US20160145325A1 - Agrochemical compositions comprising antibodies binding to sphingolipids - Google Patents

Agrochemical compositions comprising antibodies binding to sphingolipids Download PDF

Info

Publication number
US20160145325A1
US20160145325A1 US14/787,454 US201414787454A US2016145325A1 US 20160145325 A1 US20160145325 A1 US 20160145325A1 US 201414787454 A US201414787454 A US 201414787454A US 2016145325 A1 US2016145325 A1 US 2016145325A1
Authority
US
United States
Prior art keywords
seq
region
cdr1
cdr2
cdr3
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
US14/787,454
Other languages
English (en)
Inventor
Peter Verheesen
Chris De Jonghe
Inge Elodie Van Daele
Miguel Francesco Coleta De Bolle
João Filipe Veloso Vieira
Karin Thevissen
Bruno Cammue
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Biotalys NV
Original Assignee
Agrosavfe NV
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Agrosavfe NV filed Critical Agrosavfe NV
Priority to US14/787,454 priority Critical patent/US20160145325A1/en
Assigned to AGROSAVFE N.V. reassignment AGROSAVFE N.V. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: DE BOLLE, MIGUEL FRANCESCO COLETA, DE JONGHE, CHRIS, CAMMUE, BRUNO, THEVISSEN, KARIN, VAN DAELE, Inge Elodie, VELOSO VIEIRA, João Filipe, VERHEESEN, PETER
Publication of US20160145325A1 publication Critical patent/US20160145325A1/en
Abandoned legal-status Critical Current

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/14Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from fungi, algea or lichens
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01NPRESERVATION OF BODIES OF HUMANS OR ANIMALS OR PLANTS OR PARTS THEREOF; BIOCIDES, e.g. AS DISINFECTANTS, AS PESTICIDES OR AS HERBICIDES; PEST REPELLANTS OR ATTRACTANTS; PLANT GROWTH REGULATORS
    • A01N37/00Biocides, pest repellants or attractants, or plant growth regulators containing organic compounds containing a carbon atom having three bonds to hetero atoms with at the most two bonds to halogen, e.g. carboxylic acids
    • A01N37/44Biocides, pest repellants or attractants, or plant growth regulators containing organic compounds containing a carbon atom having three bonds to hetero atoms with at the most two bonds to halogen, e.g. carboxylic acids containing at least one carboxylic group or a thio analogue, or a derivative thereof, and a nitrogen atom attached to the same carbon skeleton by a single or double bond, this nitrogen atom not being a member of a derivative or of a thio analogue of a carboxylic group, e.g. amino-carboxylic acids
    • A01N37/46N-acyl derivatives
    • A01N63/02
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01NPRESERVATION OF BODIES OF HUMANS OR ANIMALS OR PLANTS OR PARTS THEREOF; BIOCIDES, e.g. AS DISINFECTANTS, AS PESTICIDES OR AS HERBICIDES; PEST REPELLANTS OR ATTRACTANTS; PLANT GROWTH REGULATORS
    • A01N63/00Biocides, pest repellants or attractants, or plant growth regulators containing microorganisms, viruses, microbial fungi, animals or substances produced by, or obtained from, microorganisms, viruses, microbial fungi or animals, e.g. enzymes or fermentates
    • A01N63/10Animals; Substances produced thereby or obtained therefrom
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01NPRESERVATION OF BODIES OF HUMANS OR ANIMALS OR PLANTS OR PARTS THEREOF; BIOCIDES, e.g. AS DISINFECTANTS, AS PESTICIDES OR AS HERBICIDES; PEST REPELLANTS OR ATTRACTANTS; PLANT GROWTH REGULATORS
    • A01N63/00Biocides, pest repellants or attractants, or plant growth regulators containing microorganisms, viruses, microbial fungi, animals or substances produced by, or obtained from, microorganisms, viruses, microbial fungi or animals, e.g. enzymes or fermentates
    • A01N63/50Isolated enzymes; Isolated proteins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/10Antimycotics
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/82Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
    • C12N15/8241Phenotypically and genetically modified plants via recombinant DNA technology
    • C12N15/8261Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield
    • C12N15/8271Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance
    • C12N15/8279Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance for biotic stress resistance, pathogen resistance, disease resistance
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/22Immunoglobulins specific features characterized by taxonomic origin from camelids, e.g. camel, llama or dromedary
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/569Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding

Definitions

  • the present invention relates to effecting control of plant pests. More specifically the invention provides agrochemical compositions comprising polypeptide compositions of a specific length and concentration which are useful to combat crop pests such as insects, fungi, nematodes, bacteria and the like.
  • Crop protection required for effective agriculture, relies heavily on the use of pesticides, which are applied to the crops by spraying them onto the crop, applying during watering of the crops or incorporating them into the soil.
  • Pesticides are often organic chemical molecules and their repeated application to crops poses toxicity threats to both agricultural workers during handling and to the environment, due to spray drift, persistence in the soil or washing off into surface or ground water. It would be advantageous to be able to use alternative compounds that are less toxic to humans and the environment, but that at the same time provide effective control of plant pests.
  • Proteinaceous pesticides with specificity against a certain plant pest target may be very advantageous in this respect, as they are expected to be short-lived in the environment and to have less toxic off-target effects.
  • proteinaceous or peptidergic pesticides there are only a few proteinaceous or peptidergic pesticides known. Some examples are Bt toxins, lectins, defensins, fabatins, tachyplesin, magainin, harpin (see WO2010019442), pea albumin 1-subunit b (PA1b).
  • these proteinaceous pesticides are either small peptides with compact structures, stabilized by several disulphide bridges, or are larger proteins (>300 amino acids) which occur in crystalline form (cry toxins). It is indeed known in the field of agriculture that biologicals, and in particular proteins, are challenging structures for developing pesticides, as they generally have far too little stability to maintain their pesticidal function in an agrochemical formulation, in particular for applications in the field.
  • the present inventors have successfully developed polypeptides with surprisingly high specificity, affinity and potency against targets of plant or crop pests, in particular plant pathogenic pests, such as but not limited to plant pathogenic fungi. Moreover, it is shown that these polypeptides retain their integrity, stability and activity in an agrochemical composition (as further defined herein) and that efficacious pest or pathogenic control can surprisingly be achieved by applying agrochemical compositions, comprising the polypeptides as disclosed in the present application, to crops.
  • the efficacy and potency of the polypeptides as disclosed herein suggests a potential for either a lower treatment dosage and/or a more effective treatment at the same dose. This can imply a reduction of unwanted side-effects and reduced toxicity. Moreover, this allows the application of lower amounts of the polypeptides or agrochemical compositions disclosed herein per hectare.
  • the present inventors have found that targeting a molecular structure of a plant pathogen with the polypeptides envisaged herein allows for efficient control of that pathogen when applied directly or indirectly on a plant or on one or more parts of a plant.
  • the present inventors have developed polypeptides or amino acid sequences that are capable of preventing, protecting, treating or curing a plant from (developing) an infection by a plant pathogen or from any other biological interaction with a plant pathogen. Therefore, the present invention demonstrates for the first time that biological molecules, such as polypeptides or amino acid sequences, can be used to effectively protect or treat a plant, from being damaged in any way by or suffering from a biological interaction between the plant and a plant pathogen, such as for instance through a plant pathogen infection.
  • the present invention provides agrochemical compositions comprising at least one heavy chain variable domain of an antibody (a V HH or a V H ) or a functional fragment thereof, which specifically binds to a sphingolipid of a plant pathogen.
  • the agrochemical compositions as disclosed herein comprise at least one a heavy chain variable domain of a heavy chain antibody (V HH ), which is naturally devoid of light chains or a functional fragment thereof, such as but not limited to a heavy chain variable domain of a camelid heavy chain antibody (camelid V HH ) or a functional fragment thereof.
  • V HH heavy chain antibody
  • the agrochemical compositions as disclosed herein comprise at least one camelized heavy chain variable domain of a conventional four-chain antibody (camelized V H ), or a functional fragment thereof.
  • the agrochemical compositions as disclosed herein comprise at least one heavy chain variable domain of an antibody or a functional fragment thereof, which do not have an amino acid sequence that is exactly the same as (i.e. as in a degree of sequence identity of 100% with) the amino acid sequence of a naturally occurring V H domain, such as the amino acid sequence of a naturally occurring V H domain from a mammal, and in particular from a human being.
  • the agrochemical compositions as disclosed herein at least comprise a heavy chain variable domain of an antibody or a functional fragment thereof, which specifically binds to a sphingolipid of a plant pathogen, such as for instance but not limited to glucosylceramide.
  • the agrochemical compositions as disclosed herein at least comprise a heavy chain variable domain of an antibody or a functional fragment thereof, which specifically binds to a plant pathogenic fungus, such as but not limited to a plant pathogenic fungus of a genus chosen from the group comprising Alternaria, Ascochyta, Botrytis, Cercospora, Colletotrichum, Diplodia, Erysiphe, Fusarium, Leptosphaeria, Gaeumanomyces, Helminthosporium, Macrophomina, Nectria, Penicillium, Peronospora, Phoma, Phymatotrichum, Phytophthora, Plasmopara, Podosphaera, Puccinia, Pyrenophora, Pyricularia, Pythium, Rhizoctonia, Scerotium, Sclerotinia, Septoria, Thielaviopsis, Uncinula, Venturia, Verticill
  • the agrochemical compositions as disclosed herein at least comprise a heavy chain variable domain of an antibody or a functional fragment thereof, which specifically binds to a plant pathogen, which is a plant pathogen for a plant chosen from the group comprising cereals, sorghum, rice, sugar beet, fodder beet, fruit, nuts, the plantain family or grapevines, leguminous crops, oil crops, cucurbits, fibre plants, fuel crops, vegetables, ornamentals, shrubs, broad-leaved trees, evergreens, grasses, coffee, tea, tobacco, hops, pepper, rubber and latex plants.
  • a plant pathogen which is a plant pathogen for a plant chosen from the group comprising cereals, sorghum, rice, sugar beet, fodder beet, fruit, nuts, the plantain family or grapevines, leguminous crops, oil crops, cucurbits, fibre plants, fuel crops, vegetables, ornamentals, shrubs, broad-leaved trees, evergreen
  • the at least one heavy chain variable domain of an antibody or functional fragment thereof in the agrochemical compositions disclosed herein is present in an amount effective to protect or treat a plant or a part of the plant from an infection or other biological interaction with the plant pathogen, such as for example but not limited to the concentration of the at least one heavy chain variable domain in the agrochemical composition ranging from 0.0001% to 50% by weight.
  • the at least one heavy chain variable domain of an antibody or functional fragment thereof in the agrochemical compositions disclosed herein is formulated in an aqueous solution, optionally but without limitation together with an agrochemically suitable carrier and/or one or more suitable adjuvants.
  • the at least one heavy chain variable domain of an antibody or functional fragment thereof in the agrochemical compositions disclosed herein at least comprises:
  • the at least one heavy chain variable domain of an antibody or functional fragment thereof in the agrochemical compositions disclosed herein at least comprises an amino acid sequence having a sequence chosen from any one of SEQ ID NO's: 1 to 84.
  • the present invention provides methods for protecting or treating a plant or a part of a plant from an infection or other biological interaction with a plant pathogen, wherein the methods at least comprise the step of applying directly or indirectly to the plant or to a part of the plant, an agrochemical composition as disclosed herein, under conditions effective to protect or treat the plant or a part of the plant against infection or biological interaction with the plant pathogen.
  • these methods comprise applying directly or indirectly to the plant or to a part of the plant an agrochemical composition as disclosed herein at an application rate higher than 50 g of the agrochemical composition per hectare, such as but not limited to an application rate higher than 75 g of the agrochemical composition per hectare, such as an application rate higher than 100 g of the agrochemical composition per hectare, or in particular an application rate higher than 200 g of the agrochemical composition per hectare.
  • these methods comprise applying directly or indirectly to the plant or to a part of the plant an agrochemical composition as disclosed herein at an application rate between 50 g and 100 g of the agrochemical composition per hectare, such as but not limited to an application rate of between 50 g and 200 g of the agrochemical composition per hectare, in particular an application rate of between 75 g and 175 g of the agrochemical composition per hectare, such as between 75 g and 150 g of the agrochemical composition per hectare or between 75 g and 125 g per hectare.
  • the agrochemical compositions as disclosed herein are directly or indirectly applied to the plant or to a part of the plant by spraying, atomizing, foaming, fogging, culturing in hydroculture, culturing in hydroponics, coating, submerging, and/or encrusting, optionally post-harvest.
  • the present invention provides post-harvest treatment methods for protecting or treating a harvested plant or a harvested part of the plant from an infection or other biological interaction with a plant pathogen, at least comprising the step of applying directly or indirectly to the harvested plant or to a harvested part of the plant, an agrochemical composition as disclosed herein, under conditions effective to protect or treat the harvested plant or a harvested part of the plant against infection or biological interaction with the plant pathogen.
  • the present invention provides the use of an agrochemical composition as disclosed herein as an anti-pest agent.
  • the anti-pest agent is a biostatic agent, a fungistatic agent, a pesticidal agent and/or a fungicidal agent.
  • the present invention provides methods of inhibiting the growth of a plant pathogen or methods of killing a plant pathogen, the methods comprising at least the step of applying directly or indirectly to a plant or to a part of the plant, an agrochemical composition as disclosed herein.
  • the agrochemical compositions as disclosed herein are directly or indirectly applied to the plant or to a part of the plant by spraying, atomizing, foaming, fogging, culturing in hydroculture, culturing in hydroponics, coating, submerging, and/or encrusting, optionally post-harvest.
  • the present invention provides methods for producing an agrochemical composition as disclosed herein, the methods at least comprising the steps of:
  • the step of obtaining at least one heavy chain variable domain of an antibody (V HH or V H ) or functional fragment thereof, which specifically binds to a sphingolipid of a plant pathogen comprises:
  • variable domain or functional fragment thereof (a) expressing a nucleotide sequence encoding a heavy chain variable domain of an antibody or functional fragment thereof, which specifically binds to a sphingolipid of a plant pathogen, and optionally (b) isolating and/or purifying the variable domain or functional fragment thereof.
  • the step of obtaining at least one heavy chain variable domain of an antibody or functional fragment thereof (V HH or V H ), which specifically binds to a sphingolipid of a plant pathogen comprises:
  • An agrochemical composition for combating plant pests which composition comprises at least one polypeptide of between 80 and 200 amino acids as the active substance.
  • An agrochemical composition for combating plant pests which composition comprises at least one polypeptide of between 80 and 200 amino acids as the active substance, wherein the polypeptide is present in a concentration of 0.01 to 50% (w/w) of the total weight of the agrochemical composition.
  • the agrochemical composition according to statements 1 or 2 wherein the polypeptide is obtained by affinity selection to a specific plant pest target.
  • the agrochemical composition according to statement 3 wherein the polypeptide has an affinity for the target with a dissociation constant below 10 ⁇ 6 M. 5.
  • a method for combating plant pests which method comprises applying the composition according to any of the statements 1 to 8 to a crop at an application rate higher than 50 g per hectare of the polypeptide comprised in the agrochemical composition. 10.
  • the method for producing an agrochemical composition comprising formulating a polypeptide of between 80 and 200 amino acids with pesticidal activity together with at least one customary agrochemical auxiliary agent.
  • 12. A nucleic acid sequence encoding a polypeptide according to statement 11.
  • a chimeric gene comprising a plant expressible promoter, a nucleic acid sequence according to statement 12 and a terminator sequence.
  • a recombinant vector comprising a chimeric gene of statement 13. 15.
  • a plant comprising a chimeric gene as defined in statement 14.
  • An agrochemical composition comprising at least one heavy chain variable domain of an antibody (V HH or V H ) or a functional fragment thereof, which specifically binds to a sphingolipid of a plant pathogen.
  • genus of the plant pathogenic fungus is chosen from the group comprising Alternaria, Ascochyta, Botrytis, Cercospora, Colletotrichum, Diplodia, Erysiphe, Fusarium, Leptosphaeria, Gaeumanomyces, Helminthosporium, Macrophomina, Nectria, Penicillium, Peronospora, Phoma, Phymatotrichum, Phytophthora, Plasmopara, Podosphaera, Puccinia, Pyrenophora, Pyricularia, Pythium, Rhizoctonia, Scerotium, Sclerotinia, Septoria, Thielaviopsis, Uncinula, Venturia, Verticillium, Magnaporthe, Blumeria, Mycosphaerella, Ustilago, Melampsora, Phakospora, Moni
  • 32. A method for protecting or treating a plant or a part of the plant from an infection or other biological interaction with a plant pathogen, at least comprising the step of applying directly or indirectly to the plant or to a part of the plant, an agrochemical composition according to any of the statements 1 to 8 and 17 to 31, under conditions effective to protect or treat the plant or a part of the plant against the infection or biological interaction with the plant pathogen.
  • a method according to statement 9 for protecting or treating a plant or a part of the plant from an infection or other biological interaction with a plant pathogen at least comprising the step of applying directly or indirectly to the plant or to a part of the plant, an agrochemical composition according to any of the statements 1 to 8 and 17 to 31, under conditions effective to protect or treat the plant or a part of the plant against the infection or biological interaction with the plant pathogen.
  • the method according to any of the statements 9, 32 or 33 comprising applying directly or indirectly to the plant or to a part of the plant an agrochemical composition according to any one of statements 1 to 8 and 17 to 31 at an application rate higher than 50 g of the agrochemical composition per hectare. 35.
  • a post-harvest treatment method for protecting or treating a harvested plant or a harvested part of the plant from an infection or other biological interaction with a plant pathogen at least comprising the step of applying directly or indirectly to the harvested plant or to a harvested part of the plant, an agrochemical composition according to any one of statements 1 to 8 and 17 to 31, under conditions effective to protect or treat the harvested plant or a harvested part of the plant against the infection or biological interaction with the plant pathogen.
  • 38. Use of an agrochemical composition according to any one of statements 1 to 8 and 17 to 31 as an anti-pest agent.
  • 39. The use according to statement 38, wherein the anti-pest agent is a biostatic agent. 40.
  • anti-pest agent is a fungistatic agent. 41. The use according to statement 38, wherein the anti-pest agent is a pesticidal agent. 42. The use according to statements 38 or 41, wherein the anti-pest agent is a fungicidal agent. 43. A method of inhibiting the growth of a plant pathogen, comprising at least the step of applying directly or indirectly to a plant or to a part of the plant, an agrochemical composition according to any one of statements 1 to 8 and 17 to 31. 44.
  • a method of killing a plant pathogen comprising at least the step of applying directly or indirectly to a plant or to a part of the plant, an agrochemical composition according to any one of statements 1 to 8 and 17 to 31.
  • 45. The method according to statements 43 or 44, wherein the agrochemical composition is directly or indirectly applied to the plant or to a part of the plant by spraying, atomizing, foaming, fogging, culturing in hydroculture, culturing in hydroponics, coating, submerging, and/or encrusting.
  • 46. The method according to any one of statements 43 to 45, wherein the agrochemical composition is directly or indirectly applied to the plant or to a part of the plant, optionally post-harvest.
  • polypeptide As used herein, the terms “polypeptide”, “protein”, “peptide”, and “amino acid sequence” are used interchangeably, and refer to a polymeric form of amino acids of any length, which can include coded and non-coded amino acids, chemically or biochemically modified or derivatized amino acids, and polypeptides having modified peptide backbones.
  • amino acid residues will be indicated either by their full name or according to the standard three-letter or one-letter amino acid code.
  • nucleic acid molecule As used herein, the terms “nucleic acid molecule”, “polynucleotide”, “polynucleic acid”, “nucleic acid” are used interchangeably and refer to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides, or analogs thereof. Polynucleotides may have any three-dimensional structure, and may perform any function, known or unknown.
  • Non-limiting examples of polynucleotides include a gene, a gene fragment, exons, introns, messenger RNA (mRNA), transfer RNA, ribosomal RNA, ribozymes, cDNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, control regions, isolated RNA of any sequence, nucleic acid probes, and primers.
  • the nucleic acid molecule may be linear or circular.
  • the term “homology” denotes at least secondary structural similarity between two macromolecules, particularly between two polypeptides or polynucleotides, from same or different taxons, wherein said similarity is due to shared ancestry.
  • the term “homologues” denotes so-related macromolecules having said secondary and optionally tertiary structural similarity.
  • nucleic acid sequences are said to be “exactly the same” if they have 100% sequence identity over their entire length.
  • CDR complementarity determining region
  • variable regions of either the H (heavy) or the L (light) chains (also abbreviated as VH and VL, respectively) and contain the amino acid sequences capable of specifically binding to antigenic targets.
  • CDR regions account for the basic specificity of the antibody for a particular antigenic determinant structure. Such regions are also referred to as “hypervariable regions.”
  • the CDRs represent non-contiguous stretches of amino acids within the variable regions but, regardless of species, the positional locations of these critical amino acid sequences within the variable heavy and light chain regions have been found to have similar locations within the amino acid sequences of the variable chains.
  • the variable heavy and light chains of all canonical antibodies each have 3 CDR regions, each non-contiguous with the others (termed L1, L2, L3, H1, H2, H3) for the respective light (L) and heavy (H) chains.
  • affinity refers to the degree to which a polypeptide, in particular an immunoglobulin, such as an antibody, or an immunoglobulin fragment, such as a VHH, binds to an antigen so as to shift the equilibrium of antigen and polypeptide toward the presence of a complex formed by their binding.
  • an antigen and antibody (fragment) are combined in relatively equal concentration, an antibody (fragment) of high affinity will bind to the available antigen so as to shift the equilibrium toward high concentration of the resulting complex.
  • the dissociation constant is commonly used to describe the affinity between the protein binding domain and the antigenic target.
  • the dissociation constant is lower than 10 ⁇ 6 M.
  • the dissociation constant is lower than 10 ⁇ 6 M, more preferably, lower than 10 ⁇ 7 M.
  • the dissociation constant is lower than 10 ⁇ 8 M.
  • telomere binding generally refers to the ability of a polypeptide, in particular an immunoglobulin, such as an antibody, or an immunoglobulin fragment, such as a VHH, to preferentially bind to a particular antigen that is present in a homogeneous mixture of different antigens.
  • a specific binding interaction will discriminate between desirable and undesirable antigens in a sample, in some embodiments more than about 10 to 100-fold or more (e.g., more than about 1000- or 10,000-fold).
  • an amino acid sequence as disclosed herein is said to “specifically bind to” a particular target when that amino acid sequence has affinity for, specificity for and/or is specifically directed against that target (or for at least one part or fragment thereof).
  • the “specificity” of an amino acid sequence as disclosed herein can be determined based on affinity and/or avidity.
  • an amino acid sequence as disclosed herein is said to be “specific for a first target antigen of interest as opposed to a second target antigen of interest” when it binds to the first target antigen of interest with an affinity that is at least 5 times, such as at least 10 times, such as at least 100 times, and preferably at least 1000 times higher than the affinity with which that amino acid sequence as disclosed herein binds to the second target antigen of interest. Accordingly, in certain embodiments, when an amino acid sequence as disclosed herein is said to be “specific for” a first target antigen of interest as opposed to a second target antigen of interest, it may specifically bind to (as defined herein) the first target antigen of interest, but not to the second target antigen of interest.
  • the terms “inhibiting”, “reducing” and/or “preventing” may refer to (the use of) an amino acid sequence as disclosed herein that specifically binds to a target antigen of interest and inhibits, reduces and/or prevents the interaction between that target antigen of interest, and its natural binding partner.
  • the terms “inhibiting”, “reducing” and/or “preventing” may also refer to (the use of) an amino acid sequence as disclosed herein that specifically binds to a target antigen of interest and inhibits, reduces and/or prevents a biological activity of that target antigen of interest, as measured using a suitable in vitro, cellular or in vivo assay.
  • “inhibiting”, “reducing” and/or “preventing” may also refer to (the use of) an amino acid sequence as disclosed herein that specifically binds to a target antigen of interest and inhibits, reduces and/or prevents one or more biological or physiological mechanisms, effects, responses, functions pathways or activities in which the target antigen of interest is involved.
  • Such an action of the amino acid sequence as disclosed herein as an antagonist may be determined in any suitable manner and/or using any suitable (in vitro and usually cellular or in vivo) assay known in the art, depending on the target antigen of interest.
  • “inhibiting”, “reducing” and/or “preventing” using amino acid sequence as disclosed herein may mean either inhibiting, reducing and/or preventing the interaction between a target antigen of interest and its natural binding partner, or, inhibiting, reducing and/or preventing the activity of a target antigen of interest, or, inhibiting, reducing and/or preventing one or more biological or physiological mechanisms, effects, responses, functions pathways or activities in which the target antigen of interest is involved, such as by at least 10%, but preferably at least 20%, for example by at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% or more, as measured using a suitable in vitro, cellular or in vivo assay, compared to the activity of the target antigen of interest in the same assay under the same conditions but without using the amino acid sequence as disclosed herein.
  • “inhibiting”, “reducing” and/or “preventing” may also mean inducing a decrease in affinity, avidity, specificity and/or selectivity of a target antigen of interest for one or more of its natural binding partners and/or inducing a decrease in the sensitivity of the target antigen of interest for one or more conditions in the medium or surroundings in which the target antigen of interest is present (such as pH, ion strength, the presence of co-factors, etc.), compared to the same conditions but without the presence of the amino acid sequence as disclosed herein.
  • “inhibiting”, “reducing” and/or “preventing” may also involve allosteric inhibition, reduction and/or prevention of the activity of a target antigen of interest.
  • the inhibiting or antagonizing activity or the enhancing or agonizing activity of an amino acid sequence as disclosed herein may be reversible or irreversible, but for agrochemical applications will typically occur reversibly.
  • amino acid sequence as disclosed herein is considered to be “(in) essentially isolated (form)” as used herein, when it has been extracted or purified from the host cell and/or medium in which it is produced.
  • binding region In respect of the amino acid sequences as disclosed herein, the terms “binding region”, “binding site” or “interaction site” present on the amino acid sequences as disclosed herein shall herein have the meaning of a particular site, region, locus, part, or domain present on the target molecule, which particular site, region, locus, part, or domain is responsible for binding to that target molecule.
  • binding region thus essentially consists of that particular site, region, locus, part, or domain of the target molecule, which is in contact with the amino acid sequence when bound to that target molecule.
  • Plant as used herein, means live plants and live plant parts, including fresh fruit, vegetables and seeds. Also, the term “plant” as used herein encompasses whole plants, ancestors and progeny of the plants and plant parts, including seeds, shoots, stems, leaves, roots (including tubers), flowers, and tissues and organs, wherein each of the aforementioned comprise the gene/nucleic acid of interest. The term “plant” also encompasses plant cells, suspension cultures, callus tissue, embryos, meristematic regions, gametophytes, sporophytes, pollen and microspores, again wherein each of the aforementioned comprises the gene/nucleic acid of interest.
  • control plants are routine part of an experimental setup and may include corresponding wild type plants or corresponding plants without the gene of interest.
  • the control plant is typically of the same plant species or even of the same variety as the plant to be assessed.
  • the control plant may also be a nullizygote of the plant to be assessed. Nullizygotes are individuals missing the transgene by segregation.
  • a “control plant” as used herein refers not only to whole plants, but also to plant parts, including seeds and seed parts.
  • Crop as used herein means a plant species or variety that is grown to be harvested as food, livestock fodder, fuel raw material, or for any other economic purpose.
  • said crops can be maize, cereals, such as wheat, rye, barley and oats, sorghum, rice, sugar beet and fodder beet, fruit, such as pome fruit (e.g. apples and pears), citrus fruit (e.g. oranges, lemons, limes, grapefruit, or mandarins), stone fruit (e.g. peaches, nectarines or plums), nuts (e.g. almonds or walnuts), soft fruit (e.g.
  • cherries, strawberries, blackberries or raspberries the plantain family or grapevines, leguminous crops, such as beans, lentils, peas and soya, oil crops, such as sunflower, safflower, rapeseed, canola, castor or olives, cucurbits, such as cucumbers, melons or pumpkins, fibre plants, such as cotton, flax or hemp, fuel crops, such as sugarcane, miscanthus or switchgrass, vegetables, such as potatoes, tomatoes, peppers, lettuce, spinach, onions, carrots, egg-plants, asparagus or cabbage, ornamentals, such as flowers (e.g.
  • petunias petunias, pelargoniums, roses, tulips, lilies, or chrysanthemums
  • shrubs broad-leaved trees (e.g. poplars or willows) and evergreens (e.g. conifers), grasses, such as lawn, turf or forage grass or other useful plants, such as coffee, tea, tobacco, hops, pepper, rubber or latex plants.
  • a “pest”, as used here, is an organism that is harmful to plants, animals, humans or human concerns, and includes, but is not limited to crop pests (as later defined), household pests, such as cockroaches, ants, etc., and disease vectors, such as malaria mosquitoes.
  • plant pest refers to organisms that specifically cause damage to plants, plant parts or plant products, particularly plants, plant parts or plant products, used in agriculture.
  • plant pest or “crop pest” is used in the meaning that the pest targets and harms plants. Pests particularly belong to invertebrate animals (e.g. insects (including agricultural pest insects, insect pests of ornamental plants, insect pests of forests).
  • nematodes living freely in soil or particularly species that parasitize plant roots, such as root-knot nematode and cyst nematodes such as soybean cyst nematode and potato cyst nematode
  • mites such as spider mites, thread-footed mites and gall mites
  • gastropods including slugs such as Deroceras spp., Milax spp., Tandonia sp., Limax spp., Arion spp. and Veronicella spp.
  • snails such as Helix spp., Cernuella spp., Theba spp., Cochlicella spp., Achatina spp., Succinea spp., Ovachlamys spp., Amphibulima spp., Zachrysia spp., Bradybaena spp., and Pomacea spp.), pathogenic fungi (including Ascomycetes (such as Fusarium spp., Thielaviopsis spp., Verticillium spp., Magnaporthe spp.), Basidiomycetes (such as Rhizoctonia spp., Phakospora spp., Puccinia spp.), and fungal-like Oomycetes (such as Pythium spp.
  • Ascomycetes such as Fusarium spp., Thielaviopsis spp., Verticillium spp., Magna
  • bacteria such as Burkholderia spp. and Proteobacteria such as Xanthomonas spp. and Pseudomonas spp.
  • Phytoplasma Spiroplasma
  • viruses such as tobacco mosaic virus and cauliflower mosaic virus
  • Merobe as used herein, means bacterium, virus, fungus, yeast and the like and “microbial” means derived from a microbe.
  • “Fungus”, as used herein, means a eukaryotic organism, belonging to the group of Eumycota.
  • the term fungus in the present invention also includes fungal-like organisms such as the Oomycota.
  • Oomycota or oomycetes
  • This group was originally classified among the fungi but modern insights support a relatively close relationship with the photosynthetic organisms such as brown algae and diatoms, within the group of heterokonts.
  • Pest infection or “pest disease” as used herein refers to any inflammatory condition, disease or disorder in a living organism, such as a plant, animal or human, which is caused by a pest.
  • Fungal infection or “fungal disease” as used herein refers to any inflammatory condition, disease or disorder in a living organism, such as a plant, animal or human, which is caused by a fungus.
  • Active substance means any biological, biochemical or chemical element and its derivatives, fragments or compounds based thereon, including micro-organisms, having general or specific action against harmful organisms on a subject, and in particular on plants, parts of plants or on plant products, as they occur naturally or by manufacture, including any impurity inevitably resulting from the manufacturing process.
  • Agrochemical means suitable for use in the agrochemical industry (including agriculture, horticulture, floriculture and home and garden uses, but also products intended for non-crop related uses such as public health/pest control operator uses to control undesirable insects and rodents, household uses, such as household fungicides and insecticides and agents, for protecting plants or parts of plants, crops, bulbs, tubers, fruits (e.g. from harmful organisms, diseases or pests); for controlling, preferably promoting or increasing, the growth of plants; and/or for promoting the yield of plants, crops or the parts of plants that are harvested (e.g. its fruits, flowers, seeds etc.).
  • Such substances will be clear to the skilled person and may for example include compounds that are active as insecticides (e.g. contact insecticides or systemic insecticides, including insecticides for household use), herbicides (e.g. contact herbicides or systemic herbicides, including herbicides for household use), fungicides (e.g. contact fungicides or systemic fungicides, including fungicides for household use), nematicides (e.g.
  • nematicides or systemic nematicides including nematicides for household use
  • other pesticides or biocides for example agents for killing insects or snails
  • fertilizers growth regulators such as plant hormones; micro-nutrients, safeners, pheromones; repellants; insect baits; and/or active principles that are used to modulate (i.e. increase, decrease, inhibit, enhance and/or trigger) gene expression (and/or other biological or biochemical processes) in or by the targeted plant (e.g.
  • nucleic acids e.g., single stranded or double stranded RNA, as for example used in the context of RNAi technology
  • proteins, chemicals, etc. known per se for this purpose, etc.
  • agrochemicals examples include, without limitation: glyphosate, paraquat, metolachlor, acetochlor, mesotrione, 2,4-D,atrazine, glufosinate, sulfosate, fenoxaprop, pendimethalin, picloram, trifluralin, bromoxynil, clodinafop, fluroxypyr, nicosulfuron, bensulfuron, imazetapyr, dicamba, imidacloprid, thiamethoxam, fipronil, chlorpyrifos, deltamethrin, lambda-cyhalotrin, endosulfan, methamidophos, carbofuran, clothianidin, cypermethrin, abamectin, diflufenican, spinosad, indoxacarb, bifenthrin,
  • an “agrochemical composition” as used herein means a composition for agrochemical use, as further defined, comprising at least one active substance, optionally with one or more additives favoring optimal dispersion, atomization, deposition, leaf wetting, distribution, retention and/or uptake of agrochemicals. It will become clear from the further description herein that an agrochemical composition as used herein includes biological control agents or biological pesticides (including but not limited to biological biocidal, biostatic, fungistatic and fungicidal agents) and these terms will be interchangeably used in the present application.
  • an agrochemical composition as used herein includes compositions comprising at least one biological molecule as an active ingredient, substance or principle for controlling pests in plants or in other agro-related settings (such for example in soil).
  • biological molecules being used as active principles in the agrochemical compositions disclosed herein are proteins (including antibodies and fragments thereof, such as but not limited to heavy chain variable domain fragments of antibodies, including VHH's), nucleic acid sequences, (poly-)saccharides, lipids, vitamins, hormones glycolipids, sterols, and glycerolipids.
  • the additives in the agrochemical compositions disclosed herein may include but are not limited to diluents, solvents, adjuvants, surfactants, wetting agents, spreading agents, oils, stickers, thickeners, penetrants, buffering agents, acidifiers, anti-settling agents, anti-freeze agents, photo-protectors, defoaming agents, biocides and/or drift control agents.
  • a “biostatic composition” or a “biostatic agent” as used herein means any active ingredient, substance or principle or a composition comprising any active ingredient, substance or principle for biostatic use (as further defined herein) comprising at least one active biostatic substance or ingredient, optionally combined with one or more additives favoring optimal dispersion, atomization, deposition, leaf wetting, distribution, retention and/or uptake of the active substance or ingredient.
  • additives are diluents, solvents, adjuvants, (ionic) surfactants, wetting agents, spreading agents, oils, stickers, thickeners, penetrants, buffering agents, acidifiers, anti-settling agents, anti-freeze agents, photo-protectors, defoaming agents, biocides, protease inhibitors and/or drift control agents.
  • a “biocidal composition” or a “biocidal agent” as used herein means any active ingredient, substance or principle or a composition comprising any active ingredient, substance or principle for biocidal use (as further defined herein) comprising at least one active biocidal substance or ingredient, optionally combined with one or more additives favoring optimal dispersion, atomization, deposition, leaf wetting, distribution, retention and/or uptake of the active substance or ingredient.
  • additives are diluents, solvents, adjuvants, (ionic) surfactants, wetting agents, spreading agents, oils, stickers, thickeners, penetrants, buffering agents, acidifiers, anti-settling agents, anti-freeze agents, photo-protectors, defoaming agents, biocides, protease inhibitors and/or drift control agents.
  • a “fungistatic composition” or a “fungistatic agent” as used herein means any active ingredient, substance or principle or a composition comprising any active ingredient, substance or principle for fungistatic use (as further defined herein) comprising at least one active fungistatic substance or ingredient, optionally combined with one or more additives favoring optimal dispersion, atomization, deposition, leaf wetting, distribution, retention and/or uptake of the active substance or ingredient.
  • additives are diluents, solvents, adjuvants, (ionic) surfactants, wetting agents, spreading agents, oils, stickers, thickeners, penetrants, buffering agents, acidifiers, anti-settling agents, anti-freeze agents, photo-protectors, defoaming agents, biocides, protease inhibitors and/or drift control agents.
  • a “fungicidal composition” or a “fungicidal agent” as used herein means any active ingredient, substance or principle or a composition comprising any active ingredient, substance or principle for fungicidal use (as further defined herein) comprising at least one active fungicidal substance or ingredient, optionally combined with one or more additives favoring optimal dispersion, atomization, deposition, leaf wetting, distribution, retention and/or uptake of the active substance or ingredient.
  • additives are diluents, solvents, adjuvants, (ionic) surfactants, wetting agents, spreading agents, oils, stickers, thickeners, penetrants, buffering agents, acidifiers, anti-settling agents, anti-freeze agents, photo-protectors, defoaming agents, biocides, protease inhibitors and/or drift control agents.
  • Agrochemical use not only includes the use of agrochemicals as defined above (for example, pesticides, growth regulators, nutrients/fertilizers, repellants, defoliants etc.) that are suitable and/or intended for use in field grown crops (e.g., agriculture), but also includes the use of agrochemicals as defined above (for example, pesticides, growth regulators, nutrients/fertilizers, repellants, defoliants etc.) that are meant for use in greenhouse grown crops (e.g.
  • agrochemicals as defined above that are suitable and/or intended for non-crop uses such as uses in private gardens, household uses (for example, herbicides or insecticides for household use), or uses by pest control operators (for example, weed control etc.).
  • Biostatic (effect) or “biostatic use”, as used herein, includes any effect or use of an active substance (optionally comprised in a biostatic, biocidal, fungicidal or fungistatic composition as defined herein) for controlling, modulating or interfering with the harmful activity of a pest, such as a plant pest or a plant pathogen, including but not limited to inhibiting the growth or activity of the pest, altering the behavior of the pest, and repelling or attracting the pest in plants, plant parts or in other agro-related settings, such as for example for household uses or in soil.
  • a pest such as a plant pest or a plant pathogen
  • Biocidal (effect)” or “biocidal use”, as used herein, includes any effect or use of an active substance (optionally comprised in a biocidal or fungicidal composition as defined herein) for controlling, modulating or interfering with the harmful activity of a pest, such as a plant pest or a plant pathogen, including but not limited to killing the pest, inhibiting the growth or activity of the pest, altering the behavior of the pest, and repelling or attracting the pest in plants, plant parts or in other agro-related settings, such as for example for household uses or in soil.
  • a pest such as a plant pest or a plant pathogen
  • “Fungistatic (effect)” or “Fungistatic use”, as used herein, includes any effect or use of an active substance (optionally comprised in a fungicidal or fungistatic composition as defined herein) for controlling, modulating or interfering with the harmful activity of a fungus, including but not limited to inhibiting the growth or activity of the fungus, altering the behavior of the fungus, and repelling or attracting the fungus in plants, plant parts or in other agro-related settings, such as for example for household uses or in soil.
  • “Fungicidal (effect)” or “Fungicidal use”, as used herein, includes any effect or use of an active substance (optionally comprised in a fungicidal composition as defined herein) for controlling, modulating or interfering with the harmful activity of a fungus, including but not limited to killing the fungus, inhibiting the growth or activity of the fungus, altering the behavior of the fungus, and repelling or attracting the fungus in plants, plant parts or in other agro-related settings, such as for example for household uses or in soil.
  • Pestcidal activity or “biocidal activity”, as used interchangeably herein, means to interfere with the harmful activity of a pest, including but not limited to killing the pest, inhibiting the growth or activity of the pest, altering the behavior of the pest, repelling or attracting the pest.
  • Biostatic activity means to interfere with the harmful activity of a pest, including but not limited to inhibiting the growth or activity of the pest, altering the behavior of the pest, repelling or attracting the pest.
  • Pesticidal, biocidal, or biostatic activity of an active ingredient, substance or principle or a composition or agent comprising a pesticidal, biocidal, or biostatic active ingredient, substance or principle can be expressed as the minimium inhibitory activity (MIC) of an agent (expressed in units of concentration such as e.g. mg/mL), without however being restricted thereto.
  • MIC minimium inhibitory activity
  • “Fungicidal activity”, as used herein, means to interfere with the harmful activity of a fungus, including but not limited to killing the fungus, inhibiting the growth or activity of the fungus, altering the behavior of the fungus, and repelling or attracting the fungus.
  • “Fungistatic activity”, as used herein, means to interfere with the harmful activity of a fungus, including but not limited to inhibiting the growth or activity of the fungus, altering the behavior of the fungus, and repelling or attracting the fungus.
  • Fungicidal or fungistatic activity of an active ingredient, substance or principle or a composition or agent comprising a pesticidal, biocidal, or biostatic active ingredient, substance or principle can be expressed as the minimium inhibitory activity (MIC) of an agent (expressed in units of concentration such as e.g. mg/mL), without however being restricted thereto.
  • MIC minimium inhibitory activity
  • a “carrier”, as used herein, means any solid, semi-solid or liquid carrier in or on(to) which an active substance can be suitably incorporated, included, immobilized, adsorbed, absorbed, bound, encapsulated, embedded, attached, or comprised.
  • Non-limiting examples of such carriers include nanocapsules, microcapsules, nanospheres, microspheres, nanoparticles, microparticles, liposomes, vesicles, beads, a gel, weak ionic resin particles, liposomes, cochleate delivery vehicles, small granules, granulates, nano-tubes, bucky-balls, water droplets that are part of an water-in-oil emulsion, oil droplets that are part of an oil-in-water emulsion, organic materials such as cork, wood or other plant-derived materials (e.g.
  • inorganic materials such as talc, clay, microcrystalline cellulose, silica, alumina, silicates and zeolites, or even microbial cells (such as yeast cells) or suitable fractions or fragments thereof.
  • an antibody refers to polyclonal antibodies, monoclonal antibodies, humanized antibodies, single-chain antibodies, and fragments thereof such as Fab F(ab)2, Fv, and other fragments that retain the antigen binding function of the parent antibody.
  • an antibody may refer to an immunoglobulin or glycoprotein, or fragment or portion thereof, or to a construct comprising an antigen-binding portion comprised within a modified immunoglobulin-like framework, or to an antigen-binding portion comprised within a construct comprising a non-immunoglobulin-like framework or scaffold.
  • the term “monoclonal antibody” refers to an antibody composition having a homogeneous antibody population.
  • the term is not limited regarding the species or source of the antibody, nor is it intended to be limited by the manner in which it is made.
  • the term encompasses whole immunoglobulins as well as fragments such as Fab, Fab)2, Fv, and others that retain the antigen binding function of the antibody.
  • Monoclonal antibodies of any mammalian species can be used in this invention. In practice, however, the antibodies will typically be of rat or murine origin because of the availability of rat or murine cell lines for use in making the required hybrid cell lines or hybridomas to produce monoclonal antibodies.
  • polyclonal antibody refers to an antibody composition having a heterogeneous antibody population. Polyclonal antibodies are often derived from the pooled serum from immunized animals or from selected humans.
  • “Heavy chain variable domain of an antibody or a functional fragment thereof”, as used herein, means (i) the variable domain of the heavy chain of a heavy chain antibody, which is naturally devoid of light chains (also indicated hereafter as V HH ), including but not limited to the variable domain of the heavy chain of heavy chain antibodies of camelids or sharks or (ii) the variable domain of the heavy chain of a conventional four-chain antibody (also indicated hereafter as V H ), including but not limited to a camelized (as further defined herein) variable domain of the heavy chain of a conventional four-chain antibody (also indicated hereafter as camelized V H ).
  • the amino acid sequence and structure of a heavy chain variable domain of an antibody can be considered, without however being limited thereto, to be comprised of four framework regions or “FR's”, which are referred to in the art and hereinbelow as “framework region 1” or “FR1”; as “framework region 2” or “FR2”; as “framework region 3” or “FR3”; and as “framework region 4” or “FR4”, respectively, which framework regions are interrupted by three complementary determining regions or “CDR's”, which are referred to in the art as “complementarity determining region 1” or “CDR1”; as “complementarity determining region 2” or “CDR2”; and as “complementarity determining region 3” or “CDR3”, respectively.
  • CDR's complementary determining regions
  • the total number of amino acid residues in a heavy chain variable domain of an antibody can be in the region of 110-130, is preferably 112-115, and is most preferably 113.
  • parts, fragments or analogs of a heavy chain variable domain of an antibody are not particularly limited as to their length and/or size, as long as such parts, fragments or analogs retain (at least part of) the functional activity, such as the pesticidal, biocidal, biostatic activity, fungicidal or fungistatic activity (as defined herein) and/or retain (at least part of) the binding specificity of the original a heavy chain variable domain of an antibody from which these parts, fragments or analogs are derived from.
  • the functional activity such as the pesticidal, biocidal, biostatic activity, fungicidal or fungistatic activity (as defined herein) and/or retain (at least part of) the binding specificity of the original a heavy chain variable domain of an antibody from which these parts, fragments or analogs are derived from.
  • Parts, fragments or analogs retaining (at least part of) the functional activity such as the pesticidal, biocidal, biostatic activity, fungicidal or fungistatic activity (as defined herein) and/or retaining (at least part of) the binding specificity of the original heavy chain variable domain of an antibody from which these parts, fragments or analogs are derived from are also further referred to herein as “functional fragments” of a heavy chain variable domain.
  • variable domains of a heavy chain variable domain of an antibody are numbered according to the general numbering for heavy chain variable domains given by Kabat et al. (“ Sequence of proteins of immunological interest ”, US Public Health Services, NIH Bethesda, Md., Publication No. 91), as applied to V HH domains from Camelids in the article of Riechmann and Muyldermans, referred to above (see for example FIG. 2 of said reference).
  • FR1 of a heavy chain variable domain comprises the amino acid residues at positions 1-30
  • CDR1 of a heavy chain variable domain comprises the amino acid residues at positions 31-36
  • FR2 of a heavy chain variable domain comprises the amino acids at positions 36-49
  • CDR2 of a heavy chain variable domain comprises the amino acid residues at positions 50-65
  • FR3 of a heavy chain variable domain comprises the amino acid residues at positions 66-94
  • CDR3 of a heavy chain variable domain comprises the amino acid residues at positions 95-102
  • FR4 of a heavy chain variable domain comprises the amino acid residues at positions 103-113.
  • the total number of amino acid residues in each of the CDR's may vary and may not correspond to the total number of amino acid residues indicated by the Kabat numbering (that is, one or more positions according to the Kabat numbering may not be occupied in the actual sequence, or the actual sequence may contain more amino acid residues than the number allowed for by the Kabat numbering).
  • the numbering according to Kabat may or may not correspond to the actual numbering of the amino acid residues in the actual sequence.
  • position 1 according to the Kabat numbering corresponds to the start of FR1 and visa versa
  • position 36 according to the Kabat numbering corresponds to the start of FR2 and visa versa
  • position 66 according to the Kabat numbering corresponds to the start of FR3 and visa versa
  • position 103 according to the Kabat numbering corresponds to the start of FR4 and visa versa.
  • the term “heavy chain variable domain” as used herein in its broadest sense is not limited to a specific biological source or to a specific method of preparation.
  • the heavy chain variable domains of the invention can be obtained (1) by isolating the V HH domain of a naturally occurring heavy chain antibody; (2) by isolating the V H domain of a naturally occurring four-chain antibody (3) by expression of a nucleotide sequence encoding a naturally occurring V HH domain; (4) by expression of a nucleotide sequence encoding a naturally occurring V H domain (5) by “camelization” (as described below) of a naturally occurring V H domain from any animal species, in particular a species of mammal, such as from a human being, or by expression of a nucleic acid encoding such a camelized V H domain; (6) by “camelisation” of a “domain antibody” or “Dab” as described by Ward et al (supra).
  • the heavy chain variable domains as disclosed herein do not have an amino acid sequence that is exactly the same as (i.e. as a degree of sequence identity of 100% with) the amino acid sequence of a naturally occurring V H domain, such as the amino acid sequence of a naturally occurring V H domain from a mammal, and in particular from a human being.
  • determining As used herein, the terms “determining”, “measuring”, “assessing”, “monitoring” and “assaying” are used interchangeably and include both quantitative and qualitative determinations.
  • compositions Comprising at Least One Heavy Chain Variable Domain of an Antibody
  • the present inventors have identified agrochemical compositions comprising at least one variable domain of an antibody, which can specifically bind to a sphingolipid of a plant pest.
  • the compositions disclosed herein are capable of controlling, modulating, inhibiting, preventing or reducing one or more biological activities of the plant pathogen, such that the growth of the plant pathogen is controlled, modulated, inhibited, prevented or reduced.
  • the agrochemical compositions as disclosed herein are capable of killing a plant pest through the specific interaction of at least one variable domain of an antibody, which can specifically bind to a sphingolipid of a plant pest and which is comprised in the compositions.
  • the agrochemical compositions as disclosed herein can be used to modulate, such as to change, decrease or inhibit, the biological function of a plant pest by binding to a binding site present on a sphingolipid target of that plant pest thereby affecting the natural biological activities (such as, but not limited to, growth) of the pest and/or one or more biological pathways in which the structural target of that pest is involved.
  • compositions comprising at least one heavy chain variable domain as disclosed herein have several additional advantages over the traditional immunoglobulin and non-immunoglobulin binding agents known in the art.
  • the amino acid sequences as disclosed herein are isolated heavy chain immunoglobulin variable domains, which are more potent and more stable than conventional four-chain antibodies, leading to (1) lower dosage forms, less frequent dosage and thus less side effects; and (2) improved stability resulting in a broader choice of administration routes. Because of their small size, heavy chain immunoglobulin variable domains have the ability to cross membranes and penetrate into physiological compartments, tissues and organs not accessible to other, larger polypeptides and proteins.
  • compositions comprising at least one heavy chain variable domain as disclosed herein are capable of specific binding (as defined herein) to a plant pest target or a plant pest antigen; and more preferably capable of binding to a pest or plant pathogen target or a plant pest antigen or plant pathogen antigen with an affinity (suitably measured and/or expressed as a K D -value (actual or apparent), a K A -value (actual or apparent), a k on -rate and/or a k off -rate, or alternatively as an IC 50 value, as further described herein) that is as defined herein.
  • the invention provides an agrochemical composition or a biological pesticide composition for combating plant pests, more particularly a plant fungus, which composition comprises at least one polypeptide or amino acid sequence of between 80 and 200 amino acids as the active substance.
  • the invention provides an agrochemical composition for combating plant pests, which composition comprises at least two polypeptides or at least two amino acid sequences of between 80 and 200 amino acids as the active substance.
  • the invention provides an agrochemical composition for combating plant pests, which composition comprises at least three polypeptides or at least three amino acid sequences of between 80 and 200 amino acids as the active substance.
  • the agrochemical composition according to the invention is an agrochemical composition, as defined herein, for combating plant pests, as defined before, meaning that the agrochemical composition, more in particular the active substance, as defined before, comprised in the agrochemical composition, is able to interfere with, preferably to reduce or to arrest, the harmful effects of one or more plantpests on one or more plants, preferably crops.
  • the agrochemical composition comprises a polypeptide of between 80 and 200 amino acids as the active substance.
  • the agrochemical composition comprises a polypeptide of between 80-100 amino acids, 800-120 amino acids, 80-140 amino acids, 80-160 amino acids or 80-180 amino acids.
  • the agrochemical composition comprises a polypeptide of between 100-200 amino acids, 100-180 amino acids, 100-160 amino acids, 100-150 amino acids, 100-140 amino acids or 100-120 amino acids.
  • the agrochemical composition comprises a polypeptide of between 110-200 amino acids, 110-180 amino acids, 110-160 amino acids, 110-140 amino acids or 110-130 amino acids.
  • the agrochemical composition comprises a polypeptide of between 120-200 amino acids, 120-180 amino acids, 120-160 amino acids, or 120-140 amino acids.
  • the agrochemical composition comprises a polypeptide of between 140-200 amino acids, 140-180 amino acids, or 140-160 amino acids.
  • the agrochemical composition comprises a polypeptide of between 160-200 amino acids or 160-180 amino acids.
  • the at least one heavy chain variable domain of an antibody comprised in the compositions disclosed herein can be derived from a naturally occurring polypeptide, or alternatively they can be entirely artificially designed.
  • Naturally occurring polypeptides include heavy chain antibodies (hcAb).
  • At least one heavy chain variable domain of an antibody comprised in the compositions disclosed herein consists of a single polypeptide chain and is not post-translationally modified. More particularly, the at least one heavy chain variable domain of an antibody comprised in the compositions disclosed herein is derived from an innate or adaptive immune system, preferably from a protein of an innate or adaptive immune system. Still more particularly, the at least one heavy chain variable domain of an antibody comprised in the compositions disclosed herein as disclosed herein is derived from an immunoglobulin.
  • the at least one heavy chain variable domain of an antibody comprised in the compositions disclosed herein comprises 4 framework regions and 3 complementary determining regions, or any suitable fragment thereof (which will then usually contain at least some of the amino acid residues that form at least one of the complementary determining regions).
  • the at least one heavy chain variable domain of an antibody comprised in the compositions disclosed herein is easy to produce at high yield, preferably in a microbial recombinant expression system, and convenient to isolate and/or purify subsequently.
  • the invention provides a number of stretches of amino acid residues (i.e. small peptides) that are particularly suited for binding to a sphingolipid antigen or a sphingolipid target, such as but not limited to a fungal sphingolipid antigen or a fungal sphingolipid target.
  • a sphingolipid antigen or a sphingolipid target such as but not limited to a fungal sphingolipid antigen or a fungal sphingolipid target.
  • CDR sequences i.e. as CDR1 sequences, CDR2 sequences and CDR3 sequences, respectively.
  • the invention in its broadest sense is not limited to a specific structural role or function that these stretches of amino acid residues may have in the heavy chain variable domains as disclosed herein, as long as these stretches of amino acid residues allow the variable domains as disclosed herein to specifically bind to a sphingolipid target.
  • the invention in its broadest sense relates to agrochemical compositions comprising a heavy chain variable domain of an antibody that is capable of binding to a sphingolipid target and that comprises a combination of CDR sequences as described herein.
  • the heavy chain variable domain sequences as disclosed herein may be heavy chain variable domains that comprise at least one amino acid sequence that is chosen from the group consisting of the CDR1 sequences, CDR2 sequences and CDR3 sequences that are described herein.
  • a heavy chain variable domain as disclosed herein may comprise at least one antigen binding site, wherein said antigen binding site comprises at least one combination of a CDR1 sequence, a CDR2 sequence and a CDR3 sequence that are described herein.
  • Any heavy chain variable domain comprised in the agrochemical compositions as disclosed herein and having one these CDR sequence combinations is preferably such that it can specifically bind (as defined herein) to a sphingolipid target or a sphingolipid antigen, and more in particular such that it specifically binds to a sphingolipid of a plant pathogen, in particular with dissociation constant (Kd) of 10 ⁇ 8 moles/liter or less of said variable domain in solution.
  • Kd dissociation constant
  • Specific binding of a heavy chain variable domain to a sphingolipid target can be determined in any suitable manner known per se, including, for example biopanning, Scatchard analysis and/or competitive binding assays, such as radioimmunoassays (RIA), enzyme immunoassays (EIA) and sandwich competition assays, and the different variants thereof known in the art.
  • RIA radioimmunoassays
  • EIA enzyme immunoassays
  • sandwich competition assays sandwich competition assays
  • the polypeptide of between 80 and 200 amino acids is obtained by affinity selection against a particular pest target molecule and said polypeptide has a high affinity for said pest target molecule: typically, the dissociation constant of the binding between the polypeptide and its pest target molecule is lower than 10 ⁇ 6 M, more preferably, the dissociation constant is lower than 10 ⁇ 6 M, even more preferably, the dissociation constant is lower than 10 ⁇ 7 M, most preferably, the dissociation constant is lower than 10 ⁇ 8 M.
  • the at least one heavy chain variable domain of an antibody comprised in the compositions disclosed herein has a minimum inhibitory concentration (MIC) value for said plant pathogenic fungus of 1.0 ⁇ g/mL or less of said variable domain in solution.
  • MIC minimum inhibitory concentration
  • the minimum inhibitory concentrations are between 0.0001 to 1 ⁇ M, are between 0.001 to 1 ⁇ M, between 0.01 to 1 ⁇ M, between 0.1 to 1 ⁇ M, between 0.0001 to 0.1 ⁇ M, between 0.001 to 0.1 ⁇ M, between 0.01 to 0.1 ⁇ M, between 0.00001 to 0.01 ⁇ M, between 0.0001 to 0.01 ⁇ M, between 0.001 to 0.01 ⁇ M.
  • the Minimal Inhibitory Concentration or the MIC value is the lowest concentration of an agent such as a polypeptide that inhibits the visible growth of the crop or plant pest after incubation.
  • an agent such as a polypeptide that inhibits the visible growth of the crop or plant pest after incubation.
  • MFC minimum fungicidal concentration
  • MFCs can be determined on agar plates but can also be conveniently determined in fluids (e.g. in microwell plates) depending on the type of the fungus and the assay conditions.
  • the agrochemical compositions as disclosed herein at least comprise a heavy chain variable domain comprising at least one combination of CDR sequences chosen from the group comprising:
  • the heavy chain variable domains in the compositions as disclosed herein are heavy chain variable domains that essentially consist of four framework regions (FR1 to FR4 respectively) and three complementarity determining regions (CDR1 to CDR3 respectively); or any suitable fragment of such an heavy chain variable domain (which will then usually contain at least some of the amino acid residues that form at least one of the CDR's, as further described herein).
  • the heavy chain variable domains as disclosed herein may in particular be a heavy chain variable domain sequence that is derived from a conventional four-chain antibody (such as, without limitation, a V H sequence that is derived from a human antibody) or be a so-called V HH -sequence (as defined herein) that is derived from a so-called “heavy chain antibody” (as defined herein).
  • a conventional four-chain antibody such as, without limitation, a V H sequence that is derived from a human antibody
  • V HH -sequence as defined herein
  • compositions as disclosed herein at least comprise an heavy chain variable domain sequence derived from an antibody or a functional fragment thereof, such as but not limited to a camelid heavy chain antibody or a functional fragment thereof, which variable domain sequence thus may be for instance a heavy chain variable domain of a camelid heavy chain antibody (V HH ).
  • V HH camelid heavy chain antibody
  • the invention is not limited as to the origin of the heavy chain variable domain sequence comprised in the compositions disclosed herein (or of the nucleotide sequence of the invention used to express it), nor as to the way that the heavy chain variable domain or nucleotide sequence thereof is (or has been) generated or obtained.
  • the heavy chain variable domains din the compositions disclosed herein may be naturally occurring heavy chain variable domains (from any suitable species) or synthetic or semi-synthetic heavy chain variable domains.
  • the heavy chain variable domain is a naturally occurring immunoglobulin sequence (from any suitable species) or a synthetic or semi-synthetic immunoglobulin sequence, including but not limited to “camelized” immunoglobulin sequences, as well as immunoglobulin sequences that have been obtained by techniques such as affinity maturation (for example, starting from synthetic, random or naturally occurring immunoglobulin sequences), CDR grafting, veneering, combining fragments derived from different immunoglobulin sequences, PCR assembly using overlapping primers, and similar techniques for engineering immunoglobulin sequences well known to the skilled person; or any suitable combination of any of the foregoing.
  • the heavy chain variable domain sequences of the compositions disclosed herein may in particular be a domain antibody (or an heavy chain variable domain that is suitable for use as a domain antibody), a single domain antibody (or an heavy chain variable domain that is suitable for use as a single domain antibody), or a “dAb” (or an heavy chain variable domain that is suitable for use as a dAb); other single variable domains, or any suitable fragment of any one thereof.
  • a domain antibody or an heavy chain variable domain that is suitable for use as a domain antibody
  • a single domain antibody or an heavy chain variable domain that is suitable for use as a single domain antibody
  • dAb or an heavy chain variable domain that is suitable for use as a dAb
  • other single variable domains or any suitable fragment of any one thereof.
  • the present invention provides heavy chain variable domains with the (general) structure
  • SEQ ID NO's: 1 to 84 (see Table 1) give the amino acid sequences of a number of heavy chain variable domains that have been raised against a sphingolipid target, in particular against glucosylceramide.
  • VHH sequences Name SEQ ID VHH Amino acid sequence 40F07 1 QVQLQESGGGLVQAGGSLRLSCVASGTTFSSYTMGWYRQAPGKQRELLASIEGGGNTDY ADSVKGRFTISRDNARNTVYLQMNSLKTEDTAVYYCNAARTWSIFRNYWGQGTQVTVSS 41D01 2 QVQLQESGGGLVQAGGSLRLSCAASGRTFSRYGMGWFRQLPGKQRELVTSITRGGTTTY ADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCNARSIWRDYWGQGTQVTVSS 41D06 3 QVQLQESGGGLVQAGGSLRLSCAASGGIFGINAMRWYRQAPGKQRELVASISSGGNTNY SESVKGRFTISRDDANYTVYLQMNSLKPEDTAVYYCNFVRLWFPDYWGQGTQVTVSS 41G10 4 QVQLQESGGGLVQPGGSLTLS
  • the invention in some specific embodiments provides agrochemical compositions comprising at least one heavy chain variable domain that is directed against a sphingolipid target and that has at least 80%, preferably at least 85%, such as 90% or 95% or more sequence identity with at least one of the heavy chain variable domains of SEQ ID NO's: 1 to 84 (see Table 1), and nucleic acid sequences that encode such heavy chain variable domains.
  • Some particularly preferred heavy chain variable domain sequences as disclosed herein are those which can bind to and/or are directed against a sphingolipid of a plant pathogen and which have at least 90% amino acid identity with at least one of the heavy chain variable domains of SEQ ID NO's: 1 to 84 (see Table 1), in which for the purposes of determining the degree of amino acid identity, the amino acid residues that form the CDR sequences are disregarded.
  • heavy chain variable domains may be derived in any suitable manner and from any suitable source, and may for example be naturally occurring V HH sequences (i.e. from a suitable species of Camelid) or synthetic or semi-synthetic heavy chain variable domains, including but not limited to “camelized” immunoglobulin sequences (and in particular camelized heavy chain variable domain sequences), as well as those that have been obtained by techniques such as affinity maturation (for example, starting from synthetic, random or naturally occurring immunoglobulin sequences), CDR grafting, veneering, combining fragments derived from different immunoglobulin sequences, PCR assembly using overlapping primers, and similar techniques for engineering immunoglobulin sequences well known to the skilled person; or any suitable combination of any of the foregoing as further described herein.
  • affinity maturation for example, starting from synthetic, random or naturally occurring immunoglobulin sequences
  • CDR grafting for example, starting from synthetic, random or naturally occurring immunoglobulin sequences
  • veneering combining fragments derived from different immunoglobul
  • agrochemical compositions or the biological control compositions as disclosed herein are stable, both during storage and during utilization, meaning that the integrity of the agrochemical composition is maintained under storage and/or utilization conditions of the agrochemical composition, which may include elevated temperatures, freeze-thaw cycles, changes in pH or in ionic strength, UV-irradiation, presence of harmful chemicals and the like.
  • the polypeptide of between 80 and 200 amino acids, and the various sub-ranges described herein remain stable in the agrochemical composition, meaning that the integrity and the pesticidal activity of the polypeptide is maintained under storage and/or utilization conditions of the agrochemical composition, which may include elevated temperatures, freeze-thaw cycles, changes in pH or in ionic strength, UV-irradiation, presence of harmful chemicals and the like.
  • said polypeptide of between 80 and 200 amino acids, and the various sub-ranges described herein remain stable in the agrochemical composition when the agrochemical composition is stored at ambient temperature for a period of two years or when the agrochemical composition is stored at 54° C. for a period of two weeks.
  • the agrochemical composition of the present invention retains at least about 70% activity, more preferably at least about 70% to 80% activity, most preferably about 80% to 90% activity or more.
  • the polypeptide may be comprised in a carrier, as defined, to protect the polypeptide from harmful effects caused by other components in the agrochemical composition or from harmful effects during storage or during application.
  • suitable carriers include, but are not limited to alginates, gums, starch, ⁇ -cyclodextrins, celluloses, polyurea, polyurethane, polyester, microbial cells or clay.
  • the agrochemical composition may occur in any type of formulation, preferred formulations are powders, wettable powders, wettable granules, water dispersible granules, emulsions, emulsifiable concentrates, dusts, suspensions, suspension concentrates, suspoemulsions (mixtures of suspensions and emulsions), capsule suspensions, aqueous dispersions, oil dispersions, aerosols, pastes, foams, slurries or flowable concentrates.
  • the polypeptide of between 80 and 200 amino acids, and the various sub-ranges described herein before, may be the only active substance in the agrochemical or biological control composition according to the invention; however, it is also possible that the agrochemical composition comprises one or more additional agrochemicals, as defined, in addition to the polypeptide or amino acid sequence (or the at least one, at least two or at least three polypeptides or amino acid sequences as disclosed herein).
  • additional agrochemicals or biological control compositions may have a different effect on plant pests as the polypeptide or amino acid sequence, they may have a synergistic effect with the polypeptide or amino acid sequence, or they may even modify the activity of the polypeptide or amino acid sequence on certain plants.
  • Suitable additional agrochemicals can be herbicides, insecticides, fungicides, nematicides, acaricides, bactericides, viricides, plant growth regulators, safeners and the like and include, but are not limited to glyphosate, paraquat, metolachlor, acetochlor, mesotrione, 2,4-D,atrazine, glufosinate, sulfosate, fenoxaprop, pendimethalin, picloram, trifluralin, bromoxynil, clodinafop, fluroxypyr, nicosulfuron, bensulfuron, imazetapyr, dicamba, imidacloprid, thiamethoxam, fipronil, chlorpyrifos, deltamethrin, lambda-cyhalotrin, endosulfan, methamidophos, carbofuran, clothianidin, cy
  • compositions Comprising Variants of Heavy Chain Variable Domain Sequences
  • the heavy chain variable domains comprised in the agrochemical compositions as disclosed herein may be optionally linked to one or more further groups, moieties, or residues via one or more linkers. These one or more further groups, moieties or residues can serve for binding to other targets of interest. It should be clear that such further groups, residues, moieties and/or binding sites may or may not provide further functionality to the heavy chain variable domains as disclosed herein (and/or to the composition in which it is present) and may or may not modify the properties of the heavy chain variable domain as disclosed herein. Such groups, residues, moieties or binding units may also for example be chemical groups which can be biologically active.
  • the heavy chain variable domains in the agrochemical compositions as disclosed herein may also have been chemically modified.
  • a modification may involve the introduction or linkage of one or more functional groups, residues or moieties into or onto the heavy chain variable domain.
  • These groups, residues or moieties may confer one or more desired properties or functionalities to the heavy chain variable domain. Examples of such functional groups will be clear to the skilled person.
  • the introduction or linkage of such functional groups to a heavy chain variable domain can result in an increase in the solubility and/or the stability of the heavy chain variable domain, in a reduction of the toxicity of the heavy chain variable domain, or in the elimination or attenuation of any undesirable side effects of the heavy chain variable domain, and/or in other advantageous properties.
  • the one or more groups, residues, moieties are linked to the heavy chain variable domain via one or more suitable linkers or spacers.
  • two or more target-specific heavy chain variable domains in the agrochemical compositions disclosed herein may be linked to each other or may be interconnected.
  • the two or more heavy chain variable domains are linked to each other via one or more suitable linkers or spacers.
  • suitable spacers or linkers for use in the coupling of different heavy chain variable domains as disclosed herein will be clear to the skilled person and may generally be any linker or spacer used in the art to link peptides and/or proteins.
  • linkers or spacers include for example, but are not limited to, polypeptide linkers such as glycine linkers, serine linkers, mixed glycine/serine linkers, glycine- and serine-rich linkers or linkers composed of largely polar polypeptide fragments, or homo- or heterobifunctional chemical crosslinking compounds such as glutaraldehyde or, optionally PEG-spaced, maleimides or NHS esters.
  • polypeptide linkers such as glycine linkers, serine linkers, mixed glycine/serine linkers, glycine- and serine-rich linkers or linkers composed of largely polar polypeptide fragments, or homo- or heterobifunctional chemical crosslinking compounds such as glutaraldehyde or, optionally PEG-spaced, maleimides or NHS esters.
  • a polypeptide linker or spacer may be a suitable amino acid sequence having a length between 1 and 50 amino acids, such as between 1 and 30, and in particular between 1 and 10 amino acid residues. It should be clear that the length, the degree of flexibility and/or other properties of the linker(s) may have some influence on the properties of the heavy chain variable domains, including but not limited to the affinity, specificity or avidity for the fungal target. It should be clear that when two or more linkers are used, these linkers may be the same or different. In the context and disclosure of the present invention, the person skilled in the art will be able to determine the optimal linkers for the purpose of coupling heavy chain variable domains as disclosed herein without any undue experimental burden.
  • the present invention also encompasses parts, fragments, analogs, mutants, variants, and/or derivatives of the heavy chain variable domains comprised in the compositions as disclosed herein and/or polypeptides comprising or essentially consisting of one or more of such parts, fragments, analogs, mutants, variants, and/or derivatives, as long as these parts, fragments, analogs, mutants, variants, and/or derivatives are suitable for the purposes envisaged herein.
  • Such parts, fragments, analogs, mutants, variants, and/or derivatives according to the invention are still capable of specifically binding to the sphingolipid target.
  • the heavy chain variable domains comprised in the compositions disclosed herein are obtained by affinity selection against a particular pest target.
  • Obtaining suitable polypeptides by affinity selection against a particular pest target may for example be performed by screening a set, collection or library of cells that express polypeptides on their surface (e.g.
  • bacteriophages for binding against a pest target molecule, which molecule is known in the art to be a target for a pesticide; all of which may be performed in a manner known per se, essentially comprising the following non-limiting steps: a) obtaining an isolated solution or suspension of a pest target molecule, which molecule is known to be a target for a pesticide; b) bio-panning phages or other cells from a polypeptide library against said target molecule; c) isolating the phages or other cells binding to the target molecule; d) determining the nucleotide sequence encoding the polypeptide insert from individual binding phages or other cells; e) producing an amount of polypeptide according to this sequence using recombinant protein expression and f) determining the affinity of said polypeptide for said pest target and optionally g) testing the pesticidal activity of said polypeptide in a bio-assay for said pest.
  • ELISA enzyme linked immunosorbent assays
  • SPR Surface Plasmon Resonance
  • the dissociation constant of the binding between the polypeptide and its pest target molecule is lower than 10 ⁇ 6 M, more preferably, the dissociation constant is lower than 10 ⁇ 6 M, even more preferably, the dissociation constant is lower than 10 ⁇ 7 M, most preferably, the dissociation constant is lower than 10 ⁇ 8 M.
  • Pest target molecules as disclosed herein are molecules occurring in or on pest organisms and which, when bound and/or inhibited, kill or arrest, inhibit or reduce the growth or pesticidal activity of said pest organism.
  • suitable target molecules are readily available from existing literature or patent databases for the skilled person and include, without limitation secreted parasitism proteins such as 16D10 as suitable pest target molecules for root knot nematodes (Huang et al (2006) PNAS 103: 14302-14306), the V-ATPase proton pump as suitable pest target molecule for coleopteran, hemipteran, dipteran insect species and nematodes (Knight A J and Behm C A (2011) Ex. Parasitol.
  • the sphingolipid targets to which the at least on heavy chain variable domain of the agrochemical compositions as disclosed herein bind constitute a distinctive group of membrane lipids characterized by a long-chain (monounsaturated), di-hydroxy amine structure (sphingosine).
  • Sphingolipids are essential components of the plasma membrane of cells where they are typically found in the outer leaflet. They are membrane constituents of some bacterial groups, particularly anaerobes. These groups include Bacteroides, Prevotella, Porphyromonas, Fusobacterium, Sphingomonas, Sphingobacterium, Bdellovibrio, Cystobacter, Mycoplasma, Flectobacillus , and possibly Acetobacter .
  • Fungi in which sphingolipids have been found comprise Saccharomyces, Candida, Histoplasma, Phytophthora, Cryptococcus, Aspergillus, Neurospora, Schizosaccharomyces, Fusicoccum, Shizophyllum, Amanita, Hansenula, Lactarius, Lentinus, Penicillium, Clitocybe, Paracoccidioides, Agaricus, Sporothrix , and oomycete plant pathogens.
  • the basic building block of fungal sphingolipids is sphinganine, which can be converted either to ceramide and finally to ceramide monohexosides (CMH; cerebrosides), or to phytoceramide and finally to ceramide dihexosides (CDH) or to glycoinositol phosphorylceramides (GIPCs).
  • CMH ceramide monohexosides
  • CDH phytoceramide
  • GIPCs glycoinositol phosphorylceramides
  • Non-limiting examples of sphinglolipids against which the at least one heavy chain variable antibody domains of the compositions as disclosed herein are directed include for instance 9-methyl 4,8-sphingadienine, glycosylceramides, glucosylceramide, monoglucosylceramides, oligoglucosylceramides, gangliosides, sulfatides, ceramides, sphingosine-1-phosphate, ceramide-1-phosphate, galactosylceramide, inositol-phosphorylceramide (IPC), mannosyl-inositol-phosphorylceramide (MIPC), galactosyl-inositol-phosphorylceramide, mannosyl-(inositol-phosphoryl) 2 -ceramide (M(IP) 2 C), dimannosyl-inositol-phosphorylceramide (M2IPC), galactosyl-dimannosyl-inositol-phosphorylcer
  • Non-limiting examples of sphingolipids against which the at least one heavy chain variable antibody domains of the compositions as disclosed herein are directed include for instance glycosylceramides, glucosylceramide, sphingomyelin, monoglycosylceramides, oligoglycosylceramides, gangliosides, sulfatides, ceramides, sphingosine-1-phosphate and ceramide-1-phosphate.
  • the target to which the variable domains in the agrochemical compositions of the present invention bind is not chitin.
  • the plant pest(s) that is/are combated by the agrochemical composition or biological control composition as disclosed herein is a fungus, such as a plant pathogenic fungus, as defined before.
  • Fungi can be highly detrimental for plants and can cause substantial harvest losses in crops.
  • Plant pathogenic fungi include necrotrophic fungi and biotrophic fungi, and include ascomycetes, basidiomycetes and oomycetes.
  • plant pathogenic fungi include, but are not limited to, those selected from the group consisting of the Genera: Alternaria; Ascochyta; Botrytis; Cercospora; Colletotrichum; Diplodia; Erysiphe; Fusarium; Leptosphaeria; Gaeumanomyces; Helminthosporium; Macrophomina; Nectria; Peronospora; Phoma; Phymatotrichum; Phytophthora; Plasmopara; Podosphaera; Puccinia; Puthium; Pyrenophora; Pyricularia; Pythium; Rhizoctonia; Scerotium; Sclerotinia; Septoria; Thielaviopsis; Uncinula; Venturia ; and Verticillium .
  • Genera Alternaria; Ascochyta; Botrytis; Cercospora; Colletotrichum; Diplodia; Erysiphe; Fusarium;
  • plant fungi infections which may be combated with the agrochemical compositions of the invention include, Erysiphe graminis in cereals, Erysiphe cichoracearum and Sphaerotheca fuliginea in cucurbits, Podosphaera leucotricha in apples, Uncinula necator in vines, Puccinia sp. in cereals, Rhizoctonia sp. in cotton, potatoes, rice and lawns, Ustilago sp. in cereals and sugarcane, Venturia inaequalis (scab) in apples, Helminthosporium sp.
  • compositions according to the invention are active against normally sensitive and resistant species and against all or some stages in the life cycle of the plant pathogenic fungus.
  • the agrochemical compositions as disclosed herein are directed against a plant pathogenic fungus from the genus chosen from the group comprising Alternaria, Ascochyta, Botrytis, Cercospora, Colletotrichum, Diplodia, Erysiphe, Fusarium, Leptosphaeria, Gaeumanomyces, Helminthosporium, Macrophomina, Nectria, Penicillium, Peronospora, Phoma, Phymatotrichum, Phytophthora, Plasmopara, Podosphaera, Puccinia, Pyrenophora, Pyricularia, Pythium, Rhizoctonia, Scerotium, Sclerotinia, Septoria, Thielaviopsis, Uncinula, Venturia, Verticillium, Magnaporthe, Blumeria, Mycosphaerella, Ustilago, Melampsora, Phakospora, Monilinia
  • compositions as disclosed herein at least comprise a heavy chain variable domain, which specifically binds to a sphingolipid of a fungus from the fungal species Botrytis, Fusarium or Penicillium .
  • the fungal sphingolipid is a ceramide, such as in particular glucosylceramide.
  • the present invention provides agrochemical compositions comprising heavy chain variable domains that are specifically directed against a structural molecular component of the fungus, i.e. a fungal sphingolipid.
  • the inventors have surprisingly succeeded in identifying such heavy chain variable domains while it is generally described in the art that it is (technically) difficult to generate proteins or amino acid sequences having a unique and specific interaction with non-protein molecular structures.
  • suitable fungal pest target molecules can be envisaged by the person skilled in the art and comprise for example chitin synthase, ⁇ -1,3-glucan synthase, succinate dehydrogenase, fungal glycosylceramides, or the tetraspanin PLS1.
  • plant pathogenic bacteria including, but not limited to, Acidovorax avenae subsp. avenae (causing bacterial brown stripe of rice), Acidovorax avenae subsp. cattleyae (causing bacterial brown spot of cattleya), Acidovorax konjaci Konnyaku (causing bacterial leaf blight), Agrobacterium rhizogenes (causing hairy root of melon), Agrobacterium tumefaciens (causing crown gall), Burkholderia andropogonis (causing bacterial spot of carnation), Burkholderia caryophylli (causing bacterial wilt of carnation), Burkholderia cepacia (causing bacterial brown spot of cymbidium), Burkholderia gladioli pv.
  • Acidovorax avenae subsp. avenae causing bacterial brown stripe of rice
  • gladioli causing neck rot of gladiolus
  • Burkholderia glumae causing bacterial grain rot of rice
  • Burkholderia plantarii causing bacterial seedling blight of rice
  • Clavibacter michiganensis subsp. michiganensis causing bacterial canker of tomato
  • Clavibacter michiganensis subsp. sepedonicus causing ring rot of potato
  • Clostridium spp. causing slimy rot of potato
  • Curtobacterium flaccumfaciens causing bacterial canker of onion
  • Erwinia amylovora causing fire blight of pear
  • Erwinia ananas causing bacterial palea browning of rice
  • Atroseptica causing black leg of potato
  • Erwinia carotovora subsp. carotovora causing bacterial soft rot of vegetables
  • Erwinia chrysanthemi causing bacterial seedling blight of taro
  • Erwinia chrysanthemi pv. zeae causing bacterial foot rot of rice
  • millettiae causing bacterial gall of wisteria
  • Pseudomonas cichorii causing bacterial spot of chrysanthemum
  • Pseudomonas corrugate Pith causing necrosis of tomato
  • Pseudomonas fuscovaginae causing sheath brown rot of rice
  • Pseudomonas marginalis pv. marginalis causing soft rot of cabbage
  • Pseudomonas rubrisubalbicans causing mottled stripe of sugar cane
  • Pseudomonas syringae pv. aptata causing bacterial blight of sugar beet
  • Atropurpurea (causing halo blight of ryegrass), Pseudomonas syringae pv. castaneae (causing bacterial canker of chestnut), Pseudomonas syringae pv. glycinea (causing bacterial blight of soybean), Pseudomonas syringae pv. lachrymans (causing bacterial spot of cucumber), Pseudomonas syringae pv. maculicola (causing bacterial black spot of cabbage), Pseudomonas syringae pv.
  • sesame causing bacterial spot of sesame
  • Pseudomonas syringae pv. striafaciens causing bacterial stripe blight of oats
  • Pseudomonas syringae pv. syringae causing bacterial brown spot of small red bead
  • Pseudomonas syringae pv. tabaci causing wild fire of tobacco
  • Pseudomonas syringae pv. theae causing bacterial shoot blight of tea
  • tomato (causing bacterial leaf spot of tomato), Pseudomonas viridiflava (causing bacterial brown spot of kidney bean), Ralstonia solanacearum (causing bacterial wilt), Rathayibacter rathayi (causing bacterial head blight of orchardgrass), Streptomyces scabies (causing common scab of potato), Streptomyces ipomoea (causing soil rot of sweet potato), Xanthomonas albilineans (causing white streak of sugar cane), Xanthomonas campestris pv. cerealis (causing bacterial streak of rye), Xanthomonas campestris pv.
  • campestris (causing black rot), Xanthomonas campestris pv. citri (causing canker of citrus), Xanthomonas campestris pv. cucurbitae (causing bacterial brown spot of cucumber), Xanthomonas campestris pv. glycines (causing bacterial pastule of soybean), Xanthomonas campestris pv. incanae (causing black rot of stock), Xanthomonas campestris pv. (causing angular leaf spot of cotton malvacearum), Xanthomonas campestris pv.
  • raphani causing bacterial spot of Japanese radish
  • Xanthomonas campestris pv. ricini causing bacterial spot of castor-oil plant
  • Xanthomonas campestris pv. theicola causing canker of tea
  • Xanthomonas campestris pv. translucens causing bacterial blight of orchardgrass
  • Xanthomonas campestris pv. vesicatoria causing bacterial spot of tomato
  • Xanthomonas oryzae pv. oryzae causing bacterial leaf blight of rice
  • compositions according to the invention are active against normally sensitive and resistant species and against all or some stages of development.
  • pests from the phylum Arthropoda, in particular from the class of the arachnids, for example Acarus spp., Aceria sheldoni, Aculops spp., Aculus spp., Amblyomma spp., Amphitetranychus viennensis, Argas spp., Boophilus spp., Brevipalpus spp., Bryobia praetiosa, Centruroides spp., Chorioptes spp., Dermanyssus gallinae, Dermatophagoides pteronyssius, Dermatophagoides farinae, Dermacentor spp., Eotetranychus spp., Epitrimerus pyri, Eutetranychus spp., Eriophyes spp., Halotydeus destructor, Hemitarsonemus spp., Hyalomma s
  • Anoplura for example, Damalinia spp., Haematopinus spp., Linognathus spp., Pediculus spp., Ptirus pubis, Trichodectes spp.
  • Chilopoda for example, Geophilus spp., Scutigera spp.
  • Still other examples are from the order of the Coleoptera, for example, Acalymma vittatum, Acanthoscelides obtectus, Adoretus spp., Agelastica alni, Agriotes spp., Alphitobius diaperinus, Amphimallon solstitialis, Anobium punctatum, Anoplophora spp., Anthonomus spp., Anthrenus spp., Apion spp., Apogonia spp., Atomaria spp., Attagenus spp., Bruchidius obtectus, Bruchus spp., Cassida spp., Cerotoma trifurcata, Ceutorrhynchus spp., Chaetocnema spp., Cleonus mendicus, Conoderus spp., Cosmopolites spp., Costelytra zealandica, Ctenicera
  • Still other examples are from the order of the Collembola, for example, Onychiurus armatus.
  • Still other examples are from the order of the Diplopoda, for example, Blaniulus guttulatus.
  • Still other examples are from the order of the Diptera, for example, Aedes spp., Agromyza spp., Anastrepha spp., Anopheles spp., Asphondylia spp., Bactrocera spp., Bibio hortulanus, Calliphora erythrocephala, Ceratitis capitata, Chironomus spp., Chrysomyia spp., Chrysops spp., Cochliomyia spp., Contarinia spp., Cordylobia anthropophaga, Culex spp., Culicoides spp., Culiseta spp., Cuterebra spp., Dacus oleae, Dasyneura spp., Delia spp., Dermatobia hominis, Drosophila spp., Echinocnemus spp., Fannia s
  • Still other examples are from the order of the Heteroptera, for example, Anasa tristis, Antestiopsis spp., Boisea spp., Blissus spp., Calocoris spp., Campylomma livida, Cavelerius spp., Cimex spp., Collaria spp., Creontiades dilutus, Dasynus piperis, Dichelops furcatus, Diconocoris hewetti, Dysdercus spp., Euschistus spp., Eurygaster spp., Heliopeltis spp., Horcias nobilellus, Leptocorisa spp., Leptoglossus phyllopus, Lygus spp., Macropes excavatus, Miridae, Monalonion atratum, Nezara spp., Oebalus spp., Pentomid
  • Still other examples are from the order of the Homoptera, for example, Acyrthosipon spp., Acrogonia spp., Aeneolamia spp., Agonoscena spp., Aleurodes spp., Aleurolobus barodensis, Aleurothrixus spp., Amrasca spp., Anuraphis cardui, Aonidiella spp., Aphanostigma pin, Aphis spp., Arboridia apicalis, Aspidiella spp., Aspidiotus spp., Atanus spp., Aulacorthum solani, Bemisia spp., Brachycaudus helichrysii, Brachycolus spp., Brevicoryne brassicae, Calligypona marginata, Carneocephala fulgida, Ceratovacuna lanigera, Cercopid
  • Hymenoptera for example, Acromyrmex spp., Athalia spp., Atta spp., Diprion spp., Hoplocampa spp., Lasius spp., Monomorium pharaonis, Solenopsis invicta, Tapinoma spp., Vespa spp.
  • Still other examples are from the order of the Isopoda, for example, Armadillidium vulgare, Oniscus asellus, Porcellio scaber.
  • Still other examples are from the order of the Isoptera, for example, Coptotermes spp., Cornitermes cumulans, Cryptotermes spp., Incisitermes spp., Microtermes obesi, Odontotermes spp., Reticulitermes spp.
  • Still other examples are from the order of the Lepidoptera, for example, Acronicta major, Adoxophyes spp., Aedia leucomelas, Agrotis spp., Alabama spp., Amyelois transitella, Anarsia spp., Anticarsia spp., Argyroploce spp., Barathra brassicae, Borbo cinnara, Bucculatrix thurberiella, Bupalus piniarius, Busseola spp., Cacoecia spp., Caloptilia theivora, Capua reticulana, Carpocapsa pomonella, Carposina niponensis, Chematobia brumata, Chilo spp., Choristoneura spp., Clysia ambiguella, Cnaphalocerus spp., Cnephasia spp., Conopomorpha
  • Still other examples are from the order of the Orthoptera, for example, Acheta domesticus, Blatta orientalis, Blattella germanica, Dichroplus spp., Gryllotalpa spp., Leucophaea maderae, Locusta spp., Melanoplus spp., Periplaneta spp., Pulex irritans, Schistocerca gregaria, Supella longipalpa.
  • Orthoptera for example, Acheta domesticus, Blatta orientalis, Blattella germanica, Dichroplus spp., Gryllotalpa spp., Leucophaea maderae, Locusta spp., Melanoplus spp., Periplaneta spp., Pulex irritans, Schistocerca gregaria, Supella longipalpa.
  • Siphonaptera for example, Ceratophyllus spp., Ctenocephalides spp., Tunga penetrans, Xenopsylla cheopis.
  • Symphyla for example, Scutigerella spp.
  • Thysanoptera for example, Anaphothrips obscurus, Baliothrips biformis, Drepanothris reuteri, Enneothrips flavens, Frankliniella spp., Heliothrips spp., Hercinothrips femoralis, Rhipiphorothrips cruentatus, Scirtothrips spp., Taeniothrips cardamoni, Thrips spp.
  • Anaphothrips obscurus for example, Anaphothrips obscurus, Baliothrips biformis, Drepanothris reuteri, Enneothrips flavens, Frankliniella spp., Heliothrips spp., Hercinothrips femoralis, Rhipiphorothrips cruentatus, Scirtothrips spp., Taeniothrips cardamoni, Thrips spp.
  • Lepisma saccharina for example Lepisma saccharina, Thermobia domestica.
  • pests of the phylum Mollusca in particular from the class of the Bivalvia, for example Dreissena spp. are also important plant pests.
  • pests of the class of the Gastropoda are important plant pests, for example, Anion spp., Biomphalaria spp., Bulinus spp., Deroceras spp., Galba spp., Lymnaea spp., Oncomelania spp., Pomacea spp., Succinea spp.
  • plant pests are from the phylum
  • Nematoda are important plant pests, i.e. phytoparasitic nematodes, thus meaning plant parasitic nematodes that cause damage to plants.
  • Plant nematodes encompass plant parasitic nematodes and nematodes living in the soil.
  • Plant parasitic nematodes include, but are not limited to, ectoparasites such as Xiphinema spp., Longidorus spp., and Trichodorus spp.; semiparasites such as Tylenchulus spp.; migratory endoparasites such as Pratylenchus spp., Radopholus spp., and Scutellonerna .
  • harmful root parasitic soil nematodes are cyst-forming nematodes of the genera Heterodera or Globodera , and/or root knot nematodes of the genus Meloidogyne .
  • Harmful species of these genera are for example Meloidogyne incognata, Heterodera glycines (soybean cyst nematode), Globodera pallida and Globodera rostochiensis (potato cyst nematode).
  • Still other important genera of importance as plant pests comprise Rotylenchulus spp., Paratriclodorus spp., Pratylenchus penetrans, Radolophus simuli, Ditylenchus dispaci, Tylenchulus semipenetrans, Xiphinema spp., Bursaphelenchus spp., and the like.
  • Aphelenchoides spp. Bursaphelenchus spp., Ditylenchus spp., Globodera spp., Heterodera spp., Longidorus spp., Meloidogyne spp., Pratylenchus spp., Radopholus similis, Trichodorus spp., Tylenchulus semipenetrans, Xiphinema spp.
  • plant viruses selected from an alfamovirus, an allexivirus, an alphacryptovirus, an anulavirus, an apscaviroid, an aureusvirus, an avenavirus, an aysunviroid, a badnavirus, a begomovirus, a benyvirus, a betacryptovirus, a betaflexiviridae, a bromovirus, a bymovirus, a capillovirus, a carlavirus, a carmovirus, a caulimovirus, a cavemovirus, a cheravirus, a closterovirus, a cocadviroid, a coleviroid, a comovirus, a crinivirus, a cucumovirus, a curtovirus, a cytorhabdovirus, a dianthovirus, an enamovirus, an umbravirus & B-type satellite virus, a fab
  • the heavy chain variable domains of the compositions as disclosed herein will in principle be directed against or specifically bind to several different forms of the sphingolipid target. It is also expected that the heavy chain variable domains of the compositions as disclosed herein will bind to a number of naturally occurring or synthetic analogs, variants, mutants, alleles, parts and fragments of their sphingolipid target.
  • the heavy chain variable domains of the compositions as disclosed herein will bind to at least to those analogs, variants, mutants, alleles, parts and fragments of the sphingolipid target that (still) contain the binding site, part or domain of the natural sphingolipid target to which those heavy chain variable domains bind.
  • polypeptide content contained in the agrochemical or biological control composition as disclosed herein may vary within a wide range and it is generally up to the manufacturer to modify the concentration range of a particular polypeptide according to specific crop pest which is to be attenuated.
  • the present invention provides agrochemical compositions comprising at least one heavy chain variable domain, wherein said heavy chain variable domain is present in an amount effective to protect or treat a plant or a part of said plant from an infection or other biological interaction with said plant pathogen.
  • the concentration of the heavy chain variable domain or polypeptide contained in the agrochemical composition may be from 0.0001% to 50% by weight.
  • the present invention provides agrochemical compositions comprising at least one heavy chain variable domain, wherein the concentration of the at least one variable domain in the agrochemical composition ranges from 0.001% to 50% by weight.
  • the concentration of the heavy chain variable domain or polypeptide contained in the agrochemical composition may be from 0.001% to 50% by weight.
  • the concentration of the heavy chain variable domain or polypeptide contained in the agrochemical composition may be from 0.01% to 50% by weight.
  • the concentration of the heavy chain variable domain or polypeptide contained in the agrochemical composition may be from 0.1% to 50% by weight.
  • the concentration of the heavy chain variable domain or polypeptide contained in the agrochemical composition may be from 1% to 50% by weight. In yet another specific embodiment the concentration of the heavy chain variable domain or polypeptide contained in the agrochemical composition may be from 10% to 50% by weight. In yet another specific embodiment the concentration of the heavy chain variable domain or polypeptide contained in the agrochemical composition may be from 0.0001% to 40% by weight. In yet another specific embodiment the concentration of the heavy chain variable domain or polypeptide contained in the agrochemical composition may be from 0.001% to 40% by weight. In yet another specific embodiment the concentration of the heavy chain variable domain or polypeptide contained in the agrochemical composition may be from 0.01% to 40% by weight.
  • the concentration of the heavy chain variable domain or polypeptide contained in the agrochemical composition may be from 0.1% to 40% by weight. In yet another specific embodiment the concentration of the heavy chain variable domain or polypeptide contained in the agrochemical composition may be from 1% to 40% by weight. In yet another specific embodiment the concentration of the heavy chain variable domain or polypeptide contained in the agrochemical composition may be from 0.0001% to 30% by weight. In yet another specific embodiment the concentration of the heavy chain variable domain or polypeptide contained in the agrochemical composition may be from 0.001% to 30% by weight. In yet another specific embodiment the concentration of the heavy chain variable domain or polypeptide contained in the agrochemical composition may be from 0.01% to 30% by weight.
  • the concentration of the heavy chain variable domain or polypeptide contained in the agrochemical composition may be from 0.1% to 30% by weight. In yet another specific embodiment the concentration of the heavy chain variable domain or polypeptide contained in the agrochemical composition may be from 1% to 30% by weight. In yet another specific embodiment the concentration of the heavy chain variable domain or polypeptide contained in the agrochemical composition may be from 0.0001% to 10% by weight. In yet another specific embodiment the concentration of the heavy chain variable domain or polypeptide contained in the agrochemical composition may be from 0.001% to 10% by weight. In yet another specific embodiment the concentration of the heavy chain variable domain or polypeptide contained in the agrochemical composition may be from 0.01% to 10% by weight.
  • the concentration of the heavy chain variable domain or polypeptide contained in the agrochemical composition may be from 0.1% to 10% by weight. In yet another specific embodiment the concentration of the heavy chain variable domain or polypeptide contained in the agrochemical composition may be from 1% to 10% by weight. In yet another specific embodiment the concentration of the heavy chain variable domain or polypeptide contained in the agrochemical composition may be from 0.0001% to 1% by weight. In yet another specific embodiment the concentration of the heavy chain variable domain or polypeptide contained in the agrochemical composition may be from 0.001% to 1% by weight. In yet another specific embodiment the concentration of the heavy chain variable domain or polypeptide contained in the agrochemical composition may be from 0.01% to 1% by weight. In yet another specific embodiment the concentration of the heavy chain variable domain or polypeptide contained in the agrochemical composition may be from 0.1% to 1% by weight.
  • the agrochemical compositions disclosed herein comprise at least one heavy chain variable domain, which is formulated in an aqueous solution.
  • the agrochemical compositions disclosed herein comprise at least one heavy chain variable domain and further comprise an agrochemically suitable carrier and/or one or more suitable adjuvants.
  • compositions according to the invention may comprise, in addition to the anti-pest variable domains described above, solid or liquid carriers which are acceptable in the pest treatment of plants and/or parts of plants and/or surfactants which are also acceptable in the pest treatment of plants and/or parts of plants.
  • solid or liquid carriers which are acceptable in the pest treatment of plants and/or parts of plants and/or surfactants which are also acceptable in the pest treatment of plants and/or parts of plants.
  • surfactants which are also acceptable in the pest treatment of plants and/or parts of plants.
  • inert and customary carriers and customary surfactants there may be used. These compositions cover not only compositions ready to be applied to the plants and/or parts of plants to be treated by immersion or using a suitable device, but also the commercial concentrated compositions which have to be diluted before application to the plants and/or parts of plants.
  • compositions according to the invention may also contain any sort of other ingredients such as, for example, protective colloids, adhesives, thickeners, thixotropic agents, penetrating agents, stabilizers, sequestrants, texturing agents, flavouring agents, taste enhancers, sugars, sweeteners, colorants and the like.
  • active substances i.e. the at least one heavy chain variable domain
  • carrier in the present disclosure, denotes a natural or synthetic organic or inorganic substance with which the anti-pest active substance is combined to facilitate its application to plants and/or one or more plant parts. This carrier is therefore generally inert and should be acceptable in the agri-sector.
  • the carrier may be solid (clays, natural or synthetic silicates, silica, resins, waxes, solid fertilizers, and the like) or liquid (water, alcohols, in particular butanol, and the like).
  • the surfactant may be an emulsifying agent, a dispersing agent or a wetting agent of the ionic or nonionic type or a mixture of such surfactants.
  • a dispersing agent or a wetting agent of the ionic or nonionic type or a mixture of such surfactants.
  • salts of polyacrylic acids salts of lignosulphonic acids, salts of phenolsulphonic or naphthalenesulphonic acids, polycondensates of ethylene oxide with fatty alcohols or with fatty acids or with fatty amines, substituted phenols (in particular alkylphenols or arylphenols), salts of esters of sulphosuccinic acids, derivatives of taurine (in particular alkyl taurates), phosphoric esters of polyoxyethylated phenols or alcohols, esters of fatty acids and polyols, sulphate, sulphonate and phosphate functional group-containing derivatives of the above compounds.
  • compositions as disclosed herein are themselves in fairly diverse, solid or liquid, forms.
  • solid composition forms there may be mentioned dustable powders (content of active substance which may be up to 100%) and granules, in particular those obtained by extrusion, by compacting, by impregnation of a granulated carrier, by granulation using a powder as starting material (the content of active substance in these granules being between 0.5 and 80% for these latter cases).
  • Such solid compositions may be optionally used in the form of a liquid which is viscous to a greater or lesser degree, depending on the type of application desired, for example by diluting in water.
  • liquid composition forms or forms intended to constitute liquid compositions during application there may be mentioned solutions, in particular water-soluble concentrates, emulsions, suspension concentrates, wettable powders (or spraying powder), oils and waxes.
  • the suspension concentrates which can be applied by spraying, are prepared so as to obtain a stable fluid product which does not form a deposit and they usually contain from 10 to 75% of active substance, from 0.5 to 15% of surfactants, from 0.1 to 10% of thixotropic agents, from 0 to 10% of appropriate additives, such as antifoams, corrosion inhibitors, stabilizers, penetrating agents and adhesives and, as carrier, water or an organic liquid in which the active substance is not or not very soluble: some organic solids or inorganic salts may be dissolved in the carrier to help prevent sedimentation or as antigels for water.
  • compositions as disclosed herein can be used as such, in form of their formulations or as the use forms prepared therefrom, such as aerosol dispenser, capsule suspension, cold fogging concentrate, hot fogging concentrate, encapsulated granule, fine granule, flowable concentrate for seed treatment, ready-to-use solutions, dustable powder, emulsifiable concentrate, emulsion oil in water, emulsion water in oil, macrogranule, macrogranule, oil dispersible powder, oil miscible flowable concentrate, oil miscible liquid, froths, paste, seed coated with a pesticide, suspension concentrate (flowable concentrate), suspensions-emulsions-concentrates, soluble concentrate, suspensions, soluble powder, granule, water soluble granules or tablets, water soluble powder for seed treatment, wettable powder, natural and synthetic materials impregnated with active compound, micro-encapsulation in polymeric materials and in jackets for seed, as well as ULV-cold and hot fogging formulations,
  • formulations are prepared in a known manner by mixing the active compounds or active compound combinations with customary additives, such as, for example, customary extenders and also solvents or diluents, emulsifiers, dispersants, and/or bonding or fixing agent, wetting agents, water repellents, if appropriate siccatives and UV stabilisers, colorants, pigments, defoamers, preservatives, secondary thickeners, adhesives, gibberellins and water as well further processing auxiliaries.
  • customary additives such as, for example, customary extenders and also solvents or diluents, emulsifiers, dispersants, and/or bonding or fixing agent, wetting agents, water repellents, if appropriate siccatives and UV stabilisers, colorants, pigments, defoamers, preservatives, secondary thickeners, adhesives, gibberellins and water as well further processing auxiliaries.
  • compositions include not only compositions which are ready to be applied to the plant or seed to be treated by means of a suitable device, such as a spraying or dusting device, but also concentrated commercial compositions which must be diluted before application to the crop.
  • the present invention provides methods for protecting or treating a plant or a part of a plant from an infection or other biological interaction with a plant pathogen, at least comprising the step of applying directly or indirectly to the plant or to a part of the plant, an agrochemical composition as disclosed herein, under conditions effective to protect or treat the plant or a part of the plant against that infection or biological interaction with the plant pathogen.
  • these methods comprise applying directly or indirectly to the plant or to a part of the plant an agrochemical composition as disclosed herein at an application rate higher than 50 g of the agrochemical composition per hectare, such as but not limited to an application rate higher than 75 g of the agrochemical composition per hectare, such as an application rate higher than 100 g of the agrochemical composition per hectare, or in particular an application rate higher than 200 g of the agrochemical composition per hectare.
  • these methods comprise applying directly or indirectly to the plant or to a part of the plant an agrochemical composition as disclosed herein at an application rate between 50 g and 100 g of the agrochemical composition per hectare, such as but not limited to an application rate of between 50 g and 200 g of the agrochemical composition per hectare, in particular an application rate of between 75 g and 175 g of the agrochemical composition per hectare, such as between 75 g and 150 g of the agrochemical composition per hectare or between 75 g and 125 g per hectare.
  • the invention provides methods for combating plant pests, which methods comprise applying an agrochemical or biological control composition according to the invention to a plant, such as a crop, or a part of a plant or a crop, at an application rate below 50 g of said polypeptide per hectare.
  • the application rate is below 45 g/ha, below 40 g/ha, below 35 g/ha, below 30 g/ha, below 25 g/ha, below 20 g/ha, below 15 g/ha, below 10 g/ha, below 5 g/ha, below 1 g/ha or even lower amounts of polypeptide/ha.
  • the invention provides the use of the agrochemical or biological control compositions of the invention for combating plant pests.
  • Applying an agrochemical or biological control composition according to the invention to a crop may be done using any suitable method for applying an agrochemical or biological control composition to a crop, including, but not limited to spraying (including high volume (HV), low volume (LV) and ultra low volume (ULV) spraying), brushing, dressing, dripping, coating, dipping, immersing, spreading, fogging, applying as small droplets, a mist or an aerosol.
  • spraying including high volume (HV), low volume (LV) and ultra low volume (ULV) spraying
  • brushing including high volume (HV), low volume (LV) and ultra low volume (ULV) spraying
  • dressing including high volume (HV), low volume (LV) and ultra low volume (ULV) spraying
  • dripping coating
  • coating dipping
  • immersing spreading
  • fogging applying as small droplets, a mist or an aerosol.
  • the methods for protecting or treating a plant or a part of a plant from an infection or other biological interaction with a plant pathogen as disclosed herein comprise applying the agrochemical composition directly or indirectly to the plant or to a part of the plant by spraying, atomizing, foaming, fogging, culturing in hydroculture, culturing in hydroponics, coating, submerging, and/or encrusting.
  • the present invention provides methods of inhibiting, preventing, reducing or controlling the growth of a plant pathogen, comprising at least the step of applying directly or indirectly to a plant or to a part of said plant, an agrochemical composition as disclosed herein.
  • the present invention provides methods for of killing a plant pathogen, comprising at least the step of applying directly or indirectly to a plant or to a part of said plant, an agrochemical composition as disclosed herein.
  • the application rate of the agrochemical composition according to the invention meaning the amount of the agrochemical composition that is applied to the crop, is such that less than 50 g, 45 g, 40 g, 35 g, 30 g, 25 g, 20 g, 20 g, 15 g, 10 g, 5 g, 1 g or even lower than 1 g of the polypeptide, comprised in the agrochemical or biological control composition according to the invention, is applied to the crop per hectare.
  • the agrochemical or biological control composition can be applied once to a crop, or it can be applied two or more times after each other with an interval between every two applications.
  • the agrochemical or biological control composition according to the invention can be applied alone or in mixture with other materials, preferably other agrochemical or biological control compositions, to the crop; alternatively, the agrochemical or biological control composition according to the invention can be applied separately to the crop with other materials, preferably other agrochemical or biological control compositions, applied at different times to the same crop.
  • the agrochemical or biological control composition according to the invention may be applied to the crop prophylactically, or alternatively, may be applied once target pests have been identified on the particular crop to be treated.
  • the agrochemical compositions as disclosed herein can be applied directly to a plant, a crop or to one or more parts of the plant by the above mentioned methods, such as directly to the entire plant or directly to one or more parts of the plant, either in a pre-harvest or in a post-harvest stage.
  • the agrochemical compositions as disclosed herein can be applied directly to one or more parts of the plant by the above mentioned methods, such as directly to the stalks, leafs, tubers, stems, shoots, the seeds, the fruits, the roots, the flowers, grains, the buds etc.
  • the method of treatment as disclosed herein can also be used in the field of protecting storage goods against attack of plant pathogens.
  • the term “storage goods” is understood to denote natural substances of vegetable or animal origin and their processed forms, which have been taken from the natural life cycle and for which long-term protection is desired.
  • Storage goods of vegetable origin such as plants or parts thereof, for example stalks, leafs, tubers, seeds, fruits or grains, can be protected in the freshly harvested state or in processed form, such as pre-dried, moistened, comminuted, ground, pressed or roasted.
  • timber whether in the form of crude timber, such as construction timber, electricity pylons and barriers, or in the form of finished articles, such as furniture or objects made from wood.
  • Storage goods of animal origin are hides, leather, furs, hairs and the like.
  • the combinations according the present invention can prevent disadvantageous effects such as decay, discoloration or mold.
  • storage goods is understood to denote natural substances of vegetable origin and their processed forms, more preferably fruits and their processed forms, such as pomes, stone fruits, soft fruits and citrus fruits and their processed forms.
  • compositions as disclosed herein can also be applied indirectly to a plant, a crop or to one or more parts of the plant by the above mentioned methods, such as indirectly to the entire plant or indirectly to one or more parts of the plant, either in a pre-harvest or in a post-harvest stage.
  • the agrochemical compositions as disclosed herein can be applied indirectly to a plant, a crop or to one or more parts of the plant by the above mentioned methods, such as by applying the agrochemical composition to the surroundings or to the medium in which the plant or the one or more parts of the plant are growing or are stored, such as for instance but not limited to the air, the soil, the hydroponic culture, the hydroculture, or the liquid medium, such as for instance the aqueous liquid medium or water, in which the plant or the one or more parts of the plant are growing or are stored.
  • the treatment of plants and plant parts with the agrochemical compositions as disclosed herein is carried out directly or by action on their environment, habitat or storage area by means of the normal treatment methods, for example by watering (drenching), drip irrigation, spraying, vaporizing, atomizing, broadcasting, dusting, foaming, spreading-on, and as a powder. It is furthermore possible to apply the compositions by the ultra-low volume method, or to inject the active compound preparation or the active compound itself into the soil.
  • the methods for protecting or treating a plant or a part of a plant from an infection or other biological interaction with a plant pathogen as disclosed herein comprise applying the agrochemical composition directly or indirectly to the plant or to a part of the plant either in a pre-harvest or in a post-harvest stage.
  • the harvested produce is a fruit, flower, nut or vegetable, a fruit or vegetable with inedible peel, preferably selected from avocados, bananas, plantains, lemons, grapefruits, melons, oranges, pineapples, kiwi fruits, guavas, mandarins, mangoes and pumpkin, is preferred, more preferably bananas, oranges, lemons and peaches, in particular bananas.
  • the harvested produce is a cut flower from ornamental plants, preferably selected from Alstroemeria, Carnation, Chrysanthemum, Freesia, Gerbera, Gladiolus , baby's breath ( Gypsophila spec), Helianthus, Hydrangea, Lilium, Lisianthus , roses and summer flowers.
  • the plant species to which the agrochemical compositions as disclosed herein can be applied can for example be but are not limited to maize, soya bean, alfalfa, cotton, sunflower, Brassica oil seeds such as Brassica napus (e.g. canola, rape-seed), Brassica rapa, B. juncea (e.g. (field) mustard) and Brassica carinata , Arecaceae sp. (e.g. oilpalm, coconut), rice, wheat, sugar beet, sugar cane, oats, rye, barley, millet and sorghum, triticale, flax, nuts, grapes and vine and various fruit and vegetables from various botanic taxa, e.g.
  • Brassica oil seeds such as Brassica napus (e.g. canola, rape-seed), Brassica rapa, B. juncea (e.g. (field) mustard) and Brassica carinata
  • Arecaceae sp. e
  • Rosaceae sp. e.g. pome fruits such as apples and pears, but also stone fruits such as apricots, cherries, almonds, plums and peaches, and berry fruits such as strawberries, raspberries, red and black currant and gooseberry
  • Ribesioidae sp. Juglandaceae sp.
  • Betulaceae sp. Anacardiaceae sp.
  • Fagaceae sp. Moraceae sp.
  • Oleaceae sp. e.g. olive tree
  • Actinidaceae sp. Lauraceae sp.
  • Lauraceae sp. e.g. avocado, cinnamon, camphor
  • Musaceae sp. e.g.
  • Rubiaceae sp. e.g. coffee
  • Theaceae sp. e.g. tea
  • Sterculiceae sp. e.g. lemons, oranges, mandarins and grapefruit
  • Solanaceae sp. e.g. tomatoes, potatoes, peppers, capsicum, aubergines, tobacco
  • Liliaceae sp. Compositae sp. (e.g. lettuce, artichokes and chicory—including root chicory, endive or common chicory), Umbelliferae sp. (e.g.
  • Cu-curbitaceae sp. e.g. cucumbers—including gherkins, pumpkins, watermelons, calabashes and melons
  • Alliaceae sp. e.g. leeks and onions
  • Cruciferae sp. e.g. white cabbage, red cabbage, broccoli, cauliflow-er, Brussels sprouts, pak choi, kohlrabi, radishes, horseradish, cress and Chinese cabbage
  • Leguminosae sp. e.g. peanuts, peas, lentils and beans—e.g. common beans and broad beans
  • Chenopodiaceae sp. e.g.
  • the crop is selected from the group consisting of field crops, grasses, fruits and vegetables, lawns, trees and ornamental plants.
  • the present invention thus also provides post-harvest treatment methods for protecting or treating a harvested plant or a harvested part of the plant from an infection or other biological interaction with a plant pathogen, at least comprising the step of applying directly or indirectly to the harvested plant or to a harvested part of the plant, an agrochemical composition as disclosed herein, under conditions effective to protect or treat the harvested plant or a harvested part of the plant against the infection or biological interaction with the plant pathogen.
  • the harvested produce is a fruit, flower, nut or vegetable, a fruit or vegetable with inedible peel, preferably selected from avocados, bananas, plantains, lemons, grapefruits, melons, oranges, pineapples, kiwi fruits, guavas, mandarins, mangoes and pumpkin, is preferred, more preferably bananas, oranges, lemons and peaches, in particular bananas.
  • the harvested produce is a cut flower from ornamental plants, preferably selected from Alstroemeria, Carnation, Chrysanthemum, Freesia, Gerbera, Gladiolus , baby's breath ( Gypsophila spec), Helianthus, Hydrangea, Lilium, Lisianthus , roses and summer flowers.
  • the harvested produce is cut grass or wood.
  • Post-harvest disorders are e.g. lenticel spots, scorch, senescent breakdown, bitter pit, scald, water core, browning, vascular breakdown, C0 2 injury, C0 2 or 0 2 deficiency, and softening.
  • Fungal diseases may be caused for example by the following fungi: Mycosphaerella spp., Mycosphaerella musae, Mycosphaerella frag a ae, Mycosphaerella citri; Mucor spp., e.g. Mucor piriformis; Monilinia spp., e.g.
  • Alternaria citri Alternaria alternata; Septoria spp., e.g. Septoria depressa; Venturia spp., e.g. Venturia inaequalis, Venturia pyrina; Rhizopus spp., e.g. Rhizopus stolonifer, Rhizopus oryzae; Glomerella spp., e.g. Glomerella cingulata; Sclerotinia spp., e.g. Sclerotinia fruiticola; Ceratocystis spp., e.g. Ceratocystis paradoxa; Fusarium spp., e.g.
  • Phacydiopycnis spp. e.g. Phacydiopycnis malirum
  • Gloeosporium spp. e.g. Gloeosporium album, Gloeosporium perennans, Gloeosporium fructigenum, Gloeosporium singulata
  • Geotrichum spp. e.g. Geotrichum candidum
  • Phlyctaena spp. e.g. Phlyctaena vagabunda
  • Cylindrocarpon spp. e.g.
  • Cylindrocarpon mail ; Stemphyllium spp., e.g. Stemphyllium vesica um; Thielaviopsis spp., e.g. Thielaviopsis paradoxy; Aspergillus spp., e.g. Aspergillus niger, Aspergillus carbonari us; Nectria spp., e.g. Nectria galligena; Cercospora spp., e.g. Cercospora angreci, Cercospora apii, Cercospora atrofiliformis, Cercospora musae, Cercospora zeae - maydis.
  • Stemphyllium spp. e.g. Stemphyllium vesica um
  • Thielaviopsis spp. e.g. Thielaviopsis paradoxy
  • Aspergillus spp. e.g. Aspergillus niger, Aspergill
  • the present invention provides uses of the agrochemical compositions as disclosed herein as an anti-pest agent, such as for instance a biostatic agent or a pesticidal agent, including but not limited to a fungistatic or a fungicidal agent.
  • an anti-pest agent such as for instance a biostatic agent or a pesticidal agent, including but not limited to a fungistatic or a fungicidal agent.
  • the plant pests combated by the method according to the present invention are plant pathogenic fungi, as defined before. Lesion number, lesion size, and extent of sporulation of fungal pathogens may all be decreased as a result of the application of the method according to the present invention.
  • the invention further provides methods for preparing or generating the heavy chain variable domain sequences, as well as methods for producing nucleic acids encoding these and host cells, products and compositions comprising these heavy chain variable domain sequences. Some preferred but non-limiting examples of such methods will become clear from the further description herein.
  • one particularly useful method for preparing heavy chain variable domain sequences as disclosed herein generally comprises the steps of:
  • the pest-specific a heavy chain variable domain sequences can be obtained by methods which involve generating a random library of amino acid sequences and screening this library for an amino acid sequence capable of specifically binding to a sphingolipid target.
  • the set, collection or library of amino acid sequences may be any suitable set, collection or library of amino acid sequences.
  • the set, collection or library of amino acid sequences may be a set, collection or library of immunoglobulin fragment sequences (as described herein), such as a na ⁇ ve set, collection or library of immunoglobulin fragment sequences; a synthetic or semi-synthetic set, collection or library of immunoglobulin fragment sequences; and/or a set, collection or library of immunoglobulin fragment sequences that have been subjected to affinity maturation.
  • the set, collection or library of amino acid sequences may be an immune set, collection or library of immunoglobulin fragment sequences, for example derived from a mammal that has been suitably immunized with a sphingolipid target or with a suitable antigenic determinant based thereon or derived therefrom, such as an antigenic part, fragment, region, domain, loop or other epitope thereof.
  • said antigenic determinant may be an extracellular part, region, domain, loop or other extracellular epitope(s).
  • the set, collection or library of amino acid sequences may be displayed on a phage, phagemid, ribosome or suitable micro-organism (such as yeast), such as to facilitate screening.
  • suitable methods, techniques and host organisms for displaying and screening (a set, collection or library of) amino acid sequences will be clear to the person skilled in the art, for example on the basis of the further disclosure herein. Reference is also made to the review by Hoogenboom in Nature Biotechnology, 23, 9, 1105-1116 (2005).
  • the methods for generating the heavy chain variable domain sequences as disclosed herein comprises at least the steps of:
  • the collection or sample of cells may for example be a collection or sample of B-cells.
  • the sample of cells may be derived from a mammal that has been suitably immunized with a fungal target or with a suitable antigenic determinant based thereon or derived therefrom, such as an antigenic part, fragment, region, domain, loop or other epitope thereof.
  • the antigenic determinant may be an extracellular part, region, domain, loop or other extracellular epitope(s).
  • the method for generating a heavy chain variable domain sequence directed against a sphingolipid target may comprise at least the steps of:
  • the set, collection or library of nucleic acid sequences encoding amino acid sequences may for example be a set, collection or library of nucleic acid sequences encoding a na ⁇ ve set, collection or library of immunoglobulin fragment sequences; a set, collection or library of nucleic acid sequences encoding a synthetic or semi-synthetic set, collection or library of immunoglobulin fragment sequences; and/or a set, collection or library of nucleic acid sequences encoding a set, collection or library of immunoglobulin fragment sequences that have been subjected to affinity maturation.
  • the set, collection or library of nucleic acid sequences encodes a set, collection or library of heavy chain variable domains (such as V H domains or V HH domains).
  • the set, collection or library of nucleic acid sequences may encode a set, collection or library of domain antibodies or single domain antibodies, or a set, collection or library of amino acid sequences that are capable of functioning as a domain antibody or single domain antibody.
  • the set, collection or library of nucleotide sequences encodes a set, collection or library of V HH sequences.
  • the set, collection or library of nucleotide sequences may be displayed on a phage, phagemid, ribosome or suitable micro-organism (such as yeast), such as to facilitate screening.
  • suitable methods, techniques and host organisms for displaying and screening (a set, collection or library of) nucleotide sequences encoding amino acid sequences will be clear to the person skilled in the art, for example on the basis of the further disclosure herein. Reference is also made to the review by Hoogenboom in Nature Biotechnology, 23, 9, 1105-1116 (2005).
  • the invention also relates to amino acid sequences that are obtainable or obtained by the above methods, or alternatively by a method that comprises one of the above methods and in addition at least the steps of determining the nucleotide sequence or amino acid sequence of said immunoglobulin sequence; and of expressing or synthesizing said amino acid sequence in a manner known per se, such as by expression in a suitable host cell or host organism or by chemical synthesis.
  • the methods for producing the amino acid sequences binding specifically to a fungal target as envisaged herein may further comprise the step of isolating from the amino acid sequence library at least one heavy chain variable domain having detectable binding affinity for, or detectable in vitro effect on a sphingolipid target.
  • These methods may further comprise the step of amplifying a sequence encoding at least one heavy chain variable domain having detectable binding affinity for, or detectable in vitro effect on the activity of a sphingolipid target.
  • a phage clone displaying a particular amino acid sequence obtained from a selection step of a method described herein, may be amplified by reinfection of a host bacteria and incubation in a growth medium.
  • these methods may encompass determining the sequence of the one or more amino acid sequences capable of binding to a sphingolipid target.
  • a heavy chain variable domain sequence comprised in a set, collection or library of amino acid sequences
  • a suitable cell or phage or particle it is possible to isolate from said cell or phage or particle, the nucleotide sequence that encodes that amino acid sequence.
  • the nucleotide sequence of the selected amino acid sequence library member(s) can be determined by a routine sequencing method.
  • the methods for producing a heavy chain variable domain as envisaged herein comprise the step of expressing said nucleotide sequence(s) in a host organism under suitable conditions, so as to obtain the actual desired amino acid sequence. This step can be performed by methods known to the person skilled in the art.
  • the obtained heavy chain variable domain sequences having detectable binding affinity for, or detectable in vitro effect on the activity of a sphingolipid target may be synthesized as soluble protein construct, optionally after their sequence has been identified.
  • the heavy chain variable domain sequences obtained, obtainable or selected by the above methods can be synthesized using recombinant or chemical synthesis methods known in the art.
  • the amino acid sequences obtained, obtainable or selected by the above methods can be produced by genetic engineering techniques.
  • methods for synthesizing the heavy chain variable domain sequences obtained, obtainable or selected by the above methods may comprise transforming or infecting a host cell with a nucleic acid or a vector encoding an amino acid sequence having detectable binding affinity for, or detectable in vitro effect on the activity of a sphingolipid target.
  • the amino acid sequences having detectable binding affinity for, or detectable in vitro effect on the activity of a sphingolipid target can be made by recombinant DNA methods.
  • DNA encoding the amino acid sequences can be readily synthesized using conventional procedures. Once prepared, the DNA can be introduced into expression vectors, which can then be transformed or transfected into host cells such as E. coli or any suitable expression system, in order to obtain the expression of amino acid sequences in the recombinant host cells and/or in the medium in which these recombinant host cells reside.
  • the heavy chain variable domain produced from an expression vector using a suitable expression system may be tagged (typically at the N-terminal or C-terminal end of the amino acid sequence) with e.g. a His-tag or other sequence tag for easy purification.
  • Transformation or transfection of nucleic acids or vectors into host cells may be accomplished by a variety of means known to the person skilled in the art including calcium phosphate-DNA co-precipitation, DEAE-dextran-mediated transfection, polybrene-mediated transfection, electroporation, microinjection, liposome fusion, lipofection, protoplast fusion, retroviral infection, and biolistics.
  • Suitable host cells for the expression of the desired heavy chain variable domain sequences may be any eukaryotic or prokaryotic cell (e.g., bacterial cells such as E. coli , yeast cells, mammalian cells, avian cells, amphibian cells, plant cells, fish cells, and insect cells), whether located in vitro or in vivo.
  • host cells may be located in a transgenic plant.
  • the application also provides methods for the production of heavy chain variable domain sequences having detectable binding affinity for, or detectable in vitro effect on the activity of a sphingolipid target comprising transforming, transfecting or infecting a host cell with nucleic acid sequences or vectors encoding such amino acid sequences and expressing the amino acid sequences under suitable conditions.
  • the invention further provides methods for the manufacture Or the production of which is equivalent wording) an agrochemical or biological control composition as disclosed herein.
  • the invention provides methods for producing an agrochemical composition as disclosed herein, at least comprising the steps of:
  • the step of obtaining at least one heavy chain variable domain or functional fragment thereof, which specifically binds to a sphingolipid of a plant pathogen comprises:
  • the step of obtaining at least one heavy chain variable domain or functional fragment thereof, which specifically binds to a sphingolipid of a plant pathogen comprises:
  • an agrochemical or biological control composition as disclosed herein, comprising formulating an amino acid sequence or polypeptide of between 80 and 200 amino acids, or other suitable sub-ranges as defined herein before, with pesticidal activity together with at least one customary agrochemical auxiliary agent.
  • Suitable manufacturing methods include, but are not limited to, high or low shear mixing, wet or dry milling, drip-casting, encapsulating, emulsifying, coating, encrusting, pilling, extrusion granulation, fluid bed granulation, co-extrusion, spray drying, spray chilling, atomization, addition or condensation polymerization, interfacial polymerization, in situ polymerization, coacervation, spray encapsulation, cooling melted dispersions, solvent evaporation, phase separation, solvent extraction, sol-gel polymerization, fluid bed coating, pan coating, melting, passive or active absorption or adsorption.
  • amino acid sequences or polypeptides of between 80 and 200 amino acids as disclosed herein, or other suitable sub-ranges as defined herein before, may be prepared by chemical synthesis.
  • amino acid sequences or polypeptides of between 80 and 200 amino acids, or other suitable sub-ranges as defined herein before may be prepared by recombinant microbial expression systems in vitro and isolated for further use.
  • Such amino acid sequences or polypeptides may be either in crude cell lysates, suspensions, colloids, etc., or alternatively may be purified, refined, buffered and/or further processed before formulating together with customary agrochemical auxiliary agents.
  • recombinant methodologies generally involve inserting a DNA molecule expressing an amino acid sequence, protein or polypeptide of interest into an expression system to which the DNA molecule is heterologous (i.e. not normally present in the host).
  • the heterologous DNA molecule is inserted into the expression system or vector in proper sense orientation and correct reading frame.
  • the vector contains the necessary elements for the transcription and translation of the inserted protein-coding sequences. Transcription of DNA is dependent upon the presence of a promoter. Similarly, translation of mRNA in prokaryotes depends upon the presence of the proper prokaryotic signals which differ from those of eukaryotes.
  • the DNA molecule is cloned into the vector using standard cloning procedures in the art, as described by Sambrook et al, Molecular Cloning: A Laboratory Manual, Cold Springs Laboratory, Cold Springs Harbor, N.Y. (1989).
  • the isolated DNA molecule encoding the protein has been cloned into an expression system, it is ready to be incorporated into a host cell. Such incorporation can be carried out by the various forms of transformation, depending upon the vector/host cell system.
  • Suitable host cells include, but are not limited to, bacteria, virus, yeast, mammalian cells, insect, plant, and the like.
  • the recombinant host cells can be host cells that express a native or recombinant, functional type III secretion system. This is described in detail in U.S. Pat. No. 6,596,509. As a consequence of expressing the functional type III secretion system, the cells will express the polypeptide and then secrete the protein into the culture medium. This can simplify isolation and purification of the polypeptide.
  • the recombinant host cells can be grown in appropriate fermentation chambers, preferably under temperature and nutrient conditions that optimize growth of the host cells and the expression of the polypeptide. Persons of skill in the art are able to identify optimal conditions for particular host cells. After fermentation, for example the bacterial suspension may be diluted in, e.g.
  • a buffer to adjust the pH between about 5.5 to 10, more preferably to a pH of between about 7 to 9, and even more preferably to a pH of about 8.0.
  • Suitable buffers are well-known in the art and may include, for example, potassium phosphate buffer or a Tris-EDTA buffer.
  • the concentration of the buffer can be from about 0.001 mM to about 0.5 M.
  • the (bacterial) suspension solution is heat treated to a temperature of about 60-130° C., preferably to a temperature of about 95-125° C. Heat treatment may be carried out for any suitable period of time. In one embodiment, heat treatment is carried out for a period of about five minutes up to about 30 minutes. The heated suspension solution is then cooled.
  • a suitable cool down temperature is, without limitation, about 35-55° C., preferably about 45° C.
  • bacterial cells in the bacterial suspension are lysed, if required, to liberate the polypeptide.
  • Cell lysis may be carried out, e.g. by contacting the bacterial suspension with a lysozyme.
  • the concentration of lysozyme may be anywhere from about 2 ppm to 100 ppm.
  • cell lysis may involve non-chemical methods, such as high pressure or sonication, both of which are well known by persons of ordinary skill in the art. It may be desirable, after cell lysis, to incubate the bacterial suspension. Suitable incubation times may vary.
  • the desired polypeptide can be further extracted by removing the cell debris and the denatured proteins resulting from the previous heat treatment step.
  • the extract is centrifuged for about 10-20 minutes to remove some of the cell debris. Suitable centrifuge speeds may be from about 4,000 to 20,000 rpm and the spinning down time can be from about 10 minutes to 20 minutes. Further cell debris may then be removed by heat treating and centrifuging the supernatant to obtain a liquid extract that is substantially free of cellular debris by removing more than about 60%, 70%, 80%, 90%, or 95% of total solids.
  • This subsequent heat treatment may be carried out at a temperature of about 60° C. for up to about two hours, at about 100° C. for about 10 minutes, or at about 121° C. with 15 psi of pressure for about 5 minutes. These temperatures and times may vary depending on other conditions.
  • the method of making a stable liquid composition containing an amino acid sequence or polypeptide as disclosed herein further involves introducing into the liquid extract a biocidal agent and, optionally, one or both of a protease inhibitor and a non-ionic surfactant, thereby obtaining a liquid composition comprising the polypeptide.
  • a protease inhibitor is introduced into the liquid extract without a non-ionic surfactant.
  • a non-ionic surfactant is introduced into the liquid extract without a protease inhibitor.
  • both a protease inhibitor and a non-ionic surfactant are introduced into the liquid extract.
  • neither a protease inhibitor nor a non-ionic surfactant are introduced into the liquid extract.
  • the stability of the liquid composition as disclosed herein can be assessed using, e.g., HPLC analysis or other suitable procedures that can identify quantity of a specific protein or polypeptide.
  • the stability of the amino acid sequences or polypeptides in a composition as disclosed herein can be determined by comparing the quantity of the protein in the aged liquid composition to that of a recently prepared liquid composition or to a prior quantitation performed on the same composition.
  • the measurement of protein stability strongly correlates with a retention of its activity.
  • Customary agrochemical auxiliary agents are well-known in the art and include, but are not limited to aqueous or organic solvents, buffering agents, acidifiers, surfactants, wetting agents, spreading agents, tackifiers, stickers, carriers, fillers, thickeners, emulsifiers, dispersants, sequestering agents, anti-settling agents, coalescing agents, rheology modifiers, defoaming agents, photo-protectors, anti-freeze agents, biocides, penetrants, mineral or vegetable oils, pigments and drift control agents or any suitable combination thereof.
  • the invention provides a polypeptide of between 80 and 200 amino acids or the sub-ranges disclosed herein before, obtained by affinity selection to a certain plant pest target, which is able to inhibit the growth and/or the activity of a plant pest at a minimum inhibitory concentration of about 0.00001 to 1 ⁇ M.
  • the heavy chain variable domain sequences sequences, polypeptides or compositions as disclosed herein are directly or indirectly applied to the plant by spraying, atomizing, foaming, fogging, in hydroculture/hydroponics, coating, submerging, and/or encrusting.
  • the present invention provides nucleic acid sequences encoding the heavy chain variable domain amino acid sequences in the compositions as disclosed herein (or suitable fragments thereof). These nucleic acid sequences can also be in the form of a vector or a genetic construct or polynucleotide.
  • the nucleic acid sequences as disclosed herein may be synthetic or semi-synthetic sequences, nucleotide sequences that have been isolated from a library (and in particular, an expression library), nucleotide sequences that have been prepared by PCR using overlapping primers, or nucleotide sequences that have been prepared using techniques for DNA synthesis known per se.
  • the genetic constructs as disclosed herein may be DNA or RNA, and are preferably double-stranded DNA.
  • the genetic constructs of the invention may also be in a form suitable for transformation of the intended host cell or host organism in a form suitable for integration into the genomic DNA of the intended host cell or in a form suitable for independent replication, maintenance and/or inheritance in the intended host organism.
  • the genetic constructs of the invention may be in the form of a vector, such as for example a plasmid, cosmid, YAC, a viral vector or transposon.
  • the vector may be an expression vector, i.e., a vector that can provide for expression in vitro and/or in vivo (e.g. in a suitable host cell, host organism and/or expression system).
  • the present invention also provides vectors comprising one or more nucleic acid sequences of the invention.
  • the present invention provides hosts or host cells that express or are capable of expressing one or more amino acid sequences as disclosed herein. Suitable examples of hosts or host cells for expression of the amino acid sequences, polypeptides of the invention will be clear to the skilled person.
  • polypeptides of between 80 and 200 amino acids or the sub-ranges discussed herein before remain stable in an agrochemical or biological control composition, as defined, meaning that the integrity and the pesticidal activity, as defined, of the polypeptide is maintained under storage and/or utilization conditions of the agrochemical composition, which may include elevated temperatures, freeze-thaw cycles, changes in pH or in ionic strength, UV-irradiation, presence of harmful chemicals and the like.
  • these polypeptides of between 80 and 200 amino acids remains stable in the agrochemical composition when the agrochemical composition is stored at ambient temperature for a period of two years or when the agrochemical composition is stored at 54° C. for a period of two weeks.
  • the polypeptides of between 80 and 200 amino acids comprised in an agrochemical composition retains at least about 70% activity, more particularly at least about 70% to 80% activity, most particularly about 80% to 90% activity, after having been stored in the agrochemical composition at ambient temperature for a period of two years or when the agrochemical composition containing the polypeptide is stored at 54° C. for a period of two weeks.
  • the application discloses nucleic acid sequences encoding a polypeptides of between 80 and 200 amino acids, wherein polypeptides are obtained by affinity selection to a specific plant pathogenic target, which polypeptide is able to inhibit the growth and/or the activity of a crop pest at a minimum inhibitory concentration of about 0.00001 to 1 ⁇ M.
  • chimeric genes comprising the following operably linked DNA elements: a) a plant expressible promoter, b) a DNA region which when transcribed yields a mRNA molecule capable of being translated into a polypeptide and c) a 3′ end region comprising transcription termination and polyadenylation signals functioning in cells of said plant.
  • a “chimeric gene” or “chimeric construct” is a recombinant nucleic acid sequence in which a promoter (e.g. a plant expressible promoter) or regulatory nucleic acid sequence is operatively linked to, or associated with, a nucleic acid sequence that codes for an mRNA, such that the regulatory nucleic acid sequence is able to regulate transcription or expression of the associated nucleic acid coding sequence when introduced into a cell such as a plant cell.
  • the regulatory nucleic acid sequence of the chimeric gene is not normally operatively linked to the associated nucleic acid sequence as found in nature.
  • a “plant promoter” comprises regulatory elements, which mediate the expression of a coding sequence segment in plant cells.
  • the nucleic acid molecule For expression in plants, the nucleic acid molecule must be linked operably to or comprise a suitable promoter which expresses the gene at the right point in time and with the required spatial expression pattern.
  • operably linked refers to a functional linkage between the promoter sequence and the gene of interest, such that the promoter sequence is able to initiate transcription of the gene of interest.
  • Plant expressible promoters comprise nucleic acid sequences which are able to direct the expression of a transgene in a plant.
  • Examples of plant expressible promoters are constitutive promoters which are transcriptionally active during most, but not necessarily all, phases of growth and development and under most environmental conditions, in at least one cell, tissue or organ, other promoters are inducible promoters, other examples are tissue specific promoters, still other examples are abiotic stress inducible promoters.
  • the chimeric gene when transformed in a plant expresses a nucleic acid which results in expression of a protein.
  • a recombinant vector which comprises an expression cassette (or a chimeric gene) as herein described before.
  • terminal encompasses a control sequence which is a DNA sequence at the end of a transcriptional unit which signals 3′ processing and polyadenylation of a primary transcript and termination of transcription.
  • the terminator can be derived from the natural gene, from a variety of other plant genes, or from T-DNA.
  • the terminator to be added may be derived from, for example, the nopaline synthase or octopine synthase genes, or alternatively from another plant gene, or less preferably from any other eukaryotic gene.
  • “Selectable marker”, “selectable marker gene” or “reporter gene” includes any gene that confers a phenotype on a cell in which it is expressed to facilitate the identification and/or selection of cells that are transfected or transformed with a nucleic acid construct of the invention. These marker genes enable the identification of a successful transfer of the nucleic acid molecules via a series of different principles. Suitable markers may be selected from markers that confer antibiotic or herbicide resistance, that introduce a new metabolic trait or that allow visual selection.
  • selectable marker genes include genes conferring resistance to antibiotics (such as nptII that phosphorylates neomycin and kanamycin, or hpt, phosphorylating hygromycin, or genes conferring resistance to, for example, bleomycin, streptomycin, tetracyclin, chloramphenicol, ampicillin, gentamycin, geneticin (G418), spectinomycin or blasticidin), to herbicides (for example bar which provides resistance to Basta®; aroA or gox providing resistance against glyphosate, or the genes conferring resistance to, for example, imidazolinone, phosphinothricin or sulfonylurea), or genes that provide a metabolic trait (such as manA that allows plants to use mannose as sole carbon source or xylose isomerase for the utilisation of xylose, or antinutritive markers such as the resistance to 2-deoxyglucose).
  • antibiotics such as nptII that phospho
  • Visual marker genes results in the formation of colour (for example ⁇ -glucuronidase, GUS or ⁇ -galactosidase with its coloured substrates, for example X-Gal), luminescence (such as the luciferin/luceferase system) or fluorescence (Green Fluorescent Protein, GFP, and derivatives thereof).
  • colour for example ⁇ -glucuronidase, GUS or ⁇ -galactosidase with its coloured substrates, for example X-Gal
  • luminescence such as the luciferin/luceferase system
  • fluorescence Green Fluorescent Protein
  • nucleic acid molecules encoding a selectable marker can be introduced into a host cell on the same vector that comprises the sequence encoding the polypeptides of the invention or used in the methods of the invention, or else in a separate vector. Cells which have been stably transfected with the introduced nucleic acid can be identified for example by selection (for example, cells which have integrated the selectable marker survive whereas the other cells die).
  • the process according to the invention for introducing the nucleic acids advantageously employs techniques which enable the removal or excision of these marker genes.
  • One such a method is what is known as co-transformation.
  • the co-transformation method employs two vectors simultaneously for the transformation, one vector bearing the nucleic acid according to the invention and a second bearing the marker gene(s).
  • a large proportion of transformants receives or, in the case of plants, comprises (up to 40% or more of the transformants), both vectors.
  • the transformants usually receive only a part of the vector, i.e.
  • the marker genes can subsequently be removed from the transformed plant by performing crosses.
  • marker genes integrated into a transposon are used for the transformation together with desired nucleic acid (known as the Ac/Ds technology).
  • the transformants can be crossed with a transposase source or the transformants are transformed with a nucleic acid construct conferring expression of a transposase, transiently or stable.
  • the transposon jumps out of the genome of the host cell once transformation has taken place successfully and is lost.
  • the transposon jumps to a different location. In these cases the marker gene must be eliminated by performing crosses.
  • Cre/lox system Cre1 is a recombinase that removes the sequences located between the loxP sequences. If the marker gene is integrated between the loxP sequences, it is removed once transformation has taken place successfully, by expression of the recombinase.
  • Cre1 is a recombinase that removes the sequences located between the loxP sequences. If the marker gene is integrated between the loxP sequences, it is removed once transformation has taken place successfully, by expression of the recombinase.
  • Further recombination systems are the HIN/HIX, FLP/FRT and REP/STB system (Tribble et al., J. Biol.
  • transgenic means with regard to, for example, a nucleic acid sequence, an expression cassette, gene construct or a vector comprising the nucleic acid sequence or an organism transformed with the nucleic acid sequences, expression cassettes or vectors according to the invention.
  • transgenic plant for the purposes of the invention is thus understood as meaning, as above, that the nucleic acids used in the method of the invention are not present in, or originating from, the genome of said plant, or are present in the genome of said plant but not at their natural locus in the genome of said plant, it being possible for the nucleic acids to be expressed homologously or heterologously.
  • transgenic also means that, while the nucleic acids according to the invention or used in the inventive method are at their natural position in the genome of a plant, the sequence has been modified with regard to the natural sequence, and/or that the regulatory sequences of the natural sequences have been modified.
  • Transgenic is preferably understood as meaning the expression of the nucleic acids according to the invention at an unnatural locus in the genome, i.e. homologous or, heterologous expression of the nucleic acids takes place.
  • Preferred transgenic plants are mentioned herein.
  • expression means the transcription of a specific gene or specific genes or specific genetic construct.
  • expression in particular means the transcription of a gene or genes or genetic construct into structural RNA (rRNA, tRNA) or mRNA with or without subsequent translation of the latter into a protein. The process includes transcription of DNA and processing of the resulting mRNA product.
  • “increased expression” or “overexpression” as used herein means any form of expression that is additional to the original wild-type expression level.
  • the original wild-type expression level might also be zero, i.e. absence of expression or immeasurable expression.
  • Isolated nucleic acids which serve as promoter or enhancer elements may be introduced in an appropriate position (typically upstream) of a non-heterologous form of a polynucleotide so as to upregulate expression of a nucleic acid encoding the polypeptide of interest. If polypeptide expression is desired, it is generally desirable to include a polyadenylation region at the 3′-end of a polynucleotide coding region.
  • the polyadenylation region can be derived from the natural gene, from a variety of other plant genes, or from T-DNA.
  • the 3′ end sequence to be added may be derived from, for example, the nopaline synthase or octopine synthase genes, or alternatively from another plant gene, or less preferably from any other eukaryotic gene.
  • An intron sequence may also be added to the 5′ untranslated region (UTR) or the coding sequence of the partial coding sequence to increase the amount of the mature message that accumulates in the cytosol.
  • UTR 5′ untranslated region
  • coding sequence of the partial coding sequence to increase the amount of the mature message that accumulates in the cytosol.
  • Inclusion of a spliceable intron in the transcription unit in both plant and animal expression constructs has been shown to increase gene expression at both the mRNA and protein levels up to 1000-fold (Buchman and Berg (1988) Mol. Cell biol. 8: 4395-4405; Callis et al. (1987) Genes Dev 1:1 183-1200).
  • Such intron enhancement of gene expression is typically greatest when placed near the 5′ end of the transcription unit.
  • Use of the maize introns Adh1-S intron 1, 2, and 6, the Bronze-1 intron are known in the art. For general information see: The Maize Handbook, Chapter 1 16, Freeling and Walbot, Eds.
  • introduction or “transformation” as referred to herein encompass the transfer of an exogenous polynucleotide or chimeric gene (or expression cassette) into a host cell, irrespective of the method used for transfer.
  • Plant tissue capable of subsequent clonal propagation may be transformed with a genetic construct of the present invention and a whole plant regenerated there from. The particular tissue chosen will vary depending on the clonal propagation systems available for, and best suited to, the particular species being transformed.
  • tissue targets include leaf disks, pollen, embryos, cotyledons, hypocotyls, megagametophytes, callus tissue, existing meristematic tissue (e.g., apical meristem, axillary buds, and root meristems), and induced meristem tissue (e.g., cotyledon meristem and hypocotyl meristem).
  • the polynucleotide may be transiently or stably introduced into a host cell and may be maintained non-integrated, for example, as a plasmid. Alternatively, it may be integrated into the host genome.
  • the resulting transformed plant cell may then be used to regenerate a transformed plant in a manner known to persons skilled in the art.
  • Transformation of plant species is now a fairly routine technique.
  • any of several transformation methods may be used to introduce the gene of interest into a suitable ancestor cell.
  • the methods described for the transformation and regeneration of plants from plant tissues or plant cells may be utilized for transient or for stable transformation. Transformation methods include the use of liposomes, electroporation, chemicals that increase free DNA uptake, injection of the DNA directly into the plant, particle gun bombardment, transformation using viruses or pollen and microprojection. Methods may be selected from the calcium/polyethylene glycol method for protoplasts (Krens, F. A. et al., (1982) Nature 296, 72-74; Negrutiu I et al.
  • Transgenic plants including transgenic crop plants, are preferably produced via Agrobacterium -mediated transformation.
  • An advantageous transformation method is the transformation in planta.
  • agrobacteria to act on plant seeds or to inoculate the plant meristem with agrobacteria. It has proved particularly expedient in accordance with the invention to allow a suspension of transformed agrobacteria to act on the intact plant or at least on the flower primordia. The plant is subsequently grown on until the seeds of the treated plant are obtained (Clough and Bent, Plant J. (1998) 16, 735-743).
  • Methods for Agrobacterium -mediated transformation of rice include well known methods for rice transformation, such as those described in any of the following: European patent application EP1198985, Aldemita and Hodges (Planta 199: 612-617, 1996); Chan et al.
  • nucleic acids or the construct to be expressed is preferably cloned into a vector, which is suitable for transforming Agrobacterium tumefaciens , for example pBin19 (Bevan et al (1984) Nucl. Acids Res. 12-8711).
  • Agrobacteria transformed by such a vector can then be used in known manner for the transformation of plants, such as plants used as a model, like Arabidopsis ( Arabidopsis thaliana is within the scope of the present invention not considered as a crop plant), or crop plants such as, by way of example, tobacco plants, for example by immersing bruised leaves or chopped leaves in an agrobacterial solution and then culturing them in suitable media.
  • plants used as a model like Arabidopsis ( Arabidopsis thaliana is within the scope of the present invention not considered as a crop plant), or crop plants such as, by way of example, tobacco plants, for example by immersing bruised leaves or chopped leaves in an agrobacterial solution and then culturing them in suitable media.
  • the transformation of plants by means of Agrobacterium tumefaciens is described, for example, by Hofgen and Willmitzer in Nucl. Acid Res. (1988) 16, 9877 or is known inter alia from F. F. White, Vectors
  • the transformation of the chloroplast genome is generally achieved by a process which has been schematically displayed in Klaus et al., 2004 [Nature Biotechnology 22 (2), 225-229]. Briefly the sequences to be transformed are cloned together with a selectable marker gene between flanking sequences homologous to the chloroplast genome. These homologous flanking sequences direct site specific integration into the plastome. Plastidal transformation has been described for many different plant species and an overview is given in Bock (2001) Transgenic plastids in basic research and plant biotechnology. J Mol Biol. 2001 Sep. 21; 312 (3):425-38 or Maliga, P (2003) Progress towards commercialization of plastid transformation technology. Trends Biotechnol. 21, 20-28. Further biotechnological progress has recently been reported in form of marker free plastid transformants, which can be produced by a transient co-integrated maker gene (Klaus et al., 2004, Nature Biotechnology 22(2), 225-229).
  • the genetically modified plant cells can be regenerated via all methods with which the skilled worker is familiar. Suitable methods can be found in the abovementioned publications by S. D. Kung and R. Wu, Potrykus or Hofgen and Willmitzer.
  • plant cells or cell groupings are selected for the presence of one or more markers which are encoded by plant-expressible genes co-transferred with the gene of interest, following which the transformed material is regenerated into a whole plant.
  • the plant material obtained in the transformation is, as a rule, subjected to selective conditions so that transformed plants can be distinguished from untransformed plants.
  • the seeds obtained in the above-described manner can be planted and, after an initial growing period, subjected to a suitable selection by spraying.
  • a further possibility consists in growing the seeds, if appropriate after sterilization, on agar plates using a suitable selection agent so that only the transformed seeds can grow into plants.
  • the transformed plants are screened for the presence of a selectable marker such as the ones described above.
  • putatively transformed plants may also be evaluated, for instance using Southern analysis, for the presence of the gene of interest, copy number and/or genomic organisation.
  • expression levels of the newly introduced DNA may be monitored using Northern and/or Western analysis, both techniques being well known to persons having ordinary skill in the art.
  • the generated transformed plants may be propagated by a variety of means, such as by clonal propagation or classical breeding techniques.
  • a first generation (or T1) transformed plant may be selfed and homozygous second-generation (or T2) transformants selected, and the T2 plants may then further be propagated through classical breeding techniques.
  • the generated transformed organisms may take a variety of forms. For example, they may be chimeras of transformed cells and non-transformed cells; clonal transformants (e.g., all cells transformed to contain the expression cassette); grafts of transformed and untransformed tissues (e.g., in plants, a transformed rootstock grafted to an untransformed scion).
  • FIG. 1 Binding of VHH as crude VHH-containing periplasmic extracts to coated fungal GlcCer from Pleurotus citrinopileatus .
  • Anti-GlcCer VHH bind to fungal GlcCer, no binding is observed for unrelated VHH.
  • FIG. 3A Binding specificity of VHH. Binding of purified VHH at 1 ⁇ g/ml to coated fungal GlcCer from Fusarium oxysporum or Pleurotus citrinopileatus . Different anti-GlcCer VHH specifically bind to different fungal GlcCer.
  • FIG. 3B Binding specificity of VHH. Binding of purified VHH at 1 ⁇ g/ml to coated non-fungal GlcCer from plant (soy). Different anti-GlcCer VHH do not bind plant GlcCer.
  • FIG. 3C Binding specificity of VHH. Binding of purified VHH at 1 ⁇ g/ml to coated non-fungal mammalian GlcCer (pork). Different anti-GlcCer VHH do not bind mammalian GlcCer.
  • FIG. 4 Real-time measurement of the antibody-antigen interaction between VHH 41 D01 and fungal GlcCer.
  • VHH 41 D01 binds fungal GlcCer.
  • a slow dissociation of GlcCer from VHH 41 D01 is observed.
  • Unrelated VHH_A does not bind fungal GlcCer.
  • FIG. 6 Binding of VHH 41D01 in different compositions to fungal GlcCer from Fusarium oxysporum .
  • Aqueous compositions containing anti-GlcCer VHH 41D01 at 0.1 ⁇ g/ml and protease inhibitors and/or non-ionic surfactant and/or preservative were tested for binding to fungal GlcCer.
  • GlcCer-specific VHH 41D01 binds to fungal GlcCer in all compositions tested without adverse effects of any of the additives.
  • FIG. 7A Visual scoring of fungal growth.
  • Serial dilution of VHH anti-GlcCer VHH's 41D01, 56E05, 56F11, and 57A06 as well as unrelated VHH_A or unrelated VHH_B
  • Botrytis cinerea spores (1E+05/ml) and incubated at room temperature.
  • Effect on fungal growth of anti-GlcCer VHH's 41D01, 56E05, 56F11, and 57A06, unrelated VHH_A or unrelated VHH_B was quantified based on a set of photographic standards. Bars represent average % of growth, error bars represent standard errors of the mean of at least 3 replicas.
  • FIG. 7B Visual scoring of fungal growth.
  • Serial dilution of VHH anti-GlcCer VHH's 56C09, 56H07, 57C09, 57E07, 57E11 as well as unrelated VHH_A or unrelated VHH_B
  • Botrytis cinerea spores (1E+05/ml) and incubated at room temperature.
  • Effect on fungal growth of anti-GlcCer VHH's 56C09, 56H07, 57C09, 57E07, 57E11, unrelated VHH_A or unrelated VHH_B was quantified based on a set of photographic standards. Bars represent average % of growth, error bars represent standard errors of the mean of at least 3 replicas.
  • FIG. 7C Visual scoring of fungal growth.
  • Serial dilution of VHH anti-GlcCer VHH's 54C08, 54C11, 56A05, 56A09 as well as unrelated VHH_A or unrelated VHH_B
  • Botrytis cinerea spores (1E+05/ml) and incubated at room temperature.
  • Effect on fungal growth of anti-GlcCer VHH's 54C08, 54C11, 56A05, 56A09, unrelated VHH_A or unrelated VHH_B was quantified based on a set of photographic standards. Bars represent average % of growth, error bars represent standard errors of the mean of at least 3 replicas.
  • FIG. 9 In-vitro antifungal assay using Penicillium expansum .
  • Two-fold serial dilutions of VHH were inoculated with P. expansum spores (1E+03/ml) at room temperature.
  • Anti-GlcCer VHH 41D01, unrelated VHH_A, BSA, unrelated hlgG, anti-GlcCer mouse monoclonal antibody and water were tested.
  • Luminescence (RLU) was measured after 24 h incubation.
  • VHH's were generated from llamas immunized with fungal glucosylceramide (GlcCer). Llamas were immunized according to standard protocols with 6 boosts of thin Layer Chromatography (TLC)-purified (99%) glucosylceramide (GlcCer) from Pleurotus citrinopileatus (Nacalai Tesque). Purified GlcCer was dissolved in a water:methanol:chloroform mixture and spotted on a TLC silica glass plate. Silica with adsorbed GlcCer was scraped from the plate and suspended in phosphate buffer. The suspension was sonicated, mixed with Freund incomplete adjuvant, and used for subcutaneous injections.
  • TLC thin Layer Chromatography
  • VHH were also generated from llamas immunized with native germinated fungal or oomycete spores. Llamas were immunized according to standard protocols with 6 boosts of native germinated spores of Botrytis cinerea or Phytophthora infestans by subcutaneous injections. All llamas remained healthy throughout the immunization process and blood samples were taken before and after immunizations.
  • a phage library of antibodies is a phage population in which each individual phage exposes a unique antigen-binding antibody domain on its surface as a part of a chimeric pill protein.
  • Peripheral blood mononuclear cells were prepared from blood samples of the immunized llamas using Ficoll-Hypaque according to the manufacturer's instructions. Total RNA was extracted from these cells and used as starting material for RT-PCR to amplify VHH encoding gene fragments. These fragments were cloned into phagemid vector pASF20.
  • pASF20 is an expression vector that is derived from pUC119 which contains the lacZ promotor, a synthetic leader sequence, a multiple cloning site, a coliphage pill protein coding sequence, a resistance gene for ampicillin, and an M13 phage origin for single strand production.
  • the vector codes for a C-terminal (His)6 peptide tag and c-myc peptide tag. Phage were prepared according to standard methods (Phage Display of Peptides and Proteins: A Laboratory Manual; Brian K. Kay, Jill Winter, Dr. John McCafferty). 4 libraries each with a clonal diversity equal to or greater than 1E+08 were obtained and phage were produced ensuring presentation of the antibody diversity.
  • Phage expressing antigen-binding antibody domains specific for a particular antigen were isolated by selecting the phage in the library for binding to the antigen.
  • Fungal GlcCer were immobilized on polystyrene Maxisorp multiwell plates by dissolving fungal GlcCer in a water:methanol:chloroform mixture or methanol at different concentrations, adding dissolved fungal GlcCer to wells of the multiwell plate, and allowing to dry overnight at room temperature.
  • Wells with coated fungal GlcCer were washed and blocked with 1% fish gelatin in preparation of VHH selections by phage display.
  • VHH library phage were allowed to bind for two hours at room temperature to wells of 96-well plate coated with fungal GlcCer.
  • To specifically select for phage binding to fungal GlcCer phage were pre-incubated with 1% fish gelatin and/or BSA and/or skimmed milk and/or plant GlcCer and/or mammalian GlcCer.
  • Non-bound phage were removed by extensive washing and bound phage were eluted by competitive elution with RsAFP2 (Osborn et al., 1995) or with trypsin.
  • the diversity of the obtained antibody or antibody domain population can be rapidly determined using high-throughput DNA sequencing and allows precise quantification of clonal diversity.
  • Antibody or antibody domain binding and specificity of binding to an antigen can be analyzed in assays for binding to that antigen and compared to related and unrelated controls.
  • Each antibody or antibody domain can bind to a specific antigen and possibly to antigenic variants of that antigen.
  • Specificity is the degree to which the binding of an antibody or antibody domain discriminates between antigenic variants. From individual VHH clones that were picked from first, second or third round phage display selections the DNA was amplified in a colony PCR and PCR products were sequenced by Sanger-sequencing. After sequence analysis and based on sequence diversity, VHH were selected for further characterization.
  • GlcCer fungal and non-fungal GlcCer from target and non-target species were used in binding assays.
  • Primary binding assays to identify which clones were functionally selected from the libraries were performed with TLC-purified (99%) GlcCer or GlcCer-enriched Glycosphingolipids (GSL) fractions from A. brassicicola, B. cinerea, C. beticola, F. culmorum, F. graminearum, F. oxysporum, P. citrinopileatus P. digitatum, P. expansum , or V. dahlia (prepared as described in Ternes et al., 2011 JBC 286:11401-14).
  • GlcCer from soybean and porcine GlcCer were purchased from Avanti Polar Lipids. VHH were produced in 96-well deep-well plates and the binding profile of diluted crude VHH-containing periplasmic extracts was assessed in ELISA format. In the same way, binding assays were performed with purified VHH.
  • VHH-containing periplasmic extracts showed to bind fungal GlcCer with higher OD 405 nm values than the unrelated VHH_A, unrelated VHH_B and blank.
  • OD 405 nm values demonstrating the specific binding of several of these fungal GlcCer binding VHH's are shown in FIG. 1 .
  • Sequence analysis revealed 84 unique sequences from the identified set of anti-GlcCer VHH.
  • VHH belonging to the abovementioned lead panel were produced in E. coli in culture flasks according to standard procedures. Hexahistidine-tagged VHH were purified from the periplasmic extract with TALON metal affinity resin (Clontech), according to the manufacturer's instructions. Purified VHH were concentrated and dialyzed to PBS. VHH were also purified using automated purification systems using a combination of immobilized Nickel IMAC and desalting columns. VHH of the lead panel that scored positively in primary binding assays, were subsequently tested for their specificity towards GlcCer or cell wall fractions from different fungal phytopathogens.
  • GlcCer-specific VHH showed specific binding to fungal GlcCer ( Pleurotus citrinopileatus, Fusarium oxysporum ) and not to other non-fungal GlcCer or blank non-coated well.
  • Binding of VHH to fungal GlcCer was characterised by surface plasmon resonance in a Biacore 3000 instrument.
  • Anti-GlcCer VHH 41 D01 or unrelated VHH_A were covalently bound to CM5 sensor chips surface via amine coupling until an increase of 1000 response units was reached. Remaining reactive groups were inactivated.
  • a range of concentrations of in solution Fusarium oxysporum GlcCer prepared according to Salio et al., 2013 PNAS 110, E4753-E4761 was injected for 2 minutes at a flow rate of 30 ⁇ l/min to allow for binding to chip-bound VHH.
  • Running buffer without GlcCer was injected over the chip at the same flow rate to allow spontaneous dissociation of bound fungal GlcCer for 10 minutes.
  • a Koff-value was calculated from the sensorgrams obtained for the different fungal GlcCer concentrations with 1:1 Langmuir dissociation global fitting model.
  • VHH For anti-GlcCer VHH a slow off-rate of 4.86*1E-4/s was calculated. As shown in FIG. 4 , an unrelated VHH did not bind fungal GlcCer.
  • Plant (soy), mammalian (pork) and fungal ( Fusarim oxysporum ) GlcCer in solution were sequentially injected for 2 minutes at a flow rate of 30 ⁇ l/min to allow for binding to chip-bound VHH (anti-GlcCer VHH 41D01 or unrelated VHH_A).
  • Running buffer without GlcCer was injected over the chip between each injection at the same flow rate to allow spontaneous dissociation of bound GlcCer.
  • Fungal extracts were prepared according to Rodrigues et al. 2000 Infection and Immunity 68 (12): 7049-60. Briefly, mycelium from Botrytis cinerea B05-10, Botrytis cinerea MUCL401, Botrytis cinerea R16, Botrytis cinerea (own pear isolate), Fusarium culmorum MUCL555, Fusarium graminearum MUCL53451, Penicillium digitatum MUCL43-410, Penicillium digitatum (own lemon isolate) or Penicillium expansum CBS 146.45 were harvested from fungi grown in agar plates and lipids were extracted with chloroform/methanol 2:1 (vol/vol) and 1:2 (vol/vol); crude lipid extract was partitioned according to Folch et al.
  • anti-GlcCer VHH 41 D01 and 56F11 specifically recognized all the fungi lipid extracts tested.
  • Anti-GlcCer VHH 41D01 and 56F11 did not show binding to unrelated coated compounds or non-coated wells.
  • the binding of the anti-GlcCer VHH compositions to a wide array of fungal lipids extracts potentiates a variety of applications for the anti-GlcCer VHH compositions as disclosed herein against different fungi.
  • compositions containing anti-GlcCer VHH 41 D01 and/or protease inhibitors and/or non-ionic surfactants and/or preservatives were prepared.
  • Composition A1 protease inhibitors: 0.06 ⁇ g/ml aprotinin (Roche, cat#: 10236624001), 0.5 ⁇ g/ml leupeptin (Roche, cat#: 11017101001), 24 ⁇ g/ml 4-benzenesulfonyl fluoride hydrochloride (Sigma, A8456), 1 mM EDTA (Carl-Roth, cat#8040.1) and non-ionic surfactant: 0.00001% Polysorbate 20 (Tween 20 , Sigma, cat# P2287);
  • Composition A2 prote inhibitors: 1 ⁇ g/ml aprotinin, 2.5 ⁇ g/ml leupeptin, 100 ⁇ g/ml 4-benzenesulfonyl fluoride hydrochlor
  • Binding of anti-GlcCer VHH (at 0.1 ⁇ g/ml) to fungal GlcCer in different aqueous compositions was tested in ELISA with coated GlcCer from F. oxysporum and compared to blank non-coated wells. Binding was measured after consecutive incubation with enzyme-conjugated detection antibodies, adding substrate and measuring absorbance at 405 nm.
  • the antifungal activity of the anti-GlcCer-VHH was tested using antifungal assays in liquid media and on agar plates as described in Thevissen et al., 2011, Bioorg. Med. Chem. Lett. 21(12): 3686-92; Francois et al., 2009, J. Biol. Chem. 284(47): 32680-5; Aerts et al., 2009, FEBS Lett. 583(15): 25143-6.
  • the minimal inhibitory concentration (MIC) was determined for the VHH on in vitro growth of Botrytis cinerea and Phytophthora infestans.
  • An in vitro assay to test fungal growth in liquid media in 96-well plate format can also be used to directly screen different VHH that are generated against integral fungal material and selected against molecular antigens, different from GlcCer, for antifungal activity. This screening is performed on crude VHH-containing periplasmic extracts of E. coli cells in which the VHH are produced, or with purified VHH.
  • antifungal activity of anti-GlcCer VHH compositions was assessed in vitro against a number of plant pathogenic fungi and compared with the antifungal activity of unrelated VHH.
  • Two-fold dilutions of the aqueous VHH compositions in water were prepared in 96-well microtiter plates.
  • 80 ⁇ l of fungal spores suspension (1 E+05 spores/ml in half strength potato dextrose broth (PDB)) were added.
  • the fungal test strains were Alternaria brassicicola MUCL20297, Botrytis cinerea R16, Cercospora beticola (own sugar beet isolate), Fusarium culmorum MUCL555 and Verticillium dahliae MUCL6963.
  • test plates were incubated for 72 h at room temperature in the dark and the antifungal activity of the test compounds was scored microscopically and quantified based on photographic standards, whereby a score of 0 or 100 referred to no or maximal fungal growth, respectively. All tests were performed in at least 2 replicas.
  • the results of the antifungal activity assays shown in FIGS. 7A, 7B, 7C, 8A, 8B, 8C and 8D indicated a clear difference between the growth inhibition pattern, expressed as the % fungal growth in function of VHH concentration ( ⁇ g/ml), of the anti-GlcCer VHH (including 41D01, 56F11, 56E05 or 57A06) and the unrelated VHH (VHH_A and VHH_B). This difference was clear irrespective of the species of the test fungus.
  • results show the antifungal potency of anti-GlcCer VHH compared to unrelated VHH. Moreover, the results reveal a broad-spectrum of antifungal activity of anti-GlcCer VHH compositions towards at least 5 different fungal plant pathogens and indicate that the spectrum of antifungal activity of the selected anti-GlcCer VHH can be broadened to other plant pathogenic fungi.
  • the in vitro antifungal activity of anti-GlcCer VHH 41D01 composition was assessed against the plant pathogen fungus Penicillium expansum CBS 146.45 and compared with the antifungal activity of unrelated VHH_A, a mouse monoclonal anti-GlcCer antibody (mouse MAb anti-GlcCer), human immunoglobulin G (hlgG) or bovine serum albumin (BSA) as controls using luminescence as read-out.
  • VHH_A mouse monoclonal anti-GlcCer antibody
  • human immunoglobulin G hlgG
  • BSA bovine serum albumin
  • Two-fold serial dilutions of all the test compositions in water were prepared in 96-well microtiter plates.
  • 80 ⁇ l of fungal spores suspension (1 E+03 spores/ml in 4-fold PDB) were added.
  • the test plates were incubated for 24 h at room temperature in the dark and the spore viability was determined at 24 post inoculation (hpi) using luminescence according to the supplier's instructions (BacTiter Glo; Promega).
  • the % RLU determined upon anti-GlcCer VHH 41D01 composition treatment differed clearly from the % RLU recorded upon unrelated VHH_A, mouse MAb anti-GlcCer, hlgG or BSA treatments.
  • the effect of 41 D01 treatment on fungal spores expressed as % RLU versus non-treated control was less than 25% at 300 ⁇ g/ml or 150 ⁇ g/ml of 41 D01, and less than 50% at 75 ⁇ g/ml, 37.5 ⁇ g/ml and 19 ⁇ g/ml.
  • the effect of all the other test compositions, expressed as % RLU versus non-treated control was generally 100% for all the tested concentrations.
  • anti-GlcCer VHH 41 D01 composition had a clear antifungal effect on the plant pathogenic fungus Penicillium expansum down to 19 ⁇ g/ml and is outperforming non-related VHH_A, mouse MAb anti-GlcCer, hlgG, or BSA.
  • anti-GlcCer VHH compositions can be used to protect plants against plant pathogenic fungi.
  • Anti-GlcCer VHH were produced as recombinant proteins in a suitable E. coli production strain. Anti-GlcCer VHH were purified from the media and/or the periplasm and/or the E. coli cells were killed and lysed at the end of the fermentation process. Anti-GlcCer VHH can also be produced as recombinant proteins in Pichia pastoris , or Saccharomyces cerevisiae and secreted into the fermentation media. Anti-GlcCer VHH are then purified from media components and cell constituents by diafiltration.
  • the resulting protein solution is diluted in a suitable buffer, such as phosphate buffered saline, to adjust the pH to about 7.
  • a biocidal agent such as sodium azide in a concentration of about 0.0001% to 0.1%
  • a non-ionic detergent such as Tween20 in a concentration of about 0.0001% to 5%
  • the resulting protein solution is admixed with a suitable wetting and dispersing agent in the presence of a customary filler material before being spray dried into wettable granules.
  • the efficacy of the VHH with potent in vitro antifungal activity against B. cinerea and P. infestans is further evaluated in planta via disease bio-assays on (i) detached leaves from tomato and potato plants and (ii) on greenhouse-grown tomato and potato plants.
  • Detached leaf disease assays are performed by using the model pathosystems tomato- B. cinerea and potato- P. infestans .
  • Greenhouse-grown tomato and potato plants are sprayed in a spraying cabinet with an aqueous VHH solution in a volume equivalent to 300 liter per ha and with an application rate below 50 g VHH per hectare.
  • the spray deposit is allowed to dry on the plants and composite leaves are subsequently detached from the plants and placed on water agar-plates.
  • the leaves on the water-agar-plates are drop-inoculated at different time points with a spore suspension of B. cinerea or P. infestans (5 ⁇ 10 5 spores/ml).
  • Disease development is monitored visually and/or digitally via measuring lesion diameter and image analysis software, respectively (Assess, Lamari 2002, St. Paul, Minn., USA: APS Press).
  • Detached leaves from greenhouse grown tomato plants were treated with 10 ⁇ l of an aqueous VHH composition (anti-GlcCer or an unrelated VHH at 5 mg/ml), and, water and Scala (1 mg pyrimethanil/ml, as recommended by the manufacturer) as controls.
  • 10 ⁇ l drops of a Botrytis cinerea spores suspension (6 E+06 spores/ml in 4-fold diluted PDB) were applied on the treated surfaces.
  • Treated and inoculated leaves were incubated at high relative humidity and at room temperature in small plant propagators. Disease severity was scored measuring the bidirectional diameter at 6 days post inoculation (dpi).
  • Detached leaves from greenhouse-grown tomato plants were inoculated with 10 ⁇ l drops of a Botrytis cinerea spores suspension ((6 E+06 spores/ml) in 4-fold diluted potato dextrose broth).
  • a Botrytis cinerea spores suspension ((6 E+06 spores/ml) in 4-fold diluted potato dextrose broth).
  • the inoculated spots on the leaves were treated with 10 ⁇ l of an aqueous VHH composition (anti-GlcCer and unrelated VHH at 1.6 mg/ml), and, BSA at 1.6 mg/ml and Scala (1 mg pyrimethanil/ml, as recommended by the manufacturer) as controls.
  • Inoculated and treated leaves were incubated at high relative humidity and at room temperature in small plant propagators. Disease severity was scored measuring the bidirectional diameter at 5 dpi.
  • Pears (variety Williams) from biological agriculture, previously confirmed as untreated, were treated with 10 ⁇ l of aqueous VHH compositions (containing anti-GlcCer VHH or an unrelated VHH at 5 mg/ml), and, water and Scala (1 mg pyrimethanil/ml, as recommended by the manufacturer) as controls.
  • 10 ⁇ l drops of a Botrytis cinerea spores suspension (1 E+04 spores/ml in water) were applied on the treated surfaces.
  • Treated and inoculated pears were incubated at high relative humidity and at room temperature in small containers. Disease severity was scored measuring the bidirectional diameter at 4 dpi.
  • preventive treatment with the anti-GlcCer VHH composition resulted in an average lesion diameter of 3 mm (+/ ⁇ 2 mm), whereas treatment with an unrelated VHH or water showed an average lesion diameter of 9.6 mm (+/ ⁇ 0.8 mm) or 6.6 mm (+/ ⁇ 1.6 mm), respectively.
  • control preventive treatment with a formulated commercial chemical fungicide pears were effectively protected against Botrytis cinerea infection (without a visible lesion).
  • an anti-GlcCer VHH composition on the protection of plant seeds against pathogenic fungi can be evaluated as follows. Surface-sterile plant seeds, treated with an anti-GlcCer VHH, an unrelated VHH, water or a formulated commercial chemical fungicide are put on top of a potato dextrose agar plate containing 1 E+03 spores/ml of the test fungus Fusarium graminearum . Test plates are incubated at room temperature and the fungal growth inhibition zones (mm) surrounding the seeds can be measured allowing comparing the effect of the different treatments.
  • mm fungal growth inhibition zones
  • Tomato plants are grown with their roots in a mineral nutrient solution or on inert media such as perlite supplemented or drenched, respectively with an anti-GlcCer VHH composition, an unrelated VHH, water or a formulated commercial chemical fungicide.
  • an anti-GlcCer VHH composition on the protection of plant flowers against pathogenic fungi can be evaluated using cereals or Arabidopsis thaliana and Fusarium culmorum or Fusarium graminearum as test fungi (as described by Urban et al., 2002).
  • flowering plants are spray-inoculated with 1 E+05 spores/ml) of Fusarium culmorum or Fusarium graminearum followed by a treatment with an anti-GlcCer VHH composition, an unrelated VHH, water or a formulated commercial chemical fungicide (curative treatment) or vice versa (preventive treatment). Plants are incubated and the disease scoring is performed as described by Urban et al. (2002) and allows quantifying the effect of the different treatments.

Landscapes

  • Life Sciences & Earth Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Zoology (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Wood Science & Technology (AREA)
  • Plant Pathology (AREA)
  • Biotechnology (AREA)
  • Molecular Biology (AREA)
  • Dentistry (AREA)
  • Environmental Sciences (AREA)
  • Agronomy & Crop Science (AREA)
  • Pest Control & Pesticides (AREA)
  • Microbiology (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • General Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biomedical Technology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Medicinal Chemistry (AREA)
  • Virology (AREA)
  • Immunology (AREA)
  • Physics & Mathematics (AREA)
  • Cell Biology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Oncology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Communicable Diseases (AREA)
  • Public Health (AREA)
  • General Chemical & Material Sciences (AREA)
  • Peptides Or Proteins (AREA)
  • Agricultural Chemicals And Associated Chemicals (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
US14/787,454 2013-04-29 2014-04-29 Agrochemical compositions comprising antibodies binding to sphingolipids Abandoned US20160145325A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US14/787,454 US20160145325A1 (en) 2013-04-29 2014-04-29 Agrochemical compositions comprising antibodies binding to sphingolipids

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
US201361817170P 2013-04-29 2013-04-29
PCT/EP2014/058771 WO2014177595A1 (en) 2013-04-29 2014-04-29 Agrochemical compositions comprising antibodies binding to sphingolipids
US14/787,454 US20160145325A1 (en) 2013-04-29 2014-04-29 Agrochemical compositions comprising antibodies binding to sphingolipids

Publications (1)

Publication Number Publication Date
US20160145325A1 true US20160145325A1 (en) 2016-05-26

Family

ID=50736046

Family Applications (5)

Application Number Title Priority Date Filing Date
US14/787,454 Abandoned US20160145325A1 (en) 2013-04-29 2014-04-29 Agrochemical compositions comprising antibodies binding to sphingolipids
US14/787,734 Active US9803003B2 (en) 2013-04-29 2014-04-29 Agrochemical compositions comprising antibodies binding to sphingolipids
US15/724,840 Active US10400033B2 (en) 2013-04-29 2017-10-04 Agrochemical compositions comprising antibodies binding to sphingolipids
US16/527,585 Expired - Fee Related US11028154B2 (en) 2013-04-29 2019-07-31 Agrochemical compositions comprising antibodies binding to sphingolipids
US17/150,147 Abandoned US20210253677A1 (en) 2013-04-29 2021-01-15 Agrochemical compositions comprising antibodies binding to sphingolipids

Family Applications After (4)

Application Number Title Priority Date Filing Date
US14/787,734 Active US9803003B2 (en) 2013-04-29 2014-04-29 Agrochemical compositions comprising antibodies binding to sphingolipids
US15/724,840 Active US10400033B2 (en) 2013-04-29 2017-10-04 Agrochemical compositions comprising antibodies binding to sphingolipids
US16/527,585 Expired - Fee Related US11028154B2 (en) 2013-04-29 2019-07-31 Agrochemical compositions comprising antibodies binding to sphingolipids
US17/150,147 Abandoned US20210253677A1 (en) 2013-04-29 2021-01-15 Agrochemical compositions comprising antibodies binding to sphingolipids

Country Status (16)

Country Link
US (5) US20160145325A1 (enrdf_load_stackoverflow)
EP (3) EP2992100B1 (enrdf_load_stackoverflow)
JP (4) JP6388917B2 (enrdf_load_stackoverflow)
CN (4) CN105358699A (enrdf_load_stackoverflow)
AU (3) AU2014273418B2 (enrdf_load_stackoverflow)
BR (2) BR112015027192B1 (enrdf_load_stackoverflow)
CA (2) CA2910632A1 (enrdf_load_stackoverflow)
DK (1) DK2992100T3 (enrdf_load_stackoverflow)
ES (2) ES2762151T3 (enrdf_load_stackoverflow)
HR (1) HRP20192182T1 (enrdf_load_stackoverflow)
HU (1) HUE047580T2 (enrdf_load_stackoverflow)
PL (2) PL2992100T3 (enrdf_load_stackoverflow)
PT (1) PT2992100T (enrdf_load_stackoverflow)
TR (1) TR201819577T4 (enrdf_load_stackoverflow)
WO (2) WO2014177595A1 (enrdf_load_stackoverflow)
ZA (2) ZA201507757B (enrdf_load_stackoverflow)

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2019032662A1 (en) * 2017-08-09 2019-02-14 Orionis Biosciences Inc. CLEC9A BINDING AGENTS AND USES THEREOF
US10271546B2 (en) 2010-04-06 2019-04-30 Agrosavfe N.V. Specific delivery of agrochemicals
WO2019152979A1 (en) * 2018-02-05 2019-08-08 Orionis Biosciences, Inc. Fibroblast binding agents and use thereof
US10400033B2 (en) 2013-04-29 2019-09-03 Agrosavfe N.V. Agrochemical compositions comprising antibodies binding to sphingolipids
US10858666B2 (en) 2014-11-05 2020-12-08 Biotalys Transgenic plants expressing a variable domain of a heavy chain antibody (VHH) that binds to a sphingolipid of a fungus
US12351614B2 (en) 2019-03-28 2025-07-08 Orionis Biosciences, Inc. CLEC9A-based chimeric protein complexes
US12410225B2 (en) 2019-11-07 2025-09-09 Orionis Biosciences, Inc Modulation of dendritic cell lineages

Families Citing this family (33)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20180222966A1 (en) * 2013-04-29 2018-08-09 Agrosavfe N.V. Transgenic plant comprising a polynucleotide encoding a variable domain of heavy-chain antibody
JP6376798B2 (ja) * 2014-03-27 2018-08-22 三菱重工業株式会社 洗濯排水生物処理製剤を用いた洗濯排水処理装置及び方法
EP3415010A1 (en) * 2017-06-13 2018-12-19 Agrosavfe Nv Insect-controlling polypeptides and methods
US10017560B1 (en) 2017-11-16 2018-07-10 King Saud University Nanobody against begomoviruses
MX2021000184A (es) * 2018-07-05 2021-05-12 Novobind Livestock Therapeutics Inc Anticuerpos contra agentes patogenos en aves de corral y sus aplicaciones.
CN109081870B (zh) * 2018-09-21 2021-12-03 成都阿帕克生物科技有限公司 一种抗人促绒毛膜促性腺激素β亚单位的纳米抗体及核酸分子和应用
IL301621B2 (en) * 2019-04-08 2025-04-01 Dna Twopointo Inc Transposition of nucleic acid constructs into eukaryotic genomes with Amylois transposase
US20220152139A1 (en) * 2019-04-13 2022-05-19 Flagship Pioneering Innovations Vi, Llc Plant messenger packs encapsulating polypeptides and uses thereof
CN110205252A (zh) * 2019-06-20 2019-09-06 江苏大学 喷雾干燥制备拮抗酵母固体制剂的方法
CA3154280A1 (en) * 2019-10-11 2021-04-15 The Trustees Of The University Of Pennsylvania Compositions and methods for targeting cd13 and tim-3 with car t cells to treat acute myeloid leukemia
CN114929740A (zh) 2019-11-11 2022-08-19 Ibi-Ag创新生物杀虫剂有限公司 昆虫防控纳米抗体及其用途
AU2021250446A1 (en) * 2020-03-31 2022-11-17 Biotalys NV Anti-fungal polypeptides
US20230227577A1 (en) * 2020-05-05 2023-07-20 Oncorus, Inc. Anti-dll3 antibodies and methods of use
WO2021226728A1 (es) * 2020-05-15 2021-11-18 Universidad Austral De Chile Método de gradiente rápido de un solo paso para la generación de nanoanticuerpos
IL300173A (en) 2020-07-31 2023-03-01 Biotalys NV Expression host
EP4015041A1 (en) * 2020-12-15 2022-06-22 Universidad De Zaragoza Treatment of fungal infections or diseases
CN113121692B (zh) * 2021-04-29 2022-12-06 中国科学技术大学 结合人rage胞外域的羊驼源抗体
US20250129387A1 (en) 2022-02-02 2025-04-24 Biotalys NV Methods for genome editing
WO2023148301A1 (en) 2022-02-02 2023-08-10 Biotalys NV Modified microbial cells and uses thereof
US20230357406A1 (en) * 2022-03-08 2023-11-09 Molecular Templates, Inc. Ctla-4 binding molecules comprising shiga toxin a subunit scaffolds and uses thereof
CN115043933B (zh) * 2022-03-31 2023-08-08 深圳市人民医院 靶向新冠病毒的纳米抗体及其制备方法和应用
WO2024133937A1 (en) 2022-12-22 2024-06-27 Biotalys NV Methods for genome editing
WO2024145551A1 (en) 2022-12-29 2024-07-04 Biotalys NV Agrochemical compositions
WO2024141638A1 (en) 2022-12-30 2024-07-04 Biotalys NV Self-emulsifiable concentrate
WO2024141641A2 (en) 2022-12-30 2024-07-04 Biotalys NV Secretion signals
WO2024141645A1 (en) 2022-12-30 2024-07-04 Biotalys N.V. Agglomerate
CN116267297B (zh) * 2023-02-21 2024-09-06 广西壮族自治区农业科学院 一种通过水分管理预防甘蔗白条病的方法
CN120058934A (zh) * 2023-11-30 2025-05-30 科弈(浙江)药业科技有限公司 靶向egfr的纳米抗体、药物偶联物及其用途
US12378306B2 (en) 2023-12-22 2025-08-05 Biotalys NV Anti-fungal VHH antibodies
WO2025154058A1 (en) 2024-01-21 2025-07-24 Ibi-Ag Innovative Bio Insecticides Ltd. Anti-insect hsp70 nanobodies and uses thereof
WO2025154056A1 (en) 2024-01-21 2025-07-24 Ibi-Ag Innovative Bio Insecticides Ltd. Anti-insect cda nanobodies and uses thereof
CN117866903B (zh) * 2024-03-12 2024-06-04 北京贝来药业有限公司 单域抗体修饰的干细胞及其在疾病治疗中用途
CN119661667B (zh) * 2025-02-21 2025-05-13 南京农业大学三亚研究院 一种药物靶标蛋白MoFrd1及其在农业病害防治中的应用

Family Cites Families (56)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JPH02128697A (ja) * 1988-11-09 1990-05-17 Hoechst Japan Ltd 抗フコシルセラミドモノクローナル抗体
DE68913658T3 (de) 1988-11-11 2005-07-21 Stratagene, La Jolla Klonierung von Immunglobulin Sequenzen aus den variablen Domänen
DE69334305D1 (de) 1992-08-21 2010-01-28 Univ Bruxelles Immunoglobuline ohne leichte Ketten
WO1994025591A1 (en) 1993-04-29 1994-11-10 Unilever N.V. PRODUCTION OF ANTIBODIES OR (FUNCTIONALIZED) FRAGMENTS THEREOF DERIVED FROM HEAVY CHAIN IMMUNOGLOBULINS OF $i(CAMELIDAE)
FR2708622B1 (fr) 1993-08-02 1997-04-18 Raymond Hamers Vecteur recombinant contenant une séquence d'un gène de lipoprotéine de structure pour l'expression de séquences de nucléotides.
WO1996009398A1 (en) 1994-09-19 1996-03-28 Rijkslandbouwuniversiteit Wageningen Gene constructs encoding crop-protecting agents, as well as transformed plants containing and expressing such constructs, and methods of controlling plague organisms and pathogens in crops
EP0739981A1 (en) 1995-04-25 1996-10-30 Vrije Universiteit Brussel Variable fragments of immunoglobulins - use for therapeutic or veterinary purposes
AU740043B2 (en) 1996-06-27 2001-10-25 Vlaams Interuniversitair Instituut Voor Biotechnologie Vzw Recognition molecules interacting specifically with the active site or cleft of a target molecule
WO1999037681A2 (en) 1998-01-26 1999-07-29 Unilever Plc Method for producing antibody fragments
US6596509B1 (en) 1998-07-10 2003-07-22 Cornell Research Foundation, Inc. Recombinant constructs and systems for secretion of proteins via type III secretion systems
BR9915543A (pt) 1998-10-16 2001-08-14 Fraunhofer Ges Forschung Resistência a doenças por plantas mediada por patogenicidas moleculares
BR9916765A (pt) 1999-01-05 2001-09-25 Unilever Nv Processo para produzir um material imunoadsorvente, uso de uma proteìna que é ligada por meio de uma ligação covalente a um fragmento de anticorpo, material imunadsorvente, uso de um material, e, kit de teste diagnóstico
EP1144616B2 (en) 1999-01-19 2009-01-14 Unilever Plc Method for producing antibody fragments
BR0009866A (pt) 1999-04-22 2002-01-08 Unilever Nv Método de inibição de infecção viral, uso de uma proteìna de ligação de antìgeno monovalente, produto alimentìcio, composição farmacêutica ou cosmética, proteìna de ligação de antìgeno monovalente, sequência de nucleotìdeos, vetor de expressão, célula hospedeira, e, métodos de seleção e de indentificação de uma proteìna de ligação de antìgeno
CN1279172C (zh) 1999-07-22 2006-10-11 独立行政法人农业生物资源研究所 转化水稻植物的方法
US6479280B1 (en) 1999-09-24 2002-11-12 Vlaams Interuniversitair Institutuut Voor Biotechnologie Vzw Recombinant phages capable of entering host cells via specific interaction with an artificial receptor
ES2331051T3 (es) 1999-11-29 2009-12-21 Bac Ip B.V. Inmovilizacion de moleculas de union de antigenos de un dominio.
EP1242460B1 (en) 1999-11-29 2006-10-18 Unilever Plc Immobilisation of proteins using a polypeptide segment
EP1118669A3 (en) 1999-12-17 2001-08-29 Unilever Plc Production of camelid antibodies in plants
ES2324280T3 (es) 2000-03-14 2009-08-04 Unilever N.V. Dominios variables de la cadena pesada de anticuerpos frente a lipasas dieteticas humanas y sus usos.
AU2001268855A1 (en) 2000-05-26 2001-12-03 National Research Council Of Canada Single-domain antigen-binding antibody fragments derived from llama antibodies
DK1360207T3 (da) 2000-12-13 2011-09-05 Bac Ip B V Proteinarray af variable domæner af tunge immunoglobulinkæder fra kameler
GB0110029D0 (en) * 2001-04-24 2001-06-13 Grosveld Frank Transgenic animal
US20060073141A1 (en) 2001-06-28 2006-04-06 Domantis Limited Compositions and methods for treating inflammatory disorders
JP4213586B2 (ja) * 2001-09-13 2009-01-21 株式会社抗体研究所 ラクダ抗体ライブラリーの作製方法
JP2005289809A (ja) 2001-10-24 2005-10-20 Vlaams Interuniversitair Inst Voor Biotechnologie Vzw (Vib Vzw) 突然変異重鎖抗体
EP1456410A2 (en) 2001-12-11 2004-09-15 AlgoNomics N.V. Method for displaying loops from immunoglobulin domains in different contexts
CA2471116A1 (en) 2001-12-21 2003-07-03 Serge Muyldermans Method for cloning of variable domain sequences
JP2005517674A (ja) 2002-01-03 2005-06-16 フラームス・インテルウニフェルシタイル・インステイチュート・フォール・ビオテヒノロヒー・ヴェーゼットウェー 腫瘍の処置に有用な新規免疫コンジュゲート
CA2482607C (en) 2002-04-22 2013-06-11 Fraunhofer-Gesellschaft Zur Foerderung Der Angewandten Forschung E.V. Antibodies, recombinant antibodies, recombinant antibody fragments and fusions mediated plant disease resistance against fungi
DE10234116A1 (de) * 2002-07-26 2004-02-12 Land Rheinland-Pfalz vertreten durch die Staatliche Lehr- und Forschungsanstalt für Landwirtschaft, Weinbau und Gartenbau (SLFA) Verfahren zur Expression von gegen virale Proteine gerichtete scFv-Fragmenten in Pflanzen und deren Verwendung
CA2505326A1 (en) 2002-11-08 2004-05-21 Ablynx N.V. Camelidae antibodies against immunoglobulin e and use thereof for the treatment of allergic disorders
BRPI0316092B8 (pt) 2002-11-08 2021-05-25 Ablynx Nv anticorpos de domínio único direcionados contra o fator de necrose tumoral alfa e usos para os mesmos
ES2542330T3 (es) 2003-01-10 2015-08-04 Ablynx N.V. Polipéptidos terapéuticos, homólogos de los mismos, fragmentos de los mismos y su uso en modular la agregación mediada por plaquetas
JP4283127B2 (ja) * 2003-06-20 2009-06-24 独立行政法人科学技術振興機構 転写因子を転写抑制因子に変換するペプチド及びこれをコードするポリヌクレオチド、並びにその利用
US7563443B2 (en) 2004-09-17 2009-07-21 Domantis Limited Monovalent anti-CD40L antibody polypeptides and compositions thereof
US20080014192A1 (en) * 2006-05-23 2008-01-17 Poeta Maurizio D Methods For The Diagnosis And Treatment of Fungal Infections Caused By Microorganisms Producing Glucosylceramide
WO2008128289A1 (en) 2007-04-20 2008-10-30 Hexima Limited Modified plant defensin
NZ580505A (en) 2007-04-20 2011-03-31 Hexima Ltd Modified plant defensin comprising a signal peptide, a mature domain from a Class I defensin and a C-terminal propeptide tail from a Class II plant defensin
CU23688A1 (es) 2008-03-28 2011-07-11 Ct Ingenieria Genetica Biotech Secuencias de ácido nucleico y aminoácidos para el control de agentes patógenos
EP2143735A1 (en) * 2008-07-10 2010-01-13 Institut Pasteur Variable domains of camelid heavy-chain antibodies directed against glial fibrillary acidic proteins
EP2315772A4 (en) 2008-08-12 2012-02-08 Plant Health Care Inc PREPARATION, FORMULATION AND USES OF STABLE LIQUID PROTEIN FORMULATIONS HAVING A HAIRPIN STRUCTURE
CN102245623A (zh) 2008-12-08 2011-11-16 康普里斯有限公司 单链反向平行卷曲型螺旋蛋白
AR078046A1 (es) * 2009-05-28 2011-10-12 Glaxo Group Ltd Proteinas de union a antigeno
CA2754024A1 (en) 2009-08-24 2011-03-03 Sylvia Schleker Antibody fusion-mediated plant resistance against oomycota
US20110165649A1 (en) 2010-01-06 2011-07-07 Brett Tyler Methods and compositions to improve the health of plants, animals and microbes by manipulating protein entry into symbionts and their hosts
US8598081B2 (en) 2010-04-06 2013-12-03 Agrosavfe N.V. Specific delivery of agrochemicals
WO2012011396A1 (ja) * 2010-07-20 2012-01-26 国立大学法人東京大学 ナノ抗体を発現するトランスジェニックイネ
WO2012025602A1 (en) * 2010-08-26 2012-03-01 Vib Vzw Insect binding antibodies
HUE036251T2 (hu) * 2010-08-26 2018-06-28 Agrosavfe N V Kitinféle poliszacharid antigént kötõ fehérjék
KR101281068B1 (ko) 2010-10-08 2013-07-09 한국생명공학연구원 파라고무나무 유래의 라텍스 분비 조직 특이적 srpp 프로모터 및 이의 용도
JP2012157315A (ja) * 2011-02-02 2012-08-23 Gekkeikan Sake Co Ltd ラクダ科動物抗体の重鎖可変ドメイン(vhh)の生産方法
EP2763529A1 (en) 2011-10-06 2014-08-13 Agrosavfe N.V. Manufacturing of specifically targeting microcapsules
US20180222966A1 (en) 2013-04-29 2018-08-09 Agrosavfe N.V. Transgenic plant comprising a polynucleotide encoding a variable domain of heavy-chain antibody
CN105358699A (zh) 2013-04-29 2016-02-24 阿格罗塞文公司 包含结合至鞘脂的抗体的农用化学组合物
AR102550A1 (es) 2014-11-05 2017-03-08 Agrosavfe Nv Planta transgénica que comprende un polinucleótido que codifica un dominio variable de anticuerpo de cadena pesada

Non-Patent Citations (6)

* Cited by examiner, † Cited by third party
Title
Casset et al. (2003) BBRC 307, 198-205 *
Chen et al. J. Mol. Bio. (1999) 293, 865-881. *
MacCallum et al. J. Mol. Biol. (1996) 262,732-745 *
Pascalis et al. The Journal of Immunology (2002) 169, 3076-3084 *
Vajdos et al. (2002) 320, 415-428 *
Wu et al. J. Mol. Biol. (1999) 294, 151-162 *

Cited By (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10271546B2 (en) 2010-04-06 2019-04-30 Agrosavfe N.V. Specific delivery of agrochemicals
US10400033B2 (en) 2013-04-29 2019-09-03 Agrosavfe N.V. Agrochemical compositions comprising antibodies binding to sphingolipids
US11028154B2 (en) 2013-04-29 2021-06-08 Biotalys NV Agrochemical compositions comprising antibodies binding to sphingolipids
US10858666B2 (en) 2014-11-05 2020-12-08 Biotalys Transgenic plants expressing a variable domain of a heavy chain antibody (VHH) that binds to a sphingolipid of a fungus
WO2019032662A1 (en) * 2017-08-09 2019-02-14 Orionis Biosciences Inc. CLEC9A BINDING AGENTS AND USES THEREOF
CN111511764A (zh) * 2017-08-09 2020-08-07 奥里尼斯生物科学有限公司 Clec9a结合剂及其用途
KR20240055153A (ko) 2017-08-09 2024-04-26 오리오니스 바이오사이언시스 인코포레이티드 Clec9a 결합제 및 이의 용도
US12091463B2 (en) 2017-08-09 2024-09-17 Orionis Biosciences, Inc. Clec9A binding agents comprising a recombinant heavy-chain only antibody (VHH)
WO2019152979A1 (en) * 2018-02-05 2019-08-08 Orionis Biosciences, Inc. Fibroblast binding agents and use thereof
US11896643B2 (en) 2018-02-05 2024-02-13 Orionis Biosciences, Inc. Fibroblast binding agents and use thereof
US12351614B2 (en) 2019-03-28 2025-07-08 Orionis Biosciences, Inc. CLEC9A-based chimeric protein complexes
US12410225B2 (en) 2019-11-07 2025-09-09 Orionis Biosciences, Inc Modulation of dendritic cell lineages

Also Published As

Publication number Publication date
CA2910874C (en) 2022-03-22
CA2910632A1 (en) 2014-12-04
ZA201507758B (en) 2017-01-25
JP2016526015A (ja) 2016-09-01
ES2762151T3 (es) 2020-05-22
PL2992101T3 (pl) 2019-05-31
EP2992100B1 (en) 2019-09-04
WO2014191146A1 (en) 2014-12-04
JP6720252B2 (ja) 2020-07-08
CN105358699A (zh) 2016-02-24
CN114732017A (zh) 2022-07-12
EP2992100A1 (en) 2016-03-09
BR112015027192A2 (enrdf_load_stackoverflow) 2017-07-25
CN105358698B (zh) 2024-02-20
CA2910874A1 (en) 2014-11-06
TR201819577T4 (tr) 2019-01-21
EP2992101A1 (en) 2016-03-09
WO2014177595A1 (en) 2014-11-06
AU2020205327A1 (en) 2020-08-06
EP2992101B1 (en) 2018-10-10
JP2019178136A (ja) 2019-10-17
BR112015027192B1 (pt) 2022-05-10
HUE047580T2 (hu) 2020-05-28
US20190352379A1 (en) 2019-11-21
PL2992100T3 (pl) 2020-04-30
JP6388917B2 (ja) 2018-09-12
US20210253677A1 (en) 2021-08-19
JP2016522186A (ja) 2016-07-28
US10400033B2 (en) 2019-09-03
US11028154B2 (en) 2021-06-08
BR112015027430B1 (pt) 2022-09-06
CN116076508A (zh) 2023-05-09
PT2992100T (pt) 2019-12-16
AU2014261434B2 (en) 2020-04-16
BR112015027430A8 (pt) 2019-12-24
CN105358698A (zh) 2016-02-24
BR112015027430A2 (pt) 2017-07-25
US9803003B2 (en) 2017-10-31
AU2014273418B2 (en) 2020-04-23
AU2014273418A1 (en) 2015-11-05
HRP20192182T1 (hr) 2020-02-21
JP2019014715A (ja) 2019-01-31
AU2014261434A1 (en) 2015-11-12
US20160075769A1 (en) 2016-03-17
AU2020205327B2 (en) 2023-02-23
EP3597758A1 (en) 2020-01-22
US20180022791A1 (en) 2018-01-25
ZA201507757B (en) 2016-12-21
ES2703192T3 (es) 2019-03-07
DK2992100T3 (da) 2019-12-09
JP6967347B2 (ja) 2021-11-17

Similar Documents

Publication Publication Date Title
AU2020205327B2 (en) Agrochemical compositions comprising antibodies binding to sphingolipids
US20210340556A1 (en) Transgenic plant comprising a polynucleotide encoding a variable domain of heavy-chain antibody
US20230242629A1 (en) Transgenic plants expressing a variable domain of heavy-chain antibody (vhh) that binds to a sphingolipid of a fungus
US12098378B2 (en) Anti-fungal polypeptides
WO2023057601A1 (en) Anti-fungal polypeptides

Legal Events

Date Code Title Description
AS Assignment

Owner name: AGROSAVFE N.V., BELGIUM

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:VERHEESEN, PETER;DE JONGHE, CHRIS;VAN DAELE, INGE ELODIE;AND OTHERS;SIGNING DATES FROM 20151021 TO 20151029;REEL/FRAME:037062/0277

STCB Information on status: application discontinuation

Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION