KR20160030586A - 항-cxcr4 항체 및 항체-약물 접합체 - Google Patents
항-cxcr4 항체 및 항체-약물 접합체 Download PDFInfo
- Publication number
- KR20160030586A KR20160030586A KR1020167005526A KR20167005526A KR20160030586A KR 20160030586 A KR20160030586 A KR 20160030586A KR 1020167005526 A KR1020167005526 A KR 1020167005526A KR 20167005526 A KR20167005526 A KR 20167005526A KR 20160030586 A KR20160030586 A KR 20160030586A
- Authority
- KR
- South Korea
- Prior art keywords
- seq
- region
- cdr3
- cdr2
- cdr1
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
- 229940049595 antibody-drug conjugate Drugs 0.000 title claims abstract description 105
- 239000000611 antibody drug conjugate Substances 0.000 title claims abstract description 99
- 101000922348 Homo sapiens C-X-C chemokine receptor type 4 Proteins 0.000 claims abstract description 302
- 102100031650 C-X-C chemokine receptor type 4 Human genes 0.000 claims abstract description 283
- 238000000034 method Methods 0.000 claims abstract description 225
- 206010028980 Neoplasm Diseases 0.000 claims abstract description 80
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims abstract description 57
- 201000010099 disease Diseases 0.000 claims abstract description 51
- 230000014509 gene expression Effects 0.000 claims abstract description 49
- 239000003814 drug Substances 0.000 claims abstract description 40
- 201000011510 cancer Diseases 0.000 claims abstract description 39
- 238000011282 treatment Methods 0.000 claims abstract description 30
- 229940079593 drug Drugs 0.000 claims abstract description 29
- 230000001225 therapeutic effect Effects 0.000 claims abstract description 24
- 102000009410 Chemokine receptor Human genes 0.000 claims abstract description 20
- 108050000299 Chemokine receptor Proteins 0.000 claims abstract description 20
- 239000000562 conjugate Substances 0.000 claims abstract description 15
- 206010061902 Pancreatic neoplasm Diseases 0.000 claims abstract description 5
- 201000005787 hematologic cancer Diseases 0.000 claims abstract description 5
- 208000024200 hematopoietic and lymphoid system neoplasm Diseases 0.000 claims abstract description 5
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 claims abstract description 5
- 208000008443 pancreatic carcinoma Diseases 0.000 claims abstract description 5
- 201000002528 pancreatic cancer Diseases 0.000 claims abstract description 4
- 230000027455 binding Effects 0.000 claims description 391
- 239000000427 antigen Substances 0.000 claims description 301
- 108091007433 antigens Proteins 0.000 claims description 297
- 102000036639 antigens Human genes 0.000 claims description 297
- 239000012634 fragment Substances 0.000 claims description 283
- 108010047041 Complementarity Determining Regions Proteins 0.000 claims description 149
- 241000282414 Homo sapiens Species 0.000 claims description 113
- 210000004027 cell Anatomy 0.000 claims description 107
- 108090000623 proteins and genes Proteins 0.000 claims description 94
- 102000040430 polynucleotide Human genes 0.000 claims description 66
- 108091033319 polynucleotide Proteins 0.000 claims description 66
- 239000002157 polynucleotide Substances 0.000 claims description 66
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 53
- 102000004169 proteins and genes Human genes 0.000 claims description 53
- 239000013598 vector Substances 0.000 claims description 27
- 239000013604 expression vector Substances 0.000 claims description 26
- 125000003729 nucleotide group Chemical group 0.000 claims description 26
- -1 caproyl Chemical group 0.000 claims description 25
- 239000002773 nucleotide Substances 0.000 claims description 25
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 claims description 23
- 238000004519 manufacturing process Methods 0.000 claims description 23
- 231100000599 cytotoxic agent Toxicity 0.000 claims description 19
- 230000000295 complement effect Effects 0.000 claims description 18
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 claims description 17
- 239000008194 pharmaceutical composition Substances 0.000 claims description 17
- 108010044540 auristatin Proteins 0.000 claims description 16
- 229940127089 cytotoxic agent Drugs 0.000 claims description 16
- 239000002254 cytotoxic agent Substances 0.000 claims description 16
- 125000005647 linker group Chemical group 0.000 claims description 16
- 125000002252 acyl group Chemical group 0.000 claims description 15
- 208000007934 ACTH-independent macronodular adrenal hyperplasia Diseases 0.000 claims description 13
- 206010035226 Plasma cell myeloma Diseases 0.000 claims description 13
- 230000004614 tumor growth Effects 0.000 claims description 13
- 208000031261 Acute myeloid leukaemia Diseases 0.000 claims description 11
- 208000033776 Myeloid Acute Leukemia Diseases 0.000 claims description 11
- 206010027476 Metastases Diseases 0.000 claims description 10
- 230000009401 metastasis Effects 0.000 claims description 10
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 claims description 10
- BLUGYPPOFIHFJS-UUFHNPECSA-N (2s)-n-[(2s)-1-[[(3r,4s,5s)-3-methoxy-1-[(2s)-2-[(1r,2r)-1-methoxy-2-methyl-3-oxo-3-[[(1s)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino]propyl]pyrrolidin-1-yl]-5-methyl-1-oxoheptan-4-yl]-methylamino]-3-methyl-1-oxobutan-2-yl]-3-methyl-2-(methylamino)butanamid Chemical compound CN[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(=O)N(C)[C@@H]([C@@H](C)CC)[C@H](OC)CC(=O)N1CCC[C@H]1[C@H](OC)[C@@H](C)C(=O)N[C@H](C=1SC=CN=1)CC1=CC=CC=C1 BLUGYPPOFIHFJS-UUFHNPECSA-N 0.000 claims description 9
- 239000003937 drug carrier Substances 0.000 claims description 9
- 201000000050 myeloid neoplasm Diseases 0.000 claims description 9
- 210000003719 b-lymphocyte Anatomy 0.000 claims description 8
- RXWNCPJZOCPEPQ-NVWDDTSBSA-N puromycin Chemical compound C1=CC(OC)=CC=C1C[C@H](N)C(=O)N[C@H]1[C@@H](O)[C@H](N2C3=NC=NC(=C3N=C2)N(C)C)O[C@@H]1CO RXWNCPJZOCPEPQ-NVWDDTSBSA-N 0.000 claims description 8
- 230000009467 reduction Effects 0.000 claims description 8
- 125000004214 1-pyrrolidinyl group Chemical group [H]C1([H])N(*)C([H])([H])C([H])([H])C1([H])[H] 0.000 claims description 7
- 208000010839 B-cell chronic lymphocytic leukemia Diseases 0.000 claims description 7
- 108091034117 Oligonucleotide Proteins 0.000 claims description 7
- 239000013078 crystal Substances 0.000 claims description 7
- 229940121354 immunomodulator Drugs 0.000 claims description 7
- 229940045799 anthracyclines and related substance Drugs 0.000 claims description 6
- 239000012216 imaging agent Substances 0.000 claims description 6
- 239000002955 immunomodulating agent Substances 0.000 claims description 6
- 229910052721 tungsten Inorganic materials 0.000 claims description 6
- KLWPJMFMVPTNCC-UHFFFAOYSA-N Camptothecin Natural products CCC1(O)C(=O)OCC2=C1C=C3C4Nc5ccccc5C=C4CN3C2=O KLWPJMFMVPTNCC-UHFFFAOYSA-N 0.000 claims description 5
- 206010058467 Lung neoplasm malignant Diseases 0.000 claims description 5
- 208000031422 Lymphocytic Chronic B-Cell Leukemia Diseases 0.000 claims description 5
- 206010033128 Ovarian cancer Diseases 0.000 claims description 5
- 206010061535 Ovarian neoplasm Diseases 0.000 claims description 5
- 229940123237 Taxane Drugs 0.000 claims description 5
- 229940127093 camptothecin Drugs 0.000 claims description 5
- VSJKWCGYPAHWDS-FQEVSTJZSA-N camptothecin Chemical compound C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-FQEVSTJZSA-N 0.000 claims description 5
- VSJKWCGYPAHWDS-UHFFFAOYSA-N dl-camptothecin Natural products C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)C5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-UHFFFAOYSA-N 0.000 claims description 5
- AMRJKAQTDDKMCE-UHFFFAOYSA-N dolastatin Chemical compound CC(C)C(N(C)C)C(=O)NC(C(C)C)C(=O)N(C)C(C(C)C)C(OC)CC(=O)N1CCCC1C(OC)C(C)C(=O)NC(C=1SC=CN=1)CC1=CC=CC=C1 AMRJKAQTDDKMCE-UHFFFAOYSA-N 0.000 claims description 5
- 229930188854 dolastatin Natural products 0.000 claims description 5
- 201000005202 lung cancer Diseases 0.000 claims description 5
- 208000020816 lung neoplasm Diseases 0.000 claims description 5
- 208000024893 Acute lymphoblastic leukemia Diseases 0.000 claims description 4
- 206010006187 Breast cancer Diseases 0.000 claims description 4
- 208000026310 Breast neoplasm Diseases 0.000 claims description 4
- 229930126263 Maytansine Natural products 0.000 claims description 4
- 208000034578 Multiple myelomas Diseases 0.000 claims description 4
- 210000001744 T-lymphocyte Anatomy 0.000 claims description 4
- 229920001222 biopolymer Polymers 0.000 claims description 4
- 238000001514 detection method Methods 0.000 claims description 4
- 238000003745 diagnosis Methods 0.000 claims description 4
- WKPWGQKGSOKKOO-RSFHAFMBSA-N maytansine Chemical compound CO[C@@H]([C@@]1(O)C[C@](OC(=O)N1)([C@H]([C@@H]1O[C@@]1(C)[C@@H](OC(=O)[C@H](C)N(C)C(C)=O)CC(=O)N1C)C)[H])\C=C\C=C(C)\CC2=CC(OC)=C(Cl)C1=C2 WKPWGQKGSOKKOO-RSFHAFMBSA-N 0.000 claims description 4
- 229910052757 nitrogen Inorganic materials 0.000 claims description 4
- 229950010131 puromycin Drugs 0.000 claims description 4
- 208000006332 Choriocarcinoma Diseases 0.000 claims description 3
- 206010009944 Colon cancer Diseases 0.000 claims description 3
- 206010025323 Lymphomas Diseases 0.000 claims description 3
- 208000005718 Stomach Neoplasms Diseases 0.000 claims description 3
- 229940122803 Vinca alkaloid Drugs 0.000 claims description 3
- 208000029742 colonic neoplasm Diseases 0.000 claims description 3
- 206010017758 gastric cancer Diseases 0.000 claims description 3
- 239000001963 growth medium Substances 0.000 claims description 3
- 208000014829 head and neck neoplasm Diseases 0.000 claims description 3
- 230000001939 inductive effect Effects 0.000 claims description 3
- 201000011549 stomach cancer Diseases 0.000 claims description 3
- 229910052717 sulfur Inorganic materials 0.000 claims description 3
- DKPFODGZWDEEBT-QFIAKTPHSA-N taxane Chemical class C([C@]1(C)CCC[C@@H](C)[C@H]1C1)C[C@H]2[C@H](C)CC[C@@H]1C2(C)C DKPFODGZWDEEBT-QFIAKTPHSA-N 0.000 claims description 3
- 230000005751 tumor progression Effects 0.000 claims description 3
- 229910052720 vanadium Inorganic materials 0.000 claims description 3
- 206010005003 Bladder cancer Diseases 0.000 claims description 2
- 206010008342 Cervix carcinoma Diseases 0.000 claims description 2
- 208000000461 Esophageal Neoplasms Diseases 0.000 claims description 2
- 208000008839 Kidney Neoplasms Diseases 0.000 claims description 2
- 206010030155 Oesophageal carcinoma Diseases 0.000 claims description 2
- 206010060862 Prostate cancer Diseases 0.000 claims description 2
- 208000000236 Prostatic Neoplasms Diseases 0.000 claims description 2
- 206010038389 Renal cancer Diseases 0.000 claims description 2
- 208000000453 Skin Neoplasms Diseases 0.000 claims description 2
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 claims description 2
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 claims description 2
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 claims description 2
- 201000010881 cervical cancer Diseases 0.000 claims description 2
- 238000012258 culturing Methods 0.000 claims description 2
- 201000004101 esophageal cancer Diseases 0.000 claims description 2
- 201000010536 head and neck cancer Diseases 0.000 claims description 2
- 201000010982 kidney cancer Diseases 0.000 claims description 2
- 201000000849 skin cancer Diseases 0.000 claims description 2
- 201000005112 urinary bladder cancer Diseases 0.000 claims description 2
- 208000031671 Large B-Cell Diffuse Lymphoma Diseases 0.000 claims 2
- 208000025205 Mantle-Cell Lymphoma Diseases 0.000 claims 2
- 206010012818 diffuse large B-cell lymphoma Diseases 0.000 claims 2
- 208000003950 B-cell lymphoma Diseases 0.000 claims 1
- 208000032612 Glial tumor Diseases 0.000 claims 1
- 206010018338 Glioma Diseases 0.000 claims 1
- 208000033559 Waldenström macroglobulinemia Diseases 0.000 claims 1
- 125000002576 diazepinyl group Chemical class N1N=C(C=CC=C1)* 0.000 claims 1
- 201000003444 follicular lymphoma Diseases 0.000 claims 1
- 201000000564 macroglobulinemia Diseases 0.000 claims 1
- 230000036210 malignancy Effects 0.000 claims 1
- 150000007523 nucleic acids Chemical class 0.000 abstract description 13
- 102000039446 nucleic acids Human genes 0.000 abstract description 9
- 108020004707 nucleic acids Proteins 0.000 abstract description 9
- 210000004072 lung Anatomy 0.000 abstract description 6
- 210000001672 ovary Anatomy 0.000 abstract description 5
- 210000001072 colon Anatomy 0.000 abstract description 3
- 210000003128 head Anatomy 0.000 abstract description 3
- 210000002784 stomach Anatomy 0.000 abstract description 3
- 210000003238 esophagus Anatomy 0.000 abstract description 2
- 210000003739 neck Anatomy 0.000 abstract description 2
- 101100112922 Candida albicans CDR3 gene Proteins 0.000 description 255
- 239000000203 mixture Substances 0.000 description 78
- 235000001014 amino acid Nutrition 0.000 description 76
- 108090000765 processed proteins & peptides Proteins 0.000 description 76
- 102000004196 processed proteins & peptides Human genes 0.000 description 67
- 229940024606 amino acid Drugs 0.000 description 62
- 229920001184 polypeptide Chemical group 0.000 description 62
- 150000001413 amino acids Chemical class 0.000 description 60
- 235000018102 proteins Nutrition 0.000 description 51
- 206010057190 Respiratory tract infections Diseases 0.000 description 47
- 238000006467 substitution reaction Methods 0.000 description 37
- 108060003951 Immunoglobulin Proteins 0.000 description 35
- 230000006870 function Effects 0.000 description 35
- 102000018358 immunoglobulin Human genes 0.000 description 35
- 230000000694 effects Effects 0.000 description 29
- 108020004414 DNA Proteins 0.000 description 28
- 102000053523 human CXCR4 Human genes 0.000 description 25
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 22
- 235000004554 glutamine Nutrition 0.000 description 22
- 230000004048 modification Effects 0.000 description 22
- 238000012986 modification Methods 0.000 description 22
- 230000035772 mutation Effects 0.000 description 22
- 229960002743 glutamine Drugs 0.000 description 21
- 230000001965 increasing effect Effects 0.000 description 21
- 241001465754 Metazoa Species 0.000 description 19
- 230000001976 improved effect Effects 0.000 description 19
- 125000000539 amino acid group Chemical group 0.000 description 18
- 230000013595 glycosylation Effects 0.000 description 18
- 238000006206 glycosylation reaction Methods 0.000 description 18
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 17
- 230000010056 antibody-dependent cellular cytotoxicity Effects 0.000 description 17
- 238000013459 approach Methods 0.000 description 17
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 16
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 16
- 230000004927 fusion Effects 0.000 description 16
- 239000000546 pharmaceutical excipient Substances 0.000 description 16
- 102000005962 receptors Human genes 0.000 description 16
- 108020003175 receptors Proteins 0.000 description 16
- 241000699666 Mus <mouse, genus> Species 0.000 description 15
- 241000283984 Rodentia Species 0.000 description 15
- 230000000875 corresponding effect Effects 0.000 description 15
- 238000009472 formulation Methods 0.000 description 15
- 239000003795 chemical substances by application Substances 0.000 description 14
- 239000000463 material Substances 0.000 description 14
- 239000000243 solution Substances 0.000 description 14
- 150000001875 compounds Chemical class 0.000 description 13
- 238000000338 in vitro Methods 0.000 description 13
- 230000004083 survival effect Effects 0.000 description 13
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 12
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 12
- 239000002202 Polyethylene glycol Substances 0.000 description 12
- 239000012636 effector Substances 0.000 description 12
- 210000004408 hybridoma Anatomy 0.000 description 12
- 230000005764 inhibitory process Effects 0.000 description 12
- 229920001223 polyethylene glycol Polymers 0.000 description 12
- 235000000346 sugar Nutrition 0.000 description 12
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 11
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 11
- 239000011780 sodium chloride Substances 0.000 description 11
- 241000894007 species Species 0.000 description 11
- 239000000126 substance Substances 0.000 description 11
- 102000019034 Chemokines Human genes 0.000 description 10
- 108010012236 Chemokines Proteins 0.000 description 10
- 239000000839 emulsion Substances 0.000 description 10
- 210000004602 germ cell Anatomy 0.000 description 10
- 230000028993 immune response Effects 0.000 description 10
- 230000001404 mediated effect Effects 0.000 description 10
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 9
- 239000004472 Lysine Substances 0.000 description 9
- 230000004988 N-glycosylation Effects 0.000 description 9
- 239000000969 carrier Substances 0.000 description 9
- 230000004540 complement-dependent cytotoxicity Effects 0.000 description 9
- 230000007423 decrease Effects 0.000 description 9
- 238000001727 in vivo Methods 0.000 description 9
- 229960003646 lysine Drugs 0.000 description 9
- 235000018977 lysine Nutrition 0.000 description 9
- 238000002823 phage display Methods 0.000 description 9
- 229940124597 therapeutic agent Drugs 0.000 description 9
- NFGXHKASABOEEW-UHFFFAOYSA-N 1-methylethyl 11-methoxy-3,7,11-trimethyl-2,4-dodecadienoate Chemical compound COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 description 8
- 241000282326 Felis catus Species 0.000 description 8
- ZHNUHDYFZUAESO-UHFFFAOYSA-N Formamide Chemical compound NC=O ZHNUHDYFZUAESO-UHFFFAOYSA-N 0.000 description 8
- 102100021669 Stromal cell-derived factor 1 Human genes 0.000 description 8
- 239000002253 acid Substances 0.000 description 8
- 239000004480 active ingredient Substances 0.000 description 8
- 238000003556 assay Methods 0.000 description 8
- 239000002502 liposome Substances 0.000 description 8
- 239000007787 solid Substances 0.000 description 8
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 8
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 8
- 108010008951 Chemokine CXCL12 Proteins 0.000 description 7
- 102000006496 Immunoglobulin Heavy Chains Human genes 0.000 description 7
- 108010019476 Immunoglobulin Heavy Chains Proteins 0.000 description 7
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 7
- 108091028043 Nucleic acid sequence Proteins 0.000 description 7
- 108010003723 Single-Domain Antibodies Proteins 0.000 description 7
- 150000001720 carbohydrates Chemical class 0.000 description 7
- 230000021615 conjugation Effects 0.000 description 7
- 238000012217 deletion Methods 0.000 description 7
- 230000037430 deletion Effects 0.000 description 7
- 238000003018 immunoassay Methods 0.000 description 7
- 238000001990 intravenous administration Methods 0.000 description 7
- 230000002018 overexpression Effects 0.000 description 7
- 229960001153 serine Drugs 0.000 description 7
- 150000008163 sugars Chemical class 0.000 description 7
- 238000003786 synthesis reaction Methods 0.000 description 7
- 230000009885 systemic effect Effects 0.000 description 7
- 108700012359 toxins Proteins 0.000 description 7
- 239000003981 vehicle Substances 0.000 description 7
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 6
- 102100031408 Acidic amino acid decarboxylase GADL1 Human genes 0.000 description 6
- 239000004475 Arginine Substances 0.000 description 6
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 6
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 6
- 102000004190 Enzymes Human genes 0.000 description 6
- 108090000790 Enzymes Proteins 0.000 description 6
- 102000003886 Glycoproteins Human genes 0.000 description 6
- 108090000288 Glycoproteins Proteins 0.000 description 6
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 6
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 6
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 6
- 241000700159 Rattus Species 0.000 description 6
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 6
- 108091022873 acetoacetate decarboxylase Proteins 0.000 description 6
- 238000007792 addition Methods 0.000 description 6
- 238000004458 analytical method Methods 0.000 description 6
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 6
- 229960003121 arginine Drugs 0.000 description 6
- 235000009697 arginine Nutrition 0.000 description 6
- 229960001230 asparagine Drugs 0.000 description 6
- 235000009582 asparagine Nutrition 0.000 description 6
- 230000009286 beneficial effect Effects 0.000 description 6
- 230000004071 biological effect Effects 0.000 description 6
- 210000004899 c-terminal region Anatomy 0.000 description 6
- 235000014633 carbohydrates Nutrition 0.000 description 6
- 230000008859 change Effects 0.000 description 6
- 230000001472 cytotoxic effect Effects 0.000 description 6
- 238000010494 dissociation reaction Methods 0.000 description 6
- 230000005593 dissociations Effects 0.000 description 6
- 239000002552 dosage form Substances 0.000 description 6
- 229940088598 enzyme Drugs 0.000 description 6
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 6
- 235000014304 histidine Nutrition 0.000 description 6
- 229960002885 histidine Drugs 0.000 description 6
- 210000000987 immune system Anatomy 0.000 description 6
- 229940127121 immunoconjugate Drugs 0.000 description 6
- 229940072221 immunoglobulins Drugs 0.000 description 6
- 239000004615 ingredient Substances 0.000 description 6
- 239000003112 inhibitor Substances 0.000 description 6
- 238000002347 injection Methods 0.000 description 6
- 239000007924 injection Substances 0.000 description 6
- 239000012528 membrane Substances 0.000 description 6
- 239000002245 particle Substances 0.000 description 6
- 239000013612 plasmid Substances 0.000 description 6
- 238000010188 recombinant method Methods 0.000 description 6
- 235000004400 serine Nutrition 0.000 description 6
- 239000000758 substrate Substances 0.000 description 6
- 238000012360 testing method Methods 0.000 description 6
- 239000003053 toxin Substances 0.000 description 6
- 231100000765 toxin Toxicity 0.000 description 6
- 101710082513 C-X-C chemokine receptor type 4 Proteins 0.000 description 5
- 241000282472 Canis lupus familiaris Species 0.000 description 5
- 108091026890 Coding region Proteins 0.000 description 5
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 5
- 241000588724 Escherichia coli Species 0.000 description 5
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 5
- 239000004471 Glycine Substances 0.000 description 5
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 5
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 5
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 5
- 235000014680 Saccharomyces cerevisiae Nutrition 0.000 description 5
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 5
- 150000001412 amines Chemical class 0.000 description 5
- 230000001580 bacterial effect Effects 0.000 description 5
- 230000015572 biosynthetic process Effects 0.000 description 5
- 239000000872 buffer Substances 0.000 description 5
- 239000002738 chelating agent Substances 0.000 description 5
- 238000010367 cloning Methods 0.000 description 5
- 238000000576 coating method Methods 0.000 description 5
- 238000007796 conventional method Methods 0.000 description 5
- 229960002433 cysteine Drugs 0.000 description 5
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 5
- 238000005516 engineering process Methods 0.000 description 5
- 108020001507 fusion proteins Proteins 0.000 description 5
- 102000037865 fusion proteins Human genes 0.000 description 5
- 238000001415 gene therapy Methods 0.000 description 5
- 229960002449 glycine Drugs 0.000 description 5
- 230000002209 hydrophobic effect Effects 0.000 description 5
- 230000001900 immune effect Effects 0.000 description 5
- 230000002401 inhibitory effect Effects 0.000 description 5
- 230000003993 interaction Effects 0.000 description 5
- 229930182817 methionine Natural products 0.000 description 5
- 235000006109 methionine Nutrition 0.000 description 5
- 229960004452 methionine Drugs 0.000 description 5
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 5
- 238000002156 mixing Methods 0.000 description 5
- 230000007170 pathology Effects 0.000 description 5
- 239000000843 powder Substances 0.000 description 5
- 230000008569 process Effects 0.000 description 5
- 230000002285 radioactive effect Effects 0.000 description 5
- 230000001105 regulatory effect Effects 0.000 description 5
- 239000003381 stabilizer Substances 0.000 description 5
- 208000024891 symptom Diseases 0.000 description 5
- 239000003826 tablet Substances 0.000 description 5
- 238000002560 therapeutic procedure Methods 0.000 description 5
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 4
- SRBFZHDQGSBBOR-IOVATXLUSA-N D-xylopyranose Chemical compound O[C@@H]1COC(O)[C@H](O)[C@H]1O SRBFZHDQGSBBOR-IOVATXLUSA-N 0.000 description 4
- 102000003688 G-Protein-Coupled Receptors Human genes 0.000 description 4
- 108090000045 G-Protein-Coupled Receptors Proteins 0.000 description 4
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 4
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 4
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 4
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 4
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 4
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 4
- 241000699670 Mus sp. Species 0.000 description 4
- 108091005804 Peptidases Proteins 0.000 description 4
- 102000035195 Peptidases Human genes 0.000 description 4
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Natural products OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 4
- 239000004365 Protease Substances 0.000 description 4
- 239000004473 Threonine Substances 0.000 description 4
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 4
- 241000700605 Viruses Species 0.000 description 4
- 238000010521 absorption reaction Methods 0.000 description 4
- 150000007513 acids Chemical class 0.000 description 4
- 230000004913 activation Effects 0.000 description 4
- 125000000217 alkyl group Chemical group 0.000 description 4
- 230000008901 benefit Effects 0.000 description 4
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 4
- 229920000249 biocompatible polymer Polymers 0.000 description 4
- 230000010261 cell growth Effects 0.000 description 4
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 4
- 239000002299 complementary DNA Substances 0.000 description 4
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 4
- 235000018417 cysteine Nutrition 0.000 description 4
- 230000003247 decreasing effect Effects 0.000 description 4
- 230000001419 dependent effect Effects 0.000 description 4
- 238000013461 design Methods 0.000 description 4
- 208000035475 disorder Diseases 0.000 description 4
- 150000002148 esters Chemical class 0.000 description 4
- 239000003102 growth factor Substances 0.000 description 4
- 238000009396 hybridization Methods 0.000 description 4
- 230000002163 immunogen Effects 0.000 description 4
- 238000001802 infusion Methods 0.000 description 4
- 238000003780 insertion Methods 0.000 description 4
- 230000037431 insertion Effects 0.000 description 4
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 4
- 235000014705 isoleucine Nutrition 0.000 description 4
- 229960000310 isoleucine Drugs 0.000 description 4
- 239000003446 ligand Substances 0.000 description 4
- 230000000670 limiting effect Effects 0.000 description 4
- 239000007788 liquid Substances 0.000 description 4
- RLSSMJSEOOYNOY-UHFFFAOYSA-N m-cresol Chemical compound CC1=CC=CC(O)=C1 RLSSMJSEOOYNOY-UHFFFAOYSA-N 0.000 description 4
- 238000013507 mapping Methods 0.000 description 4
- 210000004379 membrane Anatomy 0.000 description 4
- 108020004999 messenger RNA Proteins 0.000 description 4
- 229910052751 metal Inorganic materials 0.000 description 4
- 239000002184 metal Substances 0.000 description 4
- 239000003094 microcapsule Substances 0.000 description 4
- 238000012544 monitoring process Methods 0.000 description 4
- 238000002703 mutagenesis Methods 0.000 description 4
- 231100000350 mutagenesis Toxicity 0.000 description 4
- 150000002482 oligosaccharides Chemical class 0.000 description 4
- AQIXEPGDORPWBJ-UHFFFAOYSA-N pentan-3-ol Chemical compound CCC(O)CC AQIXEPGDORPWBJ-UHFFFAOYSA-N 0.000 description 4
- 229960005190 phenylalanine Drugs 0.000 description 4
- 239000006187 pill Substances 0.000 description 4
- 238000002360 preparation method Methods 0.000 description 4
- QELSKZZBTMNZEB-UHFFFAOYSA-N propylparaben Chemical compound CCCOC(=O)C1=CC=C(O)C=C1 QELSKZZBTMNZEB-UHFFFAOYSA-N 0.000 description 4
- 238000000159 protein binding assay Methods 0.000 description 4
- 210000002966 serum Anatomy 0.000 description 4
- 239000001509 sodium citrate Substances 0.000 description 4
- NLJMYIDDQXHKNR-UHFFFAOYSA-K sodium citrate Chemical compound O.O.[Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O NLJMYIDDQXHKNR-UHFFFAOYSA-K 0.000 description 4
- 238000010561 standard procedure Methods 0.000 description 4
- 210000000130 stem cell Anatomy 0.000 description 4
- 239000004094 surface-active agent Substances 0.000 description 4
- 238000013268 sustained release Methods 0.000 description 4
- 239000012730 sustained-release form Substances 0.000 description 4
- 230000008685 targeting Effects 0.000 description 4
- 229960002898 threonine Drugs 0.000 description 4
- 238000012546 transfer Methods 0.000 description 4
- 229960004295 valine Drugs 0.000 description 4
- 235000014393 valine Nutrition 0.000 description 4
- 239000004474 valine Substances 0.000 description 4
- 208000014697 Acute lymphocytic leukaemia Diseases 0.000 description 3
- 108700028369 Alleles Proteins 0.000 description 3
- 102000004127 Cytokines Human genes 0.000 description 3
- 108090000695 Cytokines Proteins 0.000 description 3
- 101710112752 Cytotoxin Proteins 0.000 description 3
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 3
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 3
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 3
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 3
- 238000002965 ELISA Methods 0.000 description 3
- 241000196324 Embryophyta Species 0.000 description 3
- 208000031886 HIV Infections Diseases 0.000 description 3
- 208000037357 HIV infectious disease Diseases 0.000 description 3
- 108010073807 IgG Receptors Proteins 0.000 description 3
- 102000009490 IgG Receptors Human genes 0.000 description 3
- 108010009817 Immunoglobulin Constant Regions Proteins 0.000 description 3
- 102000009786 Immunoglobulin Constant Regions Human genes 0.000 description 3
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 3
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 3
- 108700005091 Immunoglobulin Genes Proteins 0.000 description 3
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 3
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 3
- 108090001005 Interleukin-6 Proteins 0.000 description 3
- 108091092195 Intron Proteins 0.000 description 3
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 3
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 3
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 3
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 3
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 3
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 3
- 241000124008 Mammalia Species 0.000 description 3
- 229930195725 Mannitol Natural products 0.000 description 3
- 241001529936 Murinae Species 0.000 description 3
- ZDZOTLJHXYCWBA-VCVYQWHSSA-N N-debenzoyl-N-(tert-butoxycarbonyl)-10-deacetyltaxol Chemical compound O([C@H]1[C@H]2[C@@](C([C@H](O)C3=C(C)[C@@H](OC(=O)[C@H](O)[C@@H](NC(=O)OC(C)(C)C)C=4C=CC=CC=4)C[C@]1(O)C3(C)C)=O)(C)[C@@H](O)C[C@H]1OC[C@]12OC(=O)C)C(=O)C1=CC=CC=C1 ZDZOTLJHXYCWBA-VCVYQWHSSA-N 0.000 description 3
- 108091061960 Naked DNA Proteins 0.000 description 3
- 229930012538 Paclitaxel Natural products 0.000 description 3
- 208000006664 Precursor Cell Lymphoblastic Leukemia-Lymphoma Diseases 0.000 description 3
- 241000288906 Primates Species 0.000 description 3
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 3
- RWRDLPDLKQPQOW-UHFFFAOYSA-N Pyrrolidine Chemical compound C1CCNC1 RWRDLPDLKQPQOW-UHFFFAOYSA-N 0.000 description 3
- 108010071390 Serum Albumin Proteins 0.000 description 3
- 102000007562 Serum Albumin Human genes 0.000 description 3
- 241000191940 Staphylococcus Species 0.000 description 3
- 229930006000 Sucrose Natural products 0.000 description 3
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 3
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 3
- 108060008539 Transglutaminase Proteins 0.000 description 3
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 3
- 238000012452 Xenomouse strains Methods 0.000 description 3
- 230000021736 acetylation Effects 0.000 description 3
- 238000006640 acetylation reaction Methods 0.000 description 3
- 230000009471 action Effects 0.000 description 3
- 229960003767 alanine Drugs 0.000 description 3
- 235000004279 alanine Nutrition 0.000 description 3
- 230000006907 apoptotic process Effects 0.000 description 3
- PYMYPHUHKUWMLA-UHFFFAOYSA-N arabinose Natural products OCC(O)C(O)C(O)C=O PYMYPHUHKUWMLA-UHFFFAOYSA-N 0.000 description 3
- SRBFZHDQGSBBOR-UHFFFAOYSA-N beta-D-Pyranose-Lyxose Natural products OC1COC(O)C(O)C1O SRBFZHDQGSBBOR-UHFFFAOYSA-N 0.000 description 3
- 230000008827 biological function Effects 0.000 description 3
- 210000000481 breast Anatomy 0.000 description 3
- 230000003185 calcium uptake Effects 0.000 description 3
- 230000000711 cancerogenic effect Effects 0.000 description 3
- 231100000315 carcinogenic Toxicity 0.000 description 3
- 238000004113 cell culture Methods 0.000 description 3
- 238000006243 chemical reaction Methods 0.000 description 3
- 208000032852 chronic lymphocytic leukemia Diseases 0.000 description 3
- 239000011248 coating agent Substances 0.000 description 3
- 238000010168 coupling process Methods 0.000 description 3
- 230000009260 cross reactivity Effects 0.000 description 3
- 230000009089 cytolysis Effects 0.000 description 3
- 231100000433 cytotoxic Toxicity 0.000 description 3
- 239000002619 cytotoxin Substances 0.000 description 3
- 230000006378 damage Effects 0.000 description 3
- 230000002950 deficient Effects 0.000 description 3
- 238000010790 dilution Methods 0.000 description 3
- 239000012895 dilution Substances 0.000 description 3
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 3
- 238000004090 dissolution Methods 0.000 description 3
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 description 3
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical group O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 3
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 3
- 238000001476 gene delivery Methods 0.000 description 3
- 239000008103 glucose Substances 0.000 description 3
- 229960002989 glutamic acid Drugs 0.000 description 3
- 235000013922 glutamic acid Nutrition 0.000 description 3
- 239000004220 glutamic acid Substances 0.000 description 3
- 230000012010 growth Effects 0.000 description 3
- 208000033519 human immunodeficiency virus infectious disease Diseases 0.000 description 3
- 238000003384 imaging method Methods 0.000 description 3
- 238000002649 immunization Methods 0.000 description 3
- 230000005847 immunogenicity Effects 0.000 description 3
- 230000002584 immunomodulator Effects 0.000 description 3
- 230000006698 induction Effects 0.000 description 3
- 208000015181 infectious disease Diseases 0.000 description 3
- 235000005772 leucine Nutrition 0.000 description 3
- 229960003136 leucine Drugs 0.000 description 3
- 150000002632 lipids Chemical class 0.000 description 3
- 210000004962 mammalian cell Anatomy 0.000 description 3
- 239000000594 mannitol Substances 0.000 description 3
- 235000010355 mannitol Nutrition 0.000 description 3
- 239000002609 medium Substances 0.000 description 3
- 150000002739 metals Chemical class 0.000 description 3
- 230000000877 morphologic effect Effects 0.000 description 3
- 231100000252 nontoxic Toxicity 0.000 description 3
- 230000003000 nontoxic effect Effects 0.000 description 3
- 239000003921 oil Substances 0.000 description 3
- 235000019198 oils Nutrition 0.000 description 3
- 229920001542 oligosaccharide Polymers 0.000 description 3
- 229960001592 paclitaxel Drugs 0.000 description 3
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 3
- 235000008729 phenylalanine Nutrition 0.000 description 3
- 239000002953 phosphate buffered saline Substances 0.000 description 3
- 230000026731 phosphorylation Effects 0.000 description 3
- 238000006366 phosphorylation reaction Methods 0.000 description 3
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 3
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 3
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 3
- 239000000047 product Substances 0.000 description 3
- 229960002429 proline Drugs 0.000 description 3
- 235000013930 proline Nutrition 0.000 description 3
- 230000002829 reductive effect Effects 0.000 description 3
- 230000010076 replication Effects 0.000 description 3
- 238000012552 review Methods 0.000 description 3
- 150000003839 salts Chemical class 0.000 description 3
- 239000002904 solvent Substances 0.000 description 3
- 239000000600 sorbitol Substances 0.000 description 3
- 235000010356 sorbitol Nutrition 0.000 description 3
- 230000000638 stimulation Effects 0.000 description 3
- 239000005720 sucrose Substances 0.000 description 3
- 239000000725 suspension Substances 0.000 description 3
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 3
- ABZLKHKQJHEPAX-UHFFFAOYSA-N tetramethylrhodamine Chemical compound C=12C=CC(N(C)C)=CC2=[O+]C2=CC(N(C)C)=CC=C2C=1C1=CC=CC=C1C([O-])=O ABZLKHKQJHEPAX-UHFFFAOYSA-N 0.000 description 3
- 235000008521 threonine Nutrition 0.000 description 3
- 210000001519 tissue Anatomy 0.000 description 3
- 238000011200 topical administration Methods 0.000 description 3
- 230000000699 topical effect Effects 0.000 description 3
- 230000009261 transgenic effect Effects 0.000 description 3
- 102000003601 transglutaminase Human genes 0.000 description 3
- 229960004799 tryptophan Drugs 0.000 description 3
- 230000005747 tumor angiogenesis Effects 0.000 description 3
- 210000004881 tumor cell Anatomy 0.000 description 3
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 3
- 229960004441 tyrosine Drugs 0.000 description 3
- 239000000080 wetting agent Substances 0.000 description 3
- HDTRYLNUVZCQOY-UHFFFAOYSA-N α-D-glucopyranosyl-α-D-glucopyranoside Natural products OC1C(O)C(O)C(CO)OC1OC1C(O)C(O)C(O)C(CO)O1 HDTRYLNUVZCQOY-UHFFFAOYSA-N 0.000 description 2
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- MFRNYXJJRJQHNW-DEMKXPNLSA-N (2s)-2-[[(2r,3r)-3-methoxy-3-[(2s)-1-[(3r,4s,5s)-3-methoxy-5-methyl-4-[methyl-[(2s)-3-methyl-2-[[(2s)-3-methyl-2-(methylamino)butanoyl]amino]butanoyl]amino]heptanoyl]pyrrolidin-2-yl]-2-methylpropanoyl]amino]-3-phenylpropanoic acid Chemical compound CN[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(=O)N(C)[C@@H]([C@@H](C)CC)[C@H](OC)CC(=O)N1CCC[C@H]1[C@H](OC)[C@@H](C)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 MFRNYXJJRJQHNW-DEMKXPNLSA-N 0.000 description 2
- 208000023275 Autoimmune disease Diseases 0.000 description 2
- FTEDXVNDVHYDQW-UHFFFAOYSA-N BAPTA Chemical compound OC(=O)CN(CC(O)=O)C1=CC=CC=C1OCCOC1=CC=CC=C1N(CC(O)=O)CC(O)=O FTEDXVNDVHYDQW-UHFFFAOYSA-N 0.000 description 2
- 241000283690 Bos taurus Species 0.000 description 2
- 102100021943 C-C motif chemokine 2 Human genes 0.000 description 2
- 102100032367 C-C motif chemokine 5 Human genes 0.000 description 2
- 102100025277 C-X-C motif chemokine 13 Human genes 0.000 description 2
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 2
- 208000024172 Cardiovascular disease Diseases 0.000 description 2
- 102000014914 Carrier Proteins Human genes 0.000 description 2
- VEXZGXHMUGYJMC-UHFFFAOYSA-M Chloride anion Chemical compound [Cl-] VEXZGXHMUGYJMC-UHFFFAOYSA-M 0.000 description 2
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 2
- 108020004705 Codon Proteins 0.000 description 2
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 description 2
- 241000702421 Dependoparvovirus Species 0.000 description 2
- 229920002307 Dextran Polymers 0.000 description 2
- 229920001353 Dextrin Polymers 0.000 description 2
- 239000004375 Dextrin Substances 0.000 description 2
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 2
- 241000283086 Equidae Species 0.000 description 2
- 108010087819 Fc receptors Proteins 0.000 description 2
- 102000009109 Fc receptors Human genes 0.000 description 2
- 108091006027 G proteins Proteins 0.000 description 2
- 102000030782 GTP binding Human genes 0.000 description 2
- 108091000058 GTP-Binding Proteins 0.000 description 2
- 108010010803 Gelatin Proteins 0.000 description 2
- 108010017080 Granulocyte Colony-Stimulating Factor Proteins 0.000 description 2
- 102000004269 Granulocyte Colony-Stimulating Factor Human genes 0.000 description 2
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 2
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 description 2
- 101000858064 Homo sapiens C-X-C motif chemokine 13 Proteins 0.000 description 2
- 101000947178 Homo sapiens Platelet basic protein Proteins 0.000 description 2
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 description 2
- 238000012450 HuMAb Mouse Methods 0.000 description 2
- 102000013463 Immunoglobulin Light Chains Human genes 0.000 description 2
- 108010065825 Immunoglobulin Light Chains Proteins 0.000 description 2
- 206010061218 Inflammation Diseases 0.000 description 2
- 102000004889 Interleukin-6 Human genes 0.000 description 2
- 108090001007 Interleukin-8 Proteins 0.000 description 2
- 102000004890 Interleukin-8 Human genes 0.000 description 2
- 108060001084 Luciferase Proteins 0.000 description 2
- 239000005089 Luciferase Substances 0.000 description 2
- 102100035304 Lymphotactin Human genes 0.000 description 2
- 101100497626 Mus musculus Cxcr4 gene Proteins 0.000 description 2
- QPCDCPDFJACHGM-UHFFFAOYSA-N N,N-bis{2-[bis(carboxymethyl)amino]ethyl}glycine Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(=O)O)CCN(CC(O)=O)CC(O)=O QPCDCPDFJACHGM-UHFFFAOYSA-N 0.000 description 2
- 230000004989 O-glycosylation Effects 0.000 description 2
- 229910019142 PO4 Inorganic materials 0.000 description 2
- 241000235648 Pichia Species 0.000 description 2
- 102100036154 Platelet basic protein Human genes 0.000 description 2
- 102100030304 Platelet factor 4 Human genes 0.000 description 2
- 239000004698 Polyethylene Substances 0.000 description 2
- RJKFOVLPORLFTN-LEKSSAKUSA-N Progesterone Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H](C(=O)C)[C@@]1(C)CC2 RJKFOVLPORLFTN-LEKSSAKUSA-N 0.000 description 2
- 101100497630 Rattus norvegicus Cxcr4 gene Proteins 0.000 description 2
- 102000006382 Ribonucleases Human genes 0.000 description 2
- 108010083644 Ribonucleases Proteins 0.000 description 2
- 229920001800 Shellac Polymers 0.000 description 2
- 101000895926 Streptomyces plicatus Endo-beta-N-acetylglucosaminidase H Proteins 0.000 description 2
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 description 2
- NKANXQFJJICGDU-QPLCGJKRSA-N Tamoxifen Chemical compound C=1C=CC=CC=1C(/CC)=C(C=1C=CC(OCCN(C)C)=CC=1)/C1=CC=CC=C1 NKANXQFJJICGDU-QPLCGJKRSA-N 0.000 description 2
- HDTRYLNUVZCQOY-WSWWMNSNSA-N Trehalose Natural products O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-WSWWMNSNSA-N 0.000 description 2
- IEDXPSOJFSVCKU-HOKPPMCLSA-N [4-[[(2S)-5-(carbamoylamino)-2-[[(2S)-2-[6-(2,5-dioxopyrrolidin-1-yl)hexanoylamino]-3-methylbutanoyl]amino]pentanoyl]amino]phenyl]methyl N-[(2S)-1-[[(2S)-1-[[(3R,4S,5S)-1-[(2S)-2-[(1R,2R)-3-[[(1S,2R)-1-hydroxy-1-phenylpropan-2-yl]amino]-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl]-3-methoxy-5-methyl-1-oxoheptan-4-yl]-methylamino]-3-methyl-1-oxobutan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]-N-methylcarbamate Chemical compound CC[C@H](C)[C@@H]([C@@H](CC(=O)N1CCC[C@H]1[C@H](OC)[C@@H](C)C(=O)N[C@H](C)[C@@H](O)c1ccccc1)OC)N(C)C(=O)[C@@H](NC(=O)[C@H](C(C)C)N(C)C(=O)OCc1ccc(NC(=O)[C@H](CCCNC(N)=O)NC(=O)[C@@H](NC(=O)CCCCCN2C(=O)CCC2=O)C(C)C)cc1)C(C)C IEDXPSOJFSVCKU-HOKPPMCLSA-N 0.000 description 2
- 230000002378 acidificating effect Effects 0.000 description 2
- DZBUGLKDJFMEHC-UHFFFAOYSA-N acridine Chemical compound C1=CC=CC2=CC3=CC=CC=C3N=C21 DZBUGLKDJFMEHC-UHFFFAOYSA-N 0.000 description 2
- 239000013543 active substance Substances 0.000 description 2
- 150000001299 aldehydes Chemical class 0.000 description 2
- 238000005804 alkylation reaction Methods 0.000 description 2
- 208000026935 allergic disease Diseases 0.000 description 2
- HDTRYLNUVZCQOY-LIZSDCNHSA-N alpha,alpha-trehalose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-LIZSDCNHSA-N 0.000 description 2
- 230000004075 alteration Effects 0.000 description 2
- KUFRQPKVAWMTJO-LMZWQJSESA-N alvespimycin Chemical compound N1C(=O)\C(C)=C\C=C/[C@H](OC)[C@@H](OC(N)=O)\C(C)=C\[C@H](C)[C@@H](O)[C@@H](OC)C[C@H](C)CC2=C(NCCN(C)C)C(=O)C=C1C2=O KUFRQPKVAWMTJO-LMZWQJSESA-N 0.000 description 2
- 230000003321 amplification Effects 0.000 description 2
- 239000003708 ampul Substances 0.000 description 2
- 230000001093 anti-cancer Effects 0.000 description 2
- 230000000259 anti-tumor effect Effects 0.000 description 2
- 230000009830 antibody antigen interaction Effects 0.000 description 2
- 238000009175 antibody therapy Methods 0.000 description 2
- 210000000628 antibody-producing cell Anatomy 0.000 description 2
- 239000002246 antineoplastic agent Substances 0.000 description 2
- 239000003963 antioxidant agent Substances 0.000 description 2
- 235000006708 antioxidants Nutrition 0.000 description 2
- 239000007864 aqueous solution Substances 0.000 description 2
- 210000001106 artificial yeast chromosome Anatomy 0.000 description 2
- 125000003118 aryl group Chemical group 0.000 description 2
- 235000010323 ascorbic acid Nutrition 0.000 description 2
- 229960005070 ascorbic acid Drugs 0.000 description 2
- 239000011668 ascorbic acid Substances 0.000 description 2
- 235000003704 aspartic acid Nutrition 0.000 description 2
- 229960000686 benzalkonium chloride Drugs 0.000 description 2
- CADWTSSKOVRVJC-UHFFFAOYSA-N benzyl(dimethyl)azanium;chloride Chemical compound [Cl-].C[NH+](C)CC1=CC=CC=C1 CADWTSSKOVRVJC-UHFFFAOYSA-N 0.000 description 2
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 2
- 108091008324 binding proteins Proteins 0.000 description 2
- 238000010256 biochemical assay Methods 0.000 description 2
- HUTDDBSSHVOYJR-UHFFFAOYSA-H bis[(2-oxo-1,3,2$l^{5},4$l^{2}-dioxaphosphaplumbetan-2-yl)oxy]lead Chemical compound [Pb+2].[Pb+2].[Pb+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O HUTDDBSSHVOYJR-UHFFFAOYSA-H 0.000 description 2
- 210000004369 blood Anatomy 0.000 description 2
- 239000008280 blood Substances 0.000 description 2
- LRHPLDYGYMQRHN-UHFFFAOYSA-N butyl alcohol Substances CCCCO LRHPLDYGYMQRHN-UHFFFAOYSA-N 0.000 description 2
- 125000000484 butyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 2
- 229910052791 calcium Inorganic materials 0.000 description 2
- 239000011575 calcium Substances 0.000 description 2
- 239000002775 capsule Substances 0.000 description 2
- 125000002915 carbonyl group Chemical group [*:2]C([*:1])=O 0.000 description 2
- 230000015556 catabolic process Effects 0.000 description 2
- 230000001413 cellular effect Effects 0.000 description 2
- 238000012512 characterization method Methods 0.000 description 2
- 239000003153 chemical reaction reagent Substances 0.000 description 2
- 238000002512 chemotherapy Methods 0.000 description 2
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 2
- 238000012875 competitive assay Methods 0.000 description 2
- 230000002860 competitive effect Effects 0.000 description 2
- 238000010276 construction Methods 0.000 description 2
- 229920001577 copolymer Polymers 0.000 description 2
- 230000008878 coupling Effects 0.000 description 2
- 238000005859 coupling reaction Methods 0.000 description 2
- 238000004132 cross linking Methods 0.000 description 2
- 239000003431 cross linking reagent Substances 0.000 description 2
- HPXRVTGHNJAIIH-UHFFFAOYSA-N cyclohexanol Chemical compound OC1CCCCC1 HPXRVTGHNJAIIH-UHFFFAOYSA-N 0.000 description 2
- 230000003013 cytotoxicity Effects 0.000 description 2
- 231100000135 cytotoxicity Toxicity 0.000 description 2
- 230000007850 degeneration Effects 0.000 description 2
- 239000003405 delayed action preparation Substances 0.000 description 2
- 230000003111 delayed effect Effects 0.000 description 2
- 229960002086 dextran Drugs 0.000 description 2
- 235000019425 dextrin Nutrition 0.000 description 2
- 239000003085 diluting agent Substances 0.000 description 2
- 206010013023 diphtheria Diseases 0.000 description 2
- 229960003668 docetaxel Drugs 0.000 description 2
- 229960004679 doxorubicin Drugs 0.000 description 2
- 238000012377 drug delivery Methods 0.000 description 2
- 238000004520 electroporation Methods 0.000 description 2
- 230000008030 elimination Effects 0.000 description 2
- 238000003379 elimination reaction Methods 0.000 description 2
- 239000003995 emulsifying agent Substances 0.000 description 2
- 239000003623 enhancer Substances 0.000 description 2
- 239000002702 enteric coating Substances 0.000 description 2
- 239000012055 enteric layer Substances 0.000 description 2
- 238000002474 experimental method Methods 0.000 description 2
- 210000002950 fibroblast Anatomy 0.000 description 2
- GNBHRKFJIUUOQI-UHFFFAOYSA-N fluorescein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 GNBHRKFJIUUOQI-UHFFFAOYSA-N 0.000 description 2
- 238000001502 gel electrophoresis Methods 0.000 description 2
- 229920000159 gelatin Polymers 0.000 description 2
- 239000008273 gelatin Substances 0.000 description 2
- 235000019322 gelatine Nutrition 0.000 description 2
- 235000011852 gelatine desserts Nutrition 0.000 description 2
- 208000005017 glioblastoma Diseases 0.000 description 2
- 229940093915 gynecological organic acid Drugs 0.000 description 2
- 150000004820 halides Chemical class 0.000 description 2
- 230000036541 health Effects 0.000 description 2
- BXWNKGSJHAJOGX-UHFFFAOYSA-N hexadecan-1-ol Chemical compound CCCCCCCCCCCCCCCCO BXWNKGSJHAJOGX-UHFFFAOYSA-N 0.000 description 2
- 229940088597 hormone Drugs 0.000 description 2
- 239000005556 hormone Substances 0.000 description 2
- 210000005260 human cell Anatomy 0.000 description 2
- 229920001477 hydrophilic polymer Polymers 0.000 description 2
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 2
- 208000026278 immune system disease Diseases 0.000 description 2
- 230000003053 immunization Effects 0.000 description 2
- 229940099472 immunoglobulin a Drugs 0.000 description 2
- 208000027866 inflammatory disease Diseases 0.000 description 2
- 230000002757 inflammatory effect Effects 0.000 description 2
- 230000004054 inflammatory process Effects 0.000 description 2
- 229940028435 intralipid Drugs 0.000 description 2
- 238000007918 intramuscular administration Methods 0.000 description 2
- 150000002500 ions Chemical class 0.000 description 2
- 238000002955 isolation Methods 0.000 description 2
- 238000002372 labelling Methods 0.000 description 2
- 208000032839 leukemia Diseases 0.000 description 2
- 210000000265 leukocyte Anatomy 0.000 description 2
- 239000012669 liquid formulation Substances 0.000 description 2
- 201000007270 liver cancer Diseases 0.000 description 2
- 208000014018 liver neoplasm Diseases 0.000 description 2
- 239000008176 lyophilized powder Substances 0.000 description 2
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 239000003550 marker Substances 0.000 description 2
- 238000005259 measurement Methods 0.000 description 2
- SGDBTWWWUNNDEQ-LBPRGKRZSA-N melphalan Chemical compound OC(=O)[C@@H](N)CC1=CC=C(N(CCCl)CCCl)C=C1 SGDBTWWWUNNDEQ-LBPRGKRZSA-N 0.000 description 2
- 229960001924 melphalan Drugs 0.000 description 2
- 239000002207 metabolite Substances 0.000 description 2
- 239000004292 methyl p-hydroxybenzoate Substances 0.000 description 2
- 235000010270 methyl p-hydroxybenzoate Nutrition 0.000 description 2
- 229960002216 methylparaben Drugs 0.000 description 2
- 239000004005 microsphere Substances 0.000 description 2
- 235000013336 milk Nutrition 0.000 description 2
- 239000008267 milk Substances 0.000 description 2
- 210000004080 milk Anatomy 0.000 description 2
- 230000003278 mimic effect Effects 0.000 description 2
- 150000002772 monosaccharides Chemical class 0.000 description 2
- 238000003199 nucleic acid amplification method Methods 0.000 description 2
- 150000007524 organic acids Chemical class 0.000 description 2
- 235000005985 organic acids Nutrition 0.000 description 2
- 230000003647 oxidation Effects 0.000 description 2
- 238000007254 oxidation reaction Methods 0.000 description 2
- 230000001590 oxidative effect Effects 0.000 description 2
- LXCFILQKKLGQFO-UHFFFAOYSA-N p-hydroxybenzoic acid methyl ester Natural products COC(=O)C1=CC=C(O)C=C1 LXCFILQKKLGQFO-UHFFFAOYSA-N 0.000 description 2
- 210000000496 pancreas Anatomy 0.000 description 2
- 230000001575 pathological effect Effects 0.000 description 2
- 230000006320 pegylation Effects 0.000 description 2
- 230000035515 penetration Effects 0.000 description 2
- 229960003330 pentetic acid Drugs 0.000 description 2
- 210000005259 peripheral blood Anatomy 0.000 description 2
- 239000011886 peripheral blood Substances 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 2
- 239000010452 phosphate Substances 0.000 description 2
- 150000003904 phospholipids Chemical class 0.000 description 2
- 229910052698 phosphorus Inorganic materials 0.000 description 2
- 230000004962 physiological condition Effects 0.000 description 2
- 229920000573 polyethylene Polymers 0.000 description 2
- 239000005020 polyethylene terephthalate Substances 0.000 description 2
- 229920000139 polyethylene terephthalate Polymers 0.000 description 2
- 229920000642 polymer Polymers 0.000 description 2
- 238000003752 polymerase chain reaction Methods 0.000 description 2
- 229920000136 polysorbate Polymers 0.000 description 2
- 150000003141 primary amines Chemical class 0.000 description 2
- 238000012545 processing Methods 0.000 description 2
- 238000004393 prognosis Methods 0.000 description 2
- 230000035755 proliferation Effects 0.000 description 2
- 230000000069 prophylactic effect Effects 0.000 description 2
- 235000010232 propyl p-hydroxybenzoate Nutrition 0.000 description 2
- 239000004405 propyl p-hydroxybenzoate Substances 0.000 description 2
- 229960003415 propylparaben Drugs 0.000 description 2
- 210000002307 prostate Anatomy 0.000 description 2
- 125000006239 protecting group Chemical group 0.000 description 2
- 238000002818 protein evolution Methods 0.000 description 2
- ZCCUUQDIBDJBTK-UHFFFAOYSA-N psoralen Chemical compound C1=C2OC(=O)C=CC2=CC2=C1OC=C2 ZCCUUQDIBDJBTK-UHFFFAOYSA-N 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- YUOCYTRGANSSRY-UHFFFAOYSA-N pyrrolo[2,3-i][1,2]benzodiazepine Chemical class C1=CN=NC2=C3C=CN=C3C=CC2=C1 YUOCYTRGANSSRY-UHFFFAOYSA-N 0.000 description 2
- 238000003127 radioimmunoassay Methods 0.000 description 2
- ZAHRKKWIAAJSAO-UHFFFAOYSA-N rapamycin Natural products COCC(O)C(=C/C(C)C(=O)CC(OC(=O)C1CCCCN1C(=O)C(=O)C2(O)OC(CC(OC)C(=CC=CC=CC(C)CC(C)C(=O)C)C)CCC2C)C(C)CC3CCC(O)C(C3)OC)C ZAHRKKWIAAJSAO-UHFFFAOYSA-N 0.000 description 2
- 230000003578 releasing effect Effects 0.000 description 2
- 230000003362 replicative effect Effects 0.000 description 2
- 230000001850 reproductive effect Effects 0.000 description 2
- 230000000717 retained effect Effects 0.000 description 2
- 206010039073 rheumatoid arthritis Diseases 0.000 description 2
- 239000000523 sample Substances 0.000 description 2
- 230000003248 secreting effect Effects 0.000 description 2
- 229940113147 shellac Drugs 0.000 description 2
- 239000004208 shellac Substances 0.000 description 2
- ZLGIYFNHBLSMPS-ATJNOEHPSA-N shellac Chemical compound OCCCCCC(O)C(O)CCCCCCCC(O)=O.C1C23[C@H](C(O)=O)CCC2[C@](C)(CO)[C@@H]1C(C(O)=O)=C[C@@H]3O ZLGIYFNHBLSMPS-ATJNOEHPSA-N 0.000 description 2
- 235000013874 shellac Nutrition 0.000 description 2
- 238000002603 single-photon emission computed tomography Methods 0.000 description 2
- 229960002930 sirolimus Drugs 0.000 description 2
- QFJCIRLUMZQUOT-HPLJOQBZSA-N sirolimus Chemical compound C1C[C@@H](O)[C@H](OC)C[C@@H]1C[C@@H](C)[C@H]1OC(=O)[C@@H]2CCCCN2C(=O)C(=O)[C@](O)(O2)[C@H](C)CC[C@H]2C[C@H](OC)/C(C)=C/C=C/C=C/[C@@H](C)C[C@@H](C)C(=O)[C@H](OC)[C@H](O)/C(C)=C/[C@@H](C)C(=O)C1 QFJCIRLUMZQUOT-HPLJOQBZSA-N 0.000 description 2
- 150000003384 small molecules Chemical class 0.000 description 2
- 239000008247 solid mixture Substances 0.000 description 2
- 239000003549 soybean oil Substances 0.000 description 2
- 235000012424 soybean oil Nutrition 0.000 description 2
- 230000009870 specific binding Effects 0.000 description 2
- SFVFIFLLYFPGHH-UHFFFAOYSA-M stearalkonium chloride Chemical compound [Cl-].CCCCCCCCCCCCCCCCCC[N+](C)(C)CC1=CC=CC=C1 SFVFIFLLYFPGHH-UHFFFAOYSA-M 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- 125000003396 thiol group Chemical group [H]S* 0.000 description 2
- 238000001890 transfection Methods 0.000 description 2
- 238000013519 translation Methods 0.000 description 2
- 238000002054 transplantation Methods 0.000 description 2
- 230000002100 tumorsuppressive effect Effects 0.000 description 2
- 241001430294 unidentified retrovirus Species 0.000 description 2
- 239000013603 viral vector Substances 0.000 description 2
- 238000005406 washing Methods 0.000 description 2
- 229920003169 water-soluble polymer Polymers 0.000 description 2
- 238000009736 wetting Methods 0.000 description 2
- WOWDZACBATWTAU-FEFUEGSOSA-N (2s)-2-[[(2s)-2-(dimethylamino)-3-methylbutanoyl]amino]-n-[(3r,4s,5s)-1-[(2s)-2-[(1r,2r)-3-[[(1s,2r)-1-hydroxy-1-phenylpropan-2-yl]amino]-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl]-3-methoxy-5-methyl-1-oxoheptan-4-yl]-n,3-dimethylbutanamide Chemical compound CC(C)[C@H](N(C)C)C(=O)N[C@@H](C(C)C)C(=O)N(C)[C@@H]([C@@H](C)CC)[C@H](OC)CC(=O)N1CCC[C@H]1[C@H](OC)[C@@H](C)C(=O)N[C@H](C)[C@@H](O)C1=CC=CC=C1 WOWDZACBATWTAU-FEFUEGSOSA-N 0.000 description 1
- AGGWFDNPHKLBBV-YUMQZZPRSA-N (2s)-2-[[(2s)-2-amino-3-methylbutanoyl]amino]-5-(carbamoylamino)pentanoic acid Chemical compound CC(C)[C@H](N)C(=O)N[C@H](C(O)=O)CCCNC(N)=O AGGWFDNPHKLBBV-YUMQZZPRSA-N 0.000 description 1
- ALBODLTZUXKBGZ-JUUVMNCLSA-N (2s)-2-amino-3-phenylpropanoic acid;(2s)-2,6-diaminohexanoic acid Chemical compound NCCCC[C@H](N)C(O)=O.OC(=O)[C@@H](N)CC1=CC=CC=C1 ALBODLTZUXKBGZ-JUUVMNCLSA-N 0.000 description 1
- KYBXNPIASYUWLN-WUCPZUCCSA-N (2s)-5-hydroxypyrrolidine-2-carboxylic acid Chemical compound OC1CC[C@@H](C(O)=O)N1 KYBXNPIASYUWLN-WUCPZUCCSA-N 0.000 description 1
- VEEGZPWAAPPXRB-BJMVGYQFSA-N (3e)-3-(1h-imidazol-5-ylmethylidene)-1h-indol-2-one Chemical compound O=C1NC2=CC=CC=C2\C1=C/C1=CN=CN1 VEEGZPWAAPPXRB-BJMVGYQFSA-N 0.000 description 1
- RWZVMMQNDHPRQD-SFTDATJTSA-N (6as)-3-[3-[[(6as)-2-methoxy-8-methylidene-11-oxo-7,9-dihydro-6ah-pyrrolo[2,1-c][1,4]benzodiazepin-3-yl]oxy]propoxy]-2-methoxy-8-methylidene-7,9-dihydro-6ah-pyrrolo[2,1-c][1,4]benzodiazepin-11-one Chemical compound N1=C[C@@H]2CC(=C)CN2C(=O)C(C=C2OC)=C1C=C2OCCCOC1=CC(N=C[C@H]2N(CC(=C)C2)C2=O)=C2C=C1OC RWZVMMQNDHPRQD-SFTDATJTSA-N 0.000 description 1
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 1
- NKIJBSVPDYIEAT-UHFFFAOYSA-N 1,4,7,10-tetrazacyclododec-10-ene Chemical compound C1CNCCN=CCNCCN1 NKIJBSVPDYIEAT-UHFFFAOYSA-N 0.000 description 1
- ITWBWJFEJCHKSN-UHFFFAOYSA-N 1,4,7-triazonane Chemical compound C1CNCCNCCN1 ITWBWJFEJCHKSN-UHFFFAOYSA-N 0.000 description 1
- AZQWKYJCGOJGHM-UHFFFAOYSA-N 1,4-benzoquinone Chemical compound O=C1C=CC(=O)C=C1 AZQWKYJCGOJGHM-UHFFFAOYSA-N 0.000 description 1
- FPKVOQKZMBDBKP-UHFFFAOYSA-N 1-[4-[(2,5-dioxopyrrol-1-yl)methyl]cyclohexanecarbonyl]oxy-2,5-dioxopyrrolidine-3-sulfonic acid Chemical compound O=C1C(S(=O)(=O)O)CC(=O)N1OC(=O)C1CCC(CN2C(C=CC2=O)=O)CC1 FPKVOQKZMBDBKP-UHFFFAOYSA-N 0.000 description 1
- JLPULHDHAOZNQI-ZTIMHPMXSA-N 1-hexadecanoyl-2-(9Z,12Z-octadecadienoyl)-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCC\C=C/C\C=C/CCCCC JLPULHDHAOZNQI-ZTIMHPMXSA-N 0.000 description 1
- MQLACMBJVPINKE-UHFFFAOYSA-N 10-[(3-hydroxy-4-methoxyphenyl)methylidene]anthracen-9-one Chemical compound C1=C(O)C(OC)=CC=C1C=C1C2=CC=CC=C2C(=O)C2=CC=CC=C21 MQLACMBJVPINKE-UHFFFAOYSA-N 0.000 description 1
- FALRKNHUBBKYCC-UHFFFAOYSA-N 2-(chloromethyl)pyridine-3-carbonitrile Chemical compound ClCC1=NC=CC=C1C#N FALRKNHUBBKYCC-UHFFFAOYSA-N 0.000 description 1
- JHALWMSZGCVVEM-UHFFFAOYSA-N 2-[4,7-bis(carboxymethyl)-1,4,7-triazonan-1-yl]acetic acid Chemical compound OC(=O)CN1CCN(CC(O)=O)CCN(CC(O)=O)CC1 JHALWMSZGCVVEM-UHFFFAOYSA-N 0.000 description 1
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 1
- IREMDSFQZGQXDX-UHFFFAOYSA-N 2-amino-1,7-dihydropurin-6-one 7H-purine Chemical group C1=NC=C2NC=NC2=N1.C1=NC=C2NC=NC2=N1.O=C1NC(N)=NC2=C1NC=N2 IREMDSFQZGQXDX-UHFFFAOYSA-N 0.000 description 1
- NDMPLJNOPCLANR-UHFFFAOYSA-N 3,4-dihydroxy-15-(4-hydroxy-18-methoxycarbonyl-5,18-seco-ibogamin-18-yl)-16-methoxy-1-methyl-6,7-didehydro-aspidospermidine-3-carboxylic acid methyl ester Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 NDMPLJNOPCLANR-UHFFFAOYSA-N 0.000 description 1
- VXGRJERITKFWPL-UHFFFAOYSA-N 4',5'-Dihydropsoralen Natural products C1=C2OC(=O)C=CC2=CC2=C1OCC2 VXGRJERITKFWPL-UHFFFAOYSA-N 0.000 description 1
- AOJJSUZBOXZQNB-VTZDEGQISA-N 4'-epidoxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-VTZDEGQISA-N 0.000 description 1
- ILUSBJDVXKZYEP-UHFFFAOYSA-N 4-(aminomethyl)oxan-4-ol;hydrochloride Chemical compound Cl.NCC1(O)CCOCC1 ILUSBJDVXKZYEP-UHFFFAOYSA-N 0.000 description 1
- LGZKGOGODCLQHG-CYBMUJFWSA-N 5-[(2r)-2-hydroxy-2-(3,4,5-trimethoxyphenyl)ethyl]-2-methoxyphenol Chemical compound C1=C(O)C(OC)=CC=C1C[C@@H](O)C1=CC(OC)=C(OC)C(OC)=C1 LGZKGOGODCLQHG-CYBMUJFWSA-N 0.000 description 1
- NJYVEMPWNAYQQN-UHFFFAOYSA-N 5-carboxyfluorescein Chemical compound C12=CC=C(O)C=C2OC2=CC(O)=CC=C2C21OC(=O)C1=CC(C(=O)O)=CC=C21 NJYVEMPWNAYQQN-UHFFFAOYSA-N 0.000 description 1
- YMZMTOFQCVHHFB-UHFFFAOYSA-N 5-carboxytetramethylrhodamine Chemical compound C=12C=CC(N(C)C)=CC2=[O+]C2=CC(N(C)C)=CC=C2C=1C1=CC=C(C(O)=O)C=C1C([O-])=O YMZMTOFQCVHHFB-UHFFFAOYSA-N 0.000 description 1
- BZTDTCNHAFUJOG-UHFFFAOYSA-N 6-carboxyfluorescein Chemical compound C12=CC=C(O)C=C2OC2=CC(O)=CC=C2C11OC(=O)C2=CC=C(C(=O)O)C=C21 BZTDTCNHAFUJOG-UHFFFAOYSA-N 0.000 description 1
- STQGQHZAVUOBTE-UHFFFAOYSA-N 7-Cyan-hept-2t-en-4,6-diinsaeure Natural products C1=2C(O)=C3C(=O)C=4C(OC)=CC=CC=4C(=O)C3=C(O)C=2CC(O)(C(C)=O)CC1OC1CC(N)C(O)C(C)O1 STQGQHZAVUOBTE-UHFFFAOYSA-N 0.000 description 1
- 206010069754 Acquired gene mutation Diseases 0.000 description 1
- 206010067484 Adverse reaction Diseases 0.000 description 1
- 229920000936 Agarose Polymers 0.000 description 1
- 108010088751 Albumins Proteins 0.000 description 1
- 102000009027 Albumins Human genes 0.000 description 1
- 239000012099 Alexa Fluor family Substances 0.000 description 1
- 235000019489 Almond oil Nutrition 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 241000710929 Alphavirus Species 0.000 description 1
- 239000004382 Amylase Substances 0.000 description 1
- 102000013142 Amylases Human genes 0.000 description 1
- 108010065511 Amylases Proteins 0.000 description 1
- 241000228212 Aspergillus Species 0.000 description 1
- 101710192393 Attachment protein G3P Proteins 0.000 description 1
- 241000972773 Aulopiformes Species 0.000 description 1
- 241000271566 Aves Species 0.000 description 1
- 108090001008 Avidin Proteins 0.000 description 1
- 102000019260 B-Cell Antigen Receptors Human genes 0.000 description 1
- 108010012919 B-Cell Antigen Receptors Proteins 0.000 description 1
- 244000063299 Bacillus subtilis Species 0.000 description 1
- 235000014469 Bacillus subtilis Nutrition 0.000 description 1
- ZOXJGFHDIHLPTG-UHFFFAOYSA-N Boron Chemical compound [B] ZOXJGFHDIHLPTG-UHFFFAOYSA-N 0.000 description 1
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 1
- 208000003174 Brain Neoplasms Diseases 0.000 description 1
- 101710155857 C-C motif chemokine 2 Proteins 0.000 description 1
- 102100031658 C-X-C chemokine receptor type 5 Human genes 0.000 description 1
- 108091008928 CXC chemokine receptors Proteins 0.000 description 1
- 102000054900 CXCR Receptors Human genes 0.000 description 1
- 108010061299 CXCR4 Receptors Proteins 0.000 description 1
- 101150066398 CXCR4 gene Proteins 0.000 description 1
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 1
- 241000282465 Canis Species 0.000 description 1
- 101100497619 Canis lupus familiaris CXCR4 gene Proteins 0.000 description 1
- 101710158575 Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase Proteins 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 101710169873 Capsid protein G8P Proteins 0.000 description 1
- 208000005623 Carcinogenesis Diseases 0.000 description 1
- 102000053642 Catalytic RNA Human genes 0.000 description 1
- 108090000994 Catalytic RNA Proteins 0.000 description 1
- 241000700198 Cavia Species 0.000 description 1
- 102000000844 Cell Surface Receptors Human genes 0.000 description 1
- 108010001857 Cell Surface Receptors Proteins 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- 108010055166 Chemokine CCL5 Proteins 0.000 description 1
- 108010078239 Chemokine CX3CL1 Proteins 0.000 description 1
- 102000014464 Chemokine CX3CL1 Human genes 0.000 description 1
- 241000251730 Chondrichthyes Species 0.000 description 1
- 108700010070 Codon Usage Proteins 0.000 description 1
- 108020004635 Complementary DNA Proteins 0.000 description 1
- 229920002261 Corn starch Polymers 0.000 description 1
- 241000699802 Cricetulus griseus Species 0.000 description 1
- CMSMOCZEIVJLDB-UHFFFAOYSA-N Cyclophosphamide Chemical compound ClCCN(CCCl)P1(=O)NCCCO1 CMSMOCZEIVJLDB-UHFFFAOYSA-N 0.000 description 1
- PMATZTZNYRCHOR-CGLBZJNRSA-N Cyclosporin A Chemical compound CC[C@@H]1NC(=O)[C@H]([C@H](O)[C@H](C)C\C=C\C)N(C)C(=O)[C@H](C(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)N(C)C(=O)CN(C)C1=O PMATZTZNYRCHOR-CGLBZJNRSA-N 0.000 description 1
- 108010036949 Cyclosporine Proteins 0.000 description 1
- 102100034560 Cytosol aminopeptidase Human genes 0.000 description 1
- HMFHBZSHGGEWLO-SOOFDHNKSA-N D-ribofuranose Chemical compound OC[C@H]1OC(O)[C@H](O)[C@@H]1O HMFHBZSHGGEWLO-SOOFDHNKSA-N 0.000 description 1
- 102000053602 DNA Human genes 0.000 description 1
- 102000003915 DNA Topoisomerases Human genes 0.000 description 1
- 108090000323 DNA Topoisomerases Proteins 0.000 description 1
- 229940126161 DNA alkylating agent Drugs 0.000 description 1
- 239000012624 DNA alkylating agent Substances 0.000 description 1
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 1
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 1
- 108090000626 DNA-directed RNA polymerases Proteins 0.000 description 1
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 description 1
- 102000007260 Deoxyribonuclease I Human genes 0.000 description 1
- 108010008532 Deoxyribonuclease I Proteins 0.000 description 1
- 108700022150 Designed Ankyrin Repeat Proteins Proteins 0.000 description 1
- 108010016626 Dipeptides Proteins 0.000 description 1
- OFDNQWIFNXBECV-UHFFFAOYSA-N Dolastatin 10 Natural products CC(C)C(N(C)C)C(=O)NC(C(C)C)C(=O)N(C)C(C(C)CC)C(OC)CC(=O)N1CCCC1C(OC)C(C)C(=O)NC(C=1SC=CN=1)CC1=CC=CC=C1 OFDNQWIFNXBECV-UHFFFAOYSA-N 0.000 description 1
- 101000895909 Elizabethkingia meningoseptica Endo-beta-N-acetylglucosaminidase F1 Proteins 0.000 description 1
- 101000895912 Elizabethkingia meningoseptica Endo-beta-N-acetylglucosaminidase F2 Proteins 0.000 description 1
- 101000895922 Elizabethkingia meningoseptica Endo-beta-N-acetylglucosaminidase F3 Proteins 0.000 description 1
- 206010066919 Epidemic polyarthritis Diseases 0.000 description 1
- HTIJFSOGRVMCQR-UHFFFAOYSA-N Epirubicin Natural products COc1cccc2C(=O)c3c(O)c4CC(O)(CC(OC5CC(N)C(=O)C(C)O5)c4c(O)c3C(=O)c12)C(=O)CO HTIJFSOGRVMCQR-UHFFFAOYSA-N 0.000 description 1
- 102000003951 Erythropoietin Human genes 0.000 description 1
- 108090000394 Erythropoietin Proteins 0.000 description 1
- 101001039702 Escherichia coli (strain K12) Methyl-accepting chemotaxis protein I Proteins 0.000 description 1
- 229930189413 Esperamicin Natural products 0.000 description 1
- 108010008165 Etanercept Proteins 0.000 description 1
- 108700024394 Exon Proteins 0.000 description 1
- 108010021472 Fc gamma receptor IIB Proteins 0.000 description 1
- 206010016654 Fibrosis Diseases 0.000 description 1
- 229920001917 Ficoll Polymers 0.000 description 1
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 1
- 102100020997 Fractalkine Human genes 0.000 description 1
- 208000003098 Ganglion Cysts Diseases 0.000 description 1
- JRZJKWGQFNTSRN-UHFFFAOYSA-N Geldanamycin Natural products C1C(C)CC(OC)C(O)C(C)C=C(C)C(OC(N)=O)C(OC)CCC=C(C)C(=O)NC2=CC(=O)C(OC)=C1C2=O JRZJKWGQFNTSRN-UHFFFAOYSA-N 0.000 description 1
- SXRSQZLOMIGNAQ-UHFFFAOYSA-N Glutaraldehyde Chemical compound O=CCCCC=O SXRSQZLOMIGNAQ-UHFFFAOYSA-N 0.000 description 1
- JZNWSCPGTDBMEW-UHFFFAOYSA-N Glycerophosphorylethanolamin Natural products NCCOP(O)(=O)OCC(O)CO JZNWSCPGTDBMEW-UHFFFAOYSA-N 0.000 description 1
- 244000068988 Glycine max Species 0.000 description 1
- 235000010469 Glycine max Nutrition 0.000 description 1
- 102000051366 Glycosyltransferases Human genes 0.000 description 1
- 108700023372 Glycosyltransferases Proteins 0.000 description 1
- 102100034221 Growth-regulated alpha protein Human genes 0.000 description 1
- 239000007995 HEPES buffer Substances 0.000 description 1
- 101710113864 Heat shock protein 90 Proteins 0.000 description 1
- 102100034051 Heat shock protein HSP 90-alpha Human genes 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 101000797762 Homo sapiens C-C motif chemokine 5 Proteins 0.000 description 1
- 101000922405 Homo sapiens C-X-C chemokine receptor type 5 Proteins 0.000 description 1
- 101100497623 Homo sapiens CXCR4 gene Proteins 0.000 description 1
- 101000924389 Homo sapiens Cytosol aminopeptidase Proteins 0.000 description 1
- 101000854520 Homo sapiens Fractalkine Proteins 0.000 description 1
- 101001069921 Homo sapiens Growth-regulated alpha protein Proteins 0.000 description 1
- 101001016865 Homo sapiens Heat shock protein HSP 90-alpha Proteins 0.000 description 1
- 101001055222 Homo sapiens Interleukin-8 Proteins 0.000 description 1
- 101000804764 Homo sapiens Lymphotactin Proteins 0.000 description 1
- 101000603386 Homo sapiens Neuropeptide Y receptor type 1 Proteins 0.000 description 1
- 101000973997 Homo sapiens Nucleosome assembly protein 1-like 4 Proteins 0.000 description 1
- 101000582950 Homo sapiens Platelet factor 4 Proteins 0.000 description 1
- 101000617130 Homo sapiens Stromal cell-derived factor 1 Proteins 0.000 description 1
- 101000914484 Homo sapiens T-lymphocyte activation antigen CD80 Proteins 0.000 description 1
- 102000026633 IL6 Human genes 0.000 description 1
- 102100026120 IgG receptor FcRn large subunit p51 Human genes 0.000 description 1
- 101710177940 IgG receptor FcRn large subunit p51 Proteins 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- 238000012695 Interfacial polymerization Methods 0.000 description 1
- 102000006992 Interferon-alpha Human genes 0.000 description 1
- 108010047761 Interferon-alpha Proteins 0.000 description 1
- 102000003996 Interferon-beta Human genes 0.000 description 1
- 108090000467 Interferon-beta Proteins 0.000 description 1
- 102000008070 Interferon-gamma Human genes 0.000 description 1
- 108010074328 Interferon-gamma Proteins 0.000 description 1
- 102000014150 Interferons Human genes 0.000 description 1
- 108010050904 Interferons Proteins 0.000 description 1
- 108010002352 Interleukin-1 Proteins 0.000 description 1
- 108010002350 Interleukin-2 Proteins 0.000 description 1
- 102000000588 Interleukin-2 Human genes 0.000 description 1
- 108010002386 Interleukin-3 Proteins 0.000 description 1
- 102000000646 Interleukin-3 Human genes 0.000 description 1
- 102100026236 Interleukin-8 Human genes 0.000 description 1
- 241000235649 Kluyveromyces Species 0.000 description 1
- 241000110847 Kochia Species 0.000 description 1
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 1
- LRQKBLKVPFOOQJ-YFKPBYRVSA-N L-norleucine Chemical compound CCCC[C@H]([NH3+])C([O-])=O LRQKBLKVPFOOQJ-YFKPBYRVSA-N 0.000 description 1
- 125000002068 L-phenylalanino group Chemical group [H]OC(=O)[C@@]([H])(N([H])[*])C([H])([H])C1=C([H])C([H])=C([H])C([H])=C1[H] 0.000 description 1
- 125000000510 L-tryptophano group Chemical group [H]C1=C([H])C([H])=C2N([H])C([H])=C(C([H])([H])[C@@]([H])(C(O[H])=O)N([H])[*])C2=C1[H] 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- NNJVILVZKWQKPM-UHFFFAOYSA-N Lidocaine Chemical compound CCN(CC)CC(=O)NC1=C(C)C=CC=C1C NNJVILVZKWQKPM-UHFFFAOYSA-N 0.000 description 1
- 102100029205 Low affinity immunoglobulin gamma Fc region receptor II-b Human genes 0.000 description 1
- 102000009571 Macrophage Inflammatory Proteins Human genes 0.000 description 1
- 108010009474 Macrophage Inflammatory Proteins Proteins 0.000 description 1
- 101710125418 Major capsid protein Proteins 0.000 description 1
- 101710156564 Major tail protein Gp23 Proteins 0.000 description 1
- 102000018697 Membrane Proteins Human genes 0.000 description 1
- 108010052285 Membrane Proteins Proteins 0.000 description 1
- 102000029749 Microtubule Human genes 0.000 description 1
- 108091022875 Microtubule Proteins 0.000 description 1
- 229930192392 Mitomycin Natural products 0.000 description 1
- 208000003445 Mouth Neoplasms Diseases 0.000 description 1
- 241000699660 Mus musculus Species 0.000 description 1
- NWIBSHFKIJFRCO-WUDYKRTCSA-N Mytomycin Chemical compound C1N2C(C(C(C)=C(N)C3=O)=O)=C3[C@@H](COC(N)=O)[C@@]2(OC)[C@@H]2[C@H]1N2 NWIBSHFKIJFRCO-WUDYKRTCSA-N 0.000 description 1
- OVRNDRQMDRJTHS-CBQIKETKSA-N N-Acetyl-D-Galactosamine Chemical compound CC(=O)N[C@H]1[C@@H](O)O[C@H](CO)[C@H](O)[C@@H]1O OVRNDRQMDRJTHS-CBQIKETKSA-N 0.000 description 1
- NQTADLQHYWFPDB-UHFFFAOYSA-N N-Hydroxysuccinimide Chemical compound ON1C(=O)CCC1=O NQTADLQHYWFPDB-UHFFFAOYSA-N 0.000 description 1
- WNYADZVDBIBLJJ-UHFFFAOYSA-N N-Nitrosopyrrolidine Chemical compound O=NN1CCCC1 WNYADZVDBIBLJJ-UHFFFAOYSA-N 0.000 description 1
- OVRNDRQMDRJTHS-UHFFFAOYSA-N N-acelyl-D-glucosamine Natural products CC(=O)NC1C(O)OC(CO)C(O)C1O OVRNDRQMDRJTHS-UHFFFAOYSA-N 0.000 description 1
- MBLBDJOUHNCFQT-UHFFFAOYSA-N N-acetyl-D-galactosamine Natural products CC(=O)NC(C=O)C(O)C(O)C(O)CO MBLBDJOUHNCFQT-UHFFFAOYSA-N 0.000 description 1
- OVRNDRQMDRJTHS-RTRLPJTCSA-N N-acetyl-D-glucosamine Chemical compound CC(=O)N[C@H]1C(O)O[C@H](CO)[C@@H](O)[C@@H]1O OVRNDRQMDRJTHS-RTRLPJTCSA-N 0.000 description 1
- MBLBDJOUHNCFQT-LXGUWJNJSA-N N-acetylglucosamine Natural products CC(=O)N[C@@H](C=O)[C@@H](O)[C@H](O)[C@H](O)CO MBLBDJOUHNCFQT-LXGUWJNJSA-N 0.000 description 1
- 108700019961 Neoplasm Genes Proteins 0.000 description 1
- 102000048850 Neoplasm Genes Human genes 0.000 description 1
- 244000061176 Nicotiana tabacum Species 0.000 description 1
- 235000002637 Nicotiana tabacum Nutrition 0.000 description 1
- 101710163270 Nuclease Proteins 0.000 description 1
- 108020004711 Nucleic Acid Probes Proteins 0.000 description 1
- 239000004677 Nylon Substances 0.000 description 1
- 108020005187 Oligonucleotide Probes Proteins 0.000 description 1
- 108010038807 Oligopeptides Proteins 0.000 description 1
- 102000015636 Oligopeptides Human genes 0.000 description 1
- 108700026244 Open Reading Frames Proteins 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 108090000526 Papain Proteins 0.000 description 1
- 102000007079 Peptide Fragments Human genes 0.000 description 1
- 108010033276 Peptide Fragments Proteins 0.000 description 1
- 102100038551 Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase Human genes 0.000 description 1
- 102000000447 Peptide-N4-(N-acetyl-beta-glucosaminyl) Asparagine Amidase Human genes 0.000 description 1
- 108010055817 Peptide-N4-(N-acetyl-beta-glucosaminyl) Asparagine Amidase Proteins 0.000 description 1
- 206010057249 Phagocytosis Diseases 0.000 description 1
- ABLZXFCXXLZCGV-UHFFFAOYSA-N Phosphorous acid Chemical group OP(O)=O ABLZXFCXXLZCGV-UHFFFAOYSA-N 0.000 description 1
- 101100413173 Phytolacca americana PAP2 gene Proteins 0.000 description 1
- 108090000778 Platelet factor 4 Proteins 0.000 description 1
- 241000276498 Pollachius virens Species 0.000 description 1
- 239000004743 Polypropylene Substances 0.000 description 1
- 229920001214 Polysorbate 60 Polymers 0.000 description 1
- 239000004793 Polystyrene Substances 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 101000762949 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) Exotoxin A Proteins 0.000 description 1
- LOUPRKONTZGTKE-WZBLMQSHSA-N Quinine Chemical compound C([C@H]([C@H](C1)C=C)C2)C[N@@]1[C@@H]2[C@H](O)C1=CC=NC2=CC=C(OC)C=C21 LOUPRKONTZGTKE-WZBLMQSHSA-N 0.000 description 1
- 108091008103 RNA aptamers Proteins 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 108091028664 Ribonucleotide Proteins 0.000 description 1
- PYMYPHUHKUWMLA-LMVFSUKVSA-N Ribose Natural products OC[C@@H](O)[C@@H](O)[C@@H](O)C=O PYMYPHUHKUWMLA-LMVFSUKVSA-N 0.000 description 1
- 241000710942 Ross River virus Species 0.000 description 1
- 241000235070 Saccharomyces Species 0.000 description 1
- 235000019485 Safflower oil Nutrition 0.000 description 1
- 241000219287 Saponaria Species 0.000 description 1
- 241000235346 Schizosaccharomyces Species 0.000 description 1
- 241000710960 Sindbis virus Species 0.000 description 1
- 108020004682 Single-Stranded DNA Proteins 0.000 description 1
- 235000021355 Stearic acid Nutrition 0.000 description 1
- 108010090804 Streptavidin Proteins 0.000 description 1
- 241000187747 Streptomyces Species 0.000 description 1
- 108091027544 Subgenomic mRNA Proteins 0.000 description 1
- 241000282887 Suidae Species 0.000 description 1
- 208000005400 Synovial Cyst Diseases 0.000 description 1
- 108091008874 T cell receptors Proteins 0.000 description 1
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 1
- 208000000389 T-cell leukemia Diseases 0.000 description 1
- 208000028530 T-cell lymphoblastic leukemia/lymphoma Diseases 0.000 description 1
- 102100027222 T-lymphocyte activation antigen CD80 Human genes 0.000 description 1
- QJJXYPPXXYFBGM-LFZNUXCKSA-N Tacrolimus Chemical compound C1C[C@@H](O)[C@H](OC)C[C@@H]1\C=C(/C)[C@@H]1[C@H](C)[C@@H](O)CC(=O)[C@H](CC=C)/C=C(C)/C[C@H](C)C[C@H](OC)[C@H]([C@H](C[C@H]2C)OC)O[C@@]2(O)C(=O)C(=O)N2CCCC[C@H]2C(=O)O1 QJJXYPPXXYFBGM-LFZNUXCKSA-N 0.000 description 1
- 239000004098 Tetracycline Substances 0.000 description 1
- WDLRUFUQRNWCPK-UHFFFAOYSA-N Tetraxetan Chemical compound OC(=O)CN1CCN(CC(O)=O)CCN(CC(O)=O)CCN(CC(O)=O)CC1 WDLRUFUQRNWCPK-UHFFFAOYSA-N 0.000 description 1
- GNVMUORYQLCPJZ-UHFFFAOYSA-M Thiocarbamate Chemical compound NC([S-])=O GNVMUORYQLCPJZ-UHFFFAOYSA-M 0.000 description 1
- 102000036693 Thrombopoietin Human genes 0.000 description 1
- 108010041111 Thrombopoietin Proteins 0.000 description 1
- 101710162629 Trypsin inhibitor Proteins 0.000 description 1
- 229940122618 Trypsin inhibitor Drugs 0.000 description 1
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 1
- 208000002495 Uterine Neoplasms Diseases 0.000 description 1
- 101150117115 V gene Proteins 0.000 description 1
- 241000700618 Vaccinia virus Species 0.000 description 1
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 description 1
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 description 1
- 241000710959 Venezuelan equine encephalitis virus Species 0.000 description 1
- 240000001866 Vernicia fordii Species 0.000 description 1
- JXLYSJRDGCGARV-WWYNWVTFSA-N Vinblastine Natural products O=C(O[C@H]1[C@](O)(C(=O)OC)[C@@H]2N(C)c3c(cc(c(OC)c3)[C@]3(C(=O)OC)c4[nH]c5c(c4CCN4C[C@](O)(CC)C[C@H](C3)C4)cccc5)[C@@]32[C@H]2[C@@]1(CC)C=CCN2CC3)C JXLYSJRDGCGARV-WWYNWVTFSA-N 0.000 description 1
- 230000002159 abnormal effect Effects 0.000 description 1
- 239000003070 absorption delaying agent Substances 0.000 description 1
- 230000035508 accumulation Effects 0.000 description 1
- 238000009825 accumulation Methods 0.000 description 1
- DHKHKXVYLBGOIT-UHFFFAOYSA-N acetaldehyde Diethyl Acetal Natural products CCOC(C)OCC DHKHKXVYLBGOIT-UHFFFAOYSA-N 0.000 description 1
- 150000001241 acetals Chemical class 0.000 description 1
- QTBSBXVTEAMEQO-UHFFFAOYSA-N acetic acid Substances CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 1
- 229940081735 acetylcellulose Drugs 0.000 description 1
- 238000005917 acylation reaction Methods 0.000 description 1
- 229940009456 adriamycin Drugs 0.000 description 1
- 239000003463 adsorbent Substances 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 230000006838 adverse reaction Effects 0.000 description 1
- 239000000443 aerosol Substances 0.000 description 1
- 239000000556 agonist Substances 0.000 description 1
- 238000012867 alanine scanning Methods 0.000 description 1
- 125000003342 alkenyl group Chemical group 0.000 description 1
- 229940100198 alkylating agent Drugs 0.000 description 1
- 239000002168 alkylating agent Substances 0.000 description 1
- 230000029936 alkylation Effects 0.000 description 1
- 239000008168 almond oil Substances 0.000 description 1
- HMFHBZSHGGEWLO-UHFFFAOYSA-N alpha-D-Furanose-Ribose Natural products OCC1OC(O)C(O)C1O HMFHBZSHGGEWLO-UHFFFAOYSA-N 0.000 description 1
- WQZGKKKJIJFFOK-PHYPRBDBSA-N alpha-D-galactose Chemical compound OC[C@H]1O[C@H](O)[C@H](O)[C@@H](O)[C@H]1O WQZGKKKJIJFFOK-PHYPRBDBSA-N 0.000 description 1
- 229940059260 amidate Drugs 0.000 description 1
- 150000003862 amino acid derivatives Chemical class 0.000 description 1
- 238000012870 ammonium sulfate precipitation Methods 0.000 description 1
- 235000019418 amylase Nutrition 0.000 description 1
- 230000003444 anaesthetic effect Effects 0.000 description 1
- 230000033115 angiogenesis Effects 0.000 description 1
- 239000004037 angiogenesis inhibitor Substances 0.000 description 1
- 229940121369 angiogenesis inhibitor Drugs 0.000 description 1
- 150000008064 anhydrides Chemical class 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 230000000844 anti-bacterial effect Effects 0.000 description 1
- 230000005911 anti-cytotoxic effect Effects 0.000 description 1
- 230000000843 anti-fungal effect Effects 0.000 description 1
- 230000001064 anti-interferon Effects 0.000 description 1
- 230000000692 anti-sense effect Effects 0.000 description 1
- 229940125644 antibody drug Drugs 0.000 description 1
- 230000005888 antibody-dependent cellular phagocytosis Effects 0.000 description 1
- 230000009227 antibody-mediated cytotoxicity Effects 0.000 description 1
- 229940121375 antifungal agent Drugs 0.000 description 1
- 239000003429 antifungal agent Substances 0.000 description 1
- 230000000890 antigenic effect Effects 0.000 description 1
- 229940041181 antineoplastic drug Drugs 0.000 description 1
- 239000000074 antisense oligonucleotide Substances 0.000 description 1
- 238000012230 antisense oligonucleotides Methods 0.000 description 1
- 239000012062 aqueous buffer Substances 0.000 description 1
- 239000003125 aqueous solvent Substances 0.000 description 1
- PYMYPHUHKUWMLA-WDCZJNDASA-N arabinose Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)C=O PYMYPHUHKUWMLA-WDCZJNDASA-N 0.000 description 1
- 125000000613 asparagine group Chemical group N[C@@H](CC(N)=O)C(=O)* 0.000 description 1
- 229960002170 azathioprine Drugs 0.000 description 1
- LMEKQMALGUDUQG-UHFFFAOYSA-N azathioprine Chemical compound CN1C=NC([N+]([O-])=O)=C1SC1=NC=NC2=C1NC=N2 LMEKQMALGUDUQG-UHFFFAOYSA-N 0.000 description 1
- WZSDNEJJUSYNSG-UHFFFAOYSA-N azocan-1-yl-(3,4,5-trimethoxyphenyl)methanone Chemical compound COC1=C(OC)C(OC)=CC(C(=O)N2CCCCCCC2)=C1 WZSDNEJJUSYNSG-UHFFFAOYSA-N 0.000 description 1
- 208000013404 behavioral symptom Diseases 0.000 description 1
- UREZNYTWGJKWBI-UHFFFAOYSA-M benzethonium chloride Chemical compound [Cl-].C1=CC(C(C)(C)CC(C)(C)C)=CC=C1OCCOCC[N+](C)(C)CC1=CC=CC=C1 UREZNYTWGJKWBI-UHFFFAOYSA-M 0.000 description 1
- 229960001950 benzethonium chloride Drugs 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 238000011953 bioanalysis Methods 0.000 description 1
- 230000003115 biocidal effect Effects 0.000 description 1
- 230000031018 biological processes and functions Effects 0.000 description 1
- 239000012472 biological sample Substances 0.000 description 1
- 238000005415 bioluminescence Methods 0.000 description 1
- 230000029918 bioluminescence Effects 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- 210000004204 blood vessel Anatomy 0.000 description 1
- 210000001124 body fluid Anatomy 0.000 description 1
- 239000010839 body fluid Substances 0.000 description 1
- 238000006664 bond formation reaction Methods 0.000 description 1
- 229910052796 boron Inorganic materials 0.000 description 1
- 229940098773 bovine serum albumin Drugs 0.000 description 1
- 210000004556 brain Anatomy 0.000 description 1
- DQXBYHZEEUGOBF-UHFFFAOYSA-N but-3-enoic acid;ethene Chemical compound C=C.OC(=O)CC=C DQXBYHZEEUGOBF-UHFFFAOYSA-N 0.000 description 1
- 239000001110 calcium chloride Substances 0.000 description 1
- 229910001628 calcium chloride Inorganic materials 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- HXCHCVDVKSCDHU-LULTVBGHSA-N calicheamicin Chemical compound C1[C@H](OC)[C@@H](NCC)CO[C@H]1O[C@H]1[C@H](O[C@@H]2C\3=C(NC(=O)OC)C(=O)C[C@](C/3=C/CSSSC)(O)C#C\C=C/C#C2)O[C@H](C)[C@@H](NO[C@@H]2O[C@H](C)[C@@H](SC(=O)C=3C(=C(OC)C(O[C@H]4[C@@H]([C@H](OC)[C@@H](O)[C@H](C)O4)O)=C(I)C=3C)OC)[C@@H](O)C2)[C@@H]1O HXCHCVDVKSCDHU-LULTVBGHSA-N 0.000 description 1
- 229930195731 calicheamicin Natural products 0.000 description 1
- 230000036952 cancer formation Effects 0.000 description 1
- 230000009400 cancer invasion Effects 0.000 description 1
- 150000004657 carbamic acid derivatives Chemical class 0.000 description 1
- 125000002837 carbocyclic group Chemical group 0.000 description 1
- 125000004432 carbon atom Chemical group C* 0.000 description 1
- 231100000504 carcinogenesis Toxicity 0.000 description 1
- 125000002091 cationic group Chemical group 0.000 description 1
- 238000010370 cell cloning Methods 0.000 description 1
- 230000032823 cell division Effects 0.000 description 1
- 230000007910 cell fusion Effects 0.000 description 1
- 230000022534 cell killing Effects 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 230000004663 cell proliferation Effects 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 235000010980 cellulose Nutrition 0.000 description 1
- 229920002301 cellulose acetate Polymers 0.000 description 1
- 210000003679 cervix uteri Anatomy 0.000 description 1
- 229960000541 cetyl alcohol Drugs 0.000 description 1
- 230000009920 chelation Effects 0.000 description 1
- 238000007385 chemical modification Methods 0.000 description 1
- 235000012000 cholesterol Nutrition 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 239000013611 chromosomal DNA Substances 0.000 description 1
- 230000001684 chronic effect Effects 0.000 description 1
- 229960001265 ciclosporin Drugs 0.000 description 1
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 1
- 229960004316 cisplatin Drugs 0.000 description 1
- 239000013599 cloning vector Substances 0.000 description 1
- 230000004186 co-expression Effects 0.000 description 1
- 238000005354 coacervation Methods 0.000 description 1
- 230000001149 cognitive effect Effects 0.000 description 1
- 230000001427 coherent effect Effects 0.000 description 1
- LGZKGOGODCLQHG-UHFFFAOYSA-N combretastatin Natural products C1=C(O)C(OC)=CC=C1CC(O)C1=CC(OC)=C(OC)C(OC)=C1 LGZKGOGODCLQHG-UHFFFAOYSA-N 0.000 description 1
- 239000012141 concentrate Substances 0.000 description 1
- 238000012790 confirmation Methods 0.000 description 1
- 230000001268 conjugating effect Effects 0.000 description 1
- 230000001276 controlling effect Effects 0.000 description 1
- 235000005687 corn oil Nutrition 0.000 description 1
- 239000002285 corn oil Substances 0.000 description 1
- 239000008120 corn starch Substances 0.000 description 1
- 210000004351 coronary vessel Anatomy 0.000 description 1
- 235000012343 cottonseed oil Nutrition 0.000 description 1
- 239000002385 cottonseed oil Substances 0.000 description 1
- 125000004122 cyclic group Chemical group 0.000 description 1
- 125000000392 cycloalkenyl group Chemical group 0.000 description 1
- 125000000753 cycloalkyl group Chemical group 0.000 description 1
- 229960004397 cyclophosphamide Drugs 0.000 description 1
- 201000000255 cycloplegia Diseases 0.000 description 1
- 229930182912 cyclosporin Natural products 0.000 description 1
- 239000000824 cytostatic agent Substances 0.000 description 1
- 230000001085 cytostatic effect Effects 0.000 description 1
- 229960000975 daunorubicin Drugs 0.000 description 1
- STQGQHZAVUOBTE-VGBVRHCVSA-N daunorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 STQGQHZAVUOBTE-VGBVRHCVSA-N 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 230000002939 deleterious effect Effects 0.000 description 1
- 229960000633 dextran sulfate Drugs 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 239000000032 diagnostic agent Substances 0.000 description 1
- 229940039227 diagnostic agent Drugs 0.000 description 1
- 238000002405 diagnostic procedure Methods 0.000 description 1
- 238000000502 dialysis Methods 0.000 description 1
- 229930191339 dianthin Natural products 0.000 description 1
- 239000000539 dimer Substances 0.000 description 1
- NAGJZTKCGNOGPW-UHFFFAOYSA-K dioxido-sulfanylidene-sulfido-$l^{5}-phosphane Chemical compound [O-]P([O-])([S-])=S NAGJZTKCGNOGPW-UHFFFAOYSA-K 0.000 description 1
- 239000002612 dispersion medium Substances 0.000 description 1
- 238000006073 displacement reaction Methods 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- 125000002228 disulfide group Chemical group 0.000 description 1
- 150000002019 disulfides Chemical class 0.000 description 1
- 108010045524 dolastatin 10 Proteins 0.000 description 1
- OFDNQWIFNXBECV-VFSYNPLYSA-N dolastatin 10 Chemical compound CC(C)[C@H](N(C)C)C(=O)N[C@@H](C(C)C)C(=O)N(C)[C@@H]([C@@H](C)CC)[C@H](OC)CC(=O)N1CCC[C@H]1[C@H](OC)[C@@H](C)C(=O)N[C@H](C=1SC=CN=1)CC1=CC=CC=C1 OFDNQWIFNXBECV-VFSYNPLYSA-N 0.000 description 1
- 231100000673 dose–response relationship Toxicity 0.000 description 1
- 210000001198 duodenum Anatomy 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 230000013020 embryo development Effects 0.000 description 1
- 239000008393 encapsulating agent Substances 0.000 description 1
- 230000003511 endothelial effect Effects 0.000 description 1
- 239000002158 endotoxin Substances 0.000 description 1
- 238000009505 enteric coating Methods 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- SEACYXSIPDVVMV-UHFFFAOYSA-L eosin Y Chemical compound [Na+].[Na+].[O-]C(=O)C1=CC=CC=C1C1=C2C=C(Br)C(=O)C(Br)=C2OC2=C(Br)C([O-])=C(Br)C=C21 SEACYXSIPDVVMV-UHFFFAOYSA-L 0.000 description 1
- 229960001904 epirubicin Drugs 0.000 description 1
- 229940105423 erythropoietin Drugs 0.000 description 1
- LJQQFQHBKUKHIS-WJHRIEJJSA-N esperamicin Chemical compound O1CC(NC(C)C)C(OC)CC1OC1C(O)C(NOC2OC(C)C(SC)C(O)C2)C(C)OC1OC1C(\C2=C/CSSSC)=C(NC(=O)OC)C(=O)C(OC3OC(C)C(O)C(OC(=O)C=4C(=CC(OC)=C(OC)C=4)NC(=O)C(=C)OC)C3)C2(O)C#C\C=C/C#C1 LJQQFQHBKUKHIS-WJHRIEJJSA-N 0.000 description 1
- 229960000403 etanercept Drugs 0.000 description 1
- 239000005038 ethylene vinyl acetate Substances 0.000 description 1
- NPUKDXXFDDZOKR-LLVKDONJSA-N etomidate Chemical compound CCOC(=O)C1=CN=CN1[C@H](C)C1=CC=CC=C1 NPUKDXXFDDZOKR-LLVKDONJSA-N 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 238000001704 evaporation Methods 0.000 description 1
- 230000007717 exclusion Effects 0.000 description 1
- 230000029142 excretion Effects 0.000 description 1
- 230000001747 exhibiting effect Effects 0.000 description 1
- 238000010195 expression analysis Methods 0.000 description 1
- 230000004761 fibrosis Effects 0.000 description 1
- 230000003176 fibrotic effect Effects 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 239000007850 fluorescent dye Substances 0.000 description 1
- NBVXSUQYWXRMNV-UHFFFAOYSA-N fluoromethane Chemical compound FC NBVXSUQYWXRMNV-UHFFFAOYSA-N 0.000 description 1
- 229960002949 fluorouracil Drugs 0.000 description 1
- 230000005714 functional activity Effects 0.000 description 1
- 229930182830 galactose Natural products 0.000 description 1
- 239000007903 gelatin capsule Substances 0.000 description 1
- QTQAWLPCGQOSGP-GBTDJJJQSA-N geldanamycin Chemical compound N1C(=O)\C(C)=C/C=C\[C@@H](OC)[C@H](OC(N)=O)\C(C)=C/[C@@H](C)[C@@H](O)[C@H](OC)C[C@@H](C)CC2=C(OC)C(=O)C=C1C2=O QTQAWLPCGQOSGP-GBTDJJJQSA-N 0.000 description 1
- 230000030279 gene silencing Effects 0.000 description 1
- 238000007429 general method Methods 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 239000003862 glucocorticoid Substances 0.000 description 1
- 125000000404 glutamine group Chemical group N[C@@H](CCC(N)=O)C(=O)* 0.000 description 1
- 150000002309 glutamines Chemical class 0.000 description 1
- 150000004676 glycans Chemical class 0.000 description 1
- 239000008187 granular material Substances 0.000 description 1
- 230000035876 healing Effects 0.000 description 1
- 210000002837 heart atrium Anatomy 0.000 description 1
- 102000034345 heterotrimeric G proteins Human genes 0.000 description 1
- 108091006093 heterotrimeric G proteins Proteins 0.000 description 1
- 230000013632 homeostatic process Effects 0.000 description 1
- 239000008240 homogeneous mixture Substances 0.000 description 1
- 238000001794 hormone therapy Methods 0.000 description 1
- 229940096329 human immunoglobulin a Drugs 0.000 description 1
- 150000002429 hydrazines Chemical class 0.000 description 1
- 150000007857 hydrazones Chemical class 0.000 description 1
- 239000000017 hydrogel Substances 0.000 description 1
- 229920001600 hydrophobic polymer Polymers 0.000 description 1
- 125000002349 hydroxyamino group Chemical group [H]ON([H])[*] 0.000 description 1
- 229920003063 hydroxymethyl cellulose Polymers 0.000 description 1
- 229940031574 hydroxymethyl cellulose Drugs 0.000 description 1
- 150000002466 imines Chemical group 0.000 description 1
- 230000008004 immune attack Effects 0.000 description 1
- 239000012642 immune effector Substances 0.000 description 1
- 230000008105 immune reaction Effects 0.000 description 1
- 230000008073 immune recognition Effects 0.000 description 1
- 230000036039 immunity Effects 0.000 description 1
- 230000000984 immunochemical effect Effects 0.000 description 1
- 238000001114 immunoprecipitation Methods 0.000 description 1
- 229960003444 immunosuppressant agent Drugs 0.000 description 1
- 230000001861 immunosuppressant effect Effects 0.000 description 1
- 239000003018 immunosuppressive agent Substances 0.000 description 1
- 238000009169 immunotherapy Methods 0.000 description 1
- 230000002637 immunotoxin Effects 0.000 description 1
- 239000002596 immunotoxin Substances 0.000 description 1
- 229940051026 immunotoxin Drugs 0.000 description 1
- 231100000608 immunotoxin Toxicity 0.000 description 1
- 230000001771 impaired effect Effects 0.000 description 1
- 239000007943 implant Substances 0.000 description 1
- 238000011503 in vivo imaging Methods 0.000 description 1
- 229910052738 indium Inorganic materials 0.000 description 1
- 239000012678 infectious agent Substances 0.000 description 1
- 230000010354 integration Effects 0.000 description 1
- 102000006495 integrins Human genes 0.000 description 1
- 108010044426 integrins Proteins 0.000 description 1
- 239000000138 intercalating agent Substances 0.000 description 1
- 229940047124 interferons Drugs 0.000 description 1
- 229940096397 interleukin-8 Drugs 0.000 description 1
- XKTZWUACRZHVAN-VADRZIEHSA-N interleukin-8 Chemical compound C([C@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@@H](NC(C)=O)CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CCSC)C(=O)N1[C@H](CCC1)C(=O)N1[C@H](CCC1)C(=O)N[C@@H](C)C(=O)N[C@H](CC(O)=O)C(=O)N[C@H](CCC(O)=O)C(=O)N[C@H](CC(O)=O)C(=O)N[C@H](CC=1C=CC(O)=CC=1)C(=O)N[C@H](CO)C(=O)N1[C@H](CCC1)C(N)=O)C1=CC=CC=C1 XKTZWUACRZHVAN-VADRZIEHSA-N 0.000 description 1
- 230000003834 intracellular effect Effects 0.000 description 1
- 238000007917 intracranial administration Methods 0.000 description 1
- 230000008863 intramolecular interaction Effects 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 238000007913 intrathecal administration Methods 0.000 description 1
- 230000009545 invasion Effects 0.000 description 1
- 229960004768 irinotecan Drugs 0.000 description 1
- UWKQSNNFCGGAFS-XIFFEERXSA-N irinotecan Chemical compound C1=C2C(CC)=C3CN(C(C4=C([C@@](C(=O)OC4)(O)CC)C=4)=O)C=4C3=NC2=CC=C1OC(=O)N(CC1)CCC1N1CCCCC1 UWKQSNNFCGGAFS-XIFFEERXSA-N 0.000 description 1
- SZVJSHCCFOBDDC-UHFFFAOYSA-N iron(II,III) oxide Inorganic materials O=[Fe]O[Fe]O[Fe]=O SZVJSHCCFOBDDC-UHFFFAOYSA-N 0.000 description 1
- 239000007951 isotonicity adjuster Substances 0.000 description 1
- 238000005304 joining Methods 0.000 description 1
- 108010045069 keyhole-limpet hemocyanin Proteins 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 230000002147 killing effect Effects 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 229910052747 lanthanoid Inorganic materials 0.000 description 1
- 150000002602 lanthanoids Chemical class 0.000 description 1
- 229940046892 lead acetate Drugs 0.000 description 1
- RGLRXNKKBLIBQS-XNHQSDQCSA-N leuprolide acetate Chemical compound CC(O)=O.CCNC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H]1NC(=O)CC1)CC1=CC=C(O)C=C1 RGLRXNKKBLIBQS-XNHQSDQCSA-N 0.000 description 1
- 229960004194 lidocaine Drugs 0.000 description 1
- 208000012987 lip and oral cavity carcinoma Diseases 0.000 description 1
- 239000002960 lipid emulsion Substances 0.000 description 1
- 230000029226 lipidation Effects 0.000 description 1
- 238000001638 lipofection Methods 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 210000002751 lymph Anatomy 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 108010019677 lymphotactin Proteins 0.000 description 1
- 239000012931 lyophilized formulation Substances 0.000 description 1
- 229920002521 macromolecule Polymers 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 238000012423 maintenance Methods 0.000 description 1
- 125000005439 maleimidyl group Chemical group C1(C=CC(N1*)=O)=O 0.000 description 1
- 230000013011 mating Effects 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- 201000001441 melanoma Diseases 0.000 description 1
- 230000001394 metastastic effect Effects 0.000 description 1
- 206010061289 metastatic neoplasm Diseases 0.000 description 1
- 229940071648 metered dose inhaler Drugs 0.000 description 1
- 125000001360 methionine group Chemical group N[C@@H](CCSC)C(=O)* 0.000 description 1
- 229960000485 methotrexate Drugs 0.000 description 1
- DFTAZNAEBRBBKP-UHFFFAOYSA-N methyl 4-sulfanylbutanimidate Chemical compound COC(=N)CCCS DFTAZNAEBRBBKP-UHFFFAOYSA-N 0.000 description 1
- YACKEPLHDIMKIO-UHFFFAOYSA-N methylphosphonic acid Chemical compound CP(O)(O)=O YACKEPLHDIMKIO-UHFFFAOYSA-N 0.000 description 1
- HPNSFSBZBAHARI-UHFFFAOYSA-N micophenolic acid Natural products OC1=C(CC=C(C)CCC(O)=O)C(OC)=C(C)C2=C1C(=O)OC2 HPNSFSBZBAHARI-UHFFFAOYSA-N 0.000 description 1
- 239000004530 micro-emulsion Substances 0.000 description 1
- 210000000274 microglia Anatomy 0.000 description 1
- 210000004688 microtubule Anatomy 0.000 description 1
- 230000005012 migration Effects 0.000 description 1
- 238000013508 migration Methods 0.000 description 1
- 229960004857 mitomycin Drugs 0.000 description 1
- 230000011278 mitosis Effects 0.000 description 1
- 230000000394 mitotic effect Effects 0.000 description 1
- KKZJGLLVHKMTCM-UHFFFAOYSA-N mitoxantrone Chemical compound O=C1C2=C(O)C=CC(O)=C2C(=O)C2=C1C(NCCNCCO)=CC=C2NCCNCCO KKZJGLLVHKMTCM-UHFFFAOYSA-N 0.000 description 1
- 229960001156 mitoxantrone Drugs 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 108010093470 monomethyl auristatin E Proteins 0.000 description 1
- 108010059074 monomethylauristatin F Proteins 0.000 description 1
- 210000000214 mouth Anatomy 0.000 description 1
- 108091005763 multidomain proteins Proteins 0.000 description 1
- 229940014456 mycophenolate Drugs 0.000 description 1
- HPNSFSBZBAHARI-RUDMXATFSA-N mycophenolic acid Chemical compound OC1=C(C\C=C(/C)CCC(O)=O)C(OC)=C(C)C2=C1C(=O)OC2 HPNSFSBZBAHARI-RUDMXATFSA-N 0.000 description 1
- 210000004165 myocardium Anatomy 0.000 description 1
- 239000002088 nanocapsule Substances 0.000 description 1
- 229930003811 natural phenol Natural products 0.000 description 1
- 229930014626 natural product Natural products 0.000 description 1
- 210000000440 neutrophil Anatomy 0.000 description 1
- 239000002736 nonionic surfactant Substances 0.000 description 1
- 230000009871 nonspecific binding Effects 0.000 description 1
- 239000002853 nucleic acid probe Substances 0.000 description 1
- 239000012038 nucleophile Substances 0.000 description 1
- 230000000269 nucleophilic effect Effects 0.000 description 1
- 239000002777 nucleoside Substances 0.000 description 1
- 150000003833 nucleoside derivatives Chemical class 0.000 description 1
- 229920001778 nylon Polymers 0.000 description 1
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical compound CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 1
- OQCDKBAXFALNLD-UHFFFAOYSA-N octadecanoic acid Natural products CCCCCCCC(C)CCCCCCCCC(O)=O OQCDKBAXFALNLD-UHFFFAOYSA-N 0.000 description 1
- 239000002751 oligonucleotide probe Substances 0.000 description 1
- 238000002515 oligonucleotide synthesis Methods 0.000 description 1
- IXWNTLSTOZFSCM-YVACAVLKSA-N ombrabulin Chemical compound C1=C(NC(=O)[C@@H](N)CO)C(OC)=CC=C1\C=C/C1=CC(OC)=C(OC)C(OC)=C1 IXWNTLSTOZFSCM-YVACAVLKSA-N 0.000 description 1
- 229950003600 ombrabulin Drugs 0.000 description 1
- 238000011275 oncology therapy Methods 0.000 description 1
- 239000003960 organic solvent Substances 0.000 description 1
- 230000003204 osmotic effect Effects 0.000 description 1
- 230000002611 ovarian Effects 0.000 description 1
- 125000005740 oxycarbonyl group Chemical group [*:1]OC([*:2])=O 0.000 description 1
- 238000006213 oxygenation reaction Methods 0.000 description 1
- 239000006179 pH buffering agent Substances 0.000 description 1
- 229940055729 papain Drugs 0.000 description 1
- 235000019834 papain Nutrition 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 239000008188 pellet Substances 0.000 description 1
- 108040002068 peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine amidase activity proteins Proteins 0.000 description 1
- 210000003516 pericardium Anatomy 0.000 description 1
- 102000013415 peroxidase activity proteins Human genes 0.000 description 1
- 108040007629 peroxidase activity proteins Proteins 0.000 description 1
- 230000008782 phagocytosis Effects 0.000 description 1
- 239000008024 pharmaceutical diluent Substances 0.000 description 1
- 239000002831 pharmacologic agent Substances 0.000 description 1
- 239000012071 phase Substances 0.000 description 1
- 229960003742 phenol Drugs 0.000 description 1
- 239000008363 phosphate buffer Substances 0.000 description 1
- 125000002467 phosphate group Chemical group [H]OP(=O)(O[H])O[*] 0.000 description 1
- WTJKGGKOPKCXLL-RRHRGVEJSA-N phosphatidylcholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCCC=CCCCCCCCC WTJKGGKOPKCXLL-RRHRGVEJSA-N 0.000 description 1
- 150000008104 phosphatidylethanolamines Chemical class 0.000 description 1
- 150000004713 phosphodiesters Chemical class 0.000 description 1
- 230000006461 physiological response Effects 0.000 description 1
- 229920001983 poloxamer Polymers 0.000 description 1
- 229920000729 poly(L-lysine) polymer Polymers 0.000 description 1
- 229920001200 poly(ethylene-vinyl acetate) Polymers 0.000 description 1
- 229920000747 poly(lactic acid) Polymers 0.000 description 1
- 229920003229 poly(methyl methacrylate) Polymers 0.000 description 1
- 229920002401 polyacrylamide Polymers 0.000 description 1
- 229920002857 polybutadiene Polymers 0.000 description 1
- 229920000728 polyester Polymers 0.000 description 1
- 229920002338 polyhydroxyethylmethacrylate Polymers 0.000 description 1
- 238000006116 polymerization reaction Methods 0.000 description 1
- 239000004926 polymethyl methacrylate Substances 0.000 description 1
- 229920001155 polypropylene Polymers 0.000 description 1
- 229920001282 polysaccharide Polymers 0.000 description 1
- 239000005017 polysaccharide Substances 0.000 description 1
- 229920002223 polystyrene Polymers 0.000 description 1
- 229920002451 polyvinyl alcohol Polymers 0.000 description 1
- 239000011148 porous material Substances 0.000 description 1
- 230000004481 post-translational protein modification Effects 0.000 description 1
- OXCMYAYHXIHQOA-UHFFFAOYSA-N potassium;[2-butyl-5-chloro-3-[[4-[2-(1,2,4-triaza-3-azanidacyclopenta-1,4-dien-5-yl)phenyl]phenyl]methyl]imidazol-4-yl]methanol Chemical compound [K+].CCCCC1=NC(Cl)=C(CO)N1CC1=CC=C(C=2C(=CC=CC=2)C2=N[N-]N=N2)C=C1 OXCMYAYHXIHQOA-UHFFFAOYSA-N 0.000 description 1
- 229940124606 potential therapeutic agent Drugs 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 244000144977 poultry Species 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- XOFYZVNMUHMLCC-ZPOLXVRWSA-N prednisone Chemical compound O=C1C=C[C@]2(C)[C@H]3C(=O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 XOFYZVNMUHMLCC-ZPOLXVRWSA-N 0.000 description 1
- 229960004618 prednisone Drugs 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 229940002612 prodrug Drugs 0.000 description 1
- 239000000651 prodrug Substances 0.000 description 1
- 229960003387 progesterone Drugs 0.000 description 1
- 239000000186 progesterone Substances 0.000 description 1
- 230000002062 proliferating effect Effects 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 230000000644 propagated effect Effects 0.000 description 1
- 238000011321 prophylaxis Methods 0.000 description 1
- 108020001580 protein domains Proteins 0.000 description 1
- 238000001742 protein purification Methods 0.000 description 1
- 230000017854 proteolysis Effects 0.000 description 1
- 229940024999 proteolytic enzymes for treatment of wounds and ulcers Drugs 0.000 description 1
- 230000005180 public health Effects 0.000 description 1
- WRHZVMBBRYBTKZ-UHFFFAOYSA-N pyrrole-2-carboxylic acid Chemical compound OC(=O)C1=CC=CN1 WRHZVMBBRYBTKZ-UHFFFAOYSA-N 0.000 description 1
- OAWXZFGKDDFTGS-UHFFFAOYSA-N pyrrolidine-1,2-dicarboxylic acid Chemical compound OC(=O)C1CCCN1C(O)=O OAWXZFGKDDFTGS-UHFFFAOYSA-N 0.000 description 1
- 238000011002 quantification Methods 0.000 description 1
- 238000010791 quenching Methods 0.000 description 1
- 230000000171 quenching effect Effects 0.000 description 1
- 229930002341 quinoline alkaloid Natural products 0.000 description 1
- 238000001959 radiotherapy Methods 0.000 description 1
- 230000009257 reactivity Effects 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 230000022532 regulation of transcription, DNA-dependent Effects 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 230000000241 respiratory effect Effects 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- PYWVYCXTNDRMGF-UHFFFAOYSA-N rhodamine B Chemical compound [Cl-].C=12C=CC(=[N+](CC)CC)C=C2OC2=CC(N(CC)CC)=CC=C2C=1C1=CC=CC=C1C(O)=O PYWVYCXTNDRMGF-UHFFFAOYSA-N 0.000 description 1
- 239000002336 ribonucleotide Substances 0.000 description 1
- 125000002652 ribonucleotide group Chemical group 0.000 description 1
- 108020004418 ribosomal RNA Proteins 0.000 description 1
- 238000002702 ribosome display Methods 0.000 description 1
- 108091092562 ribozyme Proteins 0.000 description 1
- ATEBXHFBFRCZMA-VXTBVIBXSA-N rifabutin Chemical compound O([C@](C1=O)(C)O/C=C/[C@@H]([C@H]([C@@H](OC(C)=O)[C@H](C)[C@H](O)[C@H](C)[C@@H](O)[C@@H](C)\C=C\C=C(C)/C(=O)NC(=C2N3)C(=O)C=4C(O)=C5C)C)OC)C5=C1C=4C2=NC13CCN(CC(C)C)CC1 ATEBXHFBFRCZMA-VXTBVIBXSA-N 0.000 description 1
- 229960000885 rifabutin Drugs 0.000 description 1
- 239000012146 running buffer Substances 0.000 description 1
- 235000005713 safflower oil Nutrition 0.000 description 1
- 239000003813 safflower oil Substances 0.000 description 1
- 235000019515 salmon Nutrition 0.000 description 1
- 238000002821 scintillation proximity assay Methods 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 150000003341 sedoheptuloses Chemical class 0.000 description 1
- 238000010187 selection method Methods 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 238000013207 serial dilution Methods 0.000 description 1
- 125000003607 serino group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(O[H])([H])[H] 0.000 description 1
- 239000008159 sesame oil Substances 0.000 description 1
- 235000011803 sesame oil Nutrition 0.000 description 1
- 230000035939 shock Effects 0.000 description 1
- 230000019491 signal transduction Effects 0.000 description 1
- 230000011664 signaling Effects 0.000 description 1
- 238000002741 site-directed mutagenesis Methods 0.000 description 1
- 229940126586 small molecule drug Drugs 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- FQENQNTWSFEDLI-UHFFFAOYSA-J sodium diphosphate Chemical compound [Na+].[Na+].[Na+].[Na+].[O-]P([O-])(=O)OP([O-])([O-])=O FQENQNTWSFEDLI-UHFFFAOYSA-J 0.000 description 1
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 1
- 239000001488 sodium phosphate Substances 0.000 description 1
- 229910000162 sodium phosphate Inorganic materials 0.000 description 1
- 229940048086 sodium pyrophosphate Drugs 0.000 description 1
- 239000007790 solid phase Substances 0.000 description 1
- 238000010532 solid phase synthesis reaction Methods 0.000 description 1
- 210000001082 somatic cell Anatomy 0.000 description 1
- 230000037439 somatic mutation Effects 0.000 description 1
- 229940083466 soybean lecithin Drugs 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 210000001324 spliceosome Anatomy 0.000 description 1
- 230000006641 stabilisation Effects 0.000 description 1
- 238000011105 stabilization Methods 0.000 description 1
- 239000012128 staining reagent Substances 0.000 description 1
- 238000012289 standard assay Methods 0.000 description 1
- 239000007858 starting material Substances 0.000 description 1
- 239000008117 stearic acid Substances 0.000 description 1
- 239000008223 sterile water Substances 0.000 description 1
- 230000004936 stimulating effect Effects 0.000 description 1
- 210000002536 stromal cell Anatomy 0.000 description 1
- 125000001424 substituent group Chemical group 0.000 description 1
- 229940014800 succinic anhydride Drugs 0.000 description 1
- 239000001797 sucrose acetate isobutyrate Substances 0.000 description 1
- 235000010983 sucrose acetate isobutyrate Nutrition 0.000 description 1
- UVGUPMLLGBCFEJ-SWTLDUCYSA-N sucrose acetate isobutyrate Chemical compound CC(C)C(=O)O[C@H]1[C@H](OC(=O)C(C)C)[C@@H](COC(=O)C(C)C)O[C@@]1(COC(C)=O)O[C@@H]1[C@H](OC(=O)C(C)C)[C@@H](OC(=O)C(C)C)[C@H](OC(=O)C(C)C)[C@@H](COC(C)=O)O1 UVGUPMLLGBCFEJ-SWTLDUCYSA-N 0.000 description 1
- 125000000020 sulfo group Chemical group O=S(=O)([*])O[H] 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 239000000829 suppository Substances 0.000 description 1
- 238000001356 surgical procedure Methods 0.000 description 1
- 230000002889 sympathetic effect Effects 0.000 description 1
- 230000001360 synchronised effect Effects 0.000 description 1
- 230000002194 synthesizing effect Effects 0.000 description 1
- 230000009897 systematic effect Effects 0.000 description 1
- 238000007910 systemic administration Methods 0.000 description 1
- QJJXYPPXXYFBGM-SHYZHZOCSA-N tacrolimus Natural products CO[C@H]1C[C@H](CC[C@@H]1O)C=C(C)[C@H]2OC(=O)[C@H]3CCCCN3C(=O)C(=O)[C@@]4(O)O[C@@H]([C@H](C[C@H]4C)OC)[C@@H](C[C@H](C)CC(=C[C@@H](CC=C)C(=O)C[C@H](O)[C@H]2C)C)OC QJJXYPPXXYFBGM-SHYZHZOCSA-N 0.000 description 1
- 229960001967 tacrolimus Drugs 0.000 description 1
- 239000000454 talc Substances 0.000 description 1
- 229910052623 talc Inorganic materials 0.000 description 1
- 235000012222 talc Nutrition 0.000 description 1
- 229960001603 tamoxifen Drugs 0.000 description 1
- AYUNIORJHRXIBJ-TXHRRWQRSA-N tanespimycin Chemical compound N1C(=O)\C(C)=C\C=C/[C@H](OC)[C@@H](OC(N)=O)\C(C)=C\[C@H](C)[C@@H](O)[C@@H](OC)C[C@H](C)CC2=C(NCC=C)C(=O)C=C1C2=O AYUNIORJHRXIBJ-TXHRRWQRSA-N 0.000 description 1
- 229950007866 tanespimycin Drugs 0.000 description 1
- 229930101283 tetracycline Natural products 0.000 description 1
- 229960002180 tetracycline Drugs 0.000 description 1
- 235000019364 tetracycline Nutrition 0.000 description 1
- 150000003522 tetracyclines Chemical class 0.000 description 1
- 235000019818 tetrasodium diphosphate Nutrition 0.000 description 1
- 239000001577 tetrasodium phosphonato phosphate Substances 0.000 description 1
- 150000003568 thioethers Chemical class 0.000 description 1
- 150000003573 thiols Chemical class 0.000 description 1
- RYYWUUFWQRZTIU-UHFFFAOYSA-K thiophosphate Chemical compound [O-]P([O-])([O-])=S RYYWUUFWQRZTIU-UHFFFAOYSA-K 0.000 description 1
- 125000000341 threoninyl group Chemical group [H]OC([H])(C([H])([H])[H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- 229940104230 thymidine Drugs 0.000 description 1
- 238000004448 titration Methods 0.000 description 1
- 229960000303 topotecan Drugs 0.000 description 1
- UCFGDBYHRUNTLO-QHCPKHFHSA-N topotecan Chemical compound C1=C(O)C(CN(C)C)=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 UCFGDBYHRUNTLO-QHCPKHFHSA-N 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 231100000027 toxicology Toxicity 0.000 description 1
- 230000002103 transcriptional effect Effects 0.000 description 1
- 238000011830 transgenic mouse model Methods 0.000 description 1
- 230000014621 translational initiation Effects 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- BQVYCHTZPMKIJX-UHFFFAOYSA-N trimethyl-[2-(1h-phosphol-2-yloxy)ethyl]azanium Chemical compound C[N+](C)(C)CCOC1=CC=CP1 BQVYCHTZPMKIJX-UHFFFAOYSA-N 0.000 description 1
- RYFMWSXOAZQYPI-UHFFFAOYSA-K trisodium phosphate Chemical compound [Na+].[Na+].[Na+].[O-]P([O-])([O-])=O RYFMWSXOAZQYPI-UHFFFAOYSA-K 0.000 description 1
- 239000002753 trypsin inhibitor Substances 0.000 description 1
- 230000005740 tumor formation Effects 0.000 description 1
- 102000003390 tumor necrosis factor Human genes 0.000 description 1
- 210000004981 tumor-associated macrophage Anatomy 0.000 description 1
- 231100000588 tumorigenic Toxicity 0.000 description 1
- 230000000381 tumorigenic effect Effects 0.000 description 1
- 238000000108 ultra-filtration Methods 0.000 description 1
- 241000701161 unidentified adenovirus Species 0.000 description 1
- 241001515965 unidentified phage Species 0.000 description 1
- 210000003932 urinary bladder Anatomy 0.000 description 1
- 206010046766 uterine cancer Diseases 0.000 description 1
- 210000004291 uterus Anatomy 0.000 description 1
- 229960005486 vaccine Drugs 0.000 description 1
- 230000002792 vascular Effects 0.000 description 1
- 229960003048 vinblastine Drugs 0.000 description 1
- JXLYSJRDGCGARV-XQKSVPLYSA-N vincaleukoblastine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 JXLYSJRDGCGARV-XQKSVPLYSA-N 0.000 description 1
- OGWKCGZFUXNPDA-UHFFFAOYSA-N vincristine Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(OC(C)=O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-UHFFFAOYSA-N 0.000 description 1
- 229960004528 vincristine Drugs 0.000 description 1
- OGWKCGZFUXNPDA-XQKSVPLYSA-N vincristine Chemical compound C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-XQKSVPLYSA-N 0.000 description 1
- 229960004355 vindesine Drugs 0.000 description 1
- UGGWPQSBPIFKDZ-KOTLKJBCSA-N vindesine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(N)=O)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1N=C1[C]2C=CC=C1 UGGWPQSBPIFKDZ-KOTLKJBCSA-N 0.000 description 1
- GBABOYUKABKIAF-GHYRFKGUSA-N vinorelbine Chemical compound C1N(CC=2C3=CC=CC=C3NC=22)CC(CC)=C[C@H]1C[C@]2(C(=O)OC)C1=CC([C@]23[C@H]([C@]([C@H](OC(C)=O)[C@]4(CC)C=CCN([C@H]34)CC2)(O)C(=O)OC)N2C)=C2C=C1OC GBABOYUKABKIAF-GHYRFKGUSA-N 0.000 description 1
- 229960002066 vinorelbine Drugs 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
- 230000003442 weekly effect Effects 0.000 description 1
- 210000005253 yeast cell Anatomy 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2866—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for cytokines, lymphokines, interferons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39591—Stabilisation, fragmentation
-
- A61K47/48384—
-
- A61K47/48407—
-
- A61K47/48561—
-
- A61K47/48569—
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/68031—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being an auristatin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/6807—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug or compound being a sugar, nucleoside, nucleotide, nucleic acid, e.g. RNA antisense
- A61K47/6809—Antibiotics, e.g. antitumor antibiotics anthracyclins, adriamycin, doxorubicin or daunomycin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6847—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a hormone or a hormone-releasing or -inhibiting factor
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6849—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K49/00—Preparations for testing in vivo
- A61K49/0002—General or multifunctional contrast agents, e.g. chelated agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/02—Stomatological preparations, e.g. drugs for caries, aphtae, periodontitis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/18—Drugs for disorders of the alimentary tract or the digestive system for pancreatic disorders, e.g. pancreatic enzymes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/08—Drugs for disorders of the urinary system of the prostate
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/10—Drugs for disorders of the urinary system of the bladder
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/12—Drugs for disorders of the urinary system of the kidneys
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P15/00—Drugs for genital or sexual disorders; Contraceptives
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/04—Antineoplastic agents specific for metastasis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07H—SUGARS; DERIVATIVES THEREOF; NUCLEOSIDES; NUCLEOTIDES; NUCLEIC ACIDS
- C07H21/00—Compounds containing two or more mononucleotide units having separate phosphate or polyphosphate groups linked by saccharide radicals of nucleoside groups, e.g. nucleic acids
- C07H21/04—Compounds containing two or more mononucleotide units having separate phosphate or polyphosphate groups linked by saccharide radicals of nucleoside groups, e.g. nucleic acids with deoxyribosyl as saccharide radical
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/10—Cells modified by introduction of foreign genetic material
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/715—Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons
- C07K14/7158—Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons for chemokines
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/732—Antibody-dependent cellular cytotoxicity [ADCC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/734—Complement-dependent cytotoxicity [CDC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2330/00—Production
- C12N2330/50—Biochemical production, i.e. in a transformed host cell
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2510/00—Genetically modified cells
- C12N2510/02—Cells for production
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2800/00—Nucleic acids vectors
- C12N2800/10—Plasmid DNA
- C12N2800/106—Plasmid DNA for vertebrates
- C12N2800/107—Plasmid DNA for vertebrates for mammalian
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Organic Chemistry (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Immunology (AREA)
- Epidemiology (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- Biotechnology (AREA)
- Biomedical Technology (AREA)
- Cell Biology (AREA)
- Zoology (AREA)
- Biophysics (AREA)
- Wood Science & Technology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Microbiology (AREA)
- General Engineering & Computer Science (AREA)
- Urology & Nephrology (AREA)
- Endocrinology (AREA)
- Hematology (AREA)
- Oncology (AREA)
- Mycology (AREA)
- Plant Pathology (AREA)
- Physics & Mathematics (AREA)
- Reproductive Health (AREA)
- Neurosurgery (AREA)
- Neurology (AREA)
- Diabetes (AREA)
Abstract
Description
도 2는 h3G10 경쇄 가변 영역(VL) 정렬을 도시한다.
도 3a는 HPB-ALL(인간 T 세포 백혈병) 및 키노(Cyno)-CXCR4 형질감염된 CHO 세포상에서 일련의 희석물(0.007 내지 267 nM) 중의 유식 세포측정에 의한 키노몰구스 CXCR4에 대한 항-인간 CXCR4 Ab h3G10.1.91.A58B의 교차 반응성을 도시한다.
도 3b는 라지(Raji)(NHL; 인간 비-호지킨 림프종) 및 HSC-F(키노몰구스 T 세포주)상에서 일련의 희석물(0.007 내지 267 nM) 중의 유식 세포측정에 의한 키노몰구스 CXCR4에 대한 항-인간 CXCR4 Ab h3G10.1.91.A58B의 교차 반응성을 도시한다.
도 4는 CXCR4를 발현하는 인간 세포주상에서 항-인간 CXCR4 항체의 ADCC(4a 내지 4c) 및 CDC(4d 내지 4f) 활성을 도시한다.
도 4a는 라모스(Ramos)(NHL) 세포상에서 12A11, 6B6 및 3G10 항-인간 CXCR4 항체의 ADCC 활성을 도시한다.
도 4b는 MOLT-4(T-급성 림프구성 백혈병) 세포상에서 m3G10-hlgG1 및 m3G10-hlgG4 항-인간 CXCR4 항체의 ADCC 활성 비교를 도시한다.
도 4c는 MOLT-4(T-급성 림프구성 백혈병) 세포상에서 마우스(m3G10-) 및 인간화된(h3G10-) 항-인간 CXCR4 항체의 ADCC 활성을 도시한다.
도 4d는 라모스(NHL) 세포상에서 12A11, 6B6 및 3G10 항-인간 CXCR4 항체의 CDC 활성을 도시한다.
도 4e는 다우디(Daudi)(NHL) 세포상에서 m3G10-hlgG1 및 m3G10-hlgG4 항-인간 CXCR4 항체의 CDC 활성 비교를 도시한다.
도 4f는 다우디(NHL) 세포상에서 마우스(m3G10-) 및 인간화된(h3G10-) 항-인간 CXCR4 항체의 CDC 활성을 도시한다.
도 5는 3G10, 6B6 및 12A11 항-인간 CXCR4 항체에 의한 칼슘 유출의 억제를 도시한다.
도 6a는 3G10, 6B6 및 12A11 항-인간 CXCR4 항체가 용량 의존적인 방식으로 라모스 세포에서 세포사를 유도할 수 있음을 도시한다.
도 6b는 세포사를 유도하는 항-인간 CXCR4 항체 3G10의 능력이 2가 의존성임을 도시한다.
도 7은 3G10, 6B6 및 12A11 항-인간 CXCR4 항체가 아이소타입 대조용 항체에 비해 비-호지킨 림프종(NHL) 모델(라모스)에서 종양 성장을 현저하게 억제하였음을 도시한다.
도 8a는 항-인간 CXCR4 항체 3G10, 6B6 및 12A11이, 라지(Raji)-LUC 세포가 전신적으로 이식된 동물의 종양 크기에 대해, 아이소타입 대조용 항체에 비해 현저한 효과를 가짐을 도시한다.
도 8b는 항-인간 CXCR4 항체 3G10, 6B6 및 12A11에 의한 처리가 상기 모델에서 아이소타입 대조용 항체에 비해, 필적할만한 현저한 종양 성장 억제(TGI) 활성을 가졌음을 도시한다.
도 8c는 라지-LUC 세포가 전신적으로 이식된 동물의 생존에서 아이소타입 대조용 항체에 비해 항-인간 CXCR4 항체 3G10, 6B6 및 12A11의 현저한 효과를 도시하는 생존 곡선이다.
도 9a는 급성 골수성 백혈병(AML) 모델(MV4-11-LUC)에서 종양 크기에 대한 CXCR4 Ab 6B6의 효과를 도시한다. 제20일에서 제41일까지의 5마리 동물/처리 군의 전형적인 생물발광 이미지화를 도시한다.
도 9b는 MV4-11-LUC AML 세포가 전신적으로 이식된 동물의 생존에서 아이소타입 대조용 항체에 비해 항-CXCR4 항체 6B6의 현저한 효과를 도시한다.
도 9c는 제35 연구일에 아이소타입 대조용 처리 동물에 비해 항-CXCR4 6B6 항체로 처리된 동물의 말초 혈액(PB)에서 인간 AML 종양 크기의 현저한 감소를 도시한다.
도 10a는 CXCR4 3G10 항체로 처리된 전신 만성 림프구성 백혈병 종양을 갖는 마우스에서 전형적인 루시페라제 이미지화를 도시한다.
도 10b는 만성 림프구성 백혈병 세포가 전신적으로 이식된 동물의 생존에서 아이소타입 대조용 항체에 비해 항-인간 CXCR4 항체 3G10의 현저한 효과를 도시하는 생존 곡선이다.
도 11은 인간화된 항-인간 CXCR4 항체가 비-호지킨 림프종(NHL) 모델(라모스)에서 아이소타입 대조용 항체에 비해 종양 성장을 현저하게 억제하였음을 도시한다.
도 12a는 다발성 골수종(MM) 모델(OPM-2-LUC)에서 종양 크기에 대한 CXCR4 Ab h3G10.1.91.A58B의 효과를 도시한다. 제8일에서 제30일까지의 5마리 동물/처리 군의 전형적인 생물발광 이미지화를 도시한다.
도 12b는 아이소타입 대조용 항체 및 멜팔란으로 처리된 동물에 비해, 항-인간 CXCR4 항체 h3G10.1.91.A58B로 처리된 마우스 전신 다발성 골수종(MM) 모델에서 생물발광(루시페라제 활성)의 정량분석을 도시한다.
도 12c는 OPM-2-Luc MM 세포가 전신적으로 이식된 마우스에서 아이소타입 대조용 항체 및 멜팔란에 비해 항-CXCR4 항체 h3G10.1.91.A58B의 현저한 효과를 도시하는 생존 곡선이다.
도 13a는 라모스(NHL) 종양 모델에서 CXCR4 ADC 3G10-TG6-vc101 및 6B6-TG6-vc101의 현저한 종양 억제 효과를 도시한다.
도 13b는 HPB-ALL(T-ALL) 종양 모델에서 CXCR4 ADC 3G10-TG6-vc101의 현저한 종양 억제 효과를 도시한다.
Claims (54)
- 케모카인 수용체 4(CXCR4)에 결합하고 하기를 포함하는 단리된 항체, 또는 그의 항원 결합 단편:
a) (i) 서열번호 107, 113, 114, 108, 109, 115, 116, 117, 121 및 122로 이루어진 군 중에서 선택된 VH CDR1; (ii) 서열번호 162, 128, 110, 111, 118, 119, 154, 123, 158, 124, 159, 125, 160, 126, 161, 127, 163, 164, 165, 166, 167, 168, 155, 129, 156 및 130으로 이루어진 군 중에서 선택된 VH CDR2; 및 (iii) 서열번호 112 및 120으로 이루어진 군 중에서 선택된 VH CDR3을 포함하는 중쇄 가변(VH) 영역; 및/또는
b) (i) 서열번호 144, 131, 135, 138, 141, 142, 143, 146, 147, 148, 149, 150 및 151로 이루어진 군 중에서 선택된 VL CDR1; (ii) 서열번호 145, 132, 136 및 152로 이루어진 군 중에서 선택된 VL CDR2; 및 (iii) 서열번호 139, 133, 137, 140 및 153으로 이루어진 군 중에서 선택된 VL CDR3을 포함하는 경쇄 가변 영역(VL) 영역. - CXCR4에 결합하고 하기를 포함하는 단리된 항체, 또는 그의 항원 결합 단편:
a) (i) 서열번호 107, 113, 114, 108, 109, 115, 116, 117, 121 또는 122로 나타낸 서열을 포함하는 VH CDR1; (ii) 서열번호 162, 128, 110, 111, 118, 119, 154, 123, 158, 124, 159, 125, 160, 126, 161, 127, 163, 164, 165, 166, 167, 168, 155, 129, 156 또는 130으로 나타낸 서열을 포함하는 VH CDR2; 및 (iii) 서열번호 112 또는 120으로 나타낸 서열을 포함하는 VH CDR3으로 이루어진 군 중에서 선택된 상보성 결정 영역을 포함하는 중쇄 가변(VH) 영역; 및/또는
b) (i) 서열번호 144, 131, 135, 138, 141, 142, 143, 146, 147, 148, 149, 150 또는 151로 나타낸 서열을 포함하는 VL CDR1; (ii) 서열번호 145, 132, 136 또는 152로 나타낸 서열을 포함하는 VL CDR2; 및 (iii) 서열번호 139, 133, 137, 140 또는 153으로 나타낸 서열을 포함하는 VL CDR3으로 이루어진 군 중에서 선택된 상보성 결정 영역을 포함하는 경쇄 가변 영역(VL) 영역. - CXCR4에 결합하고 하기를 포함하는 단리된 항체, 또는 그의 항원 결합 단편:
a) (i) 서열 X1SX2X3SLFNSX4X5RKNYLX6(여기에서 X1은 R 또는 K이고/이거나; X2는 S 또는 A이고/이거나; X3은 W, N 또는 Q이고/이거나; X4는 H 또는 R이고/이거나; X5는 T 또는 F이고/이거나; X6은 A, L, N 또는 M이다)(서열번호 151)을 포함하는 VL CDR1; (ii) 서열 WASARX1S(여기에서 X1는 G 또는 E이다)(서열번호 152)를 포함하는 VL CDR2; 및 (iii) 서열 KQSFX1LRT(여기에서 X1은 N 또는 R이다)(서열번호 153)를 포함하는 VL CDR3을 포함하는 경쇄 가변(VL) 영역; 및/또는
b) (i) 서열번호 107, 108, 109, 113 또는 114로 나타낸 서열을 포함하는 VH CDR1; (ii) 서열번호 157로 나타낸 서열을 포함하는 VH CDR2; 및 (iii) 서열번호 112로 나타낸 서열을 포함하는 VH CDR3을 포함하는 중쇄 가변(VH) 영역. - CXCR4에 결합하고 하기를 포함하는 단리된 항체, 또는 그의 항원 결합 단편:
EVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMSWVRQAPGKGLEWVX1FIRHKX2NX3X4TX5EYSTX6 X7X8GRFTISRDX9SKNX10LYLQMNSLX11X12EDTAVYYCAX13DLPGFAYWGQGTLVTVSS(서열번호 106)(여기에서 X1은 G 또는 S이고/이거나; X2는 V 또는 A이고/이거나; X3은 G, F, K, V, T, L 또는 I이고/이거나; X4는 E 또는 Y이고/이거나; X5는 T 또는 R이고/이거나; X6은 W 또는 S이고/이거나; X7은 D 또는 V이고/이거나; X8은 K, T 또는 R이고/이거나; X9는 D 또는 N이고/이거나; X10은 T 또는 S이고/이거나; X11은 R 또는 K이고/이거나; X12는 A 또는 T이고/이거나; X13은 K 또는 R이다)를 포함하는 중쇄 가변(VH) 영역 서열. - 제 1 항에 있어서,
하기로 이루어진 군 중에서 선택된 케모카인 수용체 4(CXCR4)에 결합하는 단리된 항체 또는 그의 항원 결합 단편:
a) 서열번호 107, 113 또는 114의 VH CDR1; 서열번호 162 또는 128의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 중쇄 가변(VH) 영역, 및 서열번호 144의 VL CDR1; 서열번호 145의 VL CDR2 및 서열번호 139의 VL CDR3을 갖는 경쇄 가변(VL) 영역;
b) 서열번호 115, 116, 117, 121 또는 122의 VH CDR1; 서열번호 118 또는 119의 VH CDR2 및 서열번호 120의 VH CDR3을 갖는 VH 영역, 및 서열번호 135의 VL CDR1; 서열번호 136의 VL CDR2 및 서열번호 137의 VL CDR3을 갖는 VL 영역;
c) 서열번호 107, 108, 109, 113 또는 114의 VH CDR1; 서열번호 110 또는 111의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 VH 영역, 및 서열번호 131의 VL CDR1; 서열번호 132의 VL CDR2 및 서열번호 133의 VL CDR3을 갖는 VL 영역;
d) 서열번호 107, 108, 109, 113 또는 114의 VH CDR1; 서열번호 154 또는 123의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 VH 영역, 및 서열번호 138의 VL CDR1; 서열번호 132의 VL CDR2 및 서열번호 139의 VL CDR3을 갖는 VL 영역; 및
e) 서열번호 107, 108, 109, 113 또는 114의 VH CDR1; 서열번호 157의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 VH 영역, 및 서열번호 151의 VL CDR1; 서열번호 152의 VL CDR2 및 서열번호 153의 VL CDR3을 갖는 VL 영역. - 제 1 항에 있어서,
하기로 이루어진 군 중에서 선택된 단리된 항체 또는 그의 항원 결합 단편:
a) 서열번호 107의 VH CDR1; 서열번호 162의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 중쇄 가변(VH) 영역, 및 서열번호 144의 VL CDR1; 서열번호 145의 VL CDR2 및 서열번호 139의 VL CDR3을 갖는 경쇄 가변(VL) 영역;
b) 서열번호 115의 VH CDR1; 서열번호 118의 VH CDR2 및 서열번호 120의 VH CDR3을 갖는 VH 영역, 및 서열번호 135의 VL CDR1; 서열번호 136의 VL CDR2 및 서열번호 137의 VL CDR3을 갖는 VL 영역;
c) 서열번호 107의 VH CDR1; 서열번호 110의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 VH 영역, 및 서열번호 131의 VL CDR1; 서열번호 132의 VL CDR2 및 서열번호 133의 VL CDR3을 갖는 VL 영역;
d) 서열번호 107의 VH CDR1; 서열번호 154의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 VH 영역, 및 서열번호 138의 VL CDR1; 서열번호 132의 VL CDR2 및 서열번호 139의 VL CDR3을 갖는 VL 영역; 및
e) 서열번호 107의 VH CDR1; 서열번호 157의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 VH 영역, 및 서열번호 151의 VL CDR1; 서열번호 152의 VL CDR2 및 서열번호 153의 VL CDR3을 갖는 VL 영역. - 제 1 항에 있어서,
하기로 이루어진 군 중에서 선택된 케모카인 수용체 4(CXCR4)에 결합하는 단리된 항체 또는 그의 항원 결합 단편:
a) 서열번호 107의 VH CDR1; 서열번호 158의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 중쇄 가변(VH) 영역, 및 서열번호 138의 VL CDR1; 서열번호 132의 VL CDR2 및 서열번호 139의 VL CDR3을 갖는 경쇄 가변(VL) 영역;
b) 서열번호 107의 VH CDR1; 서열번호 158의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 VH 영역, 및 서열번호 138의 VL CDR1; 서열번호 132의 VL CDR2 및 서열번호 140의 VL CDR3을 갖는 VL 영역;
c) 서열번호 107의 VH CDR1; 서열번호 158의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 VH 영역, 및 서열번호 150의 VL CDR1; 서열번호 132의 VL CDR2 및 서열번호 140의 VL CDR3을 갖는 VL 영역;
d) 서열번호 107의 VH CDR1; 서열번호 158의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 VH 영역, 및 서열번호 141의 VL CDR1; 서열번호 132의 VL CDR2 및 서열번호 140의 VL CDR3을 갖는 VL 영역;
e) 서열번호 107의 VH CDR1; 서열번호 158의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 VH 영역, 및 서열번호 144의 VL CDR1; 서열번호 145의 VL CDR2 및 서열번호 140의 VL CDR3을 갖는 VL 영역;
f) 서열번호 107의 VH CDR1; 서열번호 158의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 VH 영역, 및 서열번호 147의 VL CDR1; 서열번호 132의 VL CDR2 및 서열번호 140의 VL CDR3을 갖는 VL 영역;
g) 서열번호 107의 VH CDR1; 서열번호 159의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 VH 영역, 및 서열번호 138의 VL CDR1; 서열번호 132의 VL CDR2 및 서열번호 140의 VL CDR3을 갖는 VL 영역;
h) 서열번호 107의 VH CDR1; 서열번호 160의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 VH 영역, 및 서열번호 138의 VL CDR1; 서열번호 132의 VL CDR2 및 서열번호 140의 VL CDR3을 갖는 VL 영역;
i) 서열번호 107의 VH CDR1; 서열번호 161의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 VH 영역, 및 서열번호 138의 VL CDR1; 서열번호 132의 VL CDR2 및 서열번호 140의 VL CDR3을 갖는 VL 영역;
j) 서열번호 107의 VH CDR1; 서열번호 162의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 VH 영역, 및 서열번호 138의 VL CDR1; 서열번호 132의 VL CDR2 및 서열번호 140의 VL CDR3을 갖는 VL 영역;
k) 서열번호 107의 VH CDR1; 서열번호 163의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 VH 영역, 및 서열번호 138의 VL CDR1; 서열번호 132의 VL CDR2 및 서열번호 140의 VL CDR3을 갖는 VL 영역;
l) 서열번호 107의 VH CDR1; 서열번호 164의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 VH 영역, 및 서열번호 138의 VL CDR1; 서열번호 132의 VL CDR2 및 서열번호 140의 VL CDR3을 갖는 VL 영역;
m) 서열번호 107의 VH CDR1; 서열번호 165의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 VH 영역, 및 서열번호 138의 VL CDR1; 서열번호 132의 VL CDR2 및 서열번호 140의 VL CDR3을 갖는 VL 영역;
o) 서열번호 107의 VH CDR1; 서열번호 166의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 VH 영역, 및 서열번호 138의 VL CDR1; 서열번호 132의 VL CDR2 및 서열번호 140의 VL CDR3을 갖는 VL 영역;
p) 서열번호 107의 VH CDR1; 서열번호 167의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 VH 영역, 및 서열번호 138의 VL CDR1; 서열번호 132의 VL CDR2 및 서열번호 140의 VL CDR3을 갖는 VL 영역;
q) 서열번호 107의 VH CDR1; 서열번호 168의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 VH 영역, 및 서열번호 138의 VL CDR1; 서열번호 132의 VL CDR2 및 서열번호 140의 VL CDR3을 갖는 VL 영역;
r) 서열번호 107의 VH CDR1; 서열번호 168의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 VH 영역, 및 서열번호 138의 VL CDR1; 서열번호 132의 VL CDR2 및 서열번호 140의 VL CDR3을 갖는 VL 영역;
s) 서열번호 107의 VH CDR1; 서열번호 163의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 VH 영역, 및 서열번호 144의 VL CDR1; 서열번호 145의 VL CDR2 및 서열번호 140의 VL CDR3을 갖는 VL 영역;
t) 서열번호 107의 VH CDR1; 서열번호 158의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 VH 영역, 및 서열번호 144의 VL CDR1; 서열번호 145의 VL CDR2 및 서열번호 139의 VL CDR3을 갖는 VL 영역;
u) 서열번호 107의 VH CDR1; 서열번호 162의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 VH 영역, 및 서열번호 144의 VL CDR1; 서열번호 145의 VL CDR2 및 서열번호 139의 VL CDR3을 갖는 VL 영역;
v) 서열번호 107의 VH CDR1; 서열번호 163의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 VH 영역, 및 서열번호 144의 VL CDR1; 서열번호 145의 VL CDR2 및 서열번호 139의 VL CDR3을 갖는 VL 영역; 및
w) 서열번호 107의 VH CDR1; 서열번호 162의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 VH 영역, 및 서열번호 144의 VL CDR1; 서열번호 145의 VL CDR2 및 서열번호 140의 VL CDR3을 갖는 VL 영역. - 제 1 항에 있어서,
서열번호 107, 162 및 112로 나타낸 3개의 CDR을 포함하는 중쇄 가변(VH) 영역을 포함하는 항체 또는 그의 항원 결합 단편. - 제 1 항에 있어서,
서열번호 144, 145 및 139로 나타낸 3개의 CDR을 포함하는 경쇄 가변(VL) 영역을 포함하는 항체 또는 그의 항원 결합 단편. - 제 1 항에 있어서,
a) 서열번호 107, 162 및 112로 나타낸 3개의 CDR을 포함하는 중쇄 가변(VH) 영역; 및
b) 서열번호 144, 145 및 139로 나타낸 3개의 CDR을 포함하는 경쇄 가변(VL) 영역
을 포함하는 항체 또는 그의 항원 결합 단편. - 제 1 항 내지 제 4 항 중 어느 한 항에 있어서,
서열번호 33의 VH 영역으로부터의 VH CDR1, VH CDR2 및 VH CDR3을 포함하는 중쇄 가변(VH) 영역을 포함하는 항체 또는 그의 항원 결합 단편. - 제 1 항 내지 제 4 항 중 어느 한 항에 있어서,
서열번호 73의 VL 영역으로부터의 VL CDR1, VL CDR2 및 VL CDR3을 포함하는 경쇄 가변(VL) 영역을 포함하는 항체 또는 그의 항원 결합 단편. - 제 1 항 내지 제 4 항 중 어느 한 항에 있어서,
a) 서열번호 33의 VH 영역으로부터의 VH CDR1, VH CDR2 및 VH CDR3을 포함하는 중쇄 가변(VH) 영역; 및
b) 서열번호 73의 VL 영역으로부터의 VL CDR1, VL CDR2 및 VL CDR3을 포함하는 경쇄 가변(VL) 영역
을 포함하는 단리된 항체 또는 그의 항원 결합 단편. - 제 6 항에 있어서,
하기로 이루어진 군 중에서 선택된 단리된 항체 또는 그의 항원 결합 단편:
a) 서열번호 33의 VH 영역 및 서열번호 73의 VL 영역을 포함하는 항체 또는 그의 항원-결합 단편;
b) 서열번호 13의 VH 영역 및 서열번호 15의 VL 영역을 포함하는 항체 또는 그의 항원-결합 단편;
c) 서열번호 5의 VH 영역 및 서열번호 7의 VL 영역을 포함하는 항체 또는 그의 항원-결합 단편;
d) 서열번호 21의 VH 영역 및 서열번호 47의 VL 영역을 포함하는 항체 또는 그의 항원-결합 단편; 및
e) 서열번호 106의 VH 영역, 및 서열번호 138의 VL CDR1; 서열번호 132의 VL CDR2; 및 서열번호 139의 VL CDR3을 갖는 VL 영역을 포함하는 항체 또는 그의 항원-결합 단편. - 제 14 항에 있어서,
서열번호 33에 95% 이상 일치하는 아미노산 서열을 갖는 중쇄 가변 영역 및 서열번호 73에 95% 이상 일치하는 아미노산 서열을 갖는 경쇄 가변 영역을 포함하는 단리된 항체 또는 그의 항원 단편. - 제 14 항에 있어서,
a) 서열번호 33의 중쇄 가변(VH) 영역; 및/또는
b) 서열번호 73의 경쇄 가변(VL) 영역
을 포함하는 항체 또는 그의 항원 결합 단편. - 제 8 항에 있어서,
ATCC 기탁 번호 PTA-121353을 갖는 발현 벡터에 의해 생성된 중쇄 가변(VH) 영역을 포함하는 항체 또는 항원 결합 단편. - 제 9 항에 있어서,
ATCC 기탁 번호 PTA-121354를 갖는 발현 벡터에 의해 생성된 경쇄 가변(VL) 영역을 포함하는 항체 또는 항원 결합 단편. - 제 1 항에 있어서,
하기로 이루어진 군 중에서 선택된 케모카인 수용체 4(CXCR4)에 결합하는 단리된 항체 또는 그의 항원 결합 단편:
a) 서열번호 107의 VH CDR1; 서열번호 158의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 중쇄 가변(VH) 영역, 및 서열번호 138의 VL CDR1; 서열번호 132의 VL CDR2 및 서열번호 139의 VL CDR3을 갖는 경쇄 가변(VL) 영역;
b) 서열번호 107의 VH CDR1; 서열번호 158의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 VH 영역, 및 서열번호 138의 VL CDR1; 서열번호 132의 VL CDR2 및 서열번호 140의 VL CDR3을 갖는 VL 영역;
c) 서열번호 107의 VH CDR1; 서열번호 158의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 VH 영역, 및 서열번호 150의 VL CDR1; 서열번호 132의 VL CDR2 및 서열번호 140의 VL CDR3을 갖는 VL 영역;
d) 서열번호 107의 VH CDR1; 서열번호 158의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 VH 영역, 및 서열번호 141의 VL CDR1; 서열번호 132의 VL CDR2 및 서열번호 140의 VL CDR3을 갖는 VL 영역;
e) 서열번호 107의 VH CDR1; 서열번호 158의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 VH 영역, 및 서열번호 144의 VL CDR1; 서열번호 145의 VL CDR2 및 서열번호 140의 VL CDR3을 갖는 VL 영역;
f) 서열번호 107의 VH CDR1; 서열번호 158의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 VH 영역, 및 서열번호 147의 VL CDR1; 서열번호 132의 VL CDR2 및 서열번호 140의 VL CDR3을 갖는 VL 영역;
g) 서열번호 107의 VH CDR1; 서열번호 159의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 VH 영역, 및 서열번호 138의 VL CDR1; 서열번호 132의 VL CDR2 및 서열번호 140의 VL CDR3을 갖는 VL 영역;
h) 서열번호 107의 VH CDR1; 서열번호 160의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 VH 영역, 및 서열번호 138의 VL CDR1; 서열번호 132의 VL CDR2 및 서열번호 140의 VL CDR3을 갖는 VL 영역;
i) 서열번호 107의 VH CDR1; 서열번호 161의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 VH 영역, 및 서열번호 138의 VL CDR1; 서열번호 132의 VL CDR2 및 서열번호 140의 VL CDR3을 갖는 VL 영역;
j) 서열번호 107의 VH CDR1; 서열번호 162의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 VH 영역, 및 서열번호 138의 VL CDR1; 서열번호 132의 VL CDR2 및 서열번호 140의 VL CDR3을 갖는 VL 영역;
k) 서열번호 107의 VH CDR1; 서열번호 163의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 VH 영역, 및 서열번호 138의 VL CDR1; 서열번호 132의 VL CDR2 및 서열번호 140의 VL CDR3을 갖는 VL 영역;
l) 서열번호 107의 VH CDR1; 서열번호 164의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 VH 영역, 및 서열번호 138의 VL CDR1; 서열번호 132의 VL CDR2 및 서열번호 140의 VL CDR3을 갖는 VL 영역;
m) 서열번호 107의 VH CDR1; 서열번호 165의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 VH 영역, 및 서열번호 138의 VL CDR1; 서열번호 132의 VL CDR2 및 서열번호 140의 VL CDR3을 갖는 VL 영역;
n) 서열번호 107의 VH CDR1; 서열번호 166의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 VH 영역, 및 서열번호 138의 VL CDR1; 서열번호 132의 VL CDR2 및 서열번호 140의 VL CDR3을 갖는 VL 영역;
o) 서열번호 107의 VH CDR1; 서열번호 167의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 VH 영역, 및 서열번호 138의 VL CDR1; 서열번호 132의 VL CDR2 및 서열번호 140의 VL CDR3을 갖는 VL 영역;
p) 서열번호 107의 VH CDR1; 서열번호 168의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 VH 영역, 및 서열번호 138의 VL CDR1; 서열번호 132의 VL CDR2 및 서열번호 140의 VL CDR3을 갖는 VL 영역;
q) 서열번호 107의 VH CDR1; 서열번호 168의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 VH 영역, 및 서열번호 138의 VL CDR1; 서열번호 132의 VL CDR2 및 서열번호 140의 VL CDR3을 갖는 VL 영역;
r) 서열번호 107의 VH CDR1; 서열번호 163의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 VH 영역, 및 서열번호 144의 VL CDR1; 서열번호 145의 VL CDR2 및 서열번호 140의 VL CDR3을 갖는 VL 영역;
s) 서열번호 107의 VH CDR1; 서열번호 158의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 VH 영역, 및 서열번호 144의 VL CDR1; 서열번호 145의 VL CDR2 및 서열번호 139의 VL CDR3을 갖는 VL 영역;
t) 서열번호 107의 VH CDR1; 서열번호 162의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 VH 영역, 및 서열번호 144의 VL CDR1; 서열번호 145의 VL CDR2 및 서열번호 139의 VL CDR3을 갖는 VL 영역;
u) 서열번호 107의 VH CDR1; 서열번호 163의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 VH 영역, 및 서열번호 144의 VL CDR1; 서열번호 145의 VL CDR2 및 서열번호 139의 VL CDR3을 갖는 VL 영역; 및
v) 서열번호 107의 VH CDR1; 서열번호 162의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 VH 영역, 및 서열번호 144의 VL CDR1; 서열번호 145의 VL CDR2 및 서열번호 140의 VL CDR3을 갖는 VL 영역. - 제 1 항 내지 제 19 항 중 어느 한 항에 따른 항체 또는 그의 항원 결합 단편과 동일한 CXCR4의 에피토프와 CXCR4에의 결합에 대해서 경쟁하고/하거나 상기 에피토프에 결합하는, CXCR4에 결합하는 단리된 항체 또는 그의 항원 결합 단편.
- 제 20 항에 있어서,
서열번호 107의 VH CDR1; 서열번호 162의 VH CDR2 및 서열번호 112의 VH CDR3을 갖는 VH 영역, 및 서열번호 144의 VL CDR1; 서열번호 145의 VL CDR2 및 서열번호 139의 VL CDR3을 갖는 VL 영역을 포함하는 단리된 항체 또는 그의 항원 결합 단편. - 제 1 항 내지 제 21 항 중 어느 한 항에 있어서,
인간화된, 키메릭, CDR 이식된, 또는 재조합 인간 항체인 항체 또는 그의 항원 결합 단편. - 제 1 항 내지 제 22 항 중 어느 한 항에 있어서,
개화(caninized)되거나 고양이화(felinized)되지 않은 항체 또는 그의 항원 결합 단편. - 제 1 항 내지 제 23 항 중 어느 한 항에 있어서,
특정 부위에서 조작된 아실 공여체 글루타민-함유 태그를 포함하는 항체 또는 그의 항원 결합 단편. - 하기 식을 갖는 항체-약물 접합체:
Ab-(T-L-D)
상기 식에서,
(a) Ab는 케모카인 수용체 4(CXC4)에 결합하는 항체 또는 그의 항원-결합 단편이고;
(b) T는 임의로 포함시킬 수 있는 아실 공여체 글루타민-함유 태그이고;
(c) L은 연결기이고;
(d) D는 약물이다. - 제 25 항에 있어서,
Ab가 하기로 이루어진 군 중에서 선택되는 항체-약물 접합체:
a) 서열번호 107, 162 및 112의 CDR을 포함하는 VH 영역 및 서열번호 144, 145 및 139의 CDR을 포함하는 VL 영역을 포함하는 항체 또는 그의 항원-결합 단편;
b) 서열번호 115, 118 및 120의 CDR을 포함하는 VH 영역 및 서열번호 135, 136 및 137의 CDR을 포함하는 VL 영역을 포함하는 항체 또는 그의 항원-결합 단편;
c) 서열번호 107, 110 및 112의 CDR을 포함하는 VH 영역 및 서열번호 131, 132 및 133의 CDR을 포함하는 VL 영역을 포함하는 항체 또는 그의 항원-결합 단편;
d) 서열번호 107, 154 및 112의 CDR을 포함하는 VH 영역 및 서열번호 138, 132 및 139의 CDR을 포함하는 VL 영역을 포함하는 항체 또는 그의 항원-결합 단편;
e) 서열번호 107, 157 및 112의 CDR을 포함하는 VH 영역 및 서열번호 151, 152 및 153의 CDR을 포함하는 VL 영역을 포함하는 항체 또는 그의 항원-결합 단편;
f) 서열번호 33의 VH 영역 및 서열번호 73의 VL 영역을 포함하는 항체 또는 그의 항원-결합 단편;
g) 서열번호 13의 VH 영역 및 서열번호 15의 VL 영역을 포함하는 항체 또는 그의 항원-결합 단편;
h) 서열번호 5의 VH 영역 및 서열번호 7의 VL 영역을 포함하는 항체 또는 그의 항원-결합 단편; 및
i) 서열번호 21의 VH 영역 및 서열번호 47의 VL 영역을 포함하는 항체 또는 그의 항원-결합 단편. - 제 25 항에 있어서,
Ab가 인간화된, 키메릭, CDR 이식된, 또는 재조합 인간 항체 또는 그의 항원 결합 단편인 항체-약물 접합체. - 제 25 항에 있어서,
T가 서열번호 171, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 172, 173, 102, 103 및 LLQ로 이루어진 군 중에서 선택되는 항체-약물 접합체. - 제 25 항에 있어서,
T가 서열번호 91, 92 및 102 중 어느 하나로 이루어진 군 중에서 선택되는 항체-약물 접합체. - 제 25 항에 있어서,
L이 아세틸-리신-발린-시트룰린-p-아미노벤질옥시카보닐(AcLys-VC-PABC), 아미노 PEG6-프로피오닐, 말레이미도카프로닉-발린-시트룰린-p-아미노벤질옥시카보닐(vc) 및 말레이미도카프로일(mc)로 이루어진 군 중에서 선택되는 항체-약물 접합체. - 제 29 항에 있어서,
L이 아세틸-리신-발린-시트룰린-p-아미노벤질옥시카보닐(AcLys-Vc-PABC)인 항체-약물 접합체. - 제 25 항에 있어서,
항체 또는 항원 결합 단편이 약물에 접합되고, D가 세포독성제, 면역조절제, 이미지화제, 치료학적 단백질, 생물중합체, 및 올리고뉴클레오타이드로 이루어진 군 중에서 선택되는 항체-약물 접합체. - 제 32 항에 있어서,
D가 세포독성제인 항체-약물 접합체. - 제 33 항에 있어서,
세포독성제가 안트라사이클린, 아우리스타틴, 캄토테신, 콤브레타스테인, 돌라스타틴, 듀오카마이신, 에네다인, 젤다나마이신, 인돌리노-벤조다이아제핀 이량체, 메이탄신, 퓨로마이신, 피롤로벤조다이아제핀 이량체, 탁산, 빈카 알칼로이드, 투불리신, 헤미아스털린, 스플라이스오스타틴, 플라다이에놀리드, 및 칼케아미신으로 이루어진 군 중에서 선택되는 항체-약물 접합체. - 제 34 항에 있어서,
세포독성제가 아우리스타틴인 항체-약물 접합체. - 제 35 항에 있어서,
아우리스타틴이 0101(2-메틸알라닐-N-[(3R,4S,5S)-3-메톡시-1-{(2S)-2-[(1R,2R)-1-메톡시-2-메틸-3-옥소-3-{[(1S)-2-페닐-1-(1,3-티아졸-2-일)에틸]아미노}프로필]피롤리딘-1-일}-5-메틸-1-옥소헵탄-4-일]-N-메틸-L-발린아미드), MMAD(모노메틸 아우리스타틴 D 또는 모노메틸 돌라스타틴 10) 및 8261(2-메틸알라닐-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(1S)-1-카복시-2-페닐에틸]아미노}-1-메톡시-2-메틸-3-옥소프로필]피롤리딘-1-일}-3-메톡시-5-메틸-1-옥소헵탄-4-일]-N-메틸-L-발린아미드)로 이루어진 군 중에서 선택되는 항체-약물 접합체. - 제 25 항 내지 제 36 항 중 어느 한 항에 있어서,
하기로 이루어진 군 중에서 선택되는 항체-약물 접합체:
a) Ab-LLQGA(서열번호 91)-(아세틸-리신-발린-시트룰린-p-아미노벤질옥시카보닐(AcLys-VC-PABC))-0101;
b) Ab-LLQGA(서열번호 91)-(AcLys-VC-PABC)-MMAD;
c) Ab-LLQX1X2X3X4X5(서열번호 102)-(AcLys-VC-PABC)-0101;
d) Ab-LLQX1X2X3X4X5(서열번호 102)-(AcLys-VC-PABC)-MMAD;
e) Ab-GGLLQGA(서열번호 92)-(AcLys-VC-PABC)-0101; 및
f) Ab-GGLLQGA(서열번호 92)-(AcLys-VC-PABC)-MMAD. - 제 37 항에 있어서,
Ab가 서열번호 107, 162 및 112의 CDR을 포함하는 VH 영역 및 서열번호 144, 145 및 139의 CDR을 포함하는 VL 영역을 포함하는 항체 또는 그의 항원-결합 단편인 항체-약물 접합체. - 치료 유효량의 제 1 항 내지 제 24 항 중 어느 한 항에 따른 항체 또는 그의 항원 결합 단편 또는 제 25 항 내지 제 38 항 중 어느 한 항에 따른 접합체 및 약학적으로 허용 가능한 담체를 포함하는 약학 조성물.
- 제 1 항 내지 제 24 항 중 어느 한 항에 따른 항체 또는 그의 항원 결합 단편을 암호화하는 뉴클레오타이드 서열을 포함하는 단리된 폴리뉴클레오타이드.
- 제 40 항에 따른 폴리뉴클레오타이드를 포함하는 벡터.
- 제 1 항 내지 제 24 항 중 어느 한 항에 따른 항체 또는 그의 항원 결합 단편을 재조합적으로 생산하는 단리된 숙주 세포.
- 항체 또는 그의 항원 결합 단편을 생성시키는 조건하에서 제 42 항에 따른 숙주 세포를 배양하고, 상기 숙주 세포 또는 배양 배지로부터 상기 항체 또는 그의 항원 결합 단편을 단리시킴을 포함하는, 상기 항체 또는 그의 항원 결합 단편의 생성 방법.
- 대상체에서 CXCR4 기능 또는 발현과 관련된 질환을 치료하는 방법으로서, 상기 치료가 필요한 대상체에게 유효량의 제 39 항에 따른 약학 조성물을 투여함을 포함하는 방법.
- 제 44 항에 있어서,
질환이 암인 방법. - 제 45 항에 있어서,
암이 혈액암인 방법. - 제 45 항에 있어서,
암이 B 세포 또는 T 세포 악성종양인 방법. - 제 44 항에 있어서,
암이 급성 림프구성 백혈병(ALL), 급성 골수성 백혈병(AML), 만성 림프구성 백혈병(CLL), 작은 림프구성 림프종(SLL), 다발성 골수종(MM), 비-호지킨 림프종(NHL), 호지킨 림프종, 외투세포 림프종(MCL), 여포성 림프종, 발덴스트롬 마크로글로불린혈증(WM), B-세포 림프종 및 확산성 큰 B-세포 림프종(DLBCL)으로 이루어진 군 중에서 선택되는 방법. - 제 45 항에 있어서,
암이 방광암, 유방암, 경부암, 융모막암종, 결장암, 식도암, 위암, 교모세포종, 두경부암, 신장암, 폐암, 구강암, 난소암, 췌장암, 전립선암 및 피부암으로 이루어진 군 중에서 선택되는 방법. - CXCR4 발현 종양을 갖는 대상체에서 종양 성장 또는 진행을 감소시키는 방법으로서, 상기 감소가 필요한 대상체에게 유효량의 제 39 항에 따른 약학 조성물을 투여함을 포함하는 방법.
- 대상체에서 CXCR4 발현 암세포의 전이를 감소시키는 방법으로서, 상기 감소가 필요한 대상체에게 유효량의 제 39 항에 따른 약학 조성물을 투여함을 포함하는 방법.
- CXCR4 발현 종양을 갖는 대상체에서 종양 퇴화를 유도하는 방법으로서, 상기 유도가 필요한 대상체에게 유효량의 제 39 항에 따른 약학 조성물을 투여함을 포함하는 방법.
- CXCR4의 발현과 관련된 질환의 검출, 진단 및/또는 치료에 사용하기 위한 제 1 항 내지 제 24 항 중 어느 한 항에 따른 단리된 항체 또는 그의 항원 결합 단편 또는 제 25 항 내지 제 38 항 중 어느 한 항에 따른 항체-약물 접합체.
- CXCR4의 발현과 관련된 질환의 치료를 위한 약제의 제조에서 제 1 항 내지 제 24 항 중 어느 한 항에 따른 단리된 항체 또는 제 25 항 내지 제 38 항 중 어느 한 항에 따른 항체-약물 접합체의 용도.
Applications Claiming Priority (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201361861706P | 2013-08-02 | 2013-08-02 | |
US61/861,706 | 2013-08-02 | ||
PCT/IB2014/063483 WO2015015401A2 (en) | 2013-08-02 | 2014-07-28 | Anti-cxcr4 antibodies and antibody-drug conjugates |
Related Child Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
KR1020177035455A Division KR20170140424A (ko) | 2013-08-02 | 2014-07-28 | 항-cxcr4 항체 및 항체-약물 접합체 |
Publications (2)
Publication Number | Publication Date |
---|---|
KR20160030586A true KR20160030586A (ko) | 2016-03-18 |
KR101809072B1 KR101809072B1 (ko) | 2017-12-14 |
Family
ID=51585144
Family Applications (3)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
KR1020167005526A Active KR101809072B1 (ko) | 2013-08-02 | 2014-07-28 | 항-cxcr4 항체 및 항체-약물 접합체 |
KR1020177035455A Ceased KR20170140424A (ko) | 2013-08-02 | 2014-07-28 | 항-cxcr4 항체 및 항체-약물 접합체 |
KR1020187030501A Active KR102048718B1 (ko) | 2013-08-02 | 2014-07-28 | 항-cxcr4 항체 및 항체-약물 접합체 |
Family Applications After (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
KR1020177035455A Ceased KR20170140424A (ko) | 2013-08-02 | 2014-07-28 | 항-cxcr4 항체 및 항체-약물 접합체 |
KR1020187030501A Active KR102048718B1 (ko) | 2013-08-02 | 2014-07-28 | 항-cxcr4 항체 및 항체-약물 접합체 |
Country Status (20)
Country | Link |
---|---|
US (4) | US9708405B2 (ko) |
EP (2) | EP4050033A1 (ko) |
JP (2) | JP6506280B2 (ko) |
KR (3) | KR101809072B1 (ko) |
CN (2) | CN113683695A (ko) |
AR (1) | AR097102A1 (ko) |
AU (2) | AU2014298040B2 (ko) |
BR (1) | BR112016002008B1 (ko) |
CA (1) | CA2919790C (ko) |
IL (1) | IL243900B (ko) |
MX (1) | MX371455B (ko) |
MY (1) | MY190252A (ko) |
PE (2) | PE20160671A1 (ko) |
PH (1) | PH12016500215A1 (ko) |
RU (1) | RU2675516C2 (ko) |
SA (1) | SA516370515B1 (ko) |
SG (1) | SG11201600171SA (ko) |
TW (2) | TWI623551B (ko) |
WO (1) | WO2015015401A2 (ko) |
ZA (2) | ZA201600246B (ko) |
Families Citing this family (34)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
KR102042174B1 (ko) * | 2013-03-29 | 2019-11-08 | 삼성전자주식회사 | 인간화 및 친화도 성숙된 항 c-Met 항체 및 그의 용도 |
ES2804614T3 (es) * | 2013-07-31 | 2021-02-08 | Rinat Neuroscience Corp | Conjugados de polipéptidos manipulados usando transglutaminasa |
MX384379B (es) * | 2014-08-28 | 2025-03-14 | Pfizer | Ligadores que modulan la estabilidad para usar con conjugados anticuerpo-fármaco. |
US11566082B2 (en) | 2014-11-17 | 2023-01-31 | Cytiva Bioprocess R&D Ab | Mutated immunoglobulin-binding polypeptides |
CA2977646A1 (en) * | 2015-02-24 | 2016-09-01 | Rpeptide, Llc | Anti-amyloid-beta antibodies |
EA201792522A1 (ru) | 2015-06-12 | 2018-05-31 | Бристол-Майерс Сквибб Компани | Лечение злокачественной опухоли с помощью комбинированной блокады сигнальных путей pd-1 и cxcr4 |
US11357742B2 (en) | 2015-12-14 | 2022-06-14 | X4 Pharmaceuticals, Inc. | Methods for treating cancer |
US10560742B2 (en) * | 2016-01-28 | 2020-02-11 | Oath Inc. | Pointer activity as an indicator of interestingness in video |
US11046778B2 (en) * | 2016-03-31 | 2021-06-29 | Tohoku University | Anti-podocalyxin antibody that targets tumor microenvironment |
US11337969B2 (en) | 2016-04-08 | 2022-05-24 | X4 Pharmaceuticals, Inc. | Methods for treating cancer |
EP3455241B1 (en) | 2016-05-11 | 2022-02-23 | Cytiva BioProcess R&D AB | Method of cleaning and/or sanitizing a separation matrix |
WO2017194597A1 (en) | 2016-05-11 | 2017-11-16 | Ge Healthcare Bioprocess R&D Ab | Separation matrix |
US10730908B2 (en) | 2016-05-11 | 2020-08-04 | Ge Healthcare Bioprocess R&D Ab | Separation method |
EP3455240B1 (en) | 2016-05-11 | 2025-01-01 | Cytiva BioProcess R&D AB | Method of storing a separation matrix |
US10889615B2 (en) | 2016-05-11 | 2021-01-12 | Cytiva Bioprocess R&D Ab | Mutated immunoglobulin-binding polypeptides |
US10703774B2 (en) | 2016-09-30 | 2020-07-07 | Ge Healthcare Bioprocess R&D Ab | Separation method |
US10654887B2 (en) | 2016-05-11 | 2020-05-19 | Ge Healthcare Bio-Process R&D Ab | Separation matrix |
JP7031934B2 (ja) | 2016-05-11 | 2022-03-08 | サイティバ・バイオプロセス・アールアンドディ・アクチボラグ | 分離マトリックス |
JP7261379B2 (ja) | 2016-06-20 | 2023-04-20 | カイマブ・リミテッド | 抗pd-l1抗体 |
MA47106A (fr) | 2016-12-21 | 2019-10-30 | Amgen Inc | Formulations d'anticorps anti-tnf alpha |
US20190389958A1 (en) * | 2017-01-31 | 2019-12-26 | Msm Protein Technologies, Inc. | Anti-cxcr4 antibodies |
US20200114017A1 (en) * | 2017-06-16 | 2020-04-16 | Bionomics Limited | Antibody drug conjugates that bind lgr5 |
JP2021505526A (ja) * | 2017-10-31 | 2021-02-18 | エーザイ・アール・アンド・ディー・マネジメント株式会社 | 少なくとも1つのスプライソソームモジュレーターと、bcl2阻害剤、bcl2/bclxl阻害剤及びbclxl阻害剤から選択される少なくとも1つの阻害剤とを含む組合せ、並びに使用の方法 |
US10144751B1 (en) | 2017-11-28 | 2018-12-04 | Eastman Chemical Company | Highly isoselective catalyst for alkene hydroformylation |
EP3695600A4 (en) | 2017-11-30 | 2020-08-19 | SZ DJI Technology Co., Ltd. | SYSTEM AND METHOD FOR CONTROLLING VIDEO ENCODING IN A FRAME OF IMAGE |
US10709763B2 (en) | 2017-12-19 | 2020-07-14 | Gpcr Therapeutics, Inc. | GPCR heteromer inhibitors and uses thereof |
KR102693317B1 (ko) | 2018-03-13 | 2024-08-07 | 푼다시온 파라 라 인베스티가시온 바이오메디카 델 호스피탈 우니베르시타리오 라 파즈 | 암 면역요법을 위한, 활성화되고 확장된 자연 킬러 세포와 조합된 항-cxcr4 항체 |
TWI831778B (zh) * | 2018-05-11 | 2024-02-11 | 澳門商同潤澳門一人有限公司 | 抗ox40的全人抗體及其製備方法和用途 |
CN115515585A (zh) | 2020-03-10 | 2022-12-23 | X4 制药有限公司 | 用于治疗中性粒细胞减少症的方法 |
US20230151104A1 (en) * | 2020-04-23 | 2023-05-18 | Remd Biotherapeutics, Inc. | Chemokine receptor 4 (cxcr4) antagonist antibodies |
JP2023525060A (ja) * | 2020-05-14 | 2023-06-14 | 江蘇恒瑞医薬股▲ふん▼有限公司 | 抗cd25抗体、その抗原結合断片及びその医薬用途 |
CN116333117B (zh) * | 2021-12-16 | 2024-04-26 | 徕特康(苏州)生物制药有限公司 | 抗表皮生长因子受体抗体及其制备方法和用途 |
WO2025029860A1 (en) * | 2023-08-03 | 2025-02-06 | Adcentrx Therapeutics Inc. | Drug conjugates and methods of preparing and using the same |
CN119462949B (zh) * | 2025-01-09 | 2025-04-01 | 中国农业科学院农业质量标准与检测技术研究所 | 一种抗β-内酰胺酶的抗体或其抗原结合片段、生物产品及其应用 |
Family Cites Families (164)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US3773919A (en) | 1969-10-23 | 1973-11-20 | Du Pont | Polylactide-drug mixtures |
US4554545A (en) | 1980-10-30 | 1985-11-19 | Mcdonnell Douglas Corporation | Conformal head-up display |
US4485045A (en) | 1981-07-06 | 1984-11-27 | Research Corporation | Synthetic phosphatidyl cholines useful in forming liposomes |
US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
US4544545A (en) | 1983-06-20 | 1985-10-01 | Trustees University Of Massachusetts | Liposomes containing modified cholesterol for organ targeting |
DE3343208A1 (de) | 1983-11-30 | 1985-06-05 | Bayer Ag, 5090 Leverkusen | Neue cephalosporine und verfahren zu ihrer herstellung |
EP0154316B1 (en) | 1984-03-06 | 1989-09-13 | Takeda Chemical Industries, Ltd. | Chemically modified lymphokine and production thereof |
US5807715A (en) | 1984-08-27 | 1998-09-15 | The Board Of Trustees Of The Leland Stanford Junior University | Methods and transformed mammalian lymphocyte cells for producing functional antigen-binding protein including chimeric immunoglobulin |
US4754065A (en) | 1984-12-18 | 1988-06-28 | Cetus Corporation | Precursor to nucleic acid probe |
US4683195A (en) | 1986-01-30 | 1987-07-28 | Cetus Corporation | Process for amplifying, detecting, and/or-cloning nucleic acid sequences |
US4683202A (en) | 1985-03-28 | 1987-07-28 | Cetus Corporation | Process for amplifying nucleic acid sequences |
US4676980A (en) | 1985-09-23 | 1987-06-30 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Target specific cross-linked heteroantibodies |
US4777127A (en) | 1985-09-30 | 1988-10-11 | Labsystems Oy | Human retrovirus-related products and methods of diagnosing and treating conditions associated with said retrovirus |
GB8601597D0 (en) | 1986-01-23 | 1986-02-26 | Wilson R H | Nucleotide sequences |
US4800159A (en) | 1986-02-07 | 1989-01-24 | Cetus Corporation | Process for amplifying, detecting, and/or cloning nucleic acid sequences |
US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
GB8702816D0 (en) | 1987-02-07 | 1987-03-11 | Al Sumidaie A M K | Obtaining retrovirus-containing fraction |
US5219740A (en) | 1987-02-13 | 1993-06-15 | Fred Hutchinson Cancer Research Center | Retroviral gene transfer into diploid fibroblasts for gene therapy |
US5677425A (en) | 1987-09-04 | 1997-10-14 | Celltech Therapeutics Limited | Recombinant antibody |
US5422120A (en) | 1988-05-30 | 1995-06-06 | Depotech Corporation | Heterovesicular liposomes |
AP129A (en) | 1988-06-03 | 1991-04-17 | Smithkline Biologicals S A | Expression of retrovirus gag protein eukaryotic cells |
GB8823869D0 (en) | 1988-10-12 | 1988-11-16 | Medical Res Council | Production of antibodies |
JP2919890B2 (ja) | 1988-11-11 | 1999-07-19 | メディカル リサーチ カウンスル | 単一ドメインリガンド、そのリガンドからなる受容体、その製造方法、ならびにそのリガンドおよび受容体の使用 |
US5047335A (en) | 1988-12-21 | 1991-09-10 | The Regents Of The University Of Calif. | Process for controlling intracellular glycosylation of proteins |
CA2006596C (en) | 1988-12-22 | 2000-09-05 | Rika Ishikawa | Chemically-modified g-csf |
US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
EP0832980B1 (en) | 1989-01-23 | 2002-06-19 | Chiron Corporation | Recombinant therapies for infection and hyperproliferative disorders |
EP0737750B1 (en) | 1989-03-21 | 2003-05-14 | Vical, Inc. | Expression of exogenous polynucleotide sequences in a vertebrate |
US6673776B1 (en) | 1989-03-21 | 2004-01-06 | Vical Incorporated | Expression of exogenous polynucleotide sequences in a vertebrate, mammal, fish, bird or human |
US5703055A (en) | 1989-03-21 | 1997-12-30 | Wisconsin Alumni Research Foundation | Generation of antibodies through lipid mediated DNA delivery |
US6291158B1 (en) | 1989-05-16 | 2001-09-18 | Scripps Research Institute | Method for tapping the immunological repertoire |
AU641673B2 (en) | 1989-06-29 | 1993-09-30 | Medarex, Inc. | Bispecific reagents for aids therapy |
DE3924128A1 (de) | 1989-07-20 | 1991-01-31 | Bosch Gmbh Robert | Steuereinrichtung zum stillsetzen einer brennkraftmaschine |
EP0487587A1 (en) | 1989-08-18 | 1992-06-03 | Chiron Corporation | Recombinant retroviruses delivering vector constructs to target cells |
US5585362A (en) | 1989-08-22 | 1996-12-17 | The Regents Of The University Of Michigan | Adenovirus vectors for gene therapy |
US5013556A (en) | 1989-10-20 | 1991-05-07 | Liposome Technology, Inc. | Liposomes with enhanced circulation time |
US5859205A (en) | 1989-12-21 | 1999-01-12 | Celltech Limited | Humanised antibodies |
NZ237464A (en) | 1990-03-21 | 1995-02-24 | Depotech Corp | Liposomes with at least two separate chambers encapsulating two separate biologically active substances |
US5427908A (en) | 1990-05-01 | 1995-06-27 | Affymax Technologies N.V. | Recombinant library screening methods |
US5864026A (en) | 1990-06-11 | 1999-01-26 | Nexstar Pharmaceuticals, Inc. | Systematic evolution of ligands by exponential enrichment: tissue selex |
US6261774B1 (en) | 1990-06-11 | 2001-07-17 | Gilead Sciences, Inc. | Truncation selex method |
US5763566A (en) | 1990-06-11 | 1998-06-09 | Nexstar Pharmaceuticals, Inc. | Systematic evolution of ligands by exponential enrichment: tissue SELEX |
US5789157A (en) | 1990-06-11 | 1998-08-04 | Nexstar Pharmaceuticals, Inc. | Systematic evolution of ligands by exponential enrichment: tissue selex |
US5712375A (en) | 1990-06-11 | 1998-01-27 | Nexstar Pharmaceuticals, Inc. | Systematic evolution of ligands by exponential enrichment: tissue selex |
US6172197B1 (en) | 1991-07-10 | 2001-01-09 | Medical Research Council | Methods for producing members of specific binding pairs |
GB9015198D0 (en) | 1990-07-10 | 1990-08-29 | Brien Caroline J O | Binding substance |
US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
EP0814159B1 (en) | 1990-08-29 | 2005-07-27 | GenPharm International, Inc. | Transgenic mice capable of producing heterologous antibodies |
US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
DK0564531T3 (da) | 1990-12-03 | 1998-09-28 | Genentech Inc | Berigelsesfremgangsmåde for variantproteiner med ændrede bindingsegenskaber |
US5278299A (en) | 1991-03-18 | 1994-01-11 | Scripps Clinic And Research Foundation | Method and composition for synthesizing sialylated glycosyl compounds |
EP0519596B1 (en) | 1991-05-17 | 2005-02-23 | Merck & Co. Inc. | A method for reducing the immunogenicity of antibody variable domains |
WO1994004679A1 (en) | 1991-06-14 | 1994-03-03 | Genentech, Inc. | Method for making humanized antibodies |
GB9115364D0 (en) | 1991-07-16 | 1991-08-28 | Wellcome Found | Antibody |
JP3534749B2 (ja) | 1991-08-20 | 2004-06-07 | アメリカ合衆国 | アデノウイルスが介在する胃腸管への遺伝子の輸送 |
CA2078539C (en) | 1991-09-18 | 2005-08-02 | Kenya Shitara | Process for producing humanized chimera antibody |
CA2119930C (en) | 1991-09-23 | 2002-10-01 | Hendricus R. J. M. Hoogenboom | Production of chimeric antibodies - a combinatorial approach |
ES2136092T3 (es) | 1991-09-23 | 1999-11-16 | Medical Res Council | Procedimientos para la produccion de anticuerpos humanizados. |
WO1993010218A1 (en) | 1991-11-14 | 1993-05-27 | The United States Government As Represented By The Secretary Of The Department Of Health And Human Services | Vectors including foreign genes and negative selective markers |
AU3144193A (en) | 1991-11-21 | 1993-06-15 | Board Of Trustees Of The Leland Stanford Junior University | Controlling degradation of glycoprotein oligosaccharides by extracellular glycosisases |
ATE408012T1 (de) | 1991-12-02 | 2008-09-15 | Medical Res Council | Herstellung von autoantikörpern auf phagenoberflächen ausgehend von antikörpersegmentbibliotheken |
EP1024191B8 (en) | 1991-12-02 | 2008-11-05 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
GB9125623D0 (en) | 1991-12-02 | 1992-01-29 | Dynal As | Cell modification |
US5714350A (en) | 1992-03-09 | 1998-02-03 | Protein Design Labs, Inc. | Increasing antibody affinity by altering glycosylation in the immunoglobulin variable region |
FR2688514A1 (fr) | 1992-03-16 | 1993-09-17 | Centre Nat Rech Scient | Adenovirus recombinants defectifs exprimant des cytokines et medicaments antitumoraux les contenant. |
US5733743A (en) | 1992-03-24 | 1998-03-31 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
EP0640094A1 (en) | 1992-04-24 | 1995-03-01 | The Board Of Regents, The University Of Texas System | Recombinant production of immunoglobulin-like domains in prokaryotic cells |
EP0650370A4 (en) | 1992-06-08 | 1995-11-22 | Univ California | METHODS AND COMPOSITIONS TARGETED ON SPECIFIC TISSUES. |
JPH09507741A (ja) | 1992-06-10 | 1997-08-12 | アメリカ合衆国 | ヒト血清による不活性化に耐性のあるベクター粒子 |
GB2269175A (en) | 1992-07-31 | 1994-02-02 | Imperial College | Retroviral vectors |
AU668423B2 (en) | 1992-08-17 | 1996-05-02 | Genentech Inc. | Bispecific immunoadhesins |
US6765087B1 (en) | 1992-08-21 | 2004-07-20 | Vrije Universiteit Brussel | Immunoglobulins devoid of light chains |
DE69232604T2 (de) | 1992-11-04 | 2002-11-07 | City Of Hope Duarte | Antikörperkonstrukte |
US6210671B1 (en) | 1992-12-01 | 2001-04-03 | Protein Design Labs, Inc. | Humanized antibodies reactive with L-selectin |
EP0673431A1 (en) | 1992-12-03 | 1995-09-27 | Genzyme Corporation | Gene therapy for cystic fibrosis |
US5618829A (en) | 1993-01-28 | 1997-04-08 | Mitsubishi Chemical Corporation | Tyrosine kinase inhibitors and benzoylacrylamide derivatives |
US5981568A (en) | 1993-01-28 | 1999-11-09 | Neorx Corporation | Therapeutic inhibitor of vascular smooth muscle cells |
US5759573A (en) | 1993-04-22 | 1998-06-02 | Depotech Corporation | Cyclodextrin liposomes encapsulating pharmacologic compounds and methods for their use |
DK0698097T3 (da) | 1993-04-29 | 2001-10-08 | Unilever Nv | Produktion af antistoffer eller (funktionaliserede) fragmenter deraf afledt af Camelidae-immunoglobuliner med tung kæde |
US6180377B1 (en) | 1993-06-16 | 2001-01-30 | Celltech Therapeutics Limited | Humanized antibodies |
CA2166118C (en) | 1993-06-24 | 2007-04-17 | Frank L. Graham | Adenovirus vectors for gene therapy |
KR960703622A (ko) | 1993-07-15 | 1996-08-31 | 수잔 포오덴 | 단백질 티로신 키나아제 억제제의 프로드러그(prodrugs of protein tyrosine kinase inhibitors) |
JPH09503657A (ja) | 1993-09-15 | 1997-04-15 | チロン ビアジーン インコーポレイティド | 組換えアルファウイルスベクター |
US6015686A (en) | 1993-09-15 | 2000-01-18 | Chiron Viagene, Inc. | Eukaryotic layered vector initiation systems |
ATE314482T1 (de) | 1993-10-25 | 2006-01-15 | Canji Inc | Rekombinante adenoviren-vektor und verfahren zur verwendung |
DK0729351T3 (da) | 1993-11-16 | 2000-10-16 | Skyepharma Inc | Vesikler med reguleret afgivelse af aktivstoffer |
SE9400088D0 (sv) | 1994-01-14 | 1994-01-14 | Kabi Pharmacia Ab | Bacterial receptor structures |
US6436908B1 (en) | 1995-05-30 | 2002-08-20 | Duke University | Use of exogenous β-adrenergic receptor and β-adrenergic receptor kinase gene constructs to enhance myocardial function |
CA2158977A1 (en) | 1994-05-09 | 1995-11-10 | James G. Respess | Retroviral vectors having a reduced recombination rate |
US5804396A (en) | 1994-10-12 | 1998-09-08 | Sugen, Inc. | Assay for agents active in proliferative disorders |
WO1996017072A2 (en) | 1994-11-30 | 1996-06-06 | Chiron Viagene, Inc. | Recombinant alphavirus vectors |
US5663149A (en) | 1994-12-13 | 1997-09-02 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Human cancer inhibitory pentapeptide heterocyclic and halophenyl amides |
US6121022A (en) | 1995-04-14 | 2000-09-19 | Genentech, Inc. | Altered polypeptides with increased half-life |
US5869046A (en) | 1995-04-14 | 1999-02-09 | Genentech, Inc. | Altered polypeptides with increased half-life |
WO1996034875A1 (en) | 1995-05-03 | 1996-11-07 | Nexstar Pharmaceuticals, Inc. | Systematic evolution of ligands by exponential enrichment: tissue selex |
US6013443A (en) | 1995-05-03 | 2000-01-11 | Nexstar Pharmaceuticals, Inc. | Systematic evolution of ligands by exponential enrichment: tissue SELEX |
US5639757A (en) | 1995-05-23 | 1997-06-17 | Pfizer Inc. | 4-aminopyrrolo[2,3-d]pyrimidines as tyrosine kinase inhibitors |
US6265150B1 (en) | 1995-06-07 | 2001-07-24 | Becton Dickinson & Company | Phage antibodies |
ES2174250T5 (es) | 1996-04-12 | 2010-04-21 | Warner-Lambert Company Llc | Inhibidores irreversibles de tirosina quinasas. |
WO1997042338A1 (en) | 1996-05-06 | 1997-11-13 | Chiron Corporation | Crossless retroviral vectors |
US6277375B1 (en) | 1997-03-03 | 2001-08-21 | Board Of Regents, The University Of Texas System | Immunoglobulin-like domains with increased half-lives |
GB2339430A (en) | 1997-05-21 | 2000-01-26 | Biovation Ltd | Method for the production of non-immunogenic proteins |
ZA986732B (en) | 1997-07-29 | 1999-02-02 | Warner Lambert Co | Irreversible inhibitiors of tyrosine kinases |
US6100254A (en) | 1997-10-10 | 2000-08-08 | Board Of Regents, The University Of Texas System | Inhibitors of protein tyrosine kinases |
AU9692198A (en) | 1997-10-10 | 1999-05-03 | Kevin J. Donahue | Gene delivery compositions and methods |
GB9722131D0 (en) | 1997-10-20 | 1997-12-17 | Medical Res Council | Method |
GB9809951D0 (en) | 1998-05-08 | 1998-07-08 | Univ Cambridge Tech | Binding molecules |
WO2000009560A2 (en) | 1998-08-17 | 2000-02-24 | Abgenix, Inc. | Generation of modified molecules with increased serum half-lives |
US6737056B1 (en) | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
GB9901441D0 (en) | 1999-01-23 | 1999-03-10 | Dolcan Limited | Crossbows |
US6740665B1 (en) | 1999-02-10 | 2004-05-25 | Ramachandran Murali | Tyrosine kinase inhibitors and methods of using the same |
WO2000053211A2 (en) | 1999-03-09 | 2000-09-14 | University Of Southern California | Method of promoting myocyte proliferation and myocardial tissue repair |
US6245759B1 (en) | 1999-03-11 | 2001-06-12 | Merck & Co., Inc. | Tyrosine kinase inhibitors |
AU6605200A (en) | 1999-06-30 | 2001-01-31 | Merck & Co., Inc. | Src kinase inhibitor compounds |
CA2376951A1 (en) | 1999-06-30 | 2001-01-04 | Peter J. Sinclair | Src kinase inhibitor compounds |
DE60006541D1 (de) | 1999-06-30 | 2003-12-18 | Merck & Co Inc | Src-kinase hemmende verbindungen |
US6387620B1 (en) | 1999-07-28 | 2002-05-14 | Gilead Sciences, Inc. | Transcription-free selex |
US6334459B1 (en) | 1999-08-11 | 2002-01-01 | Leon Berger | Multi-fuctional brake bleeder tool |
BR0013899A (pt) | 1999-09-10 | 2003-07-08 | Merck & Co Inc | Composto, composição farmacêutica, processos de tratamento ou prevenção de câncer, de uma doença em que a angiogênese esteja implicada, da vascularização retinal, da retinopatia diabética, da degeneração macular relacionada a idade, de doenças inflamatórias, de uma doença ou condições dependentes da tirosina quinase, de patologias associadas com ossos, e, processos para produzir uma composição farmacêutica, e de reduzir ou prevenir dano tecidual em seguida a um evento isquêmico cerebral |
US6849425B1 (en) | 1999-10-14 | 2005-02-01 | Ixsys, Inc. | Methods of optimizing antibody variable region binding affinity |
NZ518001A (en) | 1999-10-19 | 2004-05-28 | Merck & Co Inc | Tyrosine kinase inhibitors |
AU778042B2 (en) | 1999-10-19 | 2004-11-11 | Merck & Co., Inc. | Tyrosine kinase inhibitors |
US6794393B1 (en) | 1999-10-19 | 2004-09-21 | Merck & Co., Inc. | Tyrosine kinase inhibitors |
US6313138B1 (en) | 2000-02-25 | 2001-11-06 | Merck & Co., Inc. | Tyrosine kinase inhibitors |
US6420382B2 (en) | 2000-02-25 | 2002-07-16 | Merck & Co., Inc. | Tyrosine kinase inhibitors |
WO2002061087A2 (en) | 2000-12-19 | 2002-08-08 | Lifespan Biosciences, Inc. | Antigenic peptides, such as for g protein-coupled receptors (gpcrs), antibodies thereto, and systems for identifying such antigenic peptides |
US20050089932A1 (en) | 2001-04-26 | 2005-04-28 | Avidia Research Institute | Novel proteins with targeted binding |
US20050048512A1 (en) | 2001-04-26 | 2005-03-03 | Avidia Research Institute | Combinatorial libraries of monomer domains |
DK1390535T3 (da) | 2001-04-26 | 2010-12-06 | Amgen Mountain View Inc | Kombinatoriske biblioteker af monomer-domæner |
US20060223114A1 (en) | 2001-04-26 | 2006-10-05 | Avidia Research Institute | Protein scaffolds and uses thereof |
US20050053973A1 (en) | 2001-04-26 | 2005-03-10 | Avidia Research Institute | Novel proteins with targeted binding |
US20030157561A1 (en) | 2001-11-19 | 2003-08-21 | Kolkman Joost A. | Combinatorial libraries of monomer domains |
US20040175756A1 (en) | 2001-04-26 | 2004-09-09 | Avidia Research Institute | Methods for using combinatorial libraries of monomer domains |
JP2004535437A (ja) | 2001-06-22 | 2004-11-25 | メルク エンド カムパニー インコーポレーテッド | チロシンキナーゼ阻害剤 |
ATE477280T1 (de) | 2001-06-28 | 2010-08-15 | Domantis Ltd | Doppelspezifischer ligand und dessen verwendung |
WO2003011836A1 (en) | 2001-08-01 | 2003-02-13 | Merck & Co., Inc. | Tyrosine kinase inhibitors |
JP2005509408A (ja) | 2001-08-10 | 2005-04-14 | トピジェン・ファルマスーティック・インコーポレーテッド | 細胞ウイルス受容体およびその使用方法 |
US6927293B2 (en) | 2001-08-30 | 2005-08-09 | Merck & Co., Inc. | Tyrosine kinase inhibitors |
JP2005512044A (ja) | 2001-12-03 | 2005-04-28 | アブジェニックス・インコーポレーテッド | 結合特性に基づく抗体分類 |
SI1517921T1 (sl) | 2002-06-28 | 2006-10-31 | Domantis Ltd | Dvojno-specificni ligandi z zvisano serumsko razpolovno dobo |
NZ540730A (en) | 2002-12-24 | 2010-09-30 | Rinat Neuroscience Corp | Anti-NGF antibodies and methods using same |
EP1578801A2 (en) | 2002-12-27 | 2005-09-28 | Domantis Limited | Dual specific single domain antibodies specific for a ligand and for the receptor of the ligand |
JP4889493B2 (ja) | 2003-05-14 | 2012-03-07 | ドマンティス リミテッド | ポリペプチドレパートリーから可逆的にアンフォールドするポリペプチドを回収するための方法 |
SI1639011T1 (sl) | 2003-06-30 | 2009-04-30 | Domantis Ltd | Pegilirana protitelesa z enojno domeno (dAb) |
EP1675878A2 (en) | 2003-10-24 | 2006-07-05 | Avidia, Inc. | Ldl receptor class a and egf domain monomers and multimers |
US20060008844A1 (en) | 2004-06-17 | 2006-01-12 | Avidia Research Institute | c-Met kinase binding proteins |
JP2008520207A (ja) | 2004-11-16 | 2008-06-19 | アヴィディア リサーチ インスティテュート | タンパク質骨格およびその使用 |
US8329178B2 (en) * | 2005-02-18 | 2012-12-11 | Dana-Farber Cancer Institute, Inc. | Antibodies against CXCR4 and methods of use thereof |
WO2006113546A2 (en) | 2005-04-15 | 2006-10-26 | Neogenix Oncology, Inc. | Recombinant monoclonal antibodies and corresponding antigens for colon and pancreatic cancers |
CA2649253A1 (en) * | 2005-05-25 | 2006-11-30 | Hadasit Medical Research Services & Development Ltd. | Cxcr4 antagonists for wound healing and re-epithelialization |
US20070191272A1 (en) | 2005-09-27 | 2007-08-16 | Stemmer Willem P | Proteinaceous pharmaceuticals and uses thereof |
WO2007059782A1 (en) | 2005-11-28 | 2007-05-31 | Genmab A/S | Recombinant monovalent antibodies and methods for production thereof |
US7964191B2 (en) * | 2006-02-02 | 2011-06-21 | Allergan, Inc. | Compositions and methods for the treatment of ophthalmic disease |
LT2486941T (lt) * | 2006-10-02 | 2017-06-12 | E. R. Squibb & Sons, L.L.C. | Žmogaus antikūnai, kurie jungiasi prie cxcr4, ir jų panaudojimas |
EP2237798A2 (en) * | 2007-12-12 | 2010-10-13 | Imperial Innovations Limited | Methods |
EP2172485A1 (en) * | 2008-10-01 | 2010-04-07 | Pierre Fabre Medicament | Novel anti CXCR4 antibodies and their use for the treatment of cancer |
WO2011054899A1 (en) | 2009-11-04 | 2011-05-12 | Dsm Ip Assets B.V. | Talaromyces transformants |
EP2371863A1 (en) * | 2010-03-30 | 2011-10-05 | Pierre Fabre Médicament | Humanized anti CXCR4 antibodies for the treatment of cancer |
JP6022444B2 (ja) | 2010-05-14 | 2016-11-09 | ライナット ニューロサイエンス コーポレイション | ヘテロ二量体タンパク質ならびにそれを生産および精製するための方法 |
WO2012059882A2 (en) | 2010-11-05 | 2012-05-10 | Rinat Neuroscience Corporation | Engineered polypeptide conjugates and methods for making thereof using transglutaminase |
US20140120555A1 (en) * | 2011-06-20 | 2014-05-01 | Pierre Fabre Medicament | Anti-cxcr4 antibody with effector functions and its use for the treatment of cancer |
AU2012338436B2 (en) | 2011-11-17 | 2015-09-03 | Pfizer Inc. | Cytotoxic peptides and antibody drug conjugates thereof |
-
2014
- 2014-07-28 PE PE2016000212A patent/PE20160671A1/es unknown
- 2014-07-28 AR ARP140102816A patent/AR097102A1/es unknown
- 2014-07-28 EP EP22156452.9A patent/EP4050033A1/en not_active Withdrawn
- 2014-07-28 PE PE2020001896A patent/PE20211093A1/es unknown
- 2014-07-28 SG SG11201600171SA patent/SG11201600171SA/en unknown
- 2014-07-28 BR BR112016002008-1A patent/BR112016002008B1/pt not_active IP Right Cessation
- 2014-07-28 TW TW103125754A patent/TWI623551B/zh not_active IP Right Cessation
- 2014-07-28 JP JP2016530645A patent/JP6506280B2/ja not_active Expired - Fee Related
- 2014-07-28 MY MYPI2016700312A patent/MY190252A/en unknown
- 2014-07-28 KR KR1020167005526A patent/KR101809072B1/ko active Active
- 2014-07-28 CN CN202011190985.0A patent/CN113683695A/zh active Pending
- 2014-07-28 EP EP14771627.8A patent/EP3027653A2/en not_active Withdrawn
- 2014-07-28 TW TW106101264A patent/TWI671317B/zh not_active IP Right Cessation
- 2014-07-28 WO PCT/IB2014/063483 patent/WO2015015401A2/en active Application Filing
- 2014-07-28 RU RU2016103157A patent/RU2675516C2/ru active
- 2014-07-28 KR KR1020177035455A patent/KR20170140424A/ko not_active Ceased
- 2014-07-28 CA CA2919790A patent/CA2919790C/en active Active
- 2014-07-28 CN CN201480043780.6A patent/CN106211774B/zh active Active
- 2014-07-28 AU AU2014298040A patent/AU2014298040B2/en not_active Ceased
- 2014-07-28 MX MX2016001485A patent/MX371455B/es active IP Right Grant
- 2014-07-28 KR KR1020187030501A patent/KR102048718B1/ko active Active
- 2014-08-01 US US14/449,478 patent/US9708405B2/en active Active
-
2016
- 2016-01-12 ZA ZA2016/00246A patent/ZA201600246B/en unknown
- 2016-01-29 PH PH12016500215A patent/PH12016500215A1/en unknown
- 2016-02-01 SA SA516370515A patent/SA516370515B1/ar unknown
- 2016-02-01 IL IL243900A patent/IL243900B/en unknown
-
2017
- 2017-05-31 US US15/610,417 patent/US10144781B2/en active Active
- 2017-09-13 ZA ZA2017/06241A patent/ZA201706241B/en unknown
- 2017-11-29 AU AU2017268595A patent/AU2017268595B2/en not_active Ceased
-
2018
- 2018-10-22 US US16/166,830 patent/US10421815B2/en active Active
-
2019
- 2019-03-28 JP JP2019064359A patent/JP2019141059A/ja active Pending
- 2019-08-08 US US16/535,477 patent/US10927178B2/en not_active Expired - Fee Related
Also Published As
Similar Documents
Publication | Publication Date | Title |
---|---|---|
KR101809072B1 (ko) | 항-cxcr4 항체 및 항체-약물 접합체 | |
RU2708075C2 (ru) | Конъюгаты анти-ртк7 антитело-лекарственное средство | |
RU2766582C2 (ru) | Иммунотерапия с применением антител, связывающих лиганд 1 белка программируемой смерти клеток (PD-L1) | |
AU2014298040A9 (en) | Anti-CXCR4 antibodies and antibody-drug conjugates | |
KR20140091040A (ko) | Trop-2에 특이적인 항체 및 그의 용도 | |
US20230151104A1 (en) | Chemokine receptor 4 (cxcr4) antagonist antibodies | |
HK1229353B (zh) | 抗cxcr4抗體及抗體-藥物綴合物 | |
HK1229353A1 (en) | Anti-cxcr4 antibodies and antibody-drug conjugates | |
BR122016023010A2 (pt) | anticorpos anti-cxcr4 e conjugados anticorpo-fármaco, uso e métodos para produzir os mesmos, composição farmacêutica, polinucleotídeo isolado, vetor e célula hospedeira isolada |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
A201 | Request for examination | ||
PA0105 | International application |
Patent event date: 20160229 Patent event code: PA01051R01D Comment text: International Patent Application |
|
PA0201 | Request for examination | ||
PG1501 | Laying open of application | ||
E902 | Notification of reason for refusal | ||
PE0902 | Notice of grounds for rejection |
Comment text: Notification of reason for refusal Patent event date: 20170414 Patent event code: PE09021S01D |
|
E701 | Decision to grant or registration of patent right | ||
PE0701 | Decision of registration |
Patent event code: PE07011S01D Comment text: Decision to Grant Registration Patent event date: 20170908 |
|
A107 | Divisional application of patent | ||
GRNT | Written decision to grant | ||
PA0104 | Divisional application for international application |
Comment text: Divisional Application for International Patent Patent event code: PA01041R01D Patent event date: 20171208 |
|
PR0701 | Registration of establishment |
Comment text: Registration of Establishment Patent event date: 20171208 Patent event code: PR07011E01D |
|
PR1002 | Payment of registration fee |
Payment date: 20171211 End annual number: 3 Start annual number: 1 |
|
PG1601 | Publication of registration | ||
PR1001 | Payment of annual fee |
Payment date: 20201005 Start annual number: 4 End annual number: 4 |
|
PR1001 | Payment of annual fee |
Payment date: 20210929 Start annual number: 5 End annual number: 5 |
|
PR1001 | Payment of annual fee |
Payment date: 20220921 Start annual number: 6 End annual number: 6 |
|
PR1001 | Payment of annual fee |
Payment date: 20230921 Start annual number: 7 End annual number: 7 |