGTDFTL ISSVQAEDFATYYCQQHYSTPW FGQGTKVEIK
hl30M23-HlL2 Light chain amino acid sequence with predicted signal sequence underlined (SEQ ID NO:51)
MKYLLPTAAAGLLLLAAQPAMADIQMTQSPSSLSASVGDRVTITCKASQDVSSAVAWYQQ KPGKAPKLLIYWASTRHTGVPSRFSGSGSGTDFTLTISSVQAEDFATYYCQQHYSTPWTF GQG KVEIKRTVAAPSVFI FPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGN SQESVTEQDSKDSTYSLSNTLTLSKADYEKHKVYACEV HQGLSSPVTKSFNRGEC
hl30M23-HlL2 Light chain amino acid sequence without predicted signal sequence (SEQ ID NO:52)
DIQMTQSPSSLSASVGDRVTITCKASQDVSSAVAWYQQKPGKAPKLLIYWASTRHTGVPS RFSGSGSGTDFTL ISSVQAEDFATYYCQQHYSTPW FGQGTKVEIKRTVAAPSVFI FPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSNTLT LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Human LGR4 protein sequence (NM 018490; SEQ ID NO:53)
MPGPLGLLCFLALGLLGSAGPSGAAPPLCAAPCSCDGDRRVDCSGKGLTAVPEGLSAFTQ ALDISMNNITQLPEDAFKNFPFLEELQLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTV PSEAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNSLTEVPVHPLSNLPTLQ ALTLALNKISSIPDFAFTNLSSLVVLHLHNNKIRSLSQHCFDGLDNLETLDLNYNNLGEF PQAIKALPSLKELGFHSNSISVIPDGAFDGNPLLRTIHLYDNPLSFVGNSAFHNLSDLHS LVIRGASMVQQFPNLTGTVHLESLTLTGTKISSIPNNLCQEQKMLRTLDLSYNNIRDLPS FNGCHALEEISLQRNQIYQIKEGTFQGLISLRILDLSRNLIHEIHSRAFATLGPITNLDV SFNELTSFPTEGLNGLNQLKLVGNFKLKEALAAKDFVNLRSLSVPYAYQCCAFWGCDSYA NLNTEDNSLQDHSVAQEKGTADAANVTSTLENEEHSQI IIHCTPSTGAFKPCEYLLGSWM IRLTVWFI FLVALFFNLLVILTTFASCTSLPSSKLFIGLISVSNLFMGIYTGILTFLDAV SWGRFAEFGIWWETGSGCKVAGFLAVFSSESAI FLLMLATVERSLSAKDIMKNGKSNHLK QFRVAALLAFLGATVAGCFPLFHRGEYSASPLCLPFPTGETPSLGFTVTLVLLNSLAFLL MAVIYTKLYCNLEKEDLSENSQSSMIKHVAWLI FTNCIFFCPVAFFSFAPLITAISISPE IMKSVTLI FFPLPACLNPVLYVFFNPKFKEDWKLLKRRVTKKSGSVSVSISSQGGCLEQD
FYYDCGMYSHLQGNLTVCDCCESFLLTKPVSCKHLIKSHSCPALAVASCQRPEGYWSDCG TQSAHSDYADEEDSFVSDSSDQVQACGRACFYQSRGFPLVRYAYNLPRVKD
Human LGR5 protein sequence (SEQ ID NO: 54)
MDTSRLGVLLSLPVLLQLATGGSSPRSGVLLRGCPTHCHCEPDGRMLLRVDCSDLGLSEL PSNLSVFTSYLDLSMNNISQLLPNPLPSLRFLEELRLAGNALTYIPKGAFTGLYSLKVLM LQNNQLRHVPTEALQNLRSLQSLRLDA HISYVPPSCFSGLHSLRHLWLDDNALTEIPVQ AFRSLSALQAMTLALNKIHHIPDYAFGNLSSLVVLHLHNNRIHSLGKKCFDGLHSLETLD LNYNNLDEFPTAIRTLSNLKELGFHSNNIRSIPEKAFVGNPSLITIHFYDNPIQFVGRSA FQHLPELRTLTLNGASQITEFPDLTGTANLESLTLTGAQISSLPQTVCNQLPNLQVLDLS YNLLEDLPSFSVCQKLQKIDLRHNEIYEIKVD FQQLLSLRSLNLAWNKIAIIHPNAFST LPSLIKLDLSSNLLSSFPITGLHGLTHLKLTGNHALQSLISSENFPELKVIEMPYAYQCC AFGVCENAYKISNQWNKGDNSSMDDLHKKDAGMFQAQDERDLEDFLLDFEEDLKALHSVQ CSPSPGPFKPCEHLLDGWLIRIGVWTIAVLALTCNALVTSTVFRSPLYISPIKLLIGVIA AVNMLTGVSSAVLAGVDAF FGSFARHGAWWENGVGCHVIGFLSI FASESSVFLLTLAAL ERGFSVKYSAKFE KAPFSSLKVI ILLCALLALTMAAVPLLGGSKYGASPLCLPLPFGEP STMGYMVALILLNSLCFLMMTIAYTKLYCNLDKGDLENIWDCSMVKHIALLLFTNCILNC PVAFLSFSSLINLTFISPEVIKFILLVVVPLPACLNPLLYILFNPHFKEDLVSLRKQTYV WTRSKHPSLMSINSDDVEKQSCDSTQALVTFTSSSITYDLPPSSVPSPAYPVTESCHLSS VAFVPCL
Human LGR6 protein sequence (BC047905; SEQ ID NO:55)
MGRPRLTLVCQVSI I ISARDLSMNNLTELQPGLFHHLRFLEELRLSGNHLSHIPGQAFSG LYSLKILMLQNNQLGGIPAEALWELPSLQSLRLDANLISLVPERSFEGLSSLRHLWLDDN ALTEIPVRALNNLPALQAMTLALNRISHIPDYAFQNLTSLVVLHLHNNRIQHLGTHSFEG LHNLETLDLNYNKLQEFPVAIRTLGRLQELGFHNNNIKAIPEKAFMGNPLLQTIHFYDNP IQFVGRSAFQYLPKLHTLSLNGAMDIQEFPDLKGTTSLEILTLTRAGIRLLPSGMCQQLP RLRVLELSHNQIEELPSLHRCQKLEEIGLQHNRIWEIGADTFSQLSSLQALDLSWNAIRS IHPEAFSTLHSLVKLDLTDNQLTTLPLAGLGGLMHLKLKGNLALSQAFSKDSFPKLRILE VPYAYQCCPYGMCASFFKASGQWEAEDLHLDDEESSKRPLGLLARQAENHYDQDLDELQL EMEDSKPHPSVQCSPTPGPFKPCEYLFESWGIRLAVWAIVLLSVLCNGLVLLTVFAGGPV PLPPVKFVVGAIAGANTLTGISCGLLASVDALTFGQFSEYGARWETGLGCRATGFLAVLG SEASVLLLTLAAVQCSVSVSCVRAYGKSPSLGSVRAGVLGCLALAGLAAALPLASVGEYG ASPLCLPYAPPEGQPAALGFTVALVMMNSFCFLVVAGAYIKLYCDLPRGDFEAVWDCAMV RHVAWLIFADGLLYCPVAFLSFASMLGLFPVTPEAVKSVLLVVLPLPACLNPLLYLLFNP HFRDDLRRLRPRAGDSGPLAYAAAGELEKSSCDSTQALVAFSDVDLILEASEAGRPPGLE TYGFPSVTLISCQQPGAPRLEGSHCVEPEGNHFGNPQPSMDGELLLRAEGSTPAGGGLSG GGGFQPSGLAFASHV LGR5 ECD amino acids 22-564 (SEQ ID NO:56)
GSSPRSGVLLRGCPTHCHCEPDGRMLLRVDCSDLGLSELPSNLSVFTSYLDLSMNNISQL LPNPLPSLRFLEELRLAGNALTYIPKGAFTGLYSLKVLMLQNNQLRHVPTEALQNLRSLQ SLRLDANHISYVPPSCFSGLHSLRHLWLDDNALTEIPVQAFRSLSALQAMTLALNKIHHI PDYAFGNLSSLVVLHLHNNRIHSLGKKCFDGLHSLETLDLNYNNLDEFPTAIRTLSNLKE LGFHSNNIRSIPEKAFVGNPSLITIHFYDNPIQFVGRSAFQHLPELRTLTLNGASQITEF PDLTGTANLESLTLTGAQISSLPQTVCNQLPNLQVLDLSYNLLEDLPSFSVCQKLQKIDL RHNEIYEIKVDTFQQLLSLRSLNLAWNKIAI IHPNAFSTLPSLIKLDLSSNLLSSFPITG LHGLTHLKLTGNHALQSLISSENFPELKVIEMPYAYQCCAFGVCENAYKISNQWNKGDNS SMDDLHKKDAGMFQAQDERDLEDFLLDFEEDLKALHSVQCSPSPGPFKPCEHLLDGWLIR IGV
LGR5-Fc protein sequence (SEQ ID NO: 57)
MDTSRLGVLLSLPVLLQLATGGSSPRSGVLLRGCPTHCHCEPDGRMLLRVDCSDLGLSEL PSNLSVFTSYLDLSMNNISQLLPNPLPSLRFLEELRLAGNALTYIPKGAFTGLYSLKVLM LQNNQLRHVPTEALQNLRSLQSLRLDANHISYVPPSCFSGLHSLRHLWLDDNALTEIPVQ
AFRSLSALQAMTLALNKIHHIPDYAFGNLSSLVVLHLHNNRIHSLGKKCFDGLHSLETLD LNYNNLDEFPTAIRTLSNLKELGFHSNNIRSIPEKAFVGNPSLITIHFYDNPIQFVGRSA FQHLPELRTLTLNGASQITEFPDLTGTANLESLTLTGAQISSLPQTVCNQLPNLQVLDLS YNLLEDLPSFSVCQKLQKIDLRHNEIYEIKVD FQQLLSLRSLNLAWNKIAIIHPNAFST LPSLIKLDLSSNLLSSFPITGLHGLTHLKLTGNHALQSLISSENFPELKVIEMPYAYQCC AFGVCENAYKISNQWNKGDNSSMDDLHKKDAGMFQAQDERDLEDFLLDFEEDLKALHSVQ CSPSPGPFKPCEHLLDGWLIRIGVGRADKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMI SRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDW LNGKEYKCKVSNKALPAPIEK ISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFY PSDIAVEWESNGQPENNYKT PPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALH NHYTQKSLSLSPGK
Human Igd Fc region (SEQ ID NO: 58)
DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVD GVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSRDELTK QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS DGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Human Igd Fc region (SEQ ID NO: 59)
DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVD GVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSREEMTK QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS DGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Human Igd Fc region (SEQ ID NO: 60)
KSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNW YVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSRDELTK QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPV LDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Human Igd Fc region (SEQ ID NO:61)
EPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKF NWYVDGVEVHNAK KPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKT ISKAKGQPREPQVYTLPPSRDELTK QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP PVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Human IgG2 Fc region (SEQ ID NO: 62)
CVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVE VHNAKTKPREEQFNSTFRVVSVL VVHQDWLNGKEYKCKVSNKGLPAPIEK ISKTKGQP REPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGS FFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Claims
1. A method of treating cancer comprising administering to a subject a therapeutically effective amount of a RSPO or LGR antagonist and a therapeutically effective amount of an
immunotherapeutic agent.
2. A method of inhibiting tumor growth in a subject, wherein the method comprises administering to a subject a therapeutically effective amount of a RSPO or LGR antagonist and an
immunotherapeutic agent.
3. A method of inhibiting the activity of regulatory T-cells (Tregs), wherein the method comprises administering to a subject a therapeutically effective amount of a RSPO or LGR antagonist and a therapeutically effective amount an immunotherapeutic agent.
4. A method of increasing T cell infiltration into a tumor, wherein the method comprises
administering to a subject a therapeutically effective amount of a RSPO or LGR antagonist and a therapeutically effective amount of an immunotherapeutic agent.
5. A method of increasing T cell cytotoxicity to a tumor, wherein the method comprises
administering to a subject a therapeutically effective amount of a RSPO or LGR antagonist and a therapeutically effective amount of an immunotherapeutic agent.
6. A method of increasing tumor cell lysis, wherein the method comprises administering to a subject a therapeutically effective amount of a RSPO or LGR antagonist and a therapeutically effective amount of an immunotherapeutic agent.
7. A method to increase the efficacy of an immune checkpoint modulator, wherein the method comprises administering to a subject a therapeutically effective amount of a RSPO or LGR antagonist in combination with the immune checkpoint modulator.
8. A method of reducing or preventing cancer metastasis in a subject, wherein the method comprises administering to the subject a therapeutically effective amount of a RSPO or LGR antagonist and a therapeutically effective amount of an immunotherapeutic agent.
9. The method according to any one of claims 1-8, wherein the RSPO or LGR antagonist is an
antibody.
10. The method according to any one of claims 1-9, wherein the RSPO or LGR antagonist is an
antibody that specifically binds at least one RSPO protein or portion thereof.
11. The method of claim 9 or claim 10, wherein the antibody specifically binds at least one RSPO protein selected from the group consisting of human RSPOl, human RSP02, human RSP03, or human RSP04.
12. The method of claim 11, wherein the antibody specifically binds at least human RSPOl.
13. The method of claim 11, wherein the antibody comprises:
(a) a heavy chain CDR1 comprising TGYTMH (SEQ ID NO:5), a heavy chain CDR2
comprising GINPNNGGTTYNQNFKG (SEQ ID NO:6), and a heavy chain CDR3 comprising KEFSDGYYFFAY (SEQ ID NO: 7); and
(b) a light chain CDR1 comprising KASQDVIFAVA (SEQ ID NO: 8), a light chain CDR2 comprising WASTRHT (SEQ ID NO:9), and a light chain CDR3 comprising QQHYSTPW (SEQ ID NO: 10).
14. The method of claim 11, wherein the antibody comprises a heavy chain variable region
comprising SEQ ID NO: 11 or 44, and a light chain variable region comprising SEQ ID NO: 12 or 45.
15. The method of claim 11, wherein the antibody comprises a heavy chain variable region
comprising SEQ ID NO: 11 and a light chain variable region comprising SEQ ID NO: 12.
16. The method of claim 11, wherein the antibody specifically binds at least human RSP02.
17. The method of claim 11, wherein the antibody comprises:
(a) a heavy chain CDR1 comprising SSYAMS (SEQ ID NO: 17), a heavy chain CDR2
comprising SISSGGSTYYPDSVKG (SEQ ID NO: 18), and a heavy chain CDR3 comprising RGGDPGVYNGDYEDAMDY (SEQ ID NO: 19); and
(b) a light chain CDR1 comprising KASQDVSSAVA (SEQ ID NO:20), a light chain CDR2 comprising WASTRHT (SEQ ID NO:21), and a light chain CDR3 comprising QQHYSTP (SEQ ID NO:22).
18. The method of claim 11, wherein the antibody comprises a heavy chain variable region
comprising SEQ ID NO:23 and a light chain variable region comprising SEQ ID NO:24.
19. The method of claim 11, wherein the antibody specifically binds at least human RSP03.
20. The method of claim 11, wherein the antibody comprises:
(a) a heavy chain CDR1 comprising DYSIH (SEQ ID NO:29), a heavy chain CDR2
comprising YIYPSNGDSGYNQKFK (SEQ ID NO: 30), and a heavy chain CDR3 comprising TYFANNFD (SEQ ID NO:31) or ATYFANNTDY(SEQ ID NO:32); and
(b) a light chain CDR1 comprising KASQSVDYDGDSYMN (SEQ ID NO: 33), a light chain CDR2 comprising AASNLES (SEQ ID NO:34) or AAS (SEQ ID NO:35), and a light chain CDR3 comprising QQSNEDPLT (SEQ ID NO:36) or QQSNEDPLTF (SEQ ID NO:37).
21. The method of claim 23, wherein the antibody comprises:
(a) a heavy chain CDR1 comprising DYSIH (SEQ ID NO:29), a heavy chain CDR2
comprising YIYPSNGDSGYNQKFK (SEQ ID NO: 30), and a heavy chain CDR3 comprising TYFANNFD (SEQ ID NO:31); and
(b) a light chain CDR1 comprising KASQSVDYDGDSYMN (SEQ ID NO: 33), a light chain
CDR2 comprising AASNLES (SEQ ID NO: 34), and a light chain CDR3 comprising QQSNEDPLT (SEQ ID NO:36).
22. The method of claim 20, wherein the antibody comprises a heavy chain variable region
comprising SEQ ID NO:38, and a light chain variable region comprising SEQ ID NO:39.
23. The method of claim 9, wherein the RSPO or LGR antagonist is an antibody that specifically binds at least one human LGR protein.
24. The method of claim 23, wherein the antibody specifically binds at least one human LGR protein is selected from the group consisting of: LGR4, LGR5, and LGR6.
25. The method of claim 23, wherein the antibody specifically binds at least human LGR5.
26. The method of claim 23, wherein the antibody comprises:
(a) the heavy chain CDR1, CDR2, and CDR3 sequences of the monoclonal antibody produced by the 88M1 hybridoma having the ATCC deposit number PTA-9342; and
(b) the light chain CDR1, CDR2, and CDR3 sequences of the monoclonal antibody produced by the 88M1 hybridoma having the ATCC deposit number PTA-9342.
27. The method of claim 23, wherein the antibody comprises the heavy chain variable region and light chain variable region of the monoclonal antibody produced by the 88M1 hybridoma having the ATCC deposit number PTA-9342.
28. The method of any one of claims 9 to 27, wherein the antibody is a monoclonal antibody, a recombinant antibody, a chimeric antibody, a humanized antibody, a human antibody, or an antibody fragment comprising an antigen-binding site.
29. The method of any one of claims 9 to 28, wherein the antibody is a monospecific antibody or a bispecific antibody.
30. The method of any one of claims 9 to 29, wherein the antibody is an IgGl antibody or an IgG2 antibody.
31. The method of claim 9, wherein the RSPO or LGR antagonist is 131R10.
32. The method of any one of claims 1 to 8, wherein the RSPO or LGR antagonist is a soluble
receptor comprising an extracellular domain of a human LGR protein, wherein the extracellular domain is capable of binding a human RSPO protein.
33. The method of claim 32, wherein the human LGR protein is LGR5.
34. The method of claim 32, wherein the extracellular domain of a human LGR protein comprises amino acids 22-564 of human LGR5 (SEQ ID NO:56).
35. The method of any one of claims 32 to 34, wherein the soluble receptor comprises a non-LGR polypeptide.
36. The method of claim 35, wherein the non-LGR polypeptide is directly linked to the extracellular domain of the human LGR protein.
37. The method of claim 35, wherein the non-LGR polypeptide is connected to the extracellular domain of the human LGR protein by a linker.
38. The method of any one of claims 35 to 37, wherein the non-LGR polypeptide comprises a human Fc region.
39. The method of any one of claims 35 to 38, wherein the non-LGR polypeptide comprises SEQ ID NO:58, SEQ ID NO:59, SEQ ID NO:60, SEQ ID NO:61, or SEQ ID NO:62.
40. The method of any one of claims 1-40, wherein the RSPO or LGR antagonist enhances the
activity of the immunotherapeutic agent.
41. The method of any one of claims 1-40, wherein the immunotherapeutic agent enhances the
activity of the RSPO or LGR antagonist.
42. The method of any one of claims 1-40, wherein the RSPO or LGR antagonist and the
immunotherapeutic agent act synergistically.
43. The method of any one of claims 1-6 or 8-42, wherein the immunotherapeutic agent selected from a group consisting of: a modulator of PD-1 activity, a modulator of PD-L1 activity, a modulator of PD-L2 activity, a modulator of CTLA-4 activity, a modulator of CD28 activity, a modulator of CD80 activity, a modulator of CD86 activity, a modulator of 4-1BB activity, an modulator of OX40 activity, a modulator of KIR activity, a modulator of Tim -3 activity, a modulator of LAG3 activity, a modulator of CD27 activity, a modulator of CD40 activity, a modulator of GITR activity, a modulator of TIGIT activity, a modulator of CD20 activity, a modulator of CD96 activity, a modulator of IDO l activity, a cytokine, a chemokine, an interferon, an interleukin, a lymphokine, a member of the tumor necrosis factor (TNF) family, and an immunostimulatory oligonucleotide.
44. The method of any one of claims 1-6 or 8-43, wherein the immunotherapeutic agent is an immune checkpoint modulator.
45. The method of claim 7 or claim 44, wherein the immune checkpoint modulator is an immune checkpoint inhibitor.
46. The method of claim 45, wherein the immune checkpoint inhibitor is a PD-1 antagonist, a PD-Ll antagonist, a PD-L2 antagonist, a CTLA-4 antagonist, a CD80 antagonist, a CD86 antagonist, a KIR antagonist, a Tim-3 antagonist, a LAG3 antagonist, a TIGIT antagonist, a CD20 antagonist, a
CD96 antagonist, or a IDOl antagonist.
47. The method of claim 46, wherein the PD-1 antagonist is an antibody that specifically binds PD-1.
48. The method of claim 47, wherein the antibody that binds PD-1 is pembrolizumab (KEYTRUDA;
MK-3475), pidilizumab (CT-011), nivolumab (OPDIVO; BMS-936558), MEDI0680 (AMP-514), REGN2810, BGB-A317, PDR-001, or STI-A1110.
49. The method of claim 46, wherein the PD-1 antagonist comprises the extracellular domain of PD- L2.
50. The method of claim 49, wherein the PD-1 antagonist is AMP -224.
51. The method of claim 46, wherein the PD-1 antagonist is a peptide.
52. The method of claim 51, wherein the PD-1 antagonist is AUNP-12.
53. The method of claim 46, wherein the PD-Ll antagonist is an antibody that specifically binds PD- Ll .
54. The method of claim 53, wherein the antibody that binds PD-Ll is atezolizumab (RG7446;
MPDL3280A), MEDI4736, BMS-936559 (MDX-1105), avelumab (MSB0010718C), KD033, the antibody portion of KD033, or STI-A1014.
55. The method of claim 46, wherein the CTLA-4 antagonist is an antibody that specifically binds CTLA-4.
56. The method of claim 55, wherein the antibody that binds CTLA-4 is ipilimumab (YERVOY;
MDX-010, BMS-734016) or tremelimumab (CP-675,206; ticilimumab).
57. The method of claim 46, wherein the CTLA-4 antagonist comprises a soluble CTLA-4 receptor.
58. The method of claim 57, wherein the CTLA-4 antagonist is KAHR-102.
59. The method of claim 46, wherein the LAG3 antagonist is an antibody that specifically binds LAG3.
60. The method of claim 59, wherein the antibody that binds LAG3 is IMP701, BMS-986016,
LAG525, GSK2831781, or IMP731.
61. The method of claim 46, wherein the LAG3 antagonist comprises a soluble LAG3 receptor.
62. The method of claim 61, wherein the LAG3 antagonist is IMP321.
63. The method of claim 46, wherein the Tim -3 antagonist is an antibody that binds Tim-3.
64. The method of claim 46, wherein the TIGIT antagonist is an antibody that binds TIGIT.
65. The method of claim 46, wherein the KIR antagonist is an antibody that specifically binds KIR.
66. The method of claim 65, wherein tlie antibody that binds KIR is lirilumab.
67. The method of claim 45, wherein the immune checkpoint modulator is an immune checkpoint enhancer or stimulator.
68. The method of claim 67, wherein the immune checkpoint enhancer or stimulator is a CD28
agonist, a 4-lBB agonist, an OX40 agonist, a CD27 agonist, a CD80 agonist, a CD86 agonist, a CD40 agonist, or a GITR agonist.
69. Tlie method of claim 68, wherein tlie OX40 agonist comprises OX40 ligand, or an OX40-binding portion thereof.
70. The method of claim 69, wherein the OX40 agonist is MEDI6383.
71. The method of claim 68, wherein the OX40 agonist is an antibody that specifically binds OX40.
72. The method of claim 71, wherein the antibody that binds OX40 is MEDI6469, MEDI0562, or MOXR0916 (RG7888).
73. The method of claim 68, wherein tlie OX40 agonist is a vector capable of expressing OX40 ligand.
74. The method of claim 68, wherein the OX40 agonist is Delta-24-RGDOX or DNX2401.
75. The method of claim 68, wherein the 4-lBB agonist is PRS-343.
76. The method of claim 68, wherein the 4-lBB agonist is an antibody that specifically binds 4-lBB.
77. The method of claim 76, wherein the antibody that binds 4-lBB is PF-2566 (PF-05082566) or urelumab (BMS-663513).
78. The method of claim 68, wherein the CD27 agonist is an antibody that specifically binds CD27.
79. The method of claim 78, wherein the antibody that binds CD27 is varlilumab (CDX-1 127).
80. The method of claim 68, wherein the GITR agonist comprises GITR ligand or a GITR-binding portion thereof.
81. The method of claim 68, wherein the GITR agonist is an antibody that specifically binds GITR.
82. The method of claim 81 , wherein the antibody that binds GITR is TRX518, MK-4166, or
INBRX-110.
83. The method of any one of claims 1-43, wherein the immunotherapeutic agent is a cytokine.
84. The method of claim 83, wherein the cytokine is a chemokine, an interferon, an interleukin, lymphokine, or a member of the tumor necrosis factor family.
85. The method of claim 83, wherein the cytokine is IL-2, IL 15, or interferon-gamma.
86. The method of any one of claims 1 and 8-85, wherein the cancer is selected from the group
consisting of lung cancer, pancreatic cancer, breast cancer, colon cancer, colorectal cancer, melanoma, gastrointestinal cancer, gastric cancer, renal cancer, ovarian cancer, liver cancer, endometrial cancer, kidney cancer, prostate cancer, thyroid cancer, neuroblastoma, glioma, glioblastoma, glioblastoma multiforme, cervical cancer, stomach cancer, bladder cancer, head and neck cancer, and hepatoma.
87. The method of any one of claims 2, 4-6, and 9-85, wherein the tumor is selected from the group consisting of lung tumor, pancreatic tumor, breast tumor, colon tumor, colorectal tumor, melanoma, gastrointestinal tumor, gastric tumor, renal tumor, ovarian tumor, liver tumor, endometrial tumor, kidney tumor, prostate tumor, thyroid tumor, neuroblastoma, glioma, glioblastoma, glioblastoma multiforme, cervical tumor, stomach tumor, bladder tumor, head and neck tumor, and hepatoma.
88. The method of any one of claims 1, 2, 4-6, and 8-87, wherein the subject's cancer or tumor does not respond to an immune checkpoint inhibitor.
89. The method of any one of claims 1, 2, 4-6, and 8-87, wherein the subject's cancer or tumor has progressed following an initial response to an immune checkpoint inhibitor.
90. The method of claim 88 or 89, where the immune checkpoint inhibitor is PD-1 antagonist or PD- Ll antagonist therapy.
91. The method of any one of claims 1-90, wherein the subject is a human.
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201562212471P | 2015-08-31 | 2015-08-31 | |
US62/212,471 | 2015-08-31 |
Publications (2)
Publication Number | Publication Date |
---|---|
WO2017040660A1 true WO2017040660A1 (en) | 2017-03-09 |
WO2017040660A4 WO2017040660A4 (en) | 2017-04-06 |
Family
ID=58188203
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2016/049697 WO2017040660A1 (en) | 2015-08-31 | 2016-08-31 | Combination therapy for treatment of disease |
Country Status (1)
Country | Link |
---|---|
WO (1) | WO2017040660A1 (en) |
Cited By (9)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2018049474A1 (en) * | 2016-09-16 | 2018-03-22 | Bionomics Limited | Antibody and checkpoint inhibitor combination therapy |
WO2019192403A1 (en) * | 2018-04-02 | 2019-10-10 | 上海邦耀生物科技有限公司 | Lgr4/rspo blocker and anti-immune checkpoint inhibitor jointly used for tumor immunotherapy |
US10441654B2 (en) | 2014-01-24 | 2019-10-15 | Children's Hospital Of Eastern Ontario Research Institute Inc. | SMC combination therapy for the treatment of cancer |
CN110903391A (en) * | 2019-10-25 | 2020-03-24 | 东大生物技术(苏州)有限公司 | Group of PD-L1 monoclonal antibodies and medical application thereof |
CN111315398A (en) * | 2017-11-10 | 2020-06-19 | 阿尔莫生物科技股份有限公司 | Compositions and methods of use of interleukin-10 in combination with an immune checkpoint pathway inhibitor |
WO2021011501A1 (en) * | 2019-07-12 | 2021-01-21 | Oregon Health & Science University | Therapeutic constructs for co-delivery of mitotic kinase inhibitor and immune checkpoint inhibitor |
CN112646029A (en) * | 2020-12-30 | 2021-04-13 | 深圳清华大学研究院 | Antibody of mature brain-derived neurotrophic factor, application thereof and diagnostic kit |
US11235058B2 (en) | 2019-07-12 | 2022-02-01 | Oregon Health & Science University | Immunotherapeutic constructs and methods of their use |
US11401339B2 (en) | 2018-08-23 | 2022-08-02 | Seagen Inc. | Anti-TIGIT antibodies |
Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2009005809A2 (en) * | 2007-07-02 | 2009-01-08 | Oncomed Pharmaceuticals, Inc. | Compositions and methods for treating and diagnosing cancer |
US20130095116A1 (en) * | 2011-07-15 | 2013-04-18 | Oncomed Pharmaceuticals, Inc. | RSPO Binding Agents and Uses Thereof |
US20140017253A1 (en) * | 2012-07-13 | 2014-01-16 | Oncomed Pharmaceuticals, Inc | RSPO3 Binding Agents and Uses Thereof |
US20150210769A1 (en) * | 2014-01-24 | 2015-07-30 | Novartis Ag | Antibody molecules to pd-1 and uses thereof |
-
2016
- 2016-08-31 WO PCT/US2016/049697 patent/WO2017040660A1/en active Application Filing
Patent Citations (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2009005809A2 (en) * | 2007-07-02 | 2009-01-08 | Oncomed Pharmaceuticals, Inc. | Compositions and methods for treating and diagnosing cancer |
US20090074782A1 (en) * | 2007-07-02 | 2009-03-19 | Austin Gurney | Compositions and Methods for Treating and Diagnosing Cancer |
US20130095116A1 (en) * | 2011-07-15 | 2013-04-18 | Oncomed Pharmaceuticals, Inc. | RSPO Binding Agents and Uses Thereof |
US20140017253A1 (en) * | 2012-07-13 | 2014-01-16 | Oncomed Pharmaceuticals, Inc | RSPO3 Binding Agents and Uses Thereof |
US20150210769A1 (en) * | 2014-01-24 | 2015-07-30 | Novartis Ag | Antibody molecules to pd-1 and uses thereof |
Non-Patent Citations (1)
Title |
---|
CURIEL ET AL.: "Regulatory T cells and treatment of cancer", CURR OPIN IMMUNOL., vol. 20, no. 2, April 2008 (2008-04-01), pages 241 - 246, XP022710086 * |
Cited By (16)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US10441654B2 (en) | 2014-01-24 | 2019-10-15 | Children's Hospital Of Eastern Ontario Research Institute Inc. | SMC combination therapy for the treatment of cancer |
WO2018049474A1 (en) * | 2016-09-16 | 2018-03-22 | Bionomics Limited | Antibody and checkpoint inhibitor combination therapy |
US11655304B2 (en) | 2016-09-16 | 2023-05-23 | Bionomics Limited | Antibody and checkpoint inhibitor combination therapy |
CN111315398A (en) * | 2017-11-10 | 2020-06-19 | 阿尔莫生物科技股份有限公司 | Compositions and methods of use of interleukin-10 in combination with an immune checkpoint pathway inhibitor |
CN110339364A (en) * | 2018-04-02 | 2019-10-18 | 上海邦耀生物科技有限公司 | LGR4/RSPO blocking agent combines the immunization therapy for tumour with anti-immunity checkpoint inhibitor |
CN110339364B (en) * | 2018-04-02 | 2021-02-12 | 上海邦耀生物科技有限公司 | LGR4/RSPO blockers in combination with anti-immune checkpoint inhibitors for immunotherapy of tumors |
WO2019192403A1 (en) * | 2018-04-02 | 2019-10-10 | 上海邦耀生物科技有限公司 | Lgr4/rspo blocker and anti-immune checkpoint inhibitor jointly used for tumor immunotherapy |
US11401339B2 (en) | 2018-08-23 | 2022-08-02 | Seagen Inc. | Anti-TIGIT antibodies |
WO2021011501A1 (en) * | 2019-07-12 | 2021-01-21 | Oregon Health & Science University | Therapeutic constructs for co-delivery of mitotic kinase inhibitor and immune checkpoint inhibitor |
US11679082B2 (en) | 2019-07-12 | 2023-06-20 | Oregon Health & Science University | Therapeutic constructs for co-delivery of mitotic kinase inhibitor and immune checkpoint inhibitor |
US11224573B2 (en) | 2019-07-12 | 2022-01-18 | Oregon Health & Science University | Therapeutic constructs for co-delivery of mitotic kinase inhibitor and immune checkpoint inhibitor |
US11235058B2 (en) | 2019-07-12 | 2022-02-01 | Oregon Health & Science University | Immunotherapeutic constructs and methods of their use |
CN114096280A (en) * | 2019-07-12 | 2022-02-25 | 俄勒冈健康与科学大学 | Therapeutic constructs for co-delivery of mitotic kinase inhibitors and immune checkpoint inhibitors |
CN110903391A (en) * | 2019-10-25 | 2020-03-24 | 东大生物技术(苏州)有限公司 | Group of PD-L1 monoclonal antibodies and medical application thereof |
CN110903391B (en) * | 2019-10-25 | 2021-05-28 | 东大生物技术(苏州)有限公司 | Group of PD-L1 monoclonal antibodies and medical application thereof |
CN112646029A (en) * | 2020-12-30 | 2021-04-13 | 深圳清华大学研究院 | Antibody of mature brain-derived neurotrophic factor, application thereof and diagnostic kit |
Also Published As
Publication number | Publication date |
---|---|
WO2017040660A4 (en) | 2017-04-06 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US10544219B2 (en) | TIGIT-binding agents and uses thereof | |
US20210403553A1 (en) | Combination therapy for treatment of disease | |
US20180346571A1 (en) | Pd-l1-binding agents and uses thereof | |
WO2018017864A2 (en) | Pvrig-binding agents and uses thereof | |
CA2975596A1 (en) | Tnfrsf-binding agents and uses thereof | |
WO2017040660A1 (en) | Combination therapy for treatment of disease | |
US20180222958A1 (en) | Lymphotoxin-beta receptor-binding agents, targeting antibodies, and uses thereof | |
US20170266276A1 (en) | Combination Therapy For Treatment of Cancer | |
US20180244783A1 (en) | Combination therapy for treatment of disease | |
US20170044268A1 (en) | Immunotherapy with Binding Agents | |
EP3185884A1 (en) | Combination therapy for treatment of cancer | |
EP2968554A1 (en) | Met-binding agents and uses thereof | |
US20170267758A1 (en) | Immunotherapy with binding agents | |
WO2016025797A1 (en) | Rspo1 binding agents and uses thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 16842902 Country of ref document: EP Kind code of ref document: A1 |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
122 | Ep: pct application non-entry in european phase |
Ref document number: 16842902 Country of ref document: EP Kind code of ref document: A1 |