EP3209681B1 - Pharmaceutical compositions comprising peptide variants and methods of use thereof - Google Patents
Pharmaceutical compositions comprising peptide variants and methods of use thereof Download PDFInfo
- Publication number
- EP3209681B1 EP3209681B1 EP15853394.3A EP15853394A EP3209681B1 EP 3209681 B1 EP3209681 B1 EP 3209681B1 EP 15853394 A EP15853394 A EP 15853394A EP 3209681 B1 EP3209681 B1 EP 3209681B1
- Authority
- EP
- European Patent Office
- Prior art keywords
- seq
- peptide
- pharmaceutical composition
- disorder
- fgf19
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Active
Links
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/18—Growth factors; Growth regulators
- A61K38/1825—Fibroblast growth factor [FGF]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/06—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
- A61K47/16—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing nitrogen, e.g. nitro-, nitroso-, azo-compounds, nitriles, cyanates
- A61K47/18—Amines; Amides; Ureas; Quaternary ammonium compounds; Amino acids; Oligopeptides having up to five amino acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/06—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
- A61K47/26—Carbohydrates, e.g. sugar alcohols, amino sugars, nucleic acids, mono-, di- or oligo-saccharides; Derivatives thereof, e.g. polysorbates, sorbitan fatty acid esters or glycyrrhizin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/08—Solutions
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/12—Antidiarrhoeals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/14—Prodigestives, e.g. acids, enzymes, appetite stimulants, antidyspeptics, tonics, antiflatulents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/16—Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/18—Drugs for disorders of the alimentary tract or the digestive system for pancreatic disorders, e.g. pancreatic enzymes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P15/00—Drugs for genital or sexual disorders; Contraceptives
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/02—Nutrients, e.g. vitamins, minerals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/04—Anorexiants; Antiobesity agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/06—Antihyperlipidemics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/475—Growth factors; Growth regulators
- C07K14/50—Fibroblast growth factor [FGF]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/14—Particulate form, e.g. powders, Processes for size reducing of pure drugs or the resulting products, Pure drug nanoparticles
- A61K9/19—Particulate form, e.g. powders, Processes for size reducing of pure drugs or the resulting products, Pure drug nanoparticles lyophilised, i.e. freeze-dried, solutions or dispersions
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
Definitions
- compositions comprising a fusion of FGF19 and/or fibroblast growth factor 21 (FGF21) peptide sequences.
- FGF21 fibroblast growth factor 21
- the pharmaceutical compositions for use in preventing, treating, or managing various diseases and disorders are also provided herein.
- Drug substances are usually administered as part of a formulation in combination with one or more other agents that serve varied and specialized pharmaceutical functions. Dosage forms of various types may be made through selective use of pharmaceutical excipients. As pharmaceutical excipients have various functions and contribute to the pharmaceutical formulations in many different ways, e.g ., solubilization, dilution, thickening, stabilization, preservation, coloring, flavoring, etc. The properties that are commonly considered when formulating an active drug substance include bioavailability, ease of manufacture, ease of administration, and stability of the dosage form. Due to the varying properties of active drug substances being formulated, dosage forms typically require pharmaceutical excipients that are uniquely tailored to the active drug substance in order to achieve advantageous physical and pharmaceutical properties.
- International patent application publication number WO 2014/085365 A2 relates to variants and fusions of fibroblast growth factor 19 (FGF19), variants and fusions of fibroblast growth factor 21 (FGF21), fusions of FGF19 and/or FGF21, and variants or fusions of FGF19 and/or FGF21 proteins and peptide sequences (and peptidomimetics), having one or more activities, such as glucose lowering activity, and methods for and uses in treatment of hyperglycemia and other disorders.
- FGF19 fibroblast growth factor 19
- FGF21 fibroblast growth factor 21
- FGF19 and/or FGF21 fusions of FGF19 and/or FGF21 proteins and peptide sequences (and peptidomimetics
- International patent application publication number WO 2014/105939 A1 relates to variants and fusions of fibroblast growth factor 19 (FGF19), variants and fusions of fibroblast growth factor 21 (FGF21), fusions of FGF19 and/or FGF21, and variants or fusions of FGF19 and/or FGF21 proteins and peptide sequences (and peptidomimetics), having one or more activities, such as bile acid homeostasis modulating activity, and methods for and uses in treatment of bile acid and other disorders.
- FGF19 fibroblast growth factor 19
- FGF21 fibroblast growth factor 21
- FGF19 and/or FGF21 fusions of FGF19 and/or FGF21 proteins and peptide sequences (and peptidomimetics
- International patent application publication number WO 2013/006486 A2 relates to variants and fusions of fibroblast growth factor 19 (FGF19), variants and fusions of fibroblast growth factor 21 (FGF21), fusions of fibroblast growth factor 19 (FGF19) and/or fibroblast growth factor 21 (FGF21), and variants or fusions of fibroblast growth factor 19 (FGF19) and/or fibroblast growth factor 21 (FGF21) proteins and peptide sequences (and peptidomimetics), having one or more activities, such as glucose lowering activity, and methods for and uses in treatment of hyperglycemia and other disorders.
- United States patent application publication number US 2010/240587 A1 relates to a soluble pharmaceutical composition for parenteral administration, which comprises an amylin peptide and an anionic surfactant, and methods for treatment of hyperglycemia.
- formulations and dosage forms comprising variants of fibroblast growth factor 19 (FGF19) proteins and peptide sequences (and peptidomimetics) and fusions of FGF19 and/or fibroblast growth factor 21 (FGF21) proteins and peptide sequences (and peptidomimetics), and variants of fusions of FGF19 and/or FGF21 proteins and peptide sequences (and peptidomimetics).
- FGF19 fibroblast growth factor 19
- FGF21 fibroblast growth factor 21
- variants of fusions of FGF19 and/or FGF21 proteins and peptide sequences (and peptidomimetics) are useful in treating, preventing and/or managing various disease or disorders, including, but not limited to, bile acid-related or associated disorders, hyperglycemic conditions, insulin resistance, hyperinsulinemia, glucose intolerance, metabolic syndrome, and metabolic diseases, as well as certain cancers.
- the invention provides a pharmaceutical composition, comprising: (a) a peptide having an amino acid sequence consisting of SEQ ID NO:70 at a concentration of from 1 to 10 mg/mL; and (b) a pharmaceutically acceptable carrier comprising: (i) Tris that is present in a range of between 5 and 50 mM, (ii) trehalose that is present in the range of between 1 and 20% (w/v), and (iii) polysorbate-20 (TWEEN-20) that is present in the range of from 0.001 to 0.1% (v/v), wherein the composition does not comprise NaCl.
- a pharmaceutically acceptable carrier comprising: (i) Tris that is present in a range of between 5 and 50 mM, (ii) trehalose that is present in the range of between 1 and 20% (w/v), and (iii) polysorbate-20 (TWEEN-20) that is present in the range of from 0.001 to 0.1% (v/v), wherein the composition does not comprise NaCl.
- the peptide is at a concentration of 1 mg/mL; the peptide is at a concentration of 5 mg/mL; or the peptide is at a concentration of 10 mg/mL.
- the Tris is present in a range of 15 and 40 mM, 20 and 35 mM, 20 and 30 mM, or 20 and 25 mM. In a further embodiment, the Tris is present at 20 mM or in another embodiment a formulation volume of 1000 mL comprises 2.0, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9 or 3.0 g of Tris, or any range thereof, wherein preferably a formulation volume of 1000 mL comprises from 2.4 to 2.5 g of Tris.
- the trehalose is present in a range of 2 and 15%, 3 and 10%, 4 and 9.5%, 5 and 9.25%, 6 and 9%, 7 and 8.5%, 8 and 8.4%, or 8.1 and 8.3%.
- the trehalose preferable is present at 8.2%, 8.3% or 8.4%.
- a formulation volume of 1000 mL comprises 92.0, 92.1, 92.2, 92.3, 92.4, 92.5, 92.6, 92.7, 92.8, 92.9 or 93.0 g of trehalose dehydrate.
- a formulation volume of 1000 mL comprises from 92.4 to 92.5 g of trehalose dehydrate.
- the molarity of the trehalose dehydrate is from 240 to 300 mM, 240 to 290 mM, 250 to 290 mM, 260 to 290 mM, 270 to 290 mM, or 244 to 245 mM. In a further embodiment, the molarity of the trehalose dehydrate is about 280 mM.
- the concentration of TWEEN-20 is in a range of from 0.0025 to 0.075% (v/v), 0.005 to 0.05% (v/v), or 0.0075 to 0.025% (v/v). In a further embodiment, the concentration of TWEEN-20 is preferably 0.01% (v/v).
- the pharmaceutical composition has a pH in a range of 6.5 and 9.5, 6.8 and 9.3, 7.0 and 9.0, 7.3 and 8.7, 7.5 and 8.5, or 7.7 and 8.2.
- the pharmaceutical composition preferably has a pH of 7.3, 7.5, 8.0, or 8.5.
- the pH is taken at 4°C or 25°C.
- the pH is 8.0 at 25°C.
- the composition comprises: (i) 20 mM Tris, 8.37% (w/v) trehalose, and 0.01% TWEEN-20, wherein optionally the pH is 8.0 at 25°C; (ii) 20 mM Tris, 8.2% (w/v) trehalose, and 0.01% TWEEN-20, wherein optionally the pH is 8.0 at 25°C; or (iii) 20 mM Tris, 280 mM trehalose, and 0.01% TWEEN-20, wherein optionally the pH is 8.0 at 25°C.
- the pharmaceutically acceptable carrier comprises: 20 mM Tris, from 8.2% to 8.4% (w/v) trehalose, and 0.01% TWEEN-20, wherein the pH is 8.0 at 25°C.
- the pharmaceutically acceptable carrier comprises: 20 mM Tris, from 9.2% to 9.3% (w/v) trehalose, and 0.01% TWEEN-20, wherein the pH is 8.0 at 25°C.
- the composition comprises: (i) the peptide at a concentration of 1 mg/mL; (ii) the peptide at a concentration of 5 mg/mL; or (iii) the peptide at a concentration of 10 mg/mL.
- the peptide is fused with an immunoglobulin Fc region.
- the composition is in a liquid form. In other embodiment, less than 20%, less than 15%, less than 10%, less than 5% or less than 2% of the peptide aggregates after a period of time. In further embodiments, the period of time is 1 day, 7 days, 14 days, 28 days, 2 months, 3 months, 4 months, 5 months, 6 months, 7 months, 8 months, 9 months, 10 months, 11, months, 12 months, 18 months, 24 months or longer.
- the pharmaceutical composition is stored at -80°C, 4°C, 25°C or 37°C.
- the composition is provided in a single-use container or a multi-use container, wherein optionally the single-use container is a single-use vial, ampoule, syringe, or autoinjector.
- the invention provides a pharmaceutical composition as defined in the first aspect for use in a method of preventing, treating or managing a disease or disorder in a subject in need thereof, wherein the disease or disorder is a metabolic disease or disorder, a disorder involving the distal small intestine, ileal resection, inflammatory bowel diseases, Crohn's disease, ulcerative colitis, idiopathic disorders impairing absorption of bile acids, diarrhea, GI symptoms, a FGF19-dependent cancer or tumor cirrhosis, portal hypertension, and combinations thereof.
- the metabolic disease or disorder comprises a hyperglycemic condition, insulin resistance, hyperinsulinemia, glucose intolerance or a metabolic syndrome.
- the hyperglycemic condition comprises diabetes, wherein preferably the diabetes is insulin-dependent (type I) diabetes, type II diabetes, or gestational diabetes.
- the FGF19-dependent cancer or tumor is a hepatocellular carcinoma, colon cancer or tumor, GI cancer, liver cancer, or biliary cancer.
- the invention further provides a pharmaceutical composition as defined in the first aspect for use in a method of preventing, treating or managing a disease or disorder in a subject in need thereof, wherein the disease or disorder comprises bile acid synthesis abnormalities, bile acid malabsorption, bile acid diarrhea (BAD), cholestasis, intrahepatic cholestasis, pregnancy intrahepatic cholestasis (PIC), neonatal cholestasis, and drug induced cholestasis, diseases of extrahepatic cholestasis, bile cut compression from tumor, bile duct blockade by gall stones, primary biliary cirrhosis (PBC), primary sclerosing choangitis (PSC), primary familial intrahepatic cholestasis (PFIC), or progressive PFIC.
- the disease or disorder comprises non-alcoholic steatohepatitis (NASH).
- the pharmaceutical composition is lyophilized.
- the compositions comprise less than 20%, less than 15%, less than 10%, less than 5% or less than 2% of peptide aggregates after a period of time.
- the aggregates are measured using an assay provided herein ( e.g., in the Experimental section).
- the composition comprises less than 20% of peptide aggregates after a period of time.
- the composition comprises less than 15% of peptide aggregates after a period of time.
- the composition comprises less than 10% of peptide aggregates after a period of time.
- the composition comprises less than 5% of peptide aggregates after a period of time.
- the composition comprises less than 2% of peptide aggregates after a period of time. In one embodiment of the various pharmaceutical compositions provided herein, the compositions comprise less than 20%, less than 15%, less than 10%, less than 5% or less than 2% of peptide precipitates after a period of time. In some embodiments, the precipitates are measured using an assay provided herein ( e.g., in the Experimental section). In one embodiment, the composition comprises less than 20% of peptide precipitates after a period of time. In one embodiment, the composition comprises less than 15% of peptide precipitates after a period of time. In one embodiment, the composition comprises less than 10% of peptide precipitates after a period of time.
- the composition comprises less than 5% of peptide precipitates after a period of time. In one embodiment, the composition comprises less than 2% of peptide precipitates after a period of time. In certain embodiments. the period of time is 1 day, 7 days, 14 days, 28 days, 2 months, 3 months, 4 months, 5 months, 6 months, 7 months, 8 months, 9 months, 10 months, 11, months, 12 months, 18 months, 24 months or longer. In one embodiment, the period of time is 1 day. In one embodiment, the period of time is 7 days. In one embodiment, the period of time is 14 days. In one embodiment, the period of time is 21 days. In one embodiment, the period of time is 1 month. In one embodiment, the period of time is 2 months.
- the period of time is 3 months. In one embodiment, the period of time is 4 months. In one embodiment, the period of time is 5 months. In one embodiment, the period of time is 6 months. In one embodiment, the period of time is 7 months. In one embodiment, the period of time is 8 months. In one embodiment, the period of time is 9 months. In one embodiment, the period of time is 10 months. In one embodiment, the period of time is 11 months. In one embodiment, the period of time is 12 months. In one embodiment, the period of time is 18 months. In one embodiment, the period of time is 24 months. In some embodiments, the pharmaceutical composition is stored at -80°C. In one embodiment, the pharmaceutical composition is stored at 4°C. In some embodiments, the pharmaceutical composition is stored at 25°C. In one embodiment, the pharmaceutical composition is stored at 37°C.
- the peptide of the invention is assessed to ensure that it does not cause untoward adverse effects in the subject.
- the combination of the peptide and at least one additional therapeutic agent or treatment modality is assessed to ensure that it does not induce HCC in the subject.
- assessments may be performed before initiation of therapy (e.g., in a dose escalation study), during therapy, ( e.g., by evaluating a marker correlating with HCC activity), or subsequent to termination of therapy ( e.g ., by performing a liver biopsy).
- the assessment is performed in a suitable test environment (e.g. , a validated animal model).
- One of ordinary skill in the art is familiar with additional means for ensuring that the combination therapy described herein is suitable for the particular subject, or a subject population representative of the particular subject, taking into consideration all relevant factors including, for example, the severity of the subject's bile acid-related or associated disorder (e.g., PBC) and the other medications be taken by the subject.
- PBC bile acid-related or associated disorder
- patient or “subject” are used interchangeably to refer to a human or a non-human animal (e.g., a mammal).
- treat refers to a course of action (such as administering a polypeptide or a pharmaceutical composition comprising a polypeptide) initiated after a disease, disorder or condition, or a symptom thereof, has been diagnosed, observed, and the like so as to eliminate, reduce, suppress, mitigate, or ameliorate, either temporarily or permanently, at least one of the underlying causes of a disease, disorder, or condition afflicting a subject, or at least one of the symptoms associated with a disease, disorder, condition afflicting a subject.
- treatment includes inhibiting ( i.e., arresting the development or further development of the disease, disorder or condition or clinical symptoms association therewith) an active disease.
- in need of treatment refers to a judgment made by a physician or other medical professional that a subject requires or will benefit from treatment.
- prevent refers to a course of action (such as administering a polypeptide or a pharmaceutical composition comprising a polypeptide) initiated in a manner ( e.g ., prior to the onset of a disease, disorder, condition or symptom thereof) so as to prevent, suppress, inhibit or reduce, either temporarily or permanently, a subject's risk of developing a disease, disorder, condition or the like (as determined by, for example, the absence of clinical symptoms) or delaying the onset thereof, generally in the context of a subject predisposed to having a particular disease, disorder or condition. In certain instances, the terms also refer to slowing the progression of the disease, disorder or condition or inhibiting progression thereof to a harmful or otherwise undesired state.
- in need of prevention refers to a judgment made by a physician or other medical professional that a subject requires or will benefit from preventative care.
- therapeutically effective amount refers to the administration of an agent to a subject, either alone or as a part of a pharmaceutical composition and either in a single dose or as part of a series of doses, in an amount that is capable of having any detectable, positive effect on any symptom, aspect, or characteristics of a disease, disorder or condition when administered to a patient.
- the therapeutically effective amount can be ascertained by measuring relevant physiological effects. For example, in the case of a hyperglycemic condition, a lowering or reduction of blood glucose or an improvement in glucose tolerance test can be used to determine whether the amount of an agent is effective to treat the hyperglycemic condition.
- a therapeutically effective amount is an amount sufficient to reduce or decrease any level (e.g., a baseline level) of fasting plasma glucose (FPG), wherein, for example, the amount is sufficient to reduce a FPG level greater than 200 mg/dl to less than 200 mg/dl, wherein the amount is sufficient to reduce a FPG level between 175 mg/dl and 200 mg/dl to less than the starting level, wherein the amount is sufficient to reduce a FPG level between 150 mg/dl and 175 mg/dl to less than the starting level, wherein the amount is sufficient to reduce a FPG level between 125 mg/dl and 150 mg/dl to less than the starting level, and so on ( e.g., reducing FPG levels to less than 125 mg/dl, to less than 120 mg/dl, to less than 115 mg/dl, to less than 110 mg/dl, etc.
- FPG fasting plasma glucose
- the effective amount is an amount sufficient to reduce or decrease levels by more than about 10% to 9%, by more than about 9% to 8%, by more than about 8% to 7%, by more than about 7% to 6%, by more than about 6% to 5%, and so on. More particularly, a reduction or decrease of HbAIc levels by about 0.1%, 0.25%, 0.4%, 0.5%, 0.6%, 0.7%, 0.8%, 0.9%, 1%, 1.5%, 2%, 3%, 4%, 5%, 10%, 20%, 30%, 33%, 35%, 40%, 45%, 50%, or more is contemplated by the present disclosure.
- the therapeutically effective amount can be adjusted in connection with the dosing regimen and diagnostic analysis of the subject's condition and the like.
- in a sufficient amount to effect a change means that there is a detectable difference between a level of an indicator measured before (e.g., a baseline level) and after administration of a particular therapy.
- Indicators include any objective parameter (e.g ., level of glucose or insulin) or subjective parameter (e.g ., a subject's feeling of well-being).
- glucose tolerance refers to the ability of a subject to control the level of plasma glucose and/or plasma insulin when glucose intake fluctuates.
- glucose tolerance encompasses the subject's ability to reduce, within about 120 minutes, the level of plasma glucose back to a level determined before the intake of glucose.
- the terms “diabetes” and “diabetic” refer to a progressive disease of carbohydrate metabolism involving inadequate production or utilization of insulin, frequently characterized by hyperglycemia and glycosuria.
- pre-diabetes and pre-diabetic refer to a state wherein a subject does not have the characteristics, symptoms and the like typically observed in diabetes, but does have characteristics, symptoms and the like that, if left untreated, can progress to diabetes. The presence of these conditions can be determined using, for example, either the fasting plasma glucose (FPG) test or the oral glucose tolerance test (OGTT). Both usually require a subject to fast for at least 8 hours prior to initiating the test.
- FPG fasting plasma glucose
- OGTT oral glucose tolerance test
- a subject's blood glucose is measured after the conclusion of the fasting; generally, the subject fasts overnight and the blood glucose is measured in the morning before the subject eats.
- a healthy subject would generally have a FPG concentration between about 90 and about 100 mg/dl
- a subject with "pre-diabetes” would generally have a FPG concentration between about 100 and about 125 mg/dl
- a subject with "diabetes” would generally have a FPG level above about 126 mg/dl.
- OGTT a subject's blood glucose is measured after fasting and again two hours after drinking a glucose-rich beverage.
- a healthy subject Two hours after consumption of the glucose-rich beverage, a healthy subject generally has a blood glucose concentration below about 140 mg/dl, a pre-diabetic subject generally has a blood glucose concentration about 140 to about 199 mg/dl, and a diabetic subject generally has a blood glucose concentration about 200 mg/dl or above. While the aforementioned glycemic values pertain to human subjects, normoglycemia, moderate hyperglycemia and overt hyperglycemia are scaled differently in murine subjects.
- a healthy murine subject after a four-hour fast would generally have a FPG concentration between about 100 and about 150 mg/dl
- a murine subject with "pre-diabetes” would generally have a FPG concentration between about 175 and about 250 mg/dl
- a murine subject with "diabetes” would generally have a FPG concentration above about 250 mg/dl.
- insulin resistance refers to a condition where a normal amount of insulin is unable to produce a normal physiological or molecular response.
- a hyper-physiological amount of insulin either endogenously produced or exogenously administered, is able to overcome the insulin resistance, in whole or in part, and produce a biologic response.
- metabolic syndrome refers to an associated cluster of traits that includes, but is not limited to, hyperinsulinemia, abnormal glucose tolerance, obesity, redistribution of fat to the abdominal or upper body compartment, hypertension, dysfibrinolysis, and dyslipidemia characterized by high triglycerides, low high density lipoprotein (HDL)-cholesterol, and high small dense low density lipoprotein (LDL) particles.
- Subjects having metabolic syndrome are at risk for development of type 2 diabetes and/or other disorders (e.g ., atherosclerosis).
- glucose metabolism disorder encompasses any disorder characterized by a clinical symptom or a combination of clinical symptoms that is associated with an elevated level of glucose and/or an elevated level of insulin in a subject relative to a healthy individual. Elevated levels of glucose and/or insulin can be manifested in the following diseases, disorders and conditions: hyperglycemia, type II diabetes, gestational diabetes, type I diabetes, insulin resistance, impaired glucose tolerance, hyperinsulinemia, impaired glucose metabolism, pre-diabetes, other metabolic disorders (such as metabolic syndrome, which is also referred to as syndrome X), and obesity, among others.
- diseases, disorders and conditions hyperglycemia, type II diabetes, gestational diabetes, type I diabetes, insulin resistance, impaired glucose tolerance, hyperinsulinemia, impaired glucose metabolism, pre-diabetes, other metabolic disorders (such as metabolic syndrome, which is also referred to as syndrome X), and obesity, among others.
- polypeptides of the present disclosure can be used, for example, to achieve and/or maintain glucose homeostasis, e.g., to reduce glucose level in the bloodstream and/or to reduce insulin level to a range found in a healthy subject.
- hyperglycemia refers to a condition in which an elevated amount of glucose circulates in the blood plasma of a subject relative to a healthy individual. Hyperglycemia can be diagnosed using methods known in the art, including measurement of fasting blood glucose levels as described herein.
- hyperinsulinemia refers to a condition in which there are elevated levels of circulating insulin when, concomitantly, blood glucose levels are either elevated or normal.
- Hyperinsulinemia can be caused by insulin resistance which is associated with dyslipidemia, such as high triglycerides, high cholesterol, high low-density lipoprotein (LDL) and low high-density lipoprotein (HDL); high uric acids levels; polycystic ovary syndrome; type II diabetes and obesity.
- hyperinsulinemia can be diagnosed as having a plasma insulin level higher than about 2 ⁇ U/mL.
- body weight disorder refers to conditions associated with excessive body weight and/or enhanced appetite.
- Various parameters are used to determine whether a subject is overweight compared to a reference healthy individual, including the subject's age, height, sex and health status.
- a subject can be considered overweight or obese by assessment of the subject's Body Mass Index (BMI), which is calculated by dividing a subject's weight in kilograms by the subject's height in meters squared.
- BMI Body Mass Index
- An adult having a BMI in the range of ⁇ 18.5 to ⁇ 24.9 kg/m 2 is considered to have a normal weight; an adult having a BMI between ⁇ 25 and ⁇ 29.9 kg/m 2 can be considered overweight (pre-obese); and an adult having a BMI of ⁇ 30 kg/m 2 or higher can be considered obese.
- Enhanced appetite frequently contributes to excessive body weight.
- night eating syndrome which is characterized by morning anorexia and evening polyphagia often associated with insomnia, but which can be related to injury to the hypothalamus.
- polypeptide refers to a polymeric form of amino acids of any length, which can include genetically coded and non-genetically coded amino acids, chemically or biochemically modified or derivatized amino acids, and polypeptides having modified polypeptide backbones.
- the terms include fusion proteins, including, but not limited to, fusion proteins with a heterologous amino acid sequence, fusion proteins with heterologous and homologous leader sequences, with or without N-terminus methionine residues; immunologically tagged proteins; and the like. It will be appreciated that throughout this disclosure reference is made to amino acids according to the single letter or three letter codes.
- variants encompasses naturally-occurring variants (e.g ., homologs and allelic variants) and non-naturally-occurring variants (e.g. , muteins).
- Naturally-occurring variants include homologs, i.e., nucleic acids and polypeptides that differ in nucleotide or amino acid sequence, respectively, from one species to another.
- Naturally-occurring variants include allelic variants, i.e., nucleic acids and polypeptides that differ in nucleotide or amino acid sequence, respectively, from one individual to another within a species.
- Non-naturally-occurring variants include nucleic acids and polypeptides that comprise a change in nucleotide or amino acid sequence, respectively, where the change in sequence is artificially introduced, e.g ., the change is generated in the laboratory or other facility by human intervention ("hand of man").
- mutant in reference to FGF19, refers to biologically active, naturally-occurring FGF 19, including biologically active, naturally-occurring FGF19 variants.
- the term includes the 194 amino acid human FGF19 mature sequence.
- label when use in the context of a polypeptide or nucleic acid (or antibody, as appropriate) of the present disclosure are meant to refer broadly to any means useful in, for example, polypeptide purification, identification, isolation and synthesis. Labels are generally covalently bound to the polypeptide of interest and can be introduced in any manner known in the art, including attachment to a mature polypeptide (generally at the N- or C-terminus), incorporation during solid-phase peptide synthesis, or through recombinant means. Examples include, but are not limited to, fluorescence, biotinylation, and radioactive isotopes.
- Polypeptide and nucleic acid molecules can be labeled by both in vitro and in vivo methods. Labeling reagents and kits can be obtained from a number of commercial sources (e.g ., Thermo Fischer Scientific, Rockford, IL; and Molecular Probes/Life Technologies; Grand Island, NY).
- muteins refers broadly to mutated recombinant proteins, i.e., a polypeptide comprising an artificially introduced change in amino acid sequence, e.g., a change in amino acid sequence generated in the laboratory or other facility by human intervention ("hand of man"). These proteins usually carry single or multiple amino acid substitutions and are frequently derived from cloned genes that have been subjected to site-directed or random mutagenesis, or from completely synthetic genes.
- the terms "modified”, “modification” and the like refer to one or more changes that enhance a desired property of human FGF 19, a naturally-occurring FGF19 variant, or a FGF19 mutein, wherein the change(s) does not alter the primary amino acid sequence of the FGF 19.
- desired properties include, for example, enhancing solubility, prolonging the circulation half-life, increasing the stability, reducing the clearance, altering the immunogenicity or allergenicity, improving aspects of manufacturability ( e.g ., cost and efficiency), and enabling the raising of particular antibodies ( e.g., by introduction of unique epitopes) for use in detection assays.
- Changes to human FGF19, a naturally-occurring FGF19 variant, or a FGF19 mutein that can be carried out include, but are not limited to, pegylation (covalent attachment of one or more molecules of polyethylene glycol (PEG), or derivatives thereof); glycosylation (e.g ., N-glycosylation), polysialylation and hesylation; albumin fusion; albumin binding through, for example, a conjugated fatty acid chain (acylation); Fc-fusion; and fusion with a PEG mimetic.
- DNA DNA
- nucleic acid nucleic acid molecule
- polynucleotide polynucleotide
- mRNA messenger RNA
- cDNA complementary DNA
- recombinant polynucleotides vectors, probes, primers and the like.
- probe refers to a fragment of DNA or RNA corresponding to a gene or sequence of interest, wherein the fragment has been labeled radioactively (e.g ., by incorporating 32 P or 35 S) or with some other detectable molecule, such as biotin, digoxygen or fluorescein.
- a probe can be used, for example, to label viral plaques, bacterial colonies or bands on a gel that contain the gene of interest.
- a probe can be cloned DNA or it can be a synthetic DNA strand; the latter can be used to obtain a cDNA or genomic clone from an isolated protein by, for example, microsequencing a portion of the protein, deducing the nucleic acid sequence encoding the protein, synthesizing an oligonucleotide carrying that sequence, radiolabeling the sequence and using it as a probe to screen a cDNA library or a genomic library.
- heterologous refers to two components that are defined by structures derived from different sources.
- a “heterologous” polypeptide can include operably linked amino acid sequences that are derived from different polypeptides.
- a “heterologous" polynucleotide can include operably linked nucleic acid sequences that can be derived from different genes.
- heterologous nucleic acids include expression constructs in which a nucleic acid comprising a coding sequence is operably linked to a regulatory element (e.g., a promoter) that is from a genetic origin different from that of the coding sequence (e.g., to provide for expression in a host cell of interest, which can be of different genetic origin than the promoter, the coding sequence or both).
- a regulatory element e.g., a promoter
- heterologous can refer to the presence of a nucleic acid (or gene product, such as a polypeptide) that is of a different genetic origin than the host cell in which it is present.
- operably linked refers to linkage between molecules to provide a desired function.
- “operably linked” in the context of nucleic acids refers to a functional linkage between nucleic acid sequences.
- a nucleic acid expression control sequence such as a promoter, signal sequence, or array of transcription factor binding sites
- the expression control sequence affects transcription and/or translation of the second polynucleotide.
- “operably linked” refers to a functional linkage between amino acid sequences (e.g ., different domains) to provide for a described activity of the polypeptide.
- N-terminus or “amino terminus” and “C-terminus” (or “carboxyl terminus”) refer to the extreme amino and carboxyl ends of the polypeptide, respectively, while the terms “N-terminal” and “C-terminal” refer to relative positions in the amino acid sequence of the polypeptide toward the N-terminus and the C-terminus, respectively, and can include the residues at the N-terminus and C-terminus, respectively.
- Immediately N-terminal or “immediately C-terminal” refers to a position of a first amino acid residue relative to a second amino acid residue where the first and second amino acid residues are covalently bound to provide a contiguous amino acid sequence.
- “Derived from”, in the context of an amino acid sequence or polynucleotide sequence is meant to indicate that the polypeptide or nucleic acid has a sequence that is based on that of a reference polypeptide or nucleic acid (e.g., a naturally occurring FGF19 polypeptide or a FGF 19-encoding nucleic acid), and is not meant to be limiting as to the source or method in which the protein or nucleic acid is made.
- the term “derived from” includes homologues or variants of reference amino acid or DNA sequences.
- isolated refers to a polypeptide of interest that, if naturally occurring, is in an environment different from that in which it can naturally occur. "Isolated” is meant to include polypeptides that are within samples that are substantially enriched for the polypeptide of interest and/or in which the polypeptide of interest is partially or substantially purified. Where the polypeptide is not naturally occurring, “isolated” indicates the polypeptide has been separated from an environment in which it was made by either synthetic or recombinant means.
- Enriched means that a sample is non-naturally manipulated ( e.g ., by a scientist or a clinician) so that a polypeptide of interest is present in a) a greater concentration (e.g ., at least 3-fold greater, at least 4-fold greater, at least 8-fold greater, at least 64-fold greater, or more) than the concentration of the polypeptide in the starting sample, such as a biological sample ( e.g., a sample in which the polypeptide naturally occurs or in which it is present after administration), or b) a concentration greater than the environment in which the polypeptide was made ( e.g., as in a bacterial cell).
- a biological sample e.g., a sample in which the polypeptide naturally occurs or in which it is present after administration
- a concentration greater than the environment in which the polypeptide was made e.g., as in a bacterial cell.
- substantially pure indicates that a component (e.g ., a polypeptide) makes up greater than about 50% of the total content of the composition, and typically greater than about 60% of the total polypeptide content. More typically, “substantially pure” refers to compositions in which at least 75%, at least 85%, at least 90% or more of the total composition is the component of interest. In some cases, the polypeptide will make up greater than about 90%, or greater than about 95% of the total content of the composition.
- a component e.g ., a polypeptide
- measuring or “assaying” and grammatical variations thereof are used interchangeably herein and refer to either qualitative or quantitative determinations, or both qualitative and quantitative determinations.
- any means of assessing the relative amount is contemplated, including the various methods set forth herein and known in the art.
- gene expression can be assayed or measured by a Northern blot, Western blot, immunoprecipitation assay, or by measuring activity, function or amount of the expressed protein.
- antibodies refer to glycoproteins having the same structural characteristics. While antibodies exhibit binding specificity to a specific antigen, immunoglobulins include both antibodies and other antibody-like molecules which lack antigen specificity.
- monoclonal antibody refers to an antibody obtained from a population of substantially homogeneous antibodies, that is, the individual antibodies comprising the population are identical except for possible naturally occurring mutations that can be present in minor amounts. Monoclonal antibodies are highly specific, being directed against a single antigenic site. In contrast to polyclonal antibody preparations, which can include different antibodies directed against different determinants (epitopes), each monoclonal antibody is directed against a single determinant on the antigen.
- isolated refers to an antibody that has been separated and/or recovered from contaminant components of its natural environment; such contaminant components include materials which might interfere with diagnostic or therapeutic uses for the antibody, and can include enzymes, hormones, and other proteinaceous or nonproteinaceous solutes.
- FGF19-dependent refers to a disease, disorder or other condition that is caused all, or in part, by the expression of FGF19.
- the expression of FGF19 is amplified as compared to a control.
- the expression of FGF19 is amplified 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or more, or any numerical range thereof.
- the amplified expression of FGF19 directly results in the disease, disorder or condition, or a symptom thereof.
- the amplified expression of FGF19 indirectly results in the disease disorder or condition, or a symptom thereof.
- compositions having an amino acid sequence consisting of SEQ ID NO:70 the pharmaceutically acceptable carrier as recited in claim 1.
- Pharmaceutical compositions comprising peptides having sequences other than SEQ ID NO:70 are not claimed.
- compositions which include a peptide sequence (or sequences) disclosed herein, including subsequences, variants and modified forms of the exemplified peptide sequences (e.g ., sequences listed in the Sequence Listing or Table 1), and one or more pharmaceutically acceptable or physiologically acceptable diluents, carriers or excipients.
- the peptide sequences are provided in combination with, or separate from, one or more additional agents.
- a composition comprising such one or more additional agents and one or more pharmaceutically acceptable or physiologically acceptable diluents, carriers or excipients.
- a peptide sequence or sequences and an additional agent(s) are present in a therapeutically acceptable amount.
- the pharmaceutical compositions may be used in accordance with the methods and uses provided herein.
- the pharmaceutical compositions can be administered ex vivo or in vivo to a subject in order to practice treatment methods and uses disclosed, but not claimed, herein.
- Pharmaceutical compositions provided herein can be formulated to be compatible with the intended method or route of administration; exemplary routes of administration are set forth herein.
- compositions and dosage forms of chimeric and peptide sequences that modulate bile acid homeostasis and are able to treat a bile-acid related or associated disorder. Also disclosed herein are pharmaceutical compositions and dosage forms of chimeric and peptide sequences that modulate hyperglycemic condition, insulin resistance, hyperinsulinemia, glucose intolerance, metabolic syndrome, or related disorders. Also disclosed herein are pharmaceutical compositions and dosage forms of chimeric and peptide sequences that modulate a cancer or tumor.
- the pharmaceutical compositions may further comprise other therapeutically active agents or compounds disclosed herein or known to the skilled artisan which can be used in the treatment or prevention of various diseases and disorders as set forth herein.
- the additional therapeutically active agents or compounds may be present in a separate pharmaceutical composition(s). Exemplary dosing parameters and regimens are described herein.
- compositions may comprise a therapeutically effective amount of at least one of the peptide sequences disclosed herein, including subsequences, variants and modified forms of the exemplified peptide sequences (e.g ., sequences listed in the Sequence Listing or Table 1) and one or more pharmaceutically and physiologically acceptable formulation agents.
- the pharmaceutical composition further comprises one or more additional agents described herein.
- compositions of the invention comprise a therapeutically effective amount of the peptide.
- the pharmaceutical composition further comprises one or more additional agents described herein.
- the pharmaceutical compositions disclosed herein comprise the peptide at a concentration of from 0.1 -100 mg/mL.
- the pharmaceutical compositions may comprise the peptide at a concentration of from 1 to 10 mg/mL.
- the pharmaceutical compositions may comprise the peptide at a concentration of 1 mg/mL.
- the peptide may be at a concentration of 5 mg/mL.
- the pharmaceutical compositions may comprise the peptide at a concentration of 10 mg/mL.
- Suitable pharmaceutically acceptable or physiologically acceptable diluents, carriers or excipients include, but are not limited to, antioxidants (e.g ., ascorbic acid and sodium bisulfate), preservatives (e.g ., benzyl alcohol, methyl parabens, ethyl or n-propyl, p-hydroxybenzoate), emulsifying agents, suspending agents, dispersing agents, solvents, fillers, bulking agents, buffers, vehicles, diluents, and/or adjuvants.
- a suitable vehicle may be physiological saline solution or citrate buffered saline, possibly supplemented with other materials common in pharmaceutical compositions for parenteral administration.
- Neutral buffered saline or saline mixed with serum albumin are further exemplary vehicles.
- Typical buffers include, but are not limited to pharmaceutically acceptable weak acids, weak bases, or mixtures thereof.
- Buffer components also include water soluble materials such as phosphoric acid, tartaric acids, lactic acid, succinic acid, citric acid, acetic acid, ascorbic acid, aspartic acid, glutamic acid, and salts thereof.
- the pharmaceutical compositions may comprise potassium phosphate.
- the pharmaceutical compositions may comprise sodium chloride, though the claimed compositions do not.
- the pharmaceutical compositions may comprise Tromethamine (Tris).
- the pharmaceutical compositions may comprise trehalose dihydrate.
- the pharmaceutical compositions may comprise TWEEN-20 (polysorbate 20).
- the pharmaceutical compositions may comprise hydrochloric acid.
- the pharmaceutical compositions may comprise water. Any combination of two, three, four, five, six or all seven of the foregoing components are also contemplated.
- the pharmaceutical compositions may comprise potassium phosphate, sodium chloride, Tromethamine (Tris), Trehalose dehydrate, TWEEN-20, hydrochloric acid, water, or any combination thereof.
- the pharmaceutical compositions may comprise potassium phosphate, sodium chloride, Tromethamine (Tris), Trehalose dihydrate, TWEEN-20, hydrochloric acid, and water.
- the molarity of Tris useful in the pharmaceutical compositions provided herein is in the range of between 5 and 50 mM. In one embodiment, the molarity of Tris is in the range of 10 and 45 mM. In another embodiment, the molarity of Tris is in the range of 15 and 40 mM. In another embodiment, the molarity of Tris is in the range of 20 and 35 mM. In another embodiment, the molarity of Tris is in the range of 20 and 30 mM. In another embodiment, the molarity of Tris is in the range of 20 and 25 mM. In one particular embodiment, the molarity of Tris is 20 mM.
- a formulation volume of 1000 mL comprises from 2 to 3 g of Tris. In some embodiments, a formulation volume of 1000 mL comprises 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9 or 3.0 g of Tris. In some embodiments, a formulation volume of 1000 mL comprises 2.1 g of Tris. In some embodiments, a formulation volume of 1000 mL comprises 2.2 g of Tris. In some embodiments, a formulation volume of 1000 mL comprises 2.3 g of Tris. In some embodiments, a formulation volume of 1000 mL comprises 2.4 g of Tris. In some embodiments, a formulation volume of 1000 mL comprises 2.5 g of Tris.
- a formulation volume of 1000 mL comprises 2.6 g of Tris. In some embodiments, a formulation volume of 1000 mL comprises 2.7 g of Tris. In some embodiments, a formulation volume of 1000 mL comprises 2.8 g of Tris. In some embodiments, a formulation volume of 1000 mL comprises 2.9 g of Tris. In some embodiments, a formulation volume of 1000 mL comprises 3.0 g of Tris. In some embodiments, a formulation volume of 1000 mL comprises from 2.4 to 2.5 g of Tris.
- the concentration of trehalose dihydrate useful in the pharmaceutical compositions provided herein is in the range of between 1% and 20% (w/v). In one embodiment, the concentration of trehalose dihydrate is in the range of 2% and 15% (w/v). In one embodiment, the concentration of trehalose dihydrate is in the range of 3% and 10% (w/v). In another embodiment, the concentration of trehalose dihydrate is in the range of 4% and 9.5% (w/v). In one embodiment, the concentration of trehalose dihydrate is in the range of 5% and 9.25% (w/v). In another embodiment, the concentration of trehalose dihydrate is in the range of 6% and 9% (w/v).
- the concentration of trehalose dihydrate is in the range of 7% and 8.5% (w/v). In another embodiment, the concentration of trehalose dihydrate is in the range of 8% and 8.4% (w/v). In one embodiment, the concentration of trehalose dihydrate is in the range of 8.1 and 8.3% (w/v). In one particular embodiment, the concentration of trehalose dihydrate is 8.2%. In one particular embodiment, the concentration of trehalose dihydrate is 8.3% (w/v). In certain embodiments, a formulation volume of 1000 mL comprises from 92 to 93 g of trehalose dihydrate.
- a formulation volume of 1000 mL comprises 92.0, 92.1, 92.2, 92.3, 92.4, 92.5, 92.6, 92.7, 92.8, 92.9 or 93.0 g of trehalose dihydrate. In some embodiments, a formulation volume of 1000 mL comprises 92.0 g of trehalose dihydrate. In some embodiments, a formulation volume of 1000 mL comprises 92.1 g of trehalose dihydrate. In some embodiments, a formulation volume of 1000 mL comprises 92.2 g of trehalose dihydrate. In some embodiments, a formulation volume of 1000 mL comprises 92.3 g of trehalose dihydrate.
- a formulation volume of 1000 mL comprises 92.4 g of trehalose dihydrate. In some embodiments, a formulation volume of 1000 mL comprises 92.5 g of trehalose dihydrate. In some embodiments, a formulation volume of 1000 mL comprises 92.6 g of trehalose dihydrate. In some embodiments, a formulation volume of 1000 mL comprises 92.7 g of trehalose dihydrate. In some embodiments, a formulation volume of 1000 mL comprises 92.8 g of trehalose dihydrate. In some embodiments, a formulation volume of 1000 mL comprises 92.9 g of trehalose dihydrate. In some embodiments, a formulation volume of 1000 mL comprises 93.0 g of trehalose dihydrate.
- a formulation volume of 1000 mL comprises from 92.4 to 92.5 g of trehalose dihydrate.
- the molarity of the trehalose dehydrate is from 240 to 300 mM. In other embodiments, the molarity of the trehalose dehydrate is from 240 to 290 mM. In some embodiments, the molarity of the trehalose dehydrate is from 250 to 290 mM. In other embodiments, the molarity of the trehalose dehydrate is from 260 to 290 mM. In some embodiments, the molarity of the trehalose dehydrate is from 270 to 290 mM. In certain embodiments, the molarity of the trehalose dehydrate is from 244 to 245 mM. In other embodiments, the molarity of the trehalose dehydrate is about 280 mM.
- the concentration of hydrochloric acid useful in the pharmaceutical compositions provided herein is in the range of from 0.01 to 1% (v/v). In another embodiment, the concentration of hydrochloric acid is in the range of from 0.025 to 0.75% (v/v). In another embodiment, the concentration of hydrochloric acid is in the range of from 0.05 to 0.5% (v/v). In another embodiment, the concentration of hydrochloric acid is in the range of from 0.075 to 0.25% (v/v). In one particular embodiment, the concentration of hydrochloric acid is 0.1% (v/v). In certain embodiments, a formulation volume of 1000 mL comprises from 0.8 to 1.1 mL of hydrochloric acid.
- a formulation volume of 1000 mL comprises from 0.9 to 1.0 mL of hydrochloric acid. In certain embodiments, a formulation volume of 1000 mL comprises 0.90, 0.91, 0.92, 0.93, 0.94, 0.95, 0.96, 0.97, 0.98, 0.99 or 1.00 mL of hydrochloric acid. In certain embodiments, a formulation volume of 1000 mL comprises 0.90 mL of hydrochloric acid. In certain embodiments, a formulation volume of 1000 mL comprises 0.91 mL of hydrochloric acid. In certain embodiments, a formulation volume of 1000 mL comprises 0.92 mL of hydrochloric acid.
- a formulation volume of 1000 mL comprises 0.93 mL of hydrochloric acid. In certain embodiments, a formulation volume of 1000 mL comprises 0.94 mL of hydrochloric acid. In certain embodiments, a formulation volume of 1000 mL comprises 0.95 mL of hydrochloric acid. In certain embodiments, a formulation volume of 1000 mL comprises 0.96 mL of hydrochloric acid. In certain embodiments, a formulation volume of 1000 mL comprises 0.97 mL of hydrochloric acid. In certain embodiments, a formulation volume of 1000 mL comprises 0.98 mL of hydrochloric acid. In certain embodiments, a formulation volume of 1000 mL comprises 0.99 mL of hydrochloric acid. In certain embodiments, a formulation volume of 1000 mL comprises 1.00 mL of hydrochloric acid.
- the concentration of TWEEN-20 useful in the pharmaceutical compositions provided herein is in the range of from 0.001 to 0.1% (v/v). In one embodiment, the concentration of TWEEN-20 is in the range of from 0.0025 to 0.075% (v/v). In one embodiment, the concentration of TWEEN-20 is in the range of from 0.005 to 0.05% (v/v). In another embodiment, the concentration of TWEEN-20 is in the range of from 0.0075 to 0.025% (v/v). In one particular embodiment, the concentration of TWEEN-20 is 0.01% (v/v). In certain embodiments, a formulation volume of 1000 mL comprises 0.1 mL TWEEN-20.
- the molarity of potassium phosphate useful in the pharmaceutical compositions provided herein is in the range of between 5 and 50 mM. In one embodiment, the molarity of potassium phosphate is in the range of 10 and 40 mM. In another embodiment, the molarity of potassium phosphate is in the range of 10 and 35 mM. In one embodiment, the molarity of potassium phosphate is in the range of 10 and 30 mM. In another embodiment, the molarity of potassium phosphate is in the range of 10 and 25 mM. In one embodiment, the molarity of potassium phosphate is in the range of 10 and 20 mM. In one particular embodiment, the molarity of potassium phosphate is 10 mM. In one particular embodiment, the molarity of potassium phosphate is 20 mM.
- the pharmaceutical composition does not comprise potassium phosphate.
- the pharmaceutical composition of the invention does not comprise sodium chloride.
- the molarity of sodium chloride useful in said compositions may be in the range of between 50 and 250 mM.
- the molarity of sodium chloride may be in the range of 75 and 225 mM.
- the molarity of sodium chloride may be in the range of 100 and 200 mM.
- the molarity of sodium chloride may be in the range of 125 and 175 mM.
- the molarity of sodium chloride may be in the range of 130 and 160 mM.
- the molarity of potassium phosphate may be in the range of 140 and 150 mM.
- the molarity of sodium chloride may be 125 mM.
- the molarity of sodium chloride may be 140 mM.
- the molarity of sodium chloride may be 150 mM.
- the pharmaceutical compositions do not comprise a salt. In other cases, the pharmaceutical composition does not comprise sodium chloride.
- the pharmaceutical composition having a pH in a range of 6.5 and 9.5. In another embodiment, the pharmaceutical composition having a pH in a range of 6.8 and 9.3. In one embodiment, the pharmaceutical composition having a pH in a range of 7.0 and 9.0. In another embodiment, the pharmaceutical composition having a pH in a range of 7.3 and 8.7. In one embodiment, the pharmaceutical composition having a pH in a range of 7.5 and 8.5. In another embodiment, the pharmaceutical composition having a pH in a range of 7.7 and 8.2. In one particular embodiment, the pH of the pharmaceutical composition is 7.3. In one particular embodiment, the pH of the pharmaceutical composition is 7.5. In one particular embodiment, the pH of the pharmaceutical composition is 8.0. In one particular embodiment, the pH of the pharmaceutical composition is 8.5. The measurements of the pH can be taken at the temperature of 4°C.
- a pharmaceutical composition provided herein comprises 20mM Tris (e.g., 2.423 g in 1000 mL solution). In another embodiment, a pharmaceutical composition provided herein comprises 8.2% (w/v) trehalose dihydrate ( e.g ., 92.55 g in 1000 mL solution). In another embodiment, a pharmaceutical composition provided herein comprises 0.01% (v/v) TWEEN-20 ( e.g ., 0.1 mL in 1000 mL solution). In yet another embodiment, a pharmaceutical compositing provided herein comprises hydrochloric acid, N.F.
- a pharmaceutical composition provided herein has a pH from 7.7 to 8.2, such as above 7.7, above 7.8, above 7.9, above 8.0 or above 8.1, when measured at 25°C. In some embodiments, a pharmaceutical composition provided herein has a pH above 7.7, when measured at 25°C. In some embodiments, a pharmaceutical composition provided herein has a pH above 7.8, when measured at 25°C.
- a pharmaceutical composition provided herein has a pH above 7.9, when measured at 25°C. In some embodiments, a pharmaceutical composition provided herein has a pH above 8.0, when measured at 25°C. In some embodiments, a pharmaceutical composition provided herein has a pH above 8.1, when measured at 25°C. In one embodiment, a pharmaceutical composition provided herein has a pH of from 7.9 to 8.1, for example, when measured at 25°C. In certain embodiments, a pharmaceutical composition provided herein has a pH of 8.0, for example, when measured at 25°C. In some embodiments, a pharmaceutical composition provided herein has a pH of 8.5, for example, when measured at 4°C.
- the pharmaceutical composition comprises potassium phosphate, Tromethamine (Tris), Trehalose dihydrate, TWEEN-20, hydrochloric acid, water, or any combination thereof.
- the pharmaceutical composition comprises potassium phosphate, sodium chloride, Tromethamine (Tris), Trehalose dihydrate, TWEEN-20, hydrochloric acid, and water.
- a pharmaceutical composition provided herein comprises 20mM Tris (2.423 g on 1000 mL solution), 8.2% (w/v) trehalose dihydrate (92.55 g in 1000 mL solution), 0.01% (v/v) TWEEN-20 (0.1 mL in 1000 mL solution), hydrochloric acid, N.F. (0.94 mL in 1000 mL solution), and water WFI quality (added to 999 mL), and has a pH of 8.5 (measured at 4°C).
- a pharmaceutical composition provided herein does not comprise salt.
- a pharmaceutical provided herein comprises a sugar, such as trehalose.
- a pharmaceutical composition provided herein comprises a sugar, but does not comprise a salt.
- a pharmaceutical composition provided herein has a pH from 7.7 to 8.2, when measured at 25°C.
- the pharmaceutical composition has an osmolality from 250 to 350 Osmol/L. In some embodiments, the pharmaceutical composition has an osmolality from 275 to 325 Osmol/L. In some embodiments, the pharmaceutical composition has an osmolality from 295 to 305 Osmol/L. In some embodiments, the pharmaceutical composition has an osmolality of 295 Osmol/L. In some embodiments, the pharmaceutical composition has an osmolality of 296 Osmol/L. In some embodiments, the pharmaceutical composition has an osmolality of 297 Osmol/L. In some embodiments, the pharmaceutical composition has an osmolality of 298 Osmol/L.
- the pharmaceutical composition has an osmolality of 299 Osmol/L. In some embodiments, the pharmaceutical composition has an osmolality of 300 Osmol/L. In some embodiments, the pharmaceutical composition has an osmolality of 301 Osmol/L. In some embodiments, the pharmaceutical composition has an osmolality of 302 Osmol/L. In some embodiments, the pharmaceutical composition has an osmolality of 303 Osmol/L. In some embodiments, the pharmaceutical composition has an osmolality of 304 Osmol/L. In some embodiments, the pharmaceutical composition has an osmolality of 305 Osmol/L.
- a primary solvent in a vehicle may be either aqueous or non-aqueous in nature.
- the vehicle may contain other pharmaceutically acceptable excipients for modifying or maintaining the pH, osmolarity, viscosity, sterility or stability of the pharmaceutical composition.
- the pharmaceutically acceptable vehicle is an aqueous buffer.
- a vehicle comprises, for example, sodium citrate.
- compositions provided herein may contain still other pharmaceutically-acceptable formulation agents for modifying or maintaining the rate of release of a peptide and/or an additional agent, as described herein.
- formulation agents include those substances known to artisans skilled in preparing sustained-release formulations.
- a pharmaceutical composition may be stored in a sterile vial as a solution, suspension, gel, emulsion, solid, or dehydrated or lyophilized powder. Such compositions may be stored either in a ready to use form, a lyophilized form requiring reconstitution prior to use, a liquid form requiring dilution prior to use, or other acceptable form.
- a pharmaceutical composition is provided in a single-use container (e.g ., a single-use vial, ampoule, syringe, or autoinjector (similar to, e.g., an EpiPen ® )), whereas a multi-use container (e.g., a multi-use vial) is provided in other embodiments.
- Any drug delivery apparatus may be used to deliver peptides and the other agents described herein, including implants (e.g ., implantable pumps) and catheter systems, both of which are known to the skilled artisan.
- Depot injections which are generally administered subcutaneously or intramuscularly, may also be utilized to release peptides and/or other agents described herein over a defined period of time. Depot injections are usually either solid- or oil-based and generally comprise at least one of the formulation components set forth herein. The skilled artisan is familiar with possible formulations and uses of depot injections. In certain embodiments, the use of Nano Precision Medical's depot delivery technology (Nano Precision Medical; Emeryville, CA) is contemplated.
- the technology utilizes a titania nanotube membrane that produces zero-order release rates of macromolecules, such as protein and peptide therapeutics.
- the biocompatible membrane is housed in a small, subcutaneous implant that provides long-term (e.g., up to one year), constant-rate delivery of therapeutic macromolecules.
- the technology is currently being evaluated, e.g ., for the delivery of GLP-1 agonists for the treatment of Type II diabetes.
- a pharmaceutical composition can be formulated to be compatible with its intended route of administration.
- pharmaceutical compositions include carriers, diluents, or excipients suitable for administration by routes including parenteral (e.g ., subcutaneous (s.c.), intravenous, intramuscular, or intraperitoneal), intradermal, oral ( e.g ., ingestion), inhalation, intracavity, intracranial, and transdermal (topical).
- parenteral e.g ., subcutaneous (s.c.), intravenous, intramuscular, or intraperitoneal
- intradermal e.g ., oral
- oral e.g ., ingestion
- inhalation intracavity
- intracranial intracranial
- transdermal topical
- compositions may be in the form of a sterile injectable aqueous or oleagenous suspension.
- This suspension may be formulated using suitable dispersing or wetting agents and suspending agents disclosed herein or known to the skilled artisan.
- the sterile injectable preparation may also be a sterile injectable solution or suspension in a non-toxic parenterally-acceptable diluent or solvent, for example, as a solution in 1,3-butane diol.
- Acceptable diluents, solvents and dispersion media include water, Ringer's solution, isotonic sodium chloride solution, Cremophor EL TM (BASF, Parsippany, NJ) or phosphate buffered saline (PBS), ethanol, polyol ( e.g., glycerol, propylene glycol, and liquid polyethylene glycol), and suitable mixtures thereof.
- sterile, fixed oils are conventionally employed as a solvent or suspending medium.
- any bland fixed oil may be employed, including synthetic mono- or diglycerides.
- fatty acids such as oleic acid find use in the preparation of injectables. Prolonged absorption of particular injectable formulations can be achieved by including an agent that delays absorption (e.g ., aluminum monostearate or gelatin).
- compositions provided herein may be administered parenterally by injection, infusion, or implantation, for local or systemic administration.
- Parenteral administration include intravenous, intraarterial, intraperitoneal, intrathecal, intraventricular, intraurethral, intrasternal, intracranial, intramuscular, intrasynovial, and subcutaneous administration.
- the pharmaceutical compositions provided herein may be formulated in any dosage forms that are suitable for parenteral administration, including solutions, suspensions, emulsions, micelles, liposomes, microspheres, nanosystems, and solid forms suitable for solutions or suspensions in liquid prior to injection.
- dosage forms can be prepared according to conventional methods known to those skilled in the art of pharmaceutical science (see, e.g., Remington, The Science and Practice of Pharmacy, supra ) .
- the pharmaceutical compositions intended for parenteral administration may include one or more pharmaceutically acceptable carriers and excipients, including, but not limited to, aqueous vehicles, water-miscible vehicles, non-aqueous vehicles, antimicrobial agents or preservatives against the growth of microorganisms, stabilizers, solubility enhancers, isotonic agents, buffering agents, antioxidants, local anesthetics, suspending and dispersing agents, wetting or emulsifying agents, complexing agents, sequestering or chelating agents, cryoprotectants, lyoprotectants, thickening agents, pH adjusting agents, and inert gases.
- aqueous vehicles water-miscible vehicles
- non-aqueous vehicles non-aqueous vehicles
- antimicrobial agents or preservatives against the growth of microorganisms stabilizers, solubility enhancers, isotonic agents, buffering agents, antioxidants, local anesthetics, suspending and dispersing agents, wetting or e
- suitable aqueous vehicles include, but are not limited to, water, saline, physiological saline or phosphate buffered saline (PBS), sodium chloride injection, Ringers injection, isotonic dextrose injection, sterile water injection, dextrose and lactated Ringers injection.
- Non-aqueous vehicles include, but are not limited to, fixed oils of vegetable origin, castor oil, corn oil, cottonseed oil, olive oil, peanut oil, peppermint oil, safflower oil, sesame oil, soybean oil, hydrogenated vegetable oils, hydrogenated soybean oil, and medium-chain triglycerides of coconut oil, and palm seed oil.
- Water-miscible vehicles include, but are not limited to, ethanol, 1,3-butanediol, liquid polyethylene glycol (e.g ., polyethylene glycol 300 and polyethylene glycol 400), propylene glycol, glycerin, N -methyl-2-pyrrolidone, N,N- dimethylacetamide, and dimethyl sulfoxide.
- suitable antimicrobial agents or preservatives include, but are not limited to, phenols, cresols, mercurials, benzyl alcohol, chlorobutanol, methyl and propyl p-hydroxybenzoates, thimerosal, benzalkonium chloride (e.g ., benzethonium chloride), methyl- and propyl-parabens, and sorbic acid.
- Suitable isotonic agents include, but are not limited to, sodium chloride, glycerin, and dextrose.
- Suitable buffering agents include, but are not limited to, phosphate and citrate.
- Suitable antioxidants are those as described herein, including bisulfite and sodium metabisulfite.
- Suitable local anesthetics include, but are not limited to, procaine hydrochloride.
- Suitable suspending and dispersing agents are those as described herein, including sodium carboxymethylcelluose, hydroxypropyl methylcellulose, and polyvinylpyrrolidone.
- Suitable emulsifying agents include those described herein, including polyoxyethylene sorbitan monolaurate, polyoxyethylene sorbitan monooleate 80, and triethanolamine oleate.
- Suitable sequestering or chelating agents include, but are not limited to EDTA.
- Suitable pH adjusting agents include, but are not limited to, sodium hydroxide, hydrochloric acid, citric acid, and lactic acid.
- Suitable complexing agents include, but are not limited to, cyclodextrins, including ⁇ -cyclodextrin, ⁇ -cyclodextrin, hydroxypropyl- ⁇ -cyclodextrin, sulfobutylether- ⁇ -cyclodextrin, and sulfobutylether 7- ⁇ -cyclodextrin (CAPTISOL ® , CyDex, Lenexa, KS).
- cyclodextrins including ⁇ -cyclodextrin, ⁇ -cyclodextrin, hydroxypropyl- ⁇ -cyclodextrin, sulfobutylether- ⁇ -cyclodextrin, and sulfobutylether 7- ⁇ -cyclodextrin (CAPTISOL ® , CyDex, Lenexa, KS).
- the pharmaceutical compositions provided herein may be formulated for single or multiple dosage administration.
- the single dosage formulations are packaged in an ampoule, a vial, or a syringe.
- the multiple dosage parenteral formulations may contain an antimicrobial agent at bacteriostatic or fungistatic concentrations. All parenteral formulations must be sterile, as known and practiced in the art.
- the pharmaceutical compositions are provided as ready-to-use sterile solutions.
- the pharmaceutical compositions are provided as sterile dry soluble products, including lyophilized powders and hypodermic tablets, to be reconstituted with a vehicle prior to use.
- the pharmaceutical compositions are provided as ready-to-use sterile suspensions.
- the pharmaceutical compositions are provided as sterile dry insoluble products to be reconstituted with a vehicle prior to use.
- the pharmaceutical compositions are provided as ready-to-use sterile emulsions.
- compositions provided herein may be formulated as immediate or modified release dosage forms, including delayed-, sustained, pulsed-, controlled, targeted-, and programmed-release forms.
- the pharmaceutical compositions may be formulated as a suspension, solid, semi-solid, or thixotropic liquid, for administration as an implanted depot.
- the pharmaceutical compositions provided herein are dispersed in a solid inner matrix, which is surrounded by an outer polymeric membrane that is insoluble in body fluids but allows the active ingredient in the pharmaceutical compositions diffuse through.
- suitable inner matrixes include polymethylmethacrylate, polybutyl-methacrylate, plasticized or unplasticized polyvinylchloride, plasticized nylon, plasticized polyethylene terephthalate, natural rubber, polyisoprene, polyisobutylene, polybutadiene, polyethylene, ethylene-vinyl acetate copolymers, silicone rubbers, polydimethylsiloxanes, silicone carbonate copolymers, hydrophilic polymers, such as hydrogels of esters of acrylic and methacrylic acid, collagen, cross-linked polyvinyl alcohol, and cross-linked partially hydrolyzed polyvinyl acetate.
- suitable outer polymeric membranes include polyethylene, polypropylene, ethylene/propylene copolymers, ethylene/ethyl acrylate copolymers, ethylene/vinyl acetate copolymers, silicone rubbers, polydimethyl siloxanes, neoprene rubber, chlorinated polyethylene, polyvinylchloride, vinyl chloride copolymers with vinyl acetate, vinylidene chloride, ethylene and propylene, ionomer polyethylene terephthalate, butyl rubber epichlorohydrin rubbers, ethylene/vinyl alcohol copolymer, ethylene/vinyloxyethanol copolymer, and ethylene/vinyl acetate/vinyl alcohol terpolymer.
- compositions may be in a form suitable for oral use, for example, as tablets, capsules, troches, lozenges, aqueous or oily suspensions, dispersible powders or granules, emulsions, hard or soft capsules, or syrups, solutions, microbeads or elixirs.
- Pharmaceutical compositions intended for oral use may be prepared according to any method known to the art for the manufacture of pharmaceutical compositions. Such compositions may contain one or more agents such as sweetening agents, flavoring agents, coloring agents and preserving agents in order to provide pharmaceutically elegant and palatable preparations. Tablets containing a peptide provided herein may be in admixture with non-toxic pharmaceutically acceptable excipients suitable for the manufacture of tablets.
- excipients include, for example, diluents, such as calcium carbonate, sodium carbonate, lactose, calcium phosphate or sodium phosphate; granulating and disintegrating agents, for example, corn starch, or alginic acid; binding agents, for example starch, gelatin or acacia, and lubricating agents, for example magnesium stearate, stearic acid or talc.
- diluents such as calcium carbonate, sodium carbonate, lactose, calcium phosphate or sodium phosphate
- granulating and disintegrating agents for example, corn starch, or alginic acid
- binding agents for example starch, gelatin or acacia
- lubricating agents for example magnesium stearate, stearic acid or talc.
- Tablets, capsules and the like suitable for oral administration may be uncoated or they may be coated by known techniques to delay disintegration and absorption in the gastrointestinal tract and thereby provide a sustained action over a longer period.
- a time delay material such as glyceryl monostearate or glyceryl distearate may be employed. They may also be coated by techniques known in the art to form osmotic therapeutic tablets for controlled release.
- Additional agents include biodegradable or biocompatible particles or a polymeric substance such as polyesters, polyamine acids, hydrogel, polyvinyl pyrrolidone, polyanhydrides, polyglycolic acid, ethylene-vinylacetate, methylcellulose, carboxymethylcellulose, protamine sulfate, or lactide/glycolide copolymers, polylactide/glycolide copolymers, or ethylenevinylacetate copolymers in order to control delivery of an administered composition.
- a polymeric substance such as polyesters, polyamine acids, hydrogel, polyvinyl pyrrolidone, polyanhydrides, polyglycolic acid, ethylene-vinylacetate, methylcellulose, carboxymethylcellulose, protamine sulfate, or lactide/glycolide copolymers, polylactide/glycolide copolymers, or ethylenevinylacetate copolymers in order to control delivery of an administered composition.
- the oral agent can be entrapped in microcapsules prepared by coacervation techniques or by interfacial polymerization, by the use of hydroxymethylcellulose or gelatin-microcapsules or poly (methylmethacrolate) microcapsules, respectively, or in a colloid drug delivery system.
- Colloidal dispersion systems include macromolecule complexes, nano-capsules, microspheres, microbeads, and lipid-based systems, including oil-in-water emulsions, micelles, mixed micelles, and liposomes. Methods of preparing liposomes are described in, for example, U.S. Patent Nos. 4,235,871 , 4,501,728 , and 4,837,028 . Methods for the preparation of the above-mentioned formulations will be apparent to those skilled in the art.
- Formulations for oral use may also be presented as hard gelatin capsules wherein the active ingredient is mixed with an inert solid diluent, for example, calcium carbonate, calcium phosphate, kaolin or microcrystalline cellulose, or as soft gelatin capsules wherein the active ingredient is mixed with water or an oil medium, for example peanut oil, liquid paraffin, or olive oil.
- an inert solid diluent for example, calcium carbonate, calcium phosphate, kaolin or microcrystalline cellulose
- water or an oil medium for example peanut oil, liquid paraffin, or olive oil.
- Aqueous suspensions contain the active materials in admixture with excipients suitable for the manufacture thereof.
- excipients are suspending agents, for example sodium carboxymethylcellulose, methylcellulose, hydroxy-propylmethylcellulose, sodium alginate, polyvinyl-pyrrolidone, gum tragacanth and gum acacia; dispersing or wetting agents may be a naturally-occurring phosphatide, for example lecithin, or condensation products of an alkylene oxide with fatty acids, for example polyoxy-ethylene stearate, or condensation products of ethylene oxide with long chain aliphatic alcohols, for example heptadecaethyleneoxycetanol, or condensation products of ethylene oxide with partial esters derived from fatty acids and a hexitol such as polyoxyethylene sorbitol monooleate, or condensation products of ethylene oxide with partial esters derived from fatty acids and hexitol anhydrides, for example polyethylene sorbitan monooleate.
- Oily suspensions may be formulated by suspending the active ingredient in a vegetable oil, for example arachis oil, olive oil, sesame oil or coconut oil, or in a mineral oil such as liquid paraffin.
- the oily suspensions may contain a thickening agent, for example beeswax, hard paraffin or cetyl alcohol. Sweetening agents such as those set forth above, and flavoring agents may be added to provide a palatable oral preparation.
- Dispersible powders and granules suitable for preparation of an aqueous suspension by addition of water provide the active ingredient in admixture with a dispersing or wetting agent, suspending agent and one or more preservatives.
- a dispersing or wetting agent e.g., kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin,
- compositions provided herein may also be in the form of oil-in-water emulsions.
- the oily phase may be a vegetable oil, for example olive oil or arachis oil, or a mineral oil, for example, liquid paraffin, or mixtures of these.
- Suitable emulsifying agents may be naturally-occurring gums, for example, gum acacia or gum tragacanth; naturally-occurring phosphatides, for example, soy bean, lecithin, and esters or partial esters derived from fatty acids; hexitol anhydrides, for example, sorbitan monooleate; and condensation products of partial esters with ethylene oxide, for example, polyoxyethylene sorbitan monooleate.
- compositions can also include carriers to protect the composition against rapid degradation or elimination from the body, such as a controlled release formulation, including implants, liposomes, hydrogels, prodrugs and microencapsulated delivery systems.
- a time delay material such as glyceryl monostearate or glyceryl stearate alone, or in combination with a wax, may be employed.
- Prolonged absorption of injectable pharmaceutical compositions can be achieved by including an agent that delays absorption, for example, aluminum monostearate or gelatin.
- Prevention of the action of microorganisms can be achieved by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, ascorbic acid, thimerosal, and the like.
- peptides and/or one or more additional agents described herein in the form of suppositories for rectal administration can be prepared by mixing a peptide and/or one or more additional agents described herein with a suitable nonirritating excipient which is solid at ordinary temperatures but liquid at the rectal temperature and will therefore melt in the rectum to release the drug.
- suitable nonirritating excipient include, but are not limited to, cocoa butter and polyethylene glycols.
- compositions of the invention comprise a peptide having an amino acid sequence consisting of SEQ ID NO:70. Also disclosed herein but not claimed are further pharmaceutical compositions, formulations and dosage forms comprising one or more peptides or peptide sequences disclosed herein.
- the pharmaceutical compositions, formulations and dosage forms disclosed herein comprise one or more variants of FGF19 peptide sequences, fusions of FGF19 and/or FGF21 peptide sequences and variants of fusions (chimeras) of FGF19 and/or FGF21 peptide sequences having one or more activities associated with the treatment and/or prevention of a bile acid-related or associated disorder (e.g ., PBC), a metabolic disorder or a cancer or tumor.
- a bile acid-related or associated disorder e.g ., PBC
- the activity is a glucose lowering activity.
- variants and fusions (chimeras) of FGF19 and/or FGF21 peptide sequences include sequences that do not substantially increase or induce HCC formation or HCC tumorigenesis and/or do not induce a substantial elevation or increase in lipid profile.
- chimeric peptide sequences that include or consist of an N-terminal region having at least seven amino acid residues and the N-terminal region having a first amino acid position and a last amino acid position, where the N-terminal region has a DSSPL (SEQ ID NO:121) or DASPH (SEQ ID NO:122) sequence; and a C-terminal region having a portion of FGF19 and the C-terminal region having a first amino acid position and a last amino acid position, where the C-terminal region includes amino acid residues 16-29 of FGF19 (WGDPIRLRHLYTSG; SEQ ID NO: 169) and the W residue corresponds to the first amino acid position of the C-terminal region.
- DSSPL SEQ ID NO:121
- DASPH SEQ ID NO:122
- the peptide of the invention is M70: MRDSSPLVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAV ALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPV SLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDS16MDPFG LVTGLEAVRSPSFEK (SEQ ID NO:70).
- Another example, which is not claimed, is the variant M69:
- chimeric peptide sequences that include or consist of an N-terminal region having a portion of FGF21 and the N-terminal region having a first amino acid position and a last amino acid position, where the N-terminal region has a GQV sequence and the V residue corresponds to the last amino acid position of the N-terminal region; and a C-terminal region having a portion of FGF19 and the C-terminal region having a first amino acid position and a last amino acid position where the C-terminal region includes amino acid residues 21-29 of FGF19 (RLRHLYTSG; SEQ ID NO: 185) and the R residue corresponds to the first position of the C-terminal region.
- RLRHLYTSG amino acid residues 21-29 of FGF19
- FGF19 residues 127-129 are defined as constituting the Loop-8 region, although in the literature the Loop-8 region is sometimes defined as including or consisting of other residues (e.g., residues 125-129).
- Certain combinations of R127L and P128E substitutions to the FGF19 framework had an unexpectedly positive effect on HCC formation. Even more surprisingly, a combination of R127L and P128E substitutions and a substitution of Gln (Q) for Leu (L) in the FGF19 core region had an even more significant effect on preventing HCC formation.
- Variants of FGF19 Loop-8 region can reduce or eliminate substantial, measurable or detectable HCC formation. Furthermore, the effect of reducing HCC formation may be enhanced by modifications to amino acid residues outside of the Loop-8 region (e.g., substitutions of amino acid residues in the core region, such as the region corresponding to amino acids 21-29 of SEQ ID NO:99).
- Loop-8 modified variants may comprise a substitution in the FGF19 Loop-8 region corresponding to amino acids 127-129 of SEQ ID NO:99.
- Loop-8 modified variants may comprise a substitution in the FGF19 Loop-8 region corresponding to (i) a R127L substitution, (ii) a P128E substitution, or (iii) a R127L substitution and a P128E substitution.
- FGF19 variants may comprise or further comprise a substitution in the core region corresponding to amino acids 21-29 of SEQ ID NO:99.
- FGF19 variants may comprise or further comprise a substitution in the core region corresponding to a L22Q substitution.
- the amino acid sequence of the peptide may comprise one amino acid substitution to the EIRPD (amino acids 2-6 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19.
- the amino acid sequence of the peptide may comprise two amino acid substitutions to the EIRPD (amino acids 2-6 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19.
- the amino acid sequence of the peptide may comprise three amino acid substitutions to the EIRPD (amino acids 2-6 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19.
- the amino acid sequence of the peptide may comprise four amino acid substitutions to the EIRPD (amino acids 2-6 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19.
- the amino acid sequence of the peptide may comprise five amino acid substitutions to the EIRPD (amino acids 2-6 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19.
- the amino acid sequence of the peptide may comprise one amino acid substitution to the IRP (amino acids 3-5 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19.
- the amino acid sequence of the peptide may comprise two amino acid substitutions to the IRP (amino acids 3-5 of SEQ ID NO:190) amino acid sequence in the Loop-8 region of FGF19.
- the amino acid sequence of the peptide may comprise three amino acid substitutions to the IRP (amino acids 3-5 of SEQ ID NO:190) amino acid sequence in the Loop-8 region of FGF19.
- the amino acid sequence of the peptide may comprise one amino acid substitution to the RP (amino acids 4-5 of SEQ ID NO:190) amino acid sequence in the Loop-8 region of FGF19.
- the amino acid sequence of the peptide may comprise two amino acid substitutions to the RP (amino acids 4-5 of SEQ ID NO:190) amino acid sequence in the Loop-8 region of FGF19.
- the amino acid substitution to the RP (amino acids 4-5 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19 may be an Arg (R) to Leu (L) substitution.
- the substitution to the RP (amino acids 4-5 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19 may be a Pro (P) to Glu (E) substitution.
- the substitutions to the RP (amino acids 4-5 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19 may be an Arg (R) to Leu (L) substitution and a Pro (P) to Glu (E) substitution.
- the foregoing substitution(s) in the Loop-8 region of FGF19 may be in the corresponding FGF19 sequence thereof in a variant peptide disclosed but not claimed herein. That is, said substitutions within a corresponding FGF19 sequence (e.g., EIRPD, IRP or RP) of a peptide variant disclosed herein is also contemplated but not claimed.
- the Loop-8 modified variant may be a variant of M70: MRDSSPLVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAV ALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEI RPD GYNVYRSEKHRLPV SLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLV TGLEAVRSPSFEK (SEQ ID NO:70), comprising a substitution in the FGF19 Loop-8 region (underlined).
- the Loop-8 modified M70 variant may comprise a substitution in the FGF19 Loop-8 region (underlined) corresponding to (i) a R127L substitution, (ii) a P128E substitution, or (iii) a R127L substitution and a P128E substitution (SEQ. ID NO:204).
- the Loop-8 modified M70 variant may comprise or further comprise a substitution in the FGF19 core region.
- the Loop-8 modified M70 variant may comprise a L18Q substitution.
- the Loop-8 modified variant may be M69: RDSSPLVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVA LRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEI RPD GYNVYRSEKBRLPVS LSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVT GLEAVRSPSFEK (M69) (SEQ ID NO:69), comprising a substitution in the FGF19 Loop-8 region (underlined).
- the Loop-8 modified M69 variant may comprise a substitution in the FGF19 Loop-8 region (underlined) corresponding to (i) a R100L substitution, (ii) a P101E substitution, or (iii) a R100L substitution and a P101E substitution.
- the Loop-8 modified M69 variant may comprise or further comprise a substitution in the FGF19 core region.
- the Loop-8 modified M69 variant may comprise a L17Q substitution.
- the Loop-8 modified variant may comprise a substitution in the FGF19 Loop-8 region corresponding to amino acids 127-129 of SEQ ID NO:3.
- the Loop-8 modified variant may comprise a substitution in the FGF19 Loop-8 region corresponding to (i) a R127L substitution, (ii) a P128E substitution, or (iii) a R127L substitution and a P128E substitution.
- the FGF19 variant may comprise or further comprise a substitution in the core region corresponding to amino acids 21-29 of SEQ ID NO:3.
- the FGF19 variant may comprise or further comprise a substitution in the core region corresponding to a L22Q substitution.
- Peptide sequences disclosed herein but not claimed may include or consist of a FGF19 variant having one or more amino acid substitutions, insertions or deletions compared to a reference or wild type FGF19.
- Peptide sequences disclosed herein but not claimed may include or consist of a FGF21 sequence variant having one or more amino acid substitutions, insertions or deletions compared to a reference or wild type FGF21.
- Peptide sequences provided herein may include or consist of a portion of a FGF19 sequence fused to a portion of a FGF21 sequence.
- the peptide sequences may include or consist of a portion of a FGF19 sequence fused to a portion of a FGF21 sequence, where the FGF19 and/or FGF21 sequence portion(s) have one or more amino acid substitutions, insertions or deletions compared to a reference or wild type FGF19 and/or FGF21. Examples of such sequences are disclosed in PCT Pub. No. WO 2013/006486 and US Pub. No. 2013/0023474 , as well as PCT Publ. No. WO 2014/085365, published June 5, 2014 . Table 1 and the Sequence Listing also sets forth representative sequences that may be used in the methods provided herein.
- the treatment peptides disclosed herein include variants and fusions of FGF19 and/or FGF21 peptide sequences.
- the methods disclosed but not claimed herein include contacting or administering to a subject one or more nucleic acid molecules encoding a variant or fusion FGF19 and/or FGF21 peptide sequence (for example, an expression control element in operable linkage with the nucleic acid encoding the peptide sequence, optionally including a vector), in an amount effective for treating a bile acid-related or associated disorder.
- a representative reference or wild type FGF19 sequence is set forth as:
- FGF21 allelic variants include, e.g., M70, M71 and M72.
- peptide protein
- polypeptide sequence are used interchangeably herein to refer to two or more amino acids, or “residues,” including chemical modifications and derivatives of amino acids, covalently linked by an amide bond or equivalent.
- the amino acids forming all or a part of a peptide may be from among the known 21 naturally occurring amino acids, which are referred to by both their single letter abbreviation or common three-letter abbreviation.
- conventional amino acid residues have their conventional meaning. Thus, “Leu” is leucine, “Ile” is isoleucine, "Nle” is norleucine, and so on.
- Peptide or chimeric sequences disclosed herein may have at the N-terminal region first amino acid position an "M” residue, an "R” residue, a “S” residue, a “H” residue, a “P” residue, a “L” residue or an “D” residue.
- a peptide or chimeric sequence peptide sequence does not have a "M” residue or an "R” residue at the first amino acid position of the N-terminal region.
- subsequences, variants and modified forms of the exemplified peptide sequences include the FGF19 and FGF21 variants and subsequences listed in the Sequence Listing, or Table 1), so long as the foregoing retains at least a detectable or measureable activity or function.
- certain exemplified variant peptides for example, those having all or a portion of FGF21 sequence at the amino-terminus, have an "R" residue positioned at the N-terminus, which can be omitted.
- certain exemplified variant peptides include an "M" residue positioned at the N-terminus, which can be appended to or further substituted for an omitted residue, such as an "R” residue.
- peptide sequences at the N-terminus may include any of: RDSS (SEQ ID NO:115), DSS, MDSS (SEQ ID NO:116) or MRDSS (SEQ ID NO:117).
- RDSS SEQ ID NO:115
- DSS DSS
- MDSS SEQ ID NO:116
- MRDSS SEQ ID NO:117
- peptide sequences may include those with the following residues at the N-terminus: MDSSPL (SEQ ID NO:119), MSDSSPL (SEQ ID NO:120) (cleaved to SDSSPL (SEQ ID NO:112)) and MSSPL (SEQ ID NO:113) (cleaved to SSPL (SEQ ID NO:114)).
- peptide sequences distinct from reference FGF19 and FGF21 polypeptides set forth herein, that modulate bile acid homeostasis, hyperglycemic conditions, insulin resistance, hyperinsulinemia, glucose intolerance, metabolic syndrome, or related disorders, in vivo (e.g., Table 1 and the Sequence Listing).
- Particular examples are a peptide sequence with amino-terminal amino acids 1-16 of FGF21 fused to carboxy-terminal amino acids 21-194 of FGF19; a peptide sequence with amino-terminal amino acids 1-147 of FGF19 fused to carboxy-terminal amino acids 147-181 of FGF21; a peptide sequence with amino-terminal amino acids 1-20 of FGF19 fused to carboxy-terminal amino acids 17-181 of FGF21; a peptide sequence with amino-terminal amino acids 1-146 of FGF21 fused to carboxy-terminal amino acids 148-194 of FGF19; and a peptide sequence with amino-terminal amino acids 1-20 of FGF19 fused to internal amino acids 17-146 of FGF21 fused to carboxy-terminal amino acids 148-194 of FGF19.
- Additional particular peptides sequences have a WGDPI (SEQ ID NO:170) sequence motif corresponding to the WGDPI sequence of amino acids 16-20 of FGF19 (SEQ ID NO:99), lack a WGDPI (SEQ ID NO:170) sequence motif corresponding to the WGDPI sequence of amino acids 16-20 of FGF19 (SEQ ID NO:99), or have a substituted ( i.e., mutated) WGDPI (SEQ ID NO:170) sequence motif corresponding to FGF19 WGDPI sequence of amino acids 16-20 of FGF19 (SEQ ID NO:99).
- Particular peptide sequences disclosed herein also include sequences distinct from FGF19 and FGF21 ( e.g., as set forth herein), and FGF 19 variant sequences having any GQV, GDI, WGPI (SEQ ID NO:171), WGDPV (SEQ ID NO:172), WGDI (SEQ ID NO:173), GDPI (SEQ ID NO:174), GPI, WGQPI (SEQ ID NO:175), WGAPI (SEQ ID NO:176), AGDPI (SEQ ID NO:177), WADPI (SEQ ID NO:178), WGDAI (SEQ ID NO:179), WGDPA (SEQ ID NO:180), WDPI (SEQ ID NO:181), WGDI (SEQ ID NO:182), WGDP (SEQ ID NO:183) or FGDPI (SEQ ID NO:184) substituted for FGF19 WGDPI (SEQ ID NO:170) sequence at amino acids 16-20.
- FGF 19 variant sequences having any GQV
- peptide sequences include or consist of all or a part of a sequence variant specified herein as M1-M98 (SEQ ID NOs: 1-52, 192, and 54-98, respectively). More particular non-limiting examples of peptide sequences include or consist of all or a part of a sequence set forth as: HPIPDSSPLLQFGGQVRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVA LRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVS LSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVT GLEAVRSPSFEK (M5-R) (SEQ ID NO: 160) (FGF21 sequences can also include an "R" residue at the amino terminus); or a subsequence or fragment thereof any of the foregoing peptide sequences.
- M5-R SEQ ID NO: 160
- peptide sequences having at the N-terminus, a peptide sequence including or consisting of all or a part of any of: HPIPDSSPLLQFGGQVRLRHLYTSG (M5-R) (amino acids 1-25 of SEQ ID NO:160); DSSPLLQFGGQVRLRHLYTSG (M6) (M6-R) (amino acids 2-22 of SEQ ID NO:6); RPLAFSDSSPLLQFGGQVRLRHLYTSG (M7) (amino acids 1-27 of SEQ ID NO:7); HPIPDSSPLLQWGDPIRLRHLYTSG (M8-R) (amino acids 2-26 of SEQ ID NO:8); HPIPDSSPLLQFGWGDPIRLRHLYTSG (M9-R) (amino acids 2-28 of SEQ ID NO:9); HPIPDSSPHVHYGWGDPIRLRHLYTSG (M10-R) (amino acids 2-28 of SEQ ID NO:9); HPIPDSS
- Peptide sequences disclosed herein additionally include those with reduced or absent induction or formation of HCC compared to FGF 19, or a FGF 19 variant sequence having any of GQV, GDI, WGPI (SEQ ID NO: 171), WGDPV (SEQ ID NO: 172), WGDI (SEQ ID NO: 173), GDPI (SEQ ID NO: 174), GPI, WGQPI (SEQ ID NO: 175), WGAPI (SEQ ID NO: 176), AGDPI (SEQ ID NO: 177), WADPI (SEQ ID NO: 178), WGDAI (SEQ ID NO: 179), WGDPA (SEQ ID NO:180), WDPI (SEQ ID NO:181), WGDI (SEQ ID NO:182), WGDP (SEQ ID NO:183) or FGDPI (SEQ ID NO: 184) substituted for the WGDPI (SEQ ID NO: 170) sequence at amino acids 16-20 of FGF19.
- Peptide sequences disclosed herein also include those with greater glucose lowering activity compared to FGF 19, or a FGF 19 variant sequence having any of GQV, GDI, WGPI, WGPI (SEQ ID NO: 171), WGDPV (SEQ ID NO: 172), WGDI (SEQ ID NO: 173), GDPI (SEQ ID NO: 174), GPI, WGQPI (SEQ ID NO: 175), WGAPI (SEQ ID NO: 176), AGDPI (SEQ ID NO: 177), WADPI (SEQ ID NO: 178), WGDAI (SEQ ID NO: 179), WGDPA (SEQ ID NO:180), WDPI (SEQ ID NO:181), WGDI (SEQ ID NO:182), WGDP (SEQ ID NO: 183) or FGDPI (SEQ ID NO: 184) substituted for the WGDPI (SEQ ID NO: 170) sequence at amino acids 16-20 of FGF19.
- Peptide sequences disclosed herein moreover include those with less lipid (e.g ., triglyceride, cholesterol, non-HDL or HDL) increasing activity compared to FGF 19, or a FGF 19 variant sequence having any of GQV, GDI, WGPI (SEQ ID NO:171), WGDPV (SEQ ID NO: 172), WGDI (SEQ ID NO:173), GDPI (SEQ ID NO:174), GPI, WGQPI (SEQ ID NO: 175), WGAPI (SEQ ID NO: 176), AGDPI (SEQ ID NO: 177), WADPI (SEQ ID NO: 178), WGDAI (SEQ ID NO: 179), WGDPA (SEQ ID NO: 180), WDPI (SEQ ID NO: 181), WGDI (SEQ ID NO: 182), WGDP (SEQ ID NO: 183) or FGDPI (SEQ ID NO: 184) substituted for the WGDPI (SEQ ID NO: 170) sequence at
- the number of amino acids or residues in a peptide sequence disclosed herein will total less than about 250 ( e.g., amino acids or mimetics thereof).
- the number of residues may comprise from about 20 up to about 200 residues ( e.g ., amino acids or mimetics thereof).
- the number of residues may comprise from about 50 up to about 200 residues ( e.g ., amino acids or mimetics thereof).
- the number of residues may comprise from about 100 up to about 195 residues ( e.g ., amino acids or mimetics thereof) in length.
- Amino acids or residues can be linked by amide or by non-natural and non-amide chemical bonds including, for example, those formed with glutaraldehyde, N-hydroxysuccinimide esters, bifunctional maleimides, or N, N'-dicyclohexylcarbodiimide (DCC).
- Non-amide bonds include, for example, ketomethylene, aminomethylene, olefin, ether, thioether and the like (see, e.g., Spatola in Chemistry and Biochemistry of Amino Acids, Peptides and Proteins, Vol. 7, pp 267-357 (1983 ), " Peptide and Backbone Modifications," Marcel Decker, NY ).
- a peptide provided herein includes a portion of a FGF19 sequence and a portion of a FGF21 sequence
- the two portions need not be joined to each other by an amide bond, but can be joined by any other chemical moiety or conjugated together via a linker moiety.
- the treatment peptides disclosed herein also include subsequences, variants and modified forms of the exemplified peptide sequences (including the FGF19 and FGF21 variants and subsequences listed in Table 1 and Sequence Listing), so long as the foregoing retains at least a detectable or measureable activity or function.
- certain exemplified variant peptides have FGF19 C-terminal sequence, PHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKM QGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPML PMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (SEQ ID NO:188) at the C-terminal portion, e.g ., following the "TSG" amino acid residues of the variant.
- certain exemplified variant peptides for example, those having all or a portion of FGF21 sequence at the amino-terminus, have an "R" residue positioned at the N-terminus, which can be omitted.
- certain exemplified variant peptides include an "M” residue positioned at the N-terminus, which can be appended to or further substituted for an omitted residue, such as an "R” residue.
- peptide sequences at the N-terminus may include any of: RDSS (SEQ ID NO:115), DSS, MDSS (SEQ ID NO:116) or MRDSS (SEQ ID NO:117).
- peptide sequences may include those with the following residues at the N-terminus: MDSSPL (SEQ ID NO:119), MSDSSPL (SEQ ID NO:120) (cleaved to SDSSPL(SEQ ID NO:112)) and MSSPL (SEQ ID NO:113) (cleaved to SSPL (SEQ ID NO:114)).
- the "peptide,” “polypeptide,” and “protein” sequences disclosed herein include subsequences, variants and modified forms of the FGF19 and FGF21 variants and subsequences listed in Table 1 and Sequence Listing, and the FGF19/FGF21 fusions and chimeras listed in Table 1 and Sequence Listing, so long as the subsequence, variant or modified form (e.g., fusion or chimera) retains at least a detectable activity or function, e.g., glucose lowering activity and/or modulation of bile acid homeostasis.
- a detectable activity or function e.g., glucose lowering activity and/or modulation of bile acid homeostasis.
- modified peptide sequences, nucleic acids and other compositions may have greater or less activity or function, or have a distinct function or activity compared with a reference unmodified peptide sequence, nucleic acid, or other composition, or may have a property desirable in a protein formulated for therapy (e.g . serum half-life), to elicit antibody for use in a detection assay, and/or for protein purification.
- a protein formulated for therapy e.g . serum half-life
- a peptide sequence provided herein can be modified to increase serum half-life, to increase in vitro and/or in vivo stability of the protein, etc.
- Such subsequences, variants and modified forms of the peptide sequences exemplified herein include substitutions, deletions and/or insertions/additions of one or more amino acids, to or from the amino-terminus, the carboxy-terminus or internally.
- substitutions, deletions and/or insertions/additions of one or more amino acids to or from the amino-terminus, the carboxy-terminus or internally.
- substitution of an amino acid residue for another amino acid residue within the peptide sequence is a deletion of one or more amino acid residues from the peptide sequence, or an insertion or addition of one or more amino acid residues into the peptide sequence.
- the number of residues substituted, deleted or inserted/added are one or more amino acids (e.g., 1-3, 3-5, 5-10, 10-20, 20-30, 30-40, 40-50, 50-60, 60-70, 70-80, 80-90, 90-100, 100-110, 110-120, 120-130, 130-140, 140-150, 150-160, 160-170, 170-180, 180-190, 190-200, 200-225, 225-250, or more) of a peptide sequence.
- amino acids e.g., 1-3, 3-5, 5-10, 10-20, 20-30, 30-40, 40-50, 50-60, 60-70, 70-80, 80-90, 90-100, 100-110, 110-120, 120-130, 130-140, 140-150, 150-160, 160-170, 170-180, 180-190, 190-200, 200-225, 225-250, or more
- a FGF19 or FGF21 sequence can have few or many amino acids substituted, deleted or inserted/added (e.g ., 1-3, 3-5, 5-10, 10-20, 20-30, 30-40, 40-50, 50-60, 60-70, 70-80, 80-90, 90-100, 100-110, 110-120, 120-130, 130-140, 140-150, 150-160, 160-170, 170-180, 180-190, 190-200, 200-225, 225-250, or more).
- a FGF19 amino acid sequence can include or consist of an amino acid sequence of about 1-3, 3-5, 5-10, 10-20, 20-30, 30-40, 40-50, 50-60, 60-70, 70-80, 80-90, 90-100, 100-110, 110-120, 120-130, 130-140, 140-150, 150-160, 160-170, 170-180, 180-190, 190-200, 200-225, 225-250, or more amino acids from FGF21; or a FGF21 amino acid or sequence can include or consist of an amino acid sequence of about 1-3, 3-5, 5-10, 10-20, 20-30, 30-40, 40-50, 50-60, 60-70, 70-80, 80-90, 90-100, 100-110, 110-120, 120-130, 130-140, 140-150, 150-160, 160-170, 170-180, 180-190, 190-200, 200-225, 225-250, or more amino acids from FGF19.
- substitutions include substituting a D residue for an L-residue. Accordingly, although residues are listed in the L-isomer configuration, D-amino acids at any particular or all positions of the peptide sequences provided herein are included, unless a D-isomer leads to a sequence that has no detectable or measurable function.
- a "conservative substitution” is a replacement of one amino acid by a biologically, chemically or structurally similar residue.
- Biologically similar means that the substitution is compatible with a biological activity, e.g ., activity that improves PBC and/or the manifestations thereof.
- Structurally similar means that the amino acids have side chains with similar length, such as alanine, glycine and serine, or having similar size, or the structure of a first, second or additional peptide sequence is maintained.
- Chemical similarity means that the residues have the same charge or are both hydrophilic and hydrophobic.
- Particular examples include the substitution of one hydrophobic residue, such as isoleucine, valine, leucine or methionine, for another, or the substitution of one polar residue for another, such as the substitution of arginine for lysine, glutamic for aspartic acids, or glutamine for asparagine, serine for threonine, etc.
- Routine assays can be used to determine whether a subsequence, variant or modified form has activity, e.g. , activity that improves PBC and/or the manifestations thereof.
- subsequences, variants and modified forms of the peptide sequences exemplified herein have 50%-60%, 60%-70%, 70%-75%, 75%-80%, 80%-85%, 85%-90%, 90%-95%, or 96%, 97%, 98%, or 99% identity to a reference peptide sequence.
- identity and “homology” and grammatical variations thereof mean that two or more referenced entities are the same. Thus, where two amino acid sequences are identical, they have the identical amino acid sequence.
- “Areas, regions or domains of identity” mean that a portion of two or more referenced entities are the same. Thus, where two amino acid sequences are identical or homologous over one or more sequence regions, they share identity in those regions.
- BLAST e.g., BLAST 2.0
- exemplary search parameters as follows: Mismatch -2; gap open 5; gap extension 2.
- a BLASTP algorithm is typically used in combination with a scoring matrix, such as PAM100, PAM 250, BLOSUM 62 or BLOSUM 50.
- FASTA e.g ., FASTA2 and FASTA3
- SSEARCH sequence comparison programs are also used to quantitate the extent of identity ( Pearson et al., Proc. Natl. Acad. Sci. USA 85:2444 (1988 ); Pearson, Methods Mol Biol. 132:185 (2000 ); and Smith et al., J. Mol. Biol. 147:195 (1981 )).
- Programs for quantitating protein structural similarity using Delaunay-based topological mapping have also been developed ( Bostick et al., Biochem Biophys Res Commun. 304:320 (2003 )).
- amino acid therefore includes stereoisomers and modifications of naturally occurring protein amino acids, non-protein amino acids, post-translationally modified amino acids (e.g., by glycosylation, phosphorylation, ester or amide cleavage, etc. ), enzymatically modified or synthesized amino acids, derivatized amino acids, constructs or structures designed to mimic amino acids, amino acids with a side chain moiety modified, derivatized from naturally occurring moieties, or synthetic, or not naturally occurring, etc. Modified and unusual amino acids are included in the peptide sequences provided herein (see, for example, in Synthetic Peptides: A User's Guide; Hruby et al., Biochem. J. 268:249 (1990 ); and Toniolo C., Int. J. Peptide Protein Res. 35:287 (1990 )).
- amino acid side chain moiety includes any side chain of any amino acid, as the term “amino acid” is defined herein. This therefore includes the side chain moiety in naturally occurring amino acids. It further includes side chain moieties in modified naturally occurring amino acids as set forth herein and known to one of skill in the art, such as side chain moieties in stereoisomers and modifications of naturally occurring protein amino acids, non-protein amino acids, post-translationally modified amino acids, enzymatically modified or synthesized amino acids, derivatized amino acids, constructs or structures designed to mimic amino acids, etc. For example, the side chain moiety of any amino acid disclosed herein or known to one of skill in the art is included within the definition.
- a "derivative of an amino acid side chain moiety" is included within the definition of an amino acid side chain moiety.
- a single amino acid including stereoisomers and modifications of naturally occurring protein amino acids, non-protein amino acids, post-translationally modified amino acids, enzymatically-synthesized amino acids, non-naturally occurring amino acids including derivatized amino acids, an alpha, alpha disubstituted amino acid derived from any of the foregoing (i.e., an alpha, alpha disubstituted amino acid, wherein at least one side chain is the same as that of the residue from which it is derived), a beta-amino acid derived from any of the foregoing (i.e., a beta-amino acid which, other than for the presence of a beta-carbon, is the same as the residue from which it is derived) etc., including all of the foregoing can be referred to herein as a "residue.”
- Suitable substituents, in addition to the side chain moiety of the alpha-amino acid include C 1 to C 6 linear or branched alkyl.
- Aib is an example of an alpha, alpha disubstituted amino acid. While alpha, alpha disubstituted amino acids can be referred to using conventional L- and D-isomeric references, it is to be understood that such references are for convenience, and that where the substituents at the alpha-position are different, such amino acid can interchangeably be referred to as an alpha, alpha disubstituted amino acid derived from the L- or D-isomer, as appropriate, of a residue with the designated amino acid side chain moiety.
- N-substituted amino acid includes any amino acid wherein an amino acid side chain moiety is covalently bonded to the backbone amino group, optionally where there are no substituents other than H in the alpha-carbon position.
- Sarcosine is an example of an N-substituted amino acid.
- sarcosine can be referred to as an N-substituted amino acid derivative of Ala, in that the amino acid side chain moiety of sarcosine and Ala is the same, i.e., methyl.
- covalent modifications of the peptide sequences including subsequences, variants and modified forms of the peptide sequences exemplified herein are provided.
- An exemplary type of covalent modification includes reacting targeted amino acid residues with an organic derivatizing agent that is capable of reacting with selected side chains or the N- or C-terminal residues of the peptide.
- Derivatization with bifunctional agents is useful, for instance, for cross-linking peptide to a water-insoluble support matrix or surface for use in the method for purifying anti-peptide antibodies, and vice-versa.
- cross linking agents include, e.g., 1,1-bis(diazoacetyl)-2-phenylethane, glutaraldehyde, N-hydroxysuccinimide esters, for example, esters with 4-azidosalicylic acid, homobifunctional imidoesters, including disuccinimidyl esters such as 3,3'-dithiobis(succinimidylpropionate), bifunctional maleimides such as bis-N-maleimido-1,8-octane and agents such as methyl-3-[(p-azidophenyl)dithio] propioimidate.
- 1,1-bis(diazoacetyl)-2-phenylethane glutaraldehyde
- N-hydroxysuccinimide esters for example, esters with 4-azidosalicylic acid
- homobifunctional imidoesters including disuccinimidyl esters such as 3,3'-dithiobis(succ
- Exemplified peptide sequences, and subsequences, variants and modified forms of the peptide sequences exemplified herein can also include alterations of the backbone for stability, derivatives, and peptidomimetics.
- peptidomimetic includes a molecule that is a mimic of a residue (referred to as a "mimetic"), including but not limited to piperazine core molecules, keto-piperazine core molecules and diazepine core molecules.
- an amino acid mimetic of a peptide sequence provided herein includes both a carboxyl group and amino group, and a group corresponding to an amino acid side chain, or in the case of a mimetic of Glycine, no side chain other than hydrogen.
- these would include compounds that mimic the sterics, surface charge distribution, polarity, etc. of a naturally occurring amino acid, but need not be an amino acid, which would impart stability in the biological system.
- Proline may be substituted by other lactams or lactones of suitable size and substitution;
- Leucine may be substituted by an alkyl ketone, N-substituted amide, as well as variations in amino acid side chain length using alkyl, alkenyl or other substituents, others may be apparent to the skilled artisan.
- the essential element of making such substitutions is to provide a molecule of roughly the same size and charge and configuration as the residue used to design the molecule. Refinement of these modifications will be made by analyzing the compounds in a functional (e.g., glucose lowering) or other assay, and comparing the structure-activity relationship. Such methods are within the scope of the skilled artisan working in medicinal chemistry and drug development.
- binding when used in reference to a peptide sequence, means that the peptide sequence interacts at the molecular level. Specific and selective binding can be distinguished from non-specific binding using assays known in the art (e.g ., competition binding, immunoprecipitation, ELISA, flow cytometry, Western blotting).
- Peptides and peptidomimetics can be produced and isolated using methods known in the art. Peptides can be synthesized, in whole or in part, using chemical methods (see, e.g., Caruthers (1980). Nucleic Acids Res. Symp. Ser. 215; Horn (1980 ); and Banga, A.K., Therapeutic Peptides and Proteins, Formulation, Processing and Delivery Systems (1995) Technomic Publishing Co., Lancaster, PA ). Peptide synthesis can be performed using various solid-phase techniques (see, e.g., Roberge Science 269:202 (1995 ); Merrifield, Methods Enzymol.
- a “synthesized” or “manufactured” peptide sequence is a peptide made by any method involving manipulation by the hand of man. Such methods include, but are not limited to, the aforementioned, such as chemical synthesis, recombinant DNA technology, biochemical or enzymatic fragmentation of larger molecules, and combinations of the foregoing.
- Peptide sequences disclosed herein including subsequences, sequence variants and modified forms of the exemplified peptide sequences (e.g., sequences listed in the Sequence Listing or Table 1), can also be modified to form a chimeric molecule.
- peptide sequences that include a heterologous domain can be added to the amino-terminus or at the carboxyl-terminus of the peptide sequence.
- Heterologous domains can also be positioned within the peptide sequence, and/or alternatively flanked by FGF19 and/or FGF21 derived amino acid sequences.
- peptide also includes dimers or multimers (oligomers) of peptides.
- dimers or multimers (oligomers) of the exemplified peptide sequences are provided herein, as well as subsequences, variants and modified forms of the exemplified peptide sequences, including sequences listed in the Sequence Listing or Table 1.
- Peptide sequences disclosed herein comprise an amino acid sequence set forth in Table 1.
- peptide sequences disclosed herein consist of an amino acid sequence set forth in Table 1.
- Table 1 SEQ ID NO. Amino Acid Sequence 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. 13. 14. 15. 16. 17. 18. 19. 20. 21. 22. 23. 24. 25. 26. 27. 28. 29. 30. 31. 32. 33. 34. 35. 36. 37. 38. 39. 40. 41. 42. 43. 44. 45. 46. 47. 48. 49. 50. 51. 52. 53. 54. 55. 56. 57. 58. 59. 60. 61. 62. 63. 64. 65. 66. 67. 68. 69. 70. 71. 72. 73.
- Improvements of physical properties include, for example, modulating immunogenicity; methods of increasing solubility, bioavailability, serum half-life, and/or therapeutic half-life; and/or modulating biological activity. Certain modifications may also be useful to, for example, raise of antibodies for use in detection assays (e.g., epitope tags) and to provide for ease of protein purification. Such improvements must generally be imparted without adversely impacting the bioactivity of the treatment modality and/or increasing its immunogenicity.
- Pegylation of is one particular modification contemplated herein, while other modifications include, but are not limited to, glycosylation (N- and O-linked); polysialylation; albumin fusion molecules comprising serum albumin (e.g., human serum albumin (HSA), cyno serum albumin, or bovine serum albumin (BSA)); albumin binding through, for example a conjugated fatty acid chain (acylation); and Fc-fusion proteins.
- serum albumin e.g., human serum albumin (HSA), cyno serum albumin, or bovine serum albumin (BSA)
- Fc-fusion proteins Fc-fusion proteins
- PEG-conjugated biomolecules have been shown to possess clinically useful properties, including better physical and thermal stability, protection against susceptibility to enzymatic degradation, increased solubility, longer in vivo circulating half-life and decreased clearance, reduced immunogenicity and antigenicity, and reduced toxicity.
- pegylation itself may enhance activity.
- PEGs suitable for conjugation to a polypeptide sequence are generally soluble in water at room temperature, and have the general formula R(O-CH 2 -CH 2 ) n O-R, where R is hydrogen or a protective group such as an alkyl or an alkanol group, and where n is an integer from 1 to 1000. When R is a protective group, it generally has from 1 to 8 carbons.
- the PEG conjugated to the polypeptide sequence can be linear or branched. Branched PEG derivatives, "star-PEGs" and multi-armed PEGs are contemplated by the present disclosure.
- a molecular weight of the PEG used in embodiments provided herein is not restricted to any particular range, and examples are set forth elsewhere herein; by way of example, certain embodiments have molecular weights between 5kDa and 20kDa, while other embodiments have molecular weights between 4kDa and 10kDa.
- Such compositions can be produced by reaction conditions and purification methods know in the art. Cation exchange chromatography may be used to separate conjugates, and a fraction is then identified which contains the conjugate having, for example, the desired number of PEGs attached, purified free from unmodified protein sequences and from conjugates having other numbers of PEGs attached.
- PEG may be bound to a polypeptide provided herein via a terminal reactive group (a "spacer” or "linker") which mediates a bond between the free amino or carboxyl groups of one or more of the polypeptide sequences and polyethylene glycol.
- a terminal reactive group a "spacer” or "linker”
- the PEG having the spacer which may be bound to the free amino group includes N-hydroxysuccinylimide polyethylene glycol which may be prepared by activating succinic acid ester of polyethylene glycol with N-hydroxysuccinylimide.
- Another activated polyethylene glycol which may be bound to a free amino group is 2,4-bis(O-methoxypolyethyleneglycol)-6-chloro-s-triazine, which may be prepared by reacting polyethylene glycol monomethyl ether with cyanuric chloride.
- the activated polyethylene glycol which is bound to the free carboxyl group includes polyoxyethylenediamine.
- the reaction is terminated by acidifying the reaction mixture and freezing at, e.g., -20°C.
- Pegylation of various molecules is discussed in, for example, U.S. Pat. Nos. 5,252,714 ; 5,643,575 ; 5,919,455 ; 5,932,462 ; and 5,985,263 .
- PEG mimetics also provided herein are uses of PEG mimetics.
- Recombinant PEG mimetics have been developed that retain the attributes of PEG (e.g., enhanced serum half-life) while conferring several additional advantageous properties.
- simple polypeptide chains comprising, for example, Ala, Glu, Gly, Pro, Ser and Thr
- the peptide or protein drug of interest e.g., XTEN technology; Amunix; Mountain View, CA.
- This obviates the need for an additional conjugation step during the manufacturing process.
- established molecular biology techniques enable control of the side chain composition of the polypeptide chains, allowing optimization of immunogenicity and manufacturing properties.
- glycosylation is meant to broadly refer to the enzymatic process by which glycans are attached to proteins, lipids or other organic molecules.
- the use of the term “glycosylation” herein is generally intended to mean adding or deleting one or more carbohydrate moieties (either by removing the underlying glycosylation site or by deleting the glycosylation by chemical and/or enzymatic means), and/or adding one or more glycosylation sites that may or may not be present in the native sequence.
- the phrase includes qualitative changes in the glycosylation of the native proteins involving a change in the nature and proportions of the various carbohydrate moieties present.
- Glycosylation can dramatically affect the physical properties (e.g., solubility) of polypeptides and can also be important in protein stability, secretion, and subcellular localization. Glycosylated polypeptides may also exhibit enhanced stability or may improve one or more pharmacokinetic properties, such as half-life. In addition, solubility improvements can, for example, enable the generation of formulations more suitable for pharmaceutical administration than formulations comprising the non-glycosylated polypeptide.
- solubility improvements can, for example, enable the generation of formulations more suitable for pharmaceutical administration than formulations comprising the non-glycosylated polypeptide.
- Addition of glycosylation sites can be accomplished by altering the amino acid sequence.
- the alteration to the polypeptide may be made, for example, by the addition of, or substitution by, one or more serine or threonine residues (for O-linked glycosylation sites) or asparagine residues (for N-linked glycosylation sites).
- the structures of N-linked and O-linked oligosaccharides and the sugar residues found in each type may be different.
- One type of sugar that is commonly found on both is N-acetylneuraminic acid (hereafter referred to as sialic acid).
- sialic acid is usually the terminal residue of both N-linked and O-linked oligosaccharides and, by virtue of its negative charge, may confer acidic properties to the glycoprotein.
- a particular embodiment comprises the generation and use of N-glycosylation variants.
- polypeptide sequences provided herein may optionally be altered through changes at the nucleic acid level, particularly by mutating the nucleic acid encoding the polypeptide at preselected bases such that codons are generated that will translate into the desired amino acids.
- DHFR Dihydrofolate reductase
- CHO Chinese Hamster Ovary
- polysialylation the conjugation of polypeptides to the naturally occurring, biodegradable ⁇ -(2 ⁇ 8) linked polysialic acid ("PSA") in order to improve the polypeptides' stability and in vivo pharmacokinetics.
- PSA biodegradable ⁇ -(2 ⁇ 8) linked polysialic acid
- Albumin Fusion Additional suitable components and molecules for conjugation include albumins such as human serum albumin (HSA), cyno serum albumin, and bovine serum albumin (BSA).
- HSA human serum albumin
- BSA bovine serum albumin
- albumin is conjugated to a drug molecule (e.g., a polypeptide described herein) at the carboxyl terminus, the amino terminus, both the carboxyl and amino termini, and internally (see, e.g., US Pat Nos. 5,876,969 and 7,056,701 ).
- a drug molecule e.g., a polypeptide described herein
- albumin in the HSA-drug molecule conjugates embodiments provided herein, various forms of albumin may be used, such as albumin secretion pre-sequences and variants thereof, fragments and variants thereof, and HSA variants. Such forms generally possess one or more desired albumin activities.
- fusion proteins are provided herein comprising a polypeptide drug molecule fused directly or indirectly to albumin, an albumin fragment, an albumin variant, etc., wherein the fusion protein has a higher plasma stability than the unfused drug molecule and/or the fusion protein retains the therapeutic activity of the unfused drug molecule.
- the indirect fusion is effected by a linker, such as a peptide linker or modified version thereof.
- fusion of albumin to one or more polypeptides provided herein can, for example, be achieved by genetic manipulation, such that the nucleic acid coding for HSA, or a fragment thereof, is joined to the nucleic acid coding for the one or more polypeptide sequences.
- albumin binding through a conjugated fatty acid chain (acylation) and fusion proteins which comprise an albumin binding domain (ABD) polypeptide sequence and the sequence of one or more of the polypeptides described herein.
- Fusion of albumin to a peptide sequence can, for example, be achieved by genetic manipulation, such that the DNA coding for HSA (human serum albumin), or a fragment thereof, is joined to the DNA coding for a peptide sequence. Thereafter, a suitable host can be transformed or transfected with the fused nucleotide sequence in the form of, for example, a suitable plasmid, so as to express a fusion polypeptide.
- the expression may be effected in vitro from, for example, prokaryotic or eukaryotic cells, or in vivo from, for example, a transgenic organism.
- the expression of the fusion protein is performed in mammalian cell lines, for example, CHO cell lines.
- dAbs are the smallest functional binding units of human antibodies (IgGs) and have favorable stability and solubility characteristics.
- the technology entails a dAb(s) conjugated to HSA (thereby forming a "AlbudAb”; see, e.g., EP1517921B , WO2005/118642 and WO2006/051288 ) and a molecule of interest (e.g., a peptide sequence provided herein).
- AlbudAbs are often smaller and easier to manufacture in microbial expression systems, such as bacteria or yeast, than current technologies used for extending the serum half-life of peptides. As HSA has a half-life of about three weeks, the resulting conjugated molecule improves the half-life.
- Use of the dAb technology may also enhance the efficacy of the molecule of interest.
- thyroglobulin tetanus toxoid
- Diphtheria toxoid polyamino acids such as poly(D-lysine:D-glutamic acid);
- VP6 polypeptides of rotaviruses influenza virus hemagglutinin, influenza virus nucleoprotein; Keyhole Limpet Hemocyanin (KLH); and hepatitis B virus core protein and surface antigen; or any combination of the foregoing.
- KLH Keyhole Limpet Hemocyanin
- conjugation of one or more additional components or molecules at the N- and/or C-terminus of a polypeptide sequence such as another polypeptide (e.g., a polypeptide having an amino acid sequence heterologous to the subject polypeptide), or a carrier molecule is also contemplated.
- another polypeptide e.g., a polypeptide having an amino acid sequence heterologous to the subject polypeptide
- a carrier molecule e.g., an exemplary polypeptide sequence can be provided as a conjugate with another component or molecule.
- a polypeptide may also be conjugated to large, slowly metabolized macromolecules such as proteins; polysaccharides, such as sepharose, agarose, cellulose, or cellulose beads; polymeric amino acids such as polyglutamic acid, or polylysine; amino acid copolymers; inactivated virus particles; inactivated bacterial toxins such as toxoid from diphtheria, tetanus, cholera, or leukotoxin molecules; inactivated bacteria; and dendritic cells.
- Such conjugated forms if desired, can be used to produce antibodies against a polypeptide provided herein.
- the amino- or carboxyl- terminus of a polypeptide sequence provided herein is fused with an immunoglobulin Fc region to form a fusion conjugate (or fusion molecule).
- the immunoglobuling Fc region is a human Fc region. Fusion conjugates have been shown to increase the systemic half-life of biopharmaceuticals, and thus the biopharmaceutical product may require less frequent administration. In certain embodiments, the half-life is increased as compared to the same polypeptide that is not fused to an immunoglobuling Fc region.
- Fc binds to the neonatal Fc receptor (FcRn) in endothelial cells that line the blood vessels, and, upon binding, the Fc fusion molecule is protected from degradation and re-released into the circulation, keeping the molecule in circulation longer.
- This Fc binding is believed to be the mechanism by which endogenous IgG retains its long plasma half-life.
- More recent Fc-fusion technology links a single copy of a biopharmaceutical to the Fc region of an antibody to optimize the pharmacokinetic and pharmacodynamic properties of the biopharmaceutical as compared to traditional Fc-fusion conjugates.
- a fusion of M70 to a human antibody Fc fragment is provided herein.
- Such fusions can be useful in the treatment of bile acid related disorders and other metabolic disorders provided herein.
- the Fc-fusion of M70 has a longer half-life.
- the longer half-life of the Fc-fusion of M70 is as compared to M70 that is not an Fc-fusion. Such a long half-life makes these fusions suitable for once weekly, or less frequent dosing.
- the Fc-fusion comprises a linker.
- exemplary flexible linkers include glycine polymers (G) n , glycine-serine polymers, glycine-alanine polymers, alanine-serine polymers, and other flexible linkers.
- the linker is (G) 4 S.
- the linker is ((G) 4 S) n , where n is an integer of at least one.
- the linker is ((G) 4 S) 2 .
- Glycine and glycine-serine polymers are relatively unstructured, and therefore may serve as a neutral tether between components.
- the glycine-serine polymer is (GS) n , where n is an integer of at least one. In some embodiments, the glycine-serine polymer is GSGGS n (SEQ ID NO: 129), where n is an integer of at least one. In some embodiments, the glycine-serine polymer is GGGS n (SEQ ID NO: 130), where n is an integer of at least one. In certain embodiments, the linker comprises an additional G residue at the N' terminus of SEQ ID NO: 130. In one embodiment, the linker is GGSG (SEQ ID NO:131). In one embodiment, the linker is GGSGG (SEQ ID NO: 132).
- the linker is GSGSG (SEQ ID NO: 133). In one embodiment, the linker is GSGGG (SEQ ID NO: 134). In one embodiment, the linker is GGGSG (SEQ ID NO: 189). In one embodiment, the linker is GSSSG (SEQ ID NO:135).
- binding molecules such as biotin (biotin-avidin specific binding pair), an antibody, a receptor, a ligand, a lectin, or molecules that comprise a solid support, including, for example, plastic or polystyrene beads, plates or beads, magnetic beads, test strips, and membranes.
- cation exchange chromatography may be used to separate conjugates by charge difference, which effectively separates conjugates into their various molecular weights.
- the cation exchange column can be loaded and then washed with ⁇ 20 mM sodium acetate, pH ⁇ 4, and then eluted with a linear (0 M to 0.5 M) NaCl gradient buffered at a pH from 3 to 5.5, such as at pH ⁇ 4.5.
- the content of the fractions obtained by cation exchange chromatography may be identified by molecular weight using conventional methods, for example, mass spectroscopy, SDS-PAGE, or other known methods for separating molecular entities by molecular weight.
- a fraction is then identified which contains the conjugate having the desired number of PEGs attached, purified free from unmodified protein sequences and from conjugates having other numbers of PEGs attached.
- a peptide sequence provided herein is linked to a chemical agent (e.g., an immunotoxin or chemotherapeutic agent), including, but are not limited to, a cytotoxic agent, including taxol, cytochalasin B, gramicidin D, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicin, doxorubicin, daunorubicin, and analogs or homologs thereof.
- a chemical agent e.g., an immunotoxin or chemotherapeutic agent
- a cytotoxic agent including taxol, cytochalasin B, gramicidin D, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicin, doxorubicin, daunorubicin, and analogs or homologs thereof.
- detectable labels such as a radioisotope (e.g., 125 I; 35 S, 32 P; 33 P), an enzyme which generates a detectable product (e.g., luciferase, ⁇ -galactosidase, horse radish peroxidase and alkaline phosphatase), a fluorescent protein, a chromogenic protein, dye ( e.g., fluorescein isothiocyanate); fluorescence emitting metals ( e.g., 152 Eu); chemiluminescent compounds (e.g., luminol and acridinium salts); bioluminescent compounds ( e.g ., luciferin); and fluorescent proteins.
- Indirect labels include labeled or detectable antibodies that bind to a peptide sequence, where the antibody may be detected.
- Linkers and their use have been described above. Any of the foregoing components and molecules used to modify the polypeptide sequences provided herein may optionally be conjugated via a linker.
- Suitable linkers include "flexible linkers" which are generally of sufficient length to permit some movement between the modified polypeptide sequences and the linked components and molecules.
- the linker molecules are generally about 6-50 atoms long.
- the linker molecules may also be, for example, aryl acetylene, ethylene glycol oligomers containing 2-10 monomer units, diamines, diacids, amino acids, or combinations thereof.
- Suitable linkers can be readily selected and can be of any suitable length, such as 1 amino acid (e.g., Gly), 2, 3, 4, 5, 6, 7, 8, 9, 10, 10-20, 20-30, 30-50 or more than 50 amino acids.
- Exemplary flexible linkers include glycine polymers (G) n , glycine-serine polymers (for example, (GS) n , GSGGS n (SEQ ID NO:129) and GGGS n (SEQ ID NO: 130), where n is an integer of at least one), glycine-alanine polymers, alanine-serine polymers, and other flexible linkers.
- Glycine and glycine-serine polymers are relatively unstructured, and therefore may serve as a neutral tether between components.
- Exemplary flexible linkers include, but are not limited to GGSG (SEQ ID NO:131), GGSGG (SEQ ID NO: 132), GSGSG (SEQ ID NO:133), GSGGG (SEQ ID NO:134), GGGSG (SEQ ID NO:189), and GSSSG (SEQ ID NO:135).
- the linker is (G) 4 S.
- the linker is ((G) 4 S) n ), where n is an integer of at least one.
- the linker is ((G) 4 S) 2 ).
- the glycine-serine polymer is (GS) n , where n is an integer of at least one.
- a further example of an activity is a lower or reduced lean muscle mass reducing activity, for example, as compared to FGF21.
- Yet another example of an activity is binding to FGFR4, or activating FGFR4, for example, peptide sequences that bind to FGFR4 with an affinity comparable to or greater than FGF19 binding affinity for FGFR4; and peptide sequences that activate FGFR4 to an extent or amount comparable to or greater than FGF19 activates FGFR4.
- Still further examples of activities include treating a bile acid-related or associated disorder.
- Activities such as, for example, modulation of bile acid homeostasis, glucose lowering activity, analysis of a bile acid-related or associated disorder, HCC formation or tumorigenesis, lipid increasing activity, or lean mass reducing activity can be ascertained in an animal, such as a db / db mouse.
- Measurement of binding to FGFR4 or activation of FGFR4 can be ascertained by assays disclosed herein or known to the skilled artisan.
- liver cancer may be nodular, where the tumor nodules (which are round-to-oval, grey or green, well circumscribed but not encapsulated) appear as either one large mass or multiple smaller masses.
- HCC may be present as an infiltrative tumor which is diffuse and poorly circumscribed and frequently infiltrates the portal veins.
- Pathological assessment of hepatic tissue samples is generally performed after the results of one or more of the aforementioned techniques indicate the likely presence of HCC.
- methods disclosed herein may further include assessing a hepatic tissue sample from an in vivo animal model (e.g ., a db / db mouse) useful in HCC studies in order to determine whether a peptide sequence exhibits evidence of inducing HCC.
- a pathologist can determine whether one of the four general architectural and cytological types (patterns) of HCC are present (i.e., fibrolamellar, pseudoglandular (adenoid), pleomorphic (giant cell) and clear cell).
- Peptide sequences disclosed herein including the FGF19 and FGF21 variants and subsequences and the FGF19/FGF21 fusions and chimeras listed in Table 1 and Sequence Listing, as well as subsequences, variants and modified forms of the sequences listed in Table 1 and Sequence Listing include those with the following activities: peptide sequences modulating bile acid homeostasis or treating a bile acid-related or associated disorder while having reduced HCC formation compared to FGF19, or a FGF 19 variant sequence having any of GQV, GDI, WGPI (SEQ ID NO: 171), WGDPV (SEQ ID NO: 172), WGDI (SEQ ID NO: 173), GDPI (SEQ ID NO: 174), GPI, WGQPI (SEQ ID NO: 175), WGAPI (SEQ ID NO: 176), AGDPI (SEQ ID NO: 177), WADPI (SEQ ID NO: 178), WGDAI (SEQ ID
- Peptide sequences disclosed herein including the FGF19 and FGF21 variants and subsequences and the FGF19/FGF21 fusions and chimeras listed in Table 1 and Sequence Listing, as well as subsequences, variants and modified forms of the sequences listed in Table 1 and the Sequence Listing include those with the following activities: peptide sequences that modulate bile acid homeostasis; peptide sequences that treat a bile acid-related or associated disorder, peptide sequences that bind to FGFR4, or activate FGFR4, such as peptide sequences that bind to FGFR4 with an affinity comparable to or greater than FGF19 binding affinity for FGFR4; peptide sequences that activate FGFR4 to an extent or amount comparable to or greater than FGF19 activates FGFR4; peptide sequences that down-regulate or reduce aldo-keto reductase gene expression, for example, compared to FGF19; and peptide sequences that up-
- variants include various N-terminal modifications and/or truncations of FGF19, including variants in which there has been a substitution of one or several N-terminal FGF19 amino acids with amino acids from FGF21.
- variants include variants having glucose lowering activity, as well as a favorable lipid profile and are not measurably or detectably tumorigenic.
- the subject of this patent is a pharmaceutical composition comprising a peptide of SEQ ID NO:70 and its use in methods of preventing, treating, or managing a disease or disorder as defined in the claims.
- Other peptides, compositions and uses thereof are not the subject of the claimed invention.
- Peptide sequences disclosed herein including subsequences, sequence variants and modified forms of the exemplified peptide sequences may be formulated in a unit dose or unit dosage form.
- a peptide sequence may be in an amount effective to treat a subject in need of treatment, e.g., due to abnormal or aberrant bile acid homeostasis, such as metabolic syndrome; a lipid- or glucose-related disorder; cholesterol or triglyceride metabolism; type 2 diabetes; cholestasis, including, for example diseases of intrahepatic cholestasis (e.g., PBC, PFIC, PSC, PIC, neonatal cholestasis, and drug induced cholestasis ( e.g., estrogen)), and diseases of extrahepatic cholestasis ( e.g., bile cut compression from tumor, bile duct blockade by gall stones); bile acid malabsorption and other disorders involving the distal small intestine, including ileal resection, inflammatory bowel diseases (e.g., Crohn's disease and ulcerative colitis), disorders impairing absorption of bile acids not otherwise characterized (id
- Exemplary unit doses range from about 25-250, 250-500, 500-1000, 1000-2500 or 2500-5000, 5000-25,000, 25,000-50,000 ng; from about 25-250, 250-500, 500-1000, 1000-2500 or 2500-5000, 5000-25,000, 25,000-50,000 ⁇ g; and from about 25-250, 250-500, 500-1000, 1000-2500 or 2500-5000, 5000-25,000, 25,000-50,000 mg.
- Peptide sequences disclosed herein including subsequences, sequence variants and modified forms of the exemplified peptide sequences (e.g., sequences listed in the Sequence Listing or Table 1) can be administered to provide the intended effect as a single dose or multiple dosages, for example, in an effective or sufficient amount.
- Exemplary doses range from about 25-250, 250-500, 500-1000, 1000-2500 or 2500-5000, 5000-25,000, 25,000-50,000 pg/kg; from about 50-500, 500-5000, 5000-25,000 or 25,000-50,000 ng/kg; and from about 25-250, 250-500, 500-1000, 1000-2500 or 2500-5000, 5000-25,000, 25,000-50,000 ⁇ g/kg.
- Single or multiple doses can be administered, for example, multiple times per day, on consecutive days, alternating days, weekly or intermittently (e.g., twice per week, once every 1, 2, 3, 4, 5, 6, 7 or 8 weeks, or once every 2, 3, 4, 5 or 6 months).
- Peptide sequences provided herein including subsequences, variants and modified forms of the exemplified peptide sequences can be administered and methods may be practiced via systemic, regional or local administration, by any route.
- a peptide sequence can be administered parenterally (e.g., subcutaneously, intravenously, intramuscularly, or intraperitoneally), orally (e.g., ingestion, buccal, or sublingual), inhalation, intradermally, intracavity, intracranially, transdermally (topical), transmucosally or rectally.
- Peptide sequences provided herein including subsequences, variants and modified forms of the exemplified peptide sequences e.g., sequences listed in the Sequence Listing or Table 1
- methods provided herein including pharmaceutical compositions can be administered via a (micro)encapsulated delivery system or packaged into an implant for administration.
- parenteral (e.g., subcutaneous) administration entails the use of Intarcia's subcutaneous delivery system (Intarcia Therapeutics, Inc.; Hayward, CA).
- the system comprises a miniature osmotic pump that delivers a consistent amount of a therapeutic agent over a desired period of time.
- the system can be used with formulations that maintain the stability of proteinaceous therapeutic agents at human body temperature for extended periods of time.
- DUROS ® -type implantable osmotic pumps from, e.g., DURECT Corp.
- the DUROS ® system can be used for therapies requiring systemic or site-specific administration of a drug.
- the DUROS ® system is placed just under the skin, for example in the upper arm, in an outpatient procedure that is completed in just a few minutes using local anesthetic.
- miniaturized catheter technology can be used.
- the catheter can be attached to the DUROS ® system to direct the flow of a drug to the target organ, tissue or synthetic medical structure, such as a graft.
- Site-specific delivery enables a therapeutic concentration of a drug to be administered to the desired target without exposing the entire body to a similar concentration.
- the precision, size and performance of the DUROS ® system will allow for continuous site-specific delivery to a variety of precise locations within the body.
- parenteral administration entails the use of an on-body delivery system (e.g., the Neulasta ® Delivery Kit by Amgen).
- This on-body delivery system includes an on-body injector, which is a small, lightweight, injection system applied on the same day as a doctor visit (such as the day of chemotherapy). It is designed to deliver a dose of the therapeutic agent the next day, or in the near future of the doctor visit, so that the patient does not need to return to the doctor's office to receive the injection.
- the invention provides a pharmaceutical composition according to claim 1 for use in a method of preventing, treating or managing a disease or disorder in a subject in need thereof, wherein the disease or disorder is one or more of those recited in claim 16.
- Other methods of preventing, treating, and managing diseases and disorders described herein are not claimed as such.
- Disclosed herein is a method of preventing a disease or disorder in a subject having, or at risk of having, a disease or disorder preventable by a peptide sequence provided herein, comprising administering a pharmaceutical composition comprising a peptide provided herein to a subject in an amount effective for preventing the disease or disorder.
- Disclosed herein is a method of treating a disease or disorder in a subject having, or at risk of having, a disease or disorder treatable by a peptide sequence provided herein, comprising administering a pharmaceutical composition comprising a peptide provided herein to a subject in an amount effective for treating the disease or disorder. Also disclosed herein is a method of managing a disease or disorder in a subject having, or at risk of having, a disease or disorder manageable by a peptide sequence provided herein, comprising administering a pharmaceutical composition comprising a peptide provided herein to a subject in an amount effective for managing the disease or disorder.
- the disease or disorder is a bile acid-related disease or associated disorder.
- the disease or disorder is a metabolic disease or disorder.
- the disease or disorder is a cancer or tumor.
- bile acid-related disorder when used in reference to a condition of a subject, means a disruption of bile acid homeostasis, which may manifest itself as, for example, an acute, transient or chronic abnormal level of a bile acid or one or more bile acids.
- the condition can be caused by inhibition, reduction or a delay in bile acid synthesis, metabolism or absorption such that the subject exhibits a bile acid level not typically found in normal subjects.
- the methods may include administering a peptide sequence, such as a FGF19 or FGF21 variant, fusion or chimera disclosed herein (e.g., in the Sequence Listing or Table 1), or a subsequence, a variant or modified form of a FGF19 or FGF21 variant, fusion or chimera disclosed herein (e.g., the Sequence Listing or Table 1), to a subject in an amount effective for treating a bile acid-related or associated disorder.
- a peptide sequence such as a FGF19 or FGF21 variant, fusion or chimera disclosed herein (e.g., in the Sequence Listing or Table 1)
- a subsequence a variant or modified form of a FGF19 or FGF21 variant, fusion or chimera disclosed herein (e.g., the Sequence Listing or Table 1)
- the peptide is administered in combination with an additional therapeutic agent(s) and/or treatment modalities (e.g., an agent useful in the treatment and/or prevention of PBC).
- additional therapeutic agent(s) can be administered before, with, or following administration of the peptides described herein.
- Also disclosed but not claimed here are methods of preventing (e.g., in subjects predisposed to having a particular disorder(s)), delaying, slowing or inhibiting progression of, the onset of, or treating ( e.g., ameliorating) a bile acid-related or associated disorder relative to an appropriate matched subject of comparable age, gender, race, etc. ).
- a method provided herein for, for example, modulating bile acid homeostasis or treating a bile acid-related or associated disorder includes contacting or administering one or more peptides provided herein (e.g., a variant or fusion of FGF19 and/or FGF21 as set forth in the Sequence Listing or Table 1) in an amount effective to modulate bile acid homeostasis or treat a bile acid-related or associated disorder.
- the method may further comprise contacting or administering at least one additional therapeutic agent or treatment modality that is useful in the treatment or prevention of a bile acid-related or associated disorder (e.g., PBC).
- subject refers to an animal.
- the animal is a mammal that would benefit from treatment with a peptide sequence provided herein.
- Particular examples include primates ( e.g., humans), dogs, cats, horses, cows, pigs, and sheep.
- Subjects include those having a disorder, e.g., a bile acid-related or associated disorder, such as cholestasis, including, for example diseases of intrahepatic cholestasis (e.g., PBC, PFIC, PSC, PIC, neonatal cholestasis, and drug induced cholestasis ( e.g., estrogen)), and diseases of extrahepatic cholestasis (e.g., bile cut compression from tumor, bile duct blockade by gall stones); bile acid malabsorption and other disorders involving the distal small intestine, including ileal resection, inflammatory bowel diseases (e.g., Crohn's disease and ulcerative colitis), short bowel syndrome, disorders impairing absorption of bile acids not otherwise characterized (idiopathic)) leading to diarrhea (e.g., BAD) and GI symptoms, and GI, liver, and/or biliary cancers (
- Non-limiting exemplary bile acid-related or associated disorders preventable, treatable or manageable according to the methods and uses provided herein include: cholestasis, including, for example diseases of intrahepatic cholestasis (e.g., primary biliary cirrhosis (PBC), primary familial intrahepatic cholestasis (PFIC) ( e.g., progressive PFIC), primary sclerosing choangitis (PSC), pregnancy intrahepatic cholestasis (PIC), neonatal cholestasis, and drug-induced cholestasis (e.g., estrogen)), and diseases of extrahepatic cholestasis (e.g., bile cut compression from tumor, bile duct blockade by gall stones); bile acid malabsorption and other disorders involving the distal small intestine, including ileal resection, inflammatory bowel diseases (e.g.
- PBC primary biliary cirrhos
- bile acid diarrhea e.g., bile acid diarrhea (BAD)
- BAD bile acid diarrhea
- GI GI, liver, and/or biliary cancers
- NASH non-alcoholic steatohepatitis
- cirrhosis cirrhosis and portal hypertension
- Additional bile acid-related or associated disorders include metabolic syndrome; a lipid or glucose disorder; cholesterol or triglyceride metabolism; type 2 diabetes.
- the bile acid-related or associated disorder may be bile acid malabsorption.
- the bile acid-related or associated disorder may be diarrhea.
- the bile acid-related or associated disorder may be cholestasis (e.g., intrahepatic or extrahepatic cholestasis).
- the bile acid-related or associated disorder may be primary biliary cirrhosis (PBC).
- the bile acid-related or associated disorder may be primary sclerosing cholangitis.
- the bile acid-related or associated disorder may be PFIC (e.g., progressive PFIC).
- the bile acid-related or associated disorder may be NASH.
- the bile acid-related or associated disorder may be a hyperglycemic condition.
- the bile acid-related or associated disorder may be type 2 diabetes.
- the pharmaceutical composition further comprises at least one additional agent effective in modulating bile acid homeostasis or treating a bile acid-related or associated disorder, wherein the additional agent is: a glucocorticoid; CDCA; UDCA; insulin, an insulin secretagogues, an insulin mimetic, a sulfonylurea and a meglitinide; a biguanide; an alpha-glucosidase inhibitors; a DPP-IV inhibitor, GLP-1, a GLP-1 agonists and a GLP-1 analog; a DPP-IV-resistant analogue; a PPAR gamma agonist, a dual-acting PPAR agonist, a pan-acting PPAR agonist; a PTP1B inhibitor; an SGLT inhibitor; an RXR agonist; a glycogen synthase kinase-3 inhibitor; an immune modulator; a beta-3 adrenergic receptor agonist; an
- the at least one additional agent effective in modulating PBC is UDCA, an FXR agonist, OCA, an ASBT inhibitor, an autoimmune agent, an anti-IL-12 agent, an anti-CD80 agent, an anti-CD20 agent, a CXCL10 neutralizing antibody, a ligand for CXCR3, a fibrate, fish oil, colchicine, methotrexate, azathioprine, cyclosporine, or an anti-retroviral therapy.
- the at least one additional agent effective in modulating PBC is UDCA, OCA, an ASBT inhibitor, an anti-IL-12 agent, an anti-CD20 agent, or a fibrate.
- Additional bile acid-related or associated disorders that may be treated or prevented with the peptide sequences provided herein include metabolic syndrome, a lipid or glucose disorder, cholesterol or triglyceride metabolism, diabetes (e.g., type 2 diabetes), other hyperglycemic-related disorders, including kidney damage (e.g., tubule damage or nephropathy), liver degeneration, eye damage ( e.g., diabetic retinopathy or cataracts), and diabetic foot disorders, and dyslipidemias and their sequelae such as, for example, atherosclerosis, coronary artery disease, cerebrovascular disorders and the like.
- diabetes e.g., type 2 diabetes
- other hyperglycemic-related disorders including kidney damage (e.g., tubule damage or nephropathy), liver degeneration, eye damage ( e.g., diabetic retinopathy or cataracts), and diabetic foot disorders, and dyslipidemias and their sequelae such as, for example, atherosclerosis, coronary artery disease, cerebro
- Other conditions which may be associated with metabolic syndrome such as obesity and elevated body mass (including the co-morbid conditions thereof such as, but not limited to, nonalcoholic fatty liver disease (NAFLD), nonalcoholic steatohepatitis (NASH), and polycystic ovarian syndrome (PCOS)), and also include thromboses, hypercoagulable and prothrombotic states (arterial and venous), hypertension (including portal hypertension (defined as a hepatic venous pressure gradient (HVPG) greater than 5 mm Hg), cardiovascular disease, stroke and heart failure; Disorders or conditions in which inflammatory reactions are involved, including atherosclerosis, chronic inflammatory bowel diseases (e.g., Crohn's disease and ulcerative colitis), asthma, lupus erythematosus, arthritis, or other inflammatory rheumatic disorders; Disorders of cell cycle or cell differentiation processes such as adipose cell tumors, lipomatous carcinomas including, for example, liposarcomas, solid tumors, and
- Treatment of a bile acid-related or associated disorder may have the benefit of alleviating or abolishing a disorder secondary thereto.
- a subject suffering from NASH may also have depression or anxiety due to NASH; thus, treating the subject's NASH may also indirectly treat the depression or anxiety.
- the use of the therapies disclosed herein to target such secondary disorders is also contemplated in certain embodiments.
- the subject has or is at risk of having PBC. In other particular embodiments, the subject has or is at risk of having NASH.
- Subjects at risk of developing a bile acid-related or associated disorder include, for example, those who may have a family history or genetic predisposition toward such disorder, as well those whose diet may contribute to development of such disorders.
- treatment methods include contacting or administering a peptide as set forth herein (e.g., a variant or fusion of FGF19 and/or FGF21 as set forth in the Sequence Listing or Table 1) in an amount effective to achieve a desired outcome or result in a subject.
- a peptide as set forth herein e.g., a variant or fusion of FGF19 and/or FGF21 as set forth in the Sequence Listing or Table 1
- a treatment that results in a desired outcome or result includes decreasing, reducing or preventing the severity or frequency of one or more symptoms of the condition in the subject, e.g., an improvement in the subject's condition or a "beneficial effect” or "therapeutic effect.” Therefore, treatment can decrease or reduce or prevent the severity or frequency of one or more symptoms of the disorder, stabilize or inhibit progression or worsening of the disorder, and in some instances, reverse the disorder, transiently ( e.g., for 1-6, 6-12, or 12-24 hours), for medium term (e.g., 1-6, 6-12, 12-24 or 24-48 days) or long term (e.g., for 1-6, 6-12, 12-24, 24-48 weeks, or greater than 24-48 weeks).
- treatment can lower or reduce one or more symptoms or effects of the bile acid-related or associated disorders described above.
- the various methods disclosed herein may further include contacting or administering one or more additional agents or therapeutic modalities useful in the treatment or prevention of a bile acid-related or associated disorder, such as those agents or therapeutic modalities described herein, in an amount effective to achieve a desired outcome or result in a subject.
- an “effective amount” or a “sufficient amount” for use and/or for treating a subject refers to an amount that provides, in single or multiple doses, alone, or in combination with one or more other agents, treatments, protocols, or therapeutic regimens, a detectable response of any duration of time (transient, medium or long term), a desired outcome in or an objective or subjective benefit to a subject of any measurable or detectable degree or for any duration of time (e.g., for hours, days, months, years, in remission or cured).
- Such amounts typically are effective to ameliorate a disorder, or one, multiple or all adverse symptoms, consequences or complications of the disorder, to a measurable extent, although reducing or inhibiting a progression or worsening of the disorder, is considered a satisfactory outcome.
- the term “ameliorate” means an improvement in the subject's disorder, a reduction in the severity of the disorder, or an inhibition of progression or worsening of the disorder (e.g., stabilizing the disorder).
- a bile acid-related or associated disorder such as those described above, including cholestasis (e.g., PBC), disorders impairing absorption of bile acids leading to diarrhea (e.g., BAD) and bile acid synthesis abnormalities (e.g., NASH)
- an improvement can be a lowering or a reduction in one or more symptoms or effects of the disorder.
- a therapeutic benefit or improvement therefore need not be complete ablation of any one, most or all symptoms, complications, consequences or underlying causes associated with the disorder or disease.
- a satisfactory endpoint is achieved when there is a transient, medium or long term, incremental improvement in a subject's condition, or a partial reduction in the occurrence, frequency, severity, progression, or duration, or inhibition or reversal, of one or more associated adverse symptoms or complications or consequences or underlying causes, worsening or progression (e.g., stabilizing one or more symptoms or complications of the condition, disorder or disease), of the disorder or disease, over a duration of time (hours, days, weeks, months, etc.).
- the amount of the peptide (and optionally the additional agent) sufficient to ameliorate a disorder will depend on the type, severity and extent, or duration of the disorder, the therapeutic effect or outcome desired, and can be readily ascertained by the skilled artisan. Appropriate amounts will also depend upon the individual subject (e.g., the bioavailability within the subject, gender, age, etc.).
- a transient, or partial, restoration of normal bile acid homeostasis in a subject can reduce the dosage amount or frequency of the peptides and agents described herein in order to treat the bile acid-related or associated disorders described previously even though complete freedom from treatment has not resulted.
- An effective amount can be ascertained, for example, by measuring one or more relevant physiological effects.
- Methods and uses provided herein for treating a subject are applicable for prophylaxis to prevent or reduce the likelihood of a disorder in a subject, such as a bile acid-related or associated disorder. Accordingly, methods and uses provided herein for treating a subject having, or at risk of developing, a bile acid-related or associated disorder can be practiced prior to, substantially contemporaneously with, or following administration or application of another agent useful for the treatment or prevention of a bile acid-related or associated disorder, and/or can be supplemented with other forms of therapy.
- Supplementary therapies include other glucose lowering treatments, such as insulin, an insulin sensitivity enhancer and other drug treatments, a change in diet (low sugar, fats, etc.), weight loss surgery- (reducing stomach volume by gastric bypass, gastrectomy), gastric banding, gastric balloon, gastric sleeve, etc.
- a method or use provided herein for treating a hyperglycemic or insulin resistance disorder can be used in combination with drugs or other pharmaceutical compositions that lower glucose or increase insulin sensitivity in a subject.
- a method or use may include contacting or administering to a subject one or more variant or fusion FGF19 and/or FGF21 peptide sequences in an amount effective for preventing a bile-acid related or associated disorder.
- a method or use may include contacting or administering to a subject one or more variant or fusion FGF19 and/or FGF21 peptide sequences in an amount effective for treating a bile-acid related or associated disorder.
- a method or use may include contacting or administering to a subject one or more variant or fusion FGF19 and/or FGF21 peptide sequences in an amount effective for managing a bile-acid related or associated disorder.
- PBC Primary biliary cirrhosis
- patients with PBC are often asymptomatic at the time of initial diagnosis, most present, or subsequently develop, one or more of the following: pruritus; fatigue; jaundice; xanthoma; disorders associated with an extrahepatic autoimmune disorder (e.g., Sjögren's Syndrome and rheumatoid arthritis); and complications that result from cirrhosis or portal hypertension (e.g., ascites, esophageal varices and hepatic encephalopathy).
- pruritus e.g., fatigue; jaundice; xanthoma
- disorders associated with an extrahepatic autoimmune disorder e.g., Sjögren's Syndrome and rheumatoid arthritis
- complications that result from cirrhosis or portal hypertension e.g., ascites, esophageal varices and hepatic encephalopathy.
- diagnosis of PBC requires that other conditions with similar symptoms (e.g., autoimmune hepatitis and primary sclerosing cholangitis) by ruled out; by way of example, abdominal ultrasound or CT scan is usually performed to rule out blockage of the bile ducts.
- other conditions with similar symptoms e.g., autoimmune hepatitis and primary sclerosing cholangitis
- Diagnostic blood tests include deranged liver function tests (gamma-glutamyl transferase and alkaline phosphatase) and the presence of particular antibodies (antimitochondrial antibody (AMA) an antinuclear antibody (ANA)). Antinuclear antibodies are believed to be prognostic indicators of PBC. When other tests and procedures are indicative of PBC, a liver biopsy is frequently performed to confirm disease. Endoscopic retrograde cholangiopancreatography (ERCP), an endoscopic evaluation of the bile duct, may also be employed to confirm disease.
- ERCP Endoscopic retrograde cholangiopancreatography
- Stage 1 (Portal Stage) is characterized by portal inflammation and mild bile duct damage;
- Stage 2 (Periportal Stage) is characterized by enlarged triads, periportal fibrosis or inflammation;
- Stage 3 (Septal Stage) is characterized by active and/or passive fibrous septa; and
- Stage 4 (Biliary Cirrhosis) is characterized by the presence of hepatic nodules. Liver biopsy is required to determine the stage of disease.
- Serum bilirubin is an indicator of PBC progression and prognosis. Patients with a serum bilirubin level of 2-6 mg/dL have a mean survival time of 4.1 years, patients with a serum bilirubin level of 6-10 mg/dL have a mean survival time of 2.1 years, and patients with a serum bilirubin level above 10 mg/dL have a mean survival time of 1.4 years. Liver transplantation is an option in advanced cases of PBC, although the recurrence rate may be as high as 18% at 5 years, and up to 30% at 10 years.
- one aspect pertains to the use of one or more current therapies in combination with variants of FGF 19 peptide sequences, fusions of FGF19 and/or FGF21 peptide sequences and variants of fusions (chimeras) of FGF19 and/or FGF21 peptide sequences having one or more activities associated with the treatment and/or prevention of PBC and associated diseases, disorders and conditions.
- the most commonly used and/or promising agents for combination therapy are set forth hereafter, although it is to be understood that these agents are illustrative, and not exclusionary.
- UDCA bile acid ursodeoxycholic acid
- PBC treatment most frequently involves the bile acid ursodeoxycholic acid (Urosdiol, UDCA).
- UDCA therapy is helpful in reducing the cholestasis and improving the liver function tests in PBC patients; however, it does not demonstrably improve symptoms and has a questionable impact on prognosis.
- UDCA has been shown to reduce mortality, adverse events and the need for transplantation in PBC. Although UDCA is considered the first-line therapy, approximately one-third of patients may be non-responsive and remain at risk of progressive liver disease and are candidates for alternative or additive therapy.
- Farnesoid-X-receptor agonists represent a promising class of agents that may be used in combination therapy.
- FXR a nuclear receptor expressed at high levels in the liver and intestine
- CYP7A1 cholesterol 7 ⁇ hydroxylase-1
- Obeticholic acid OCA; Intercept Pharmaceuticals, NY
- CDCA chenodeoxycholic acid
- Inhibitors of the apical sodium-dependent bile acid transporter represent another class of agents that may be used in combination with the variants of FGF 19 peptide sequences, fusions of FGF19 and/or FGF21 peptide sequences and variants of fusions (chimeras) of FGF19 and/or FGF21 peptide sequences described herein for the treatment and/or prevention of PBC and associated diseases.
- ASBT a member of the sodium/bile-salt co-transport family coded by gene SLC10A2
- ABST inhibitors include LUM001 and SC-435, both of which are being developed by Lumena Pharmaceuticals (San Diego, CA).
- Bile acid sequestrants also find use in the treatment of PBC. Cholestyramine and colestipol are the best known bile acid sequestrants. However, their use is sometimes limited because they are only available in powder form and are not tolerated by many patients, often because of the poor texture and taste of the resin powder. The bile acid sequestrant colesevelam is available in tablet form and is often better tolerated. All bile acid sequestrants are capable of binding other compounds, including the fat-soluble vitamins A, D, E and K, and deficiencies of these vitamins many necessitate supplementation. Importantly, the PBC patient population inherently has poor lipid-dependent absorption of vitamins A, D, E and K, and thus patients taking bile acid sequestrants are at particular risk for deficiency of those vitamins.
- Agents associated with immune and inflammatory function are candidates for combination therapy with the variants of FGF19 peptide sequences, fusions of FGF19 and/or FGF21 peptide sequences and variants of fusions (chimeras) of FGF19 and/or FGF21 peptide sequences having one or more activities associated with the treatment and/or prevention of PBC and associated diseases, disorders and conditions.
- the interleukin IL-12 is linked with autoimmunity. Data indicate that the IL-12 signaling pathway plays a key role in the effector mechanisms that lead to biliary destruction. Targeting the p40 subunit of IL-12 has also been shown to ameliorate experimental immune-mediated cholangiopathy.
- anti-IL-12 agents e.g., monoclonal Ab inhibitors
- CD80 polymorphisms in CD80 have been identified as conferring an increased susceptibility to PBC
- blockade of co-stimulation between T cells and antigen-presenting cells through CD80 by use of an anti-CD80 agent could represent an important therapeutic approach for the treatment of PBC.
- improvement in IgM titre and an increase in intrahepatic regulatory T-cell number using the anti-CD20 antibody rituximab (RITUXAN) have shown promise.
- the immune-mediated destruction of small-sized bile ducts in PBC is predominantly cell-mediated, characterized by Th1 cells, CD8+ T cells, NK cells and NKT cells which express CXCR3. Therefore, neutralizing antibodies to CXCL10, a ligand for CXCR3, may offer the possibility to interfere with one of the key inflammatory processes and contribute to immune-mediated biliary destruction in PBC.
- blockade of co-stimulatory signals between T cells expressing CD28 and antigen-presenting cells expressing CD80 might represent an important approach for the treatment of autoimmune diseases.
- variants of FGF19 peptide sequences, fusions of FGF19 and/or FGF21 peptide sequences and variants of fusions (chimeras) of FGF19 and/or FGF21 peptide sequences described herein can be used alone or in combination with other agents for the treatment and/or prevention of those bile acid-related or associated disorders referenced herein that have an immune and/or inflammatory component, including, but not limited to, PBC and associated diseases, disorders and conditions.
- NSAID non-steroidal anti-inflammatory drugs
- steroids cytokine suppressive anti-inflammatory drug(s)
- CSAIDs antibodies to, or antagonists of, other human cytokines or growth factors (e.g., IL-2, IL-6, or PDGF); TNF antagonists (e.g., agents such as REMICADE, p75TNFRIgG (ENBREL) or p55TNFR1gG (LENERCEPT)); interferon- ⁇ 1a (AVONEX); interferon- ⁇ 1b (BETASERON); and immune checkpoint inhibitors, including PD1 (associated agents include the antibodies nivolumab and lambrolizumab), PDL1, BTLA, CTLA4 (associated agents include the fully humanized CTLA4 monoclonal antibody ipilimumab (YERVOY), TIM3, LAG3, and A2aR.
- PD1 associated agents include the antibodies nivolumab and lambrolizumab
- a fibrate is a member selected from the group of bezafibrate (BEZALIP), ciprofibrate (MODALIM), gemfibrozil (LOPID), clofibrate, and fenofibrate (TRICOR). Fish oil has exhibited similar benefits.
- corticosteroids such as budesonide may improve liver histology and biochemistry, particularly when used in combination with UDCA.
- Colchicine has been shown to improve liver function tests (e.g., AST and ALP) and represents another alternative treatment for PBC.
- Non-alcoholic steatohepatitis (NASH), considered part of a spectrum of non-alcoholic fatty liver diseases (NAFLD), causes inflammation and accumulation of fat and fibrous tissue in the liver.
- NASH non-alcoholic fatty liver diseases
- risk factors include central obesity, type-2 diabetes mellitus, insulin resistance (IR) and dyslipidemia; combinations of the foregoing are frequently described as the metabolic syndrome.
- certain drugs have been linked to NASH, including tamoxifen, amiodarone and steroids (e.g., prednisone and hydrocortisone).
- NASH non-alcoholic fatty liver disease
- tamoxifen amiodarone
- steroids e.g., prednisone and hydrocortisone
- Non-alcoholic fatty liver disease is the most common cause of chronic liver disease in the United States, and the estimated prevalence of NAFLD is 20-30% and for NASH it is estimated at 3.5-5%.
- NASH frequently presents with no overt symptoms, complicating its diagnosis.
- Liver function tests generally begin the diagnostic process, with levels of AST (aspartate aminotransferase) and ALT (alanine aminotransferase) elevated in about 90% percent of individuals with NASH.
- Other blood tests are often used for ruling out other causes of liver disease, such as hepatitis.
- Imaging tests e.g., ultrasound, CT scan, or MRI
- a liver biopsy is required to confirm NASH.
- treatment of NASH focuses primarily on pharmacological and non-pharmacological management of those medical conditions associated with it, including hyperlipidemia, diabetes and obesity.
- pharmacological intervention of NASH itself includes treatment with vitamin E, pioglitazone, metformin, statins, omega-3 fatty acids, and ursodeoxycholic acid (UDCA (ursodiol)).
- Other agents being evaluated, currently approved for different indications, include losartan and telisartan, exenatide, GLP-1 agonists, DPP IV inhibitors, and carbamazepine.
- variants of FGF19 peptide sequences fusions of FGF19 and/or FGF21 peptide sequences and variants of fusions (chimeras) of FGF19 and/or FGF21 peptide sequences having one or more activities associated with the treatment and/or prevention of other bile acid-related disorders and associated diseases, disorders and conditions besides PBC.
- the peptides may be used in combination with other therapeutic agents and/or treatment modalities.
- micellar solubilization a bile acid deficiency occurs in the proximal intestine that leads to impaired micellar solubilization
- cholylsarcosine cholyl-N-methylglycine
- a synthetic bile acid analogue has been shown to increase lipid absorption.
- Bile acid replacement is used in inborn errors of bile acid biosynthesis, usually with a mixture of CDCA or UDCA and cholic acid, to suppress the synthesis of cytotoxic bile acid precursors and restore the input of primary bile acids into the enterohepatic circulation.
- combination therapy with numerous additional agents is also contemplated, including. but not limited to, 1) insulin e.g., bolus and basal analogs), insulin mimetics and agents that entail stimulation of insulin secretion, including sulfonylureas (e.g., chlorpropamide, tolazamide, acetohexamide, tolbutamide, glyburide, glimepiride, glipizide) and meglitinides (e.g., repaglinide (PRANDIN) and nateglinide (STARLIX)); 2) biguanides (e.g., metformin (GLUCOPHAGE)) and other agents that act by promoting glucose utilization, reducing hepatic glucose production and/or diminishing intestinal glucose output; 3) alpha-glucosidase inhibitors (e.g., acarbose and miglitol) and other agents that slow down
- sulfonylureas e.g., chlorpropamide,
- DPP-4 dipeptidyl peptidase-4
- bromocriptine formulations e.g. and bile acid sequestrants (e.g., colesevelam)
- SGLT-2 inhibitors e.g
- the methods may include administering a peptide sequence, such as a FGF19 or FGF21 variant, fusion or chimera disclosed herein (e.g., in the Sequence Listing or Table 1), or a subsequence, a variant or modified form of a FGF19 or FGF21 variant, fusion or chimera disclosed herein (e.g., the Sequence Listing or Table 1), to a subject in an amount effective for treating a metabolic or associated disorder.
- a peptide sequence such as a FGF19 or FGF21 variant, fusion or chimera disclosed herein (e.g., in the Sequence Listing or Table 1)
- a subsequence a variant or modified form of a FGF19 or FGF21 variant, fusion or chimera disclosed herein (e.g., the Sequence Listing or Table 1)
- the peptide may be administered in combination with an additional therapeutic agent(s) and/or treatment modalities (e.g., an agent useful in the treatment and/or prevention of PBC).
- additional therapeutic agent(s) can be administered before, with, or following administration of the peptides described herein.
- a method provided herein for, for example, modulating bile acid homeostasis or treating a metabolic or associated disorder includes contacting or administering one or more peptides provided herein (e.g., a variant or fusion of FGF19 and/or FGF21 as set forth in the Sequence Listing or Table 1) in an amount effective to modulate bile acid homeostasis or treat a metabolic or associated disorder.
- the method may further comprise contacting or administering at least one additional therapeutic agent or treatment modality that is useful in the treatment or prevention of a metabolic or associated disorder (e.g., PBC).
- subject refers to an animal.
- the animal is a mammal that would benefit from treatment with a peptide sequence provided herein.
- Particular examples include primates ( e.g., humans), dogs, cats, horses, cows, pigs, and sheep.
- Subjects include those having a disorder, e.g., a metabolic or associated disorder, or subjects that do not have a disorder but may be at risk of developing the disorder.
- peptide sequences provided herein can be administered to subjects in need of modulation of bile acid homeostasis or having a bile-acid related or associated disorder.
- Peptide sequences provided herein may also be useful in other hyperglycemic-related disorders, including kidney damage (e.g., tubule damage or nephropathy), liver degeneration, eye damage ( e.g., diabetic retinopathy or cataracts), and diabetic foot disorders; dyslipidemias and their sequelae such as, for example, atherosclerosis, coronary artery disease, cerebrovascular disorders and the like.
- Other conditions which may be associated with metabolic syndrome such as obesity and elevated body mass (including the co-morbid conditions thereof such as, but not limited to, nonalcoholic fatty liver disease (NAFLD), nonalcoholic steatohepatitis (NASH), and polycystic ovarian syndrome (PCOS)), and also include thromboses, hypercoagulable and prothrombotic states (arterial and venous), hypertension (including portal hypertension (defined as a hepatic venous pressure gradient (HVPG) greater than 5 mm Hg), cardiovascular disease, stroke and heart failure; Disorders or conditions in which inflammatory reactions are involved, including atherosclerosis, chronic inflammatory bowel diseases (e.g., Crohn's disease and ulcerative colitis), asthma, lupus erythematosus, arthritis, or other inflammatory rheumatic disorders; Disorders of cell cycle or cell differentiation processes such as adipose cell tumors, lipomatous carcinomas including, for example, liposarcomas, solid tumors, and
- a subject has a hyperglycemic condition (e.g., diabetes, such as insulin-dependent (type I) diabetes, type II diabetes, or gestational diabetes), insulin resistance, hyperinsulinemia, glucose intolerance or metabolic syndrome, is obese and/or has an undesirable body mass.
- diabetes such as insulin-dependent (type I) diabetes, type II diabetes, or gestational diabetes
- a peptide sequence or chimeric peptide sequence provided herein may be administered to a subject in an amount effective to improve glucose metabolism in the subject.
- a subject has a fasting plasma glucose level greater than 100 mg/dl or has a hemoglobin A1c (HbA1c) level above 6%, prior to administration.
- HbA1c hemoglobin A1c
- a use or method of treatment of a subject may be intended to or result in reduced glucose levels, increased insulin sensitivity, reduced insulin resistance, reduced glucagon, an improvement in glucose tolerance, or glucose metabolism or homeostasis, improved pancreatic function, or reduced triglyceride, cholesterol, IDL, LDL or VLDL levels, or a decrease in blood pressure, a decrease in intimal thickening of the blood vessel, or a decrease in body mass or weight gain.
- Treatment of a metabolic or associated disorder may have the benefit of alleviating or abolishing a disorder secondary thereto.
- a subject suffering from hyperglycemia may also have depression or anxiety due to the hyperglycemia; thus, treating the subject's hyperglycemia may also indirectly treat the depression or anxiety.
- the use of the therapies disclosed herein to target such secondary disorders is also contemplated in certain embodiments.
- the subject has or is at risk of having hyperglycemia.
- the subject has or is at risk of having diabetes, such as Type 2 diabetes.
- Subjects at risk of developing a metabolic or associated disorder include, for example, those who may have a family history or genetic predisposition toward such disorder, as well those whose diet may contribute to development of such disorders.
- treatment methods include contacting or administering a peptide as set forth herein (e.g., a variant or fusion of FGF19 and/or FGF21 as set forth in the Sequence Listing or Table 1) in an amount effective to achieve a desired outcome or result in a subject.
- a peptide as set forth herein e.g., a variant or fusion of FGF19 and/or FGF21 as set forth in the Sequence Listing or Table 1
- a treatment that results in a desired outcome or result includes decreasing, reducing or preventing the severity or frequency of one or more symptoms of the condition in the subject, e.g., an improvement in the subject's condition or a "beneficial effect” or "therapeutic effect.” Therefore, treatment can decrease or reduce or prevent the severity or frequency of one or more symptoms of the disorder, stabilize or inhibit progression or worsening of the disorder, and in some instances, reverse the disorder, transiently ( e.g., for 1-6, 6-12, or 12-24 hours), for medium term ( e.g., 1-6, 6-12, 12-24 or 24-48 days) or long term ( e.g., for 1-6, 6-12, 12-24, 24-48 weeks, or greater than 24-48 weeks).
- treatment can lower or reduce one or more symptoms or effects of the metabolic or associated disorders described above.
- the various methods provided herein may further include contacting or administering one or more additional agents or therapeutic modalities useful in the treatment or prevention of a metabolic or associated disorder, such as those agents or therapeutic modalities described herein, in an amount effective to achieve a desired outcome or result in a subject.
- an “effective amount” or a “sufficient amount” for use and/or for treating a subject refers to an amount that provides, in single or multiple doses, alone, or in combination with one or more other agents, treatments, protocols, or therapeutic regimens, a detectable response of any duration of time (transient, medium or long term), a desired outcome in or an objective or subjective benefit to a subject of any measurable or detectable degree or for any duration of time (e.g., for hours, days, months, years, in remission or cured).
- Such amounts typically are effective to ameliorate a disorder, or one, multiple or all adverse symptoms, consequences or complications of the disorder, to a measurable extent, although reducing or inhibiting a progression or worsening of the disorder, is considered a satisfactory outcome.
- the term “ameliorate” means an improvement in the subject's disorder, a reduction in the severity of the disorder, or an inhibition of progression or worsening of the disorder (e.g., stabilizing the disorder).
- an improvement can be a lowering or a reduction in one or more symptoms or effects of the disorder.
- a therapeutic benefit or improvement therefore need not be complete ablation of any one, most or all symptoms, complications, consequences or underlying causes associated with the disorder or disease.
- a satisfactory endpoint is achieved when there is a transient, medium or long term, incremental improvement in a subject's condition, or a partial reduction in the occurrence, frequency, severity, progression, or duration, or inhibition or reversal, of one or more associated adverse symptoms or complications or consequences or underlying causes, worsening or progression (e.g., stabilizing one or more symptoms or complications of the condition, disorder or disease), of the disorder or disease, over a duration of time (hours, days, weeks, months, etc. ).
- the amount of the peptide (and optionally the additional agent )sufficient to ameliorate a disorder will depend on the type, severity and extent, or duration of the disorder, the therapeutic effect or outcome desired, and can be readily ascertained by the skilled artisan. Appropriate amounts will also depend upon the individual subject ( e.g., the bioavailability within the subject, gender, age, etc .).
- a transient, or partial, restoration of normal bile acid homeostasis in a subject can reduce the dosage amount or frequency of the peptides and agents described herein in order to treat the metabolic or associated disorders described previously even though complete freedom from treatment has not resulted.
- An effective amount can be ascertained, for example, by measuring one or more relevant physiological effects.
- Methods and uses provided herein for treating a subject are applicable for prophylaxis to prevent or reduce the likelihood of a disorder in a subject, such as a metabolic or associated disorder. Accordingly, methods and uses provided herein for treating a subject having, or at risk of developing, a metabolic or associated disorder can be practiced prior to, substantially contemporaneously with, or following administration or application of another agent useful for the treatment or prevention of a metabolic or associated disorder, and/or can be supplemented with other forms of therapy.
- Supplementary therapies include other glucose lowering treatments, such as insulin, an insulin sensitivity enhancer and other drug treatments, a change in diet (low sugar, fats, etc .), weight loss surgery- (reducing stomach volume by gastric bypass, gastrectomy), gastric banding, gastric balloon, gastric sleeve, etc.
- a method or use provided herein for treating a hyperglycemic or insulin resistance disorder can be used in combination with drugs or other pharmaceutical compositions that lower glucose or increase insulin sensitivity in a subject.
- the methods may include administering a peptide sequence, such as a FGF19 or FGF21 variant, fusion or chimera disclosed herein ( e.g., in the Sequence Listing or Table 1), or a subsequence, a variant or modified form of a FGF19 or FGF21 variant, fusion or chimera disclosed herein ( e.g., the Sequence Listing or Table 1), to a subject in an amount effective for treating a cancer, tumor or associated disorder.
- a peptide sequence such as a FGF19 or FGF21 variant, fusion or chimera disclosed herein (e.g., in the Sequence Listing or Table 1)
- a subsequence a variant or modified form of a FGF19 or FGF21 variant, fusion or chimera disclosed herein (e.g., the Sequence Listing or Table 1)
- the peptide may be administered in combination with an additional therapeutic agent(s) and/or treatment modalities (e.g., an agent useful in the treatment and/or prevention of PBC).
- additional therapeutic agent(s) can be administered before, with, or following administration of the peptides described herein.
- a method provided herein for, for example, preventing or treating a cancer, tumor or associated disorder includes contacting or administering one or more peptides provided herein (e.g., a variant or fusion of FGF19 and/or FGF21 as set forth in the Sequence Listing or Table 1) in an amount effective to prevent or treat a cancer, tumor or associated disorder.
- the method may further comprise contacting or administering at least one additional therapeutic agent or treatment modality that is useful in the treatment or prevention of a cancer, tumor or associated disorder (e.g., PBC).
- subject refers to an animal.
- the animal is a mammal that would benefit from treatment with a peptide sequence provided herein.
- Particular examples include primates ( e.g., humans), dogs, cats, horses, cows, pigs, and sheep.
- Subjects include those having a disorder, e.g., a cancer, tumor or associated disorder; or subjects that do not have a disorder but may be at risk of developing the disorder.
- a disorder e.g., a cancer, tumor or associated disorder
- Non-limiting exemplary disorders or conditions preventable, treatable or manageable with the peptide formulations, methods and uses thereof provided herein, include cancer, tumors and associated diseases and disorders.
- Non limiting examples of diseases and disorders include:
- the cancer or tumor is a colon tumor or a hepatic tumor.
- Treatment of a cancer, tumor or associated disorder may have the benefit of alleviating or abolishing a disorder secondary thereto.
- a subject suffering from a cancer or tumor may also have depression or anxiety due to the cancer or tumor; thus, treating the subject's cancer or tumor may also indirectly treat the depression or anxiety.
- the use of the therapies disclosed herein to target such secondary disorders is also contemplated in certain embodiments.
- Subjects at risk of developing a cancer, tumor or associated disorder include, for example, those who may have a family history or genetic predisposition toward such disorder, as well those whose diet may contribute to development of such disorders.
- the cancer or tumor is a liver, colon, prostate or lung cancer or tumor. In some embodiments, the cancer or tumor is benign. In other embodiments, the cancer or tumor is malignant.
- the subject has or is at risk of developing a FGF19-dependent disease, disorder or condition.
- the FGF19-dependent disease, disorder or condition is a liver (hepatocellular) disease, disorder or condition, such as cirrhosis or cholestasis.
- the liver disease or disorder is a chronic liver disease or disorder.
- the FGF19-dependent disease, disorder or condition is cancer or tumor, such as HCC.
- the FGF19-dependent disease, disorder or condition is not a liver disease, disorder or condition, such as cirrhosis or cholestasis.
- the FGF 19-dependent disease, disorder or condition is not a cancer or tumor, such as HCC.
- the FGF19-dependent disease, disorder or condition is a colon cancer or tumor.
- the colon cancer or tumor is a colon adenocarcinoma.
- the FGF19-dependent disease, disorder or condition is a prostate cancer or tumor.
- the FGF19-dependnent disease, disorder or condition is a lung cancer or tumor.
- the lung cancer or tumor is a lung squamous cell carcinoma.
- FGF19 is expressed in a primary or metastatic cancer or tumor cell.
- the FGF19-dependent disease, disorder or condition is pre-cancerous.
- cirrhosis and cholestasis sometimes to lead to liver cancers, such as HCC, and methods of treating or preventing such liver diseases and disorders are contemplated.
- the subject is a subject in need of prevention or treatment thereof.
- administration of the FGF19 variant maintains bile acid homeostasis in the subject.
- the administration may result in an improvement in the cancer, tumor or symptom thereof in the subject.
- the method may result in a reduction in tumor number, tumor size, or tumor weight.
- a method of preventing a cancer or tumor, such as a FGF19-dependent cancer or tumor, or a symptom thereof, in a subject comprising administering to the subject a therapeutically effective amount of a FGF19 variant.
- the administration may result in prevention of the cancer, tumor, or symptom thereof in the subject.
- the method may result in a reduction in tumor number, tumor size, or tumor weight.
- the cancer or tumor may be a FGF19-dependent cancer or tumor.
- the cancer or tumor may be hepatocellular carcinoma. In some cases, the cancer or tumor is not hepatocellular carcinoma.
- the cancer or tumor may be a colon cancer or tumor.
- the cancer or tumor may be a prostate cancer or tumor.
- the cancer or tumor may be a lung cancer or tumor.
- the FGF19 variant may be a polypeptide comprising an amino acid sequence set forth in SEQ ID NO:70.
- the FGF19 variant may be a polypeptide consisting of an amino acid sequence set forth in SEQ ID NO:70.
- the subject may be a subject in need thereof.
- treatment methods include contacting or administering a peptide as set forth herein (e.g., a variant or fusion of FGF19 and/or FGF21 as set forth in the Sequence Listing or Table 1) in an amount effective to achieve a desired outcome or result in a subject.
- a peptide as set forth herein e.g., a variant or fusion of FGF19 and/or FGF21 as set forth in the Sequence Listing or Table 1
- a treatment that results in a desired outcome or result includes decreasing, reducing or preventing the severity or frequency of one or more symptoms of the condition in the subject, e.g., an improvement in the subject's condition or a "beneficial effect” or "therapeutic effect.” Therefore, treatment can decrease or reduce or prevent the severity or frequency of one or more symptoms of the disorder, stabilize or inhibit progression or worsening of the disorder, and in some instances, reverse the disorder, transiently (e.g., for 1-6, 6-12, or 12-24 hours), for medium term ( e.g., 1-6, 6-12, 12-24 or 24-48 days) or long term ( e.g., for 1-6, 6-12, 12-24, 24-48 weeks, or greater than 24-48 weeks).
- treatment can lower or reduce one or more symptoms or effects of the cancer, tumor or associated disorders described above.
- the various methods provided herein further include contacting or administering one or more additional agents or therapeutic modalities useful in the treatment or prevention of a cancer, tumor or associated disorder, such as those agents or therapeutic modalities described herein, in an amount effective to achieve a desired outcome or result in a subject.
- an “effective amount” or a “sufficient amount” for use and/or for treating a subject refers to an amount that provides, in single or multiple doses, alone, or in combination with one or more other agents, treatments, protocols, or therapeutic regimens, a detectable response of any duration of time (transient, medium or long term), a desired outcome in or an objective or subjective benefit to a subject of any measurable or detectable degree or for any duration of time (e.g., for hours, days, months, years, in remission or cured).
- Such amounts typically are effective to ameliorate a disorder, or one, multiple or all adverse symptoms, consequences or complications of the disorder, to a measurable extent, although reducing or inhibiting a progression or worsening of the disorder, is considered a satisfactory outcome.
- the term “ameliorate” means an improvement in the subject's disorder, a reduction in the severity of the disorder, or an inhibition of progression or worsening of the disorder (e.g., stabilizing the disorder).
- an improvement can be a lowering or a reduction in one or more symptoms or effects of the disorder.
- a therapeutic benefit or improvement therefore need not be complete ablation of any one, most or all symptoms, complications, consequences or underlying causes associated with the disorder or disease.
- a satisfactory endpoint is achieved when there is a transient, medium or long term, incremental improvement in a subject's condition, or a partial reduction in the occurrence, frequency, severity, progression, or duration, or inhibition or reversal, of one or more associated adverse symptoms or complications or consequences or underlying causes, worsening or progression (e.g., stabilizing one or more symptoms or complications of the condition, disorder or disease), of the disorder or disease, over a duration of time (hours, days, weeks, months, etc .).
- the amount of the peptide (and optionally the additional agent )sufficient to ameliorate a disorder will depend on the type, severity and extent, or duration of the disorder, the therapeutic effect or outcome desired, and can be readily ascertained by the skilled artisan. Appropriate amounts will also depend upon the individual subject ( e.g., the bioavailability within the subject, gender, age, etc .).
- a transient, or partial, restoration of normal bile acid homeostasis in a subject can reduce the dosage amount or frequency of the peptides and agents described herein in order to treat the cancer, tumor or associated disorders described previously even though complete freedom from treatment has not resulted.
- An effective amount can be ascertained, for example, by measuring one or more relevant physiological effects.
- Methods and uses provided herein for treating a subject are applicable for prophylaxis to prevent or reduce the likelihood of a disorder in a subject, such as a cancer, tumor or associated disorder. Accordingly, methods and uses provided herein for treating a subject having, or at risk of developing, a cancer, tumor or associated disorder can be practiced prior to, substantially contemporaneously with, or following administration or application of another agent useful for the treatment or prevention of a cancer, tumor or associated disorder, and/or can be supplemented with other forms of therapy.
- Supplementary therapies include other glucose lowering treatments, such as insulin, an insulin sensitivity enhancer and other drug treatments, a change in diet (low sugar, fats, etc .), weight loss surgery- (reducing stomach volume by gastric bypass, gastrectomy), gastric banding, gastric balloon, gastric sleeve, etc.
- a method or use provided herein for treating a hyperglycemic or insulin resistance disorder can be used in combination with drugs or other pharmaceutical compositions that lower glucose or increase insulin sensitivity in a subject.
- a method or use may include contacting or administering to a subject one or more variant or fusion FGF19 and/or FGF21 peptide sequences in an amount effective for preventing a cancer, tumor or associated disorder.
- a method or use may include contacting or administering to a subject one or more variant or fusion FGF19 and/or FGF21 peptide sequences in an amount effective for treating a cancer, tumor or associated disorder.
- a method or use may include contacting or administering to a subject one or more variant or fusion FGF19 and/or FGF21 peptide sequences in an amount effective for managing a cancer, tumor or associated disorder.
- nucleic acid molecules encoding peptide sequences disclosed herein, including subsequences, sequence variants and modified forms of the sequences listed in the Sequence Listing (and in PCT Pub. No. WO 2013/006486 and US Pub. No. 2013/0023474 , as well as PCT Publ. No. WO 2014/085365 ) or Table 1, and vectors that include nucleic acid encoding the peptides used in the methods described herein.
- nucleic acids include those that encode the exemplified peptide sequences disclosed herein, as well as those encoding functional subsequences, sequence variants and modified forms of the exemplified peptide sequences, so long as the foregoing retain at least detectable or measureable activity or function useful in the treatment or prevention of a bile acid-related or associated disorder (e.g., PBC).
- a bile acid-related or associated disorder e.g., PBC
- Nucleic acid which can also be referred to herein as a gene, polynucleotide, nucleotide sequence, primer, oligonucleotide or probe, refers to natural or modified purine- and pyrimidine-containing polymers of any length, either polyribonucleotides or polydeoxyribonucleotides or mixed polyribo-polydeoxyribo nucleotides and ⁇ -anomeric forms thereof.
- the two or more purine- and pyrimidine-containing polymers are typically linked by a phosphoester bond or analog thereof.
- the terms can be used interchangeably to refer to all forms of nucleic acid, including deoxyribonucleic acid (DNA) and ribonucleic acid (RNA).
- the nucleic acids can be single strand, double, or triplex, linear or circular. Nucleic acids include genomic DNA and cDNA. RNA nucleic acid can be spliced or unspliced mRNA, rRNA, tRNA or antisense. Nucleic acids include naturally occurring, synthetic, as well as nucleotide analogs and derivatives.
- nucleic acid molecules provided herein include sequences degenerate with respect to nucleic acid molecules encoding the peptide sequences useful in the methods provided herein.
- degenerate nucleic acid sequences encoding peptide sequences including subsequences, variants and modified forms of the peptide sequences exemplified herein ( e.g., in the Sequence Listing or Table 1), are provided.
- Nucleic acid can be produced using any of a variety of known standard cloning and chemical synthesis methods, and can be altered intentionally by site-directed mutagenesis or other recombinant techniques known to one skilled in the art. Purity of polynucleotides can be determined through, for example, sequencing, gel electrophoresis, and UV spectrometry.
- Nucleic acids may be inserted into a nucleic acid construct in which expression of the nucleic acid is influenced or regulated by an "expression control element," referred to herein as an "expression cassette.”
- expression control element refers to one or more nucleic acid sequence elements that regulate or influence expression of a nucleic acid sequence to which it is operatively linked.
- An expression control element can include, as appropriate, promoters, enhancers, transcription terminators, gene silencers, a start codon (e.g., ATG) in front of a protein-encoding gene, etc.
- An expression control element operatively linked to a nucleic acid sequence controls transcription and, as appropriate, translation of the nucleic acid sequence.
- the term "operatively linked" refers to a juxtaposition wherein the referenced components are in a relationship permitting them to function in their intended manner.
- expression control elements are juxtaposed at the 5' or the 3' ends of the genes but can also be intronic.
- Expression control elements include elements that activate transcription constitutively, that are inducible (i.e., require an external signal or stimuli for activation), or derepressible (i.e., require a signal to turn transcription off; when the signal is no longer present, transcription is activated or "derepressed”). Also included in the expression cassettes provided herein are control elements sufficient to render gene expression controllable for specific cell types or tissues ( i.e., tissue-specific control elements). Typically, such elements are located upstream or downstream ( i.e., 5' or 3') of the coding sequence. Promoters are generally positioned 5' of the coding sequence. Promoters, produced by recombinant DNA or synthetic techniques, can be used to provide for transcription of the polynucleotides provided herein. A “promoter” typically means a minimal sequence element sufficient to direct transcription.
- Nucleic acids may be inserted into a plasmid for transformation into a host cell and for subsequent expression and/or genetic manipulation.
- a plasmid is a nucleic acid that can be stably propagated in a host cell; plasmids may optionally contain expression control elements in order to drive expression of the nucleic acid.
- a vector is synonymous with a plasmid. Plasmids and vectors generally contain at least an origin of replication for propagation in a cell and a promoter.
- Plasmids and vectors may also include an expression control element for expression in a host cell, and are therefore useful for expression and/or genetic manipulation of nucleic acids encoding peptide sequences, expressing peptide sequences in host cells and organisms, or producing peptide sequences, for example.
- transgene means a polynucleotide that has been introduced into a cell or organism by artifice.
- the transgene has been introduced by genetic manipulation or "transformation” of the cell.
- a cell or progeny thereof into which the transgene has been introduced is referred to as a "transformed cell” or “transformant.”
- the transgene is included in progeny of the transformant or becomes a part of the organism that develops from the cell.
- Transgenes may be inserted into the chromosomal DNA or maintained as a self-replicating plasmid, YAC, minichromosome, or the like.
- Bacterial system promoters include T7 and inducible promoters such as pL of bacteriophage ⁇ , plac, ptrp, ptac (ptrp-lac hybrid promoter) and tetracycline-responsive promoters.
- Insect cell system promoters include constitutive or inducible promoters (e.g., ecdysone).
- Mammalian cell constitutive promoters include SV40, RSV, bovine papilloma virus (BPV) and other virus promoters, or inducible promoters derived from the genome of mammalian cells (e.g., metallothionein IIA promoter; heat shock promoter) or from mammalian viruses (e.g., the adenovirus late promoter; the inducible mouse mammary tumor virus long terminal repeat).
- a retroviral genome can be genetically modified for introducing and directing expression of a peptide sequence in appropriate host cells.
- expression systems further include vectors designed for in vivo use.
- vectors designed for in vivo use include adenoviral vectors ( U.S. Patent Nos. 5,700,470 and 5,731,172 ), adeno-associated vectors ( U.S. Patent No. 5,604,090 ), herpes simplex virus vectors ( U.S. Patent No. 5,501,979 ), retroviral vectors ( U.S. Patent Nos. 5,624,820 , 5,693,508 and 5,674,703 ), BPV vectors ( U.S. Patent No. 5,719,054 ), CMV vectors ( U.S. Patent No.
- Vectors include those that deliver genes to cells of the intestinal tract, including the stem cells ( Croyle et al., Gene Ther. 5:645 (1998 ); S.J. Henning, Adv. Drug Deliv. Rev. 17:341 (1997 ), U.S. Patent Nos. 5,821,235 and 6,110,456 ). Many of these vectors have been approved for human studies.
- Yeast vectors include constitutive and inducible promoters (see, e.g., Ausubel et al., In: Current Protocols in Molecular Biology, Vol. 2, Ch. 13, ed., Greene Publish. Assoc. & Wiley Interscience, 1988 ; Grant et al. Methods in Enzymology, 153:516 (1987), eds. Wu & Grossman ; Bitter Methods in Enzymology, 152:673 (1987), eds. Berger & Kimmel, Acad. Press, N.Y .; and, Strathern et al., The Molecular Biology of the Yeast Saccharomyces (1982) eds. Cold Spring Harbor Press, Vols.
- a constitutive yeast promoter such as ADH or LEU2 or an inducible promoter such as GAL may be used ( R. Rothstein In: DNA Cloning, A Practical Approach, Vol.11, Ch. 3, ed. D.M. Glover, IRL Press, Wash., D.C., 1986 ).
- Vectors that facilitate integration of foreign nucleic acid sequences into a yeast chromosome, via homologous recombination for example, are known in the art.
- Yeast artificial chromosomes YAC are typically used when the inserted polynucleotides are too large for more conventional vectors ( e.g., greater than about 12 Kb).
- Expression vectors also can contain a selectable marker conferring resistance to a selective pressure or identifiable marker (e.g., beta-galactosidase), thereby allowing cells having the vector to be selected for, grown and expanded.
- a selectable marker can be on a second vector that is co-transfected into a host cell with a first vector containing a nucleic acid encoding a peptide sequence.
- Selection systems include, but are not limited to, herpes simplex virus thymidine kinase gene ( Wigler et al., Cell 11:223 (1977 )), hypoxanthine-guanine phosphoribosyltransferase gene ( Szybalska et al., Proc. Natl.
- adenine phosphoribosyltransferase genes that can be employed in tk-, hgprt- or aprt- cells, respectively.
- antimetabolite resistance can be used as the basis of selection for dhfr, which confers resistance to methotrexate ( O'Hare et al., Proc. Natl. Acad. Sci. USA 78:1527 (1981 )); the gpt gene, which confers resistance to mycophenolic acid ( Mulligan et al., Proc. Natl. Acad. Sci.
- neomycin gene which confers resistance to aminoglycoside G-418 ( Colberre-Garapin et al., J. Mol. Biol. 150:1(1981 )); puromycin; and hygromycin gene, which confers resistance to hygromycin ( Santerre et al., Gene 30:147 (1984 )).
- Additional selectable genes include trpB, which allows cells to utilize indole in place of tryptophan; hisD, which allows cells to utilize histinol in place of histidine ( Hartman et al., Proc. Natl. Acad. Sci.
- a transformed cell(s) in vitro, ex vivo and in vivo ) and host cells that produce a variant or fusion of FGF19 and/or FGF21 as set forth herein, where expression of the variant or fusion of FGF19 and/or FGF21 is conferred by a nucleic acid encoding the variant or fusion of FGF19 and/or FGF21.
- a "transformed" or "host” cell is a cell into which a nucleic acid is introduced that can be propagated and/or transcribed for expression of an encoded peptide sequence. The term also includes any progeny or subclones of the host cell.
- Transformed and host cells that express peptide sequences provided herein typically include a nucleic acid that encodes the peptide sequence.
- a transformed or host cell may be a prokaryotic cell.
- a transformed or host cell may be a eukaryotic cell.
- the eukaryotic cell may be a yeast or mammalian ( e.g., human, primate, etc .) cell.
- Transformed and host cells include but are not limited to microorganisms such as bacteria and yeast; and plant, insect and mammalian cells.
- bacteria transformed with recombinant bacteriophage nucleic acid, plasmid nucleic acid or cosmid nucleic acid expression vectors yeast transformed with recombinant yeast expression vectors
- plant cell systems infected with recombinant virus expression vectors e.g., cauliflower mosaic virus, CaMV; tobacco mosaic virus, TMV
- recombinant plasmid expression vectors e.g., Ti plasmid
- insect cell systems infected with recombinant virus expression vectors e.g., baculovirus
- animal cell systems infected with recombinant virus expression vectors e.g., retroviruses, adenovirus, vaccinia virus, or transformed animal cell systems engineered for transient or stable propagation or expression.
- a transformed cell can be in a subject.
- a cell in a subject can be transformed with a nucleic acid that encodes a peptide sequence as set forth herein in vivo.
- a cell can be transformed in vitro with a transgene or polynucleotide, and then transplanted into a tissue of subject in order to effect treatment.
- a primary cell isolate or an established cell line can be transformed with a transgene or polynucleotide that encodes a variant of FGF19 and/or FGF21 or a fusion/chimeric sequence (or variant) thereof, such as a chimeric peptide sequence including all or a portion of FGF19, or including all or a portion of FGF21, and then optionally transplanted into a tissue of a subject.
- a transgene or polynucleotide that encodes a variant of FGF19 and/or FGF21 or a fusion/chimeric sequence (or variant) thereof, such as a chimeric peptide sequence including all or a portion of FGF19, or including all or a portion of FGF21, and then optionally transplanted into a tissue of a subject.
- Non-limiting target cells for expression of peptide sequences include pancreas cells (islet cells), muscle cells, mucosal cells and endocrine cells.
- pancreas cells islet cells
- Such endocrine cells can provide inducible production (secretion) of a variant of FGF19 and/or FGF21, or a fusion/chimeric sequence (or variant) thereof, such as a chimeric peptide sequence including all or a portion of FGF19, or including all or a portion of FGF21.
- Additional cells to transform include stem cells or other multipotent or pluripotent cells, for example, progenitor cells that differentiate into the various pancreas cells (islet cells), muscle cells, mucosal cells and endocrine cells. Targeting stem cells provides longer term expression of peptide sequences provided herein.
- the term "cultured,” when used in reference to a cell, means that the cell is grown in vitro.
- a particular example of such a cell is a cell isolated from a subject, and grown or adapted for growth in tissue culture.
- Another example is a cell genetically manipulated in vitro, and transplanted back into the same or a different subject.
- isolated when used in reference to a cell, means a cell that is separated from its naturally occurring in vivo environment. "Cultured” and “isolated” cells may be manipulated by the hand of man, such as genetically transformed. These terms include any progeny of the cells, including progeny cells that may not be identical to the parental cell due to mutations that occur during cell division. The terms do not include an entire human being.
- Nucleic acids encoding peptide sequences provided herein can be introduced for stable expression into cells of a whole organism. Such organisms, including non-human transgenic animals, are useful for studying the effect of peptide expression in a whole animal and therapeutic benefit. For example, as disclosed herein, production of a variant of FGF19 and/or FGF21 or a fusion/chimeric sequence (or variant) thereof, such as a chimeric peptide sequence including all or a portion of FGF19, or including all or a portion of FGF21 as set forth herein, in mice.
- mice strains that develop or are susceptible to developing a particular disease are also useful for introducing therapeutic proteins as described herein in order to study the effect of therapeutic protein expression in the disease-susceptible mouse.
- Transgenic and genetic animal models that are susceptible to particular disease or physiological conditions such as streptozotocin (STZ)-induced diabetic (STZ) mice, are appropriate targets for expressing variants of FGF19 and/or FGF21, fusions/chimeric sequences (or variant) thereof, such as a chimeric peptide sequence including all or a portion of FGF19, or including all or a portion of FGF21, as set forth herein.
- non-human transgenic animals that produce a variant of FGF19 and/or FGF21, or a fusion/chimeric sequence (or variant) thereof, such as a chimeric peptide sequence including all or a portion of FGF 19, or including all or a portion of FGF21, the production of which is not naturally occurring in the animal which is conferred by a transgene present in somatic or germ cells of the animal.
- transgenic animal refers to an animal whose somatic or germ line cells bear genetic information received, directly or indirectly, by deliberate genetic manipulation at the subcellular level, such as by microinjection or infection with recombinant virus.
- transgenic further includes cells or tissues (i.e., "transgenic cell,” “transgenic tissue”) obtained from a transgenic animal genetically manipulated as described herein.
- a transgenic animal does not encompass animals produced by classical crossbreeding or in vitro fertilization, but rather denotes animals in which one or more cells receive a nucleic acid molecule.
- Transgenic animals provided herein can be either heterozygous or homozygous with respect to the transgene.
- mice including mice, sheep, pigs and frogs
- transgenic animals including mice, sheep, pigs and frogs
- U.S. Patent Nos. 5,721,367 , 5,695,977 , 5,650,298 , and 5,614,396 are well known in the art (see, e.g., U.S. Patent Nos. 5,721,367 , 5,695,977 , 5,650,298 , and 5,614,396 ) and, as such, are additionally included.
- Peptide sequences, nucleic acids encoding peptide sequences, vectors and transformed host cells expressing peptide sequences include isolated and purified forms.
- isolated when used as a modifier of a composition provided herein, means that the composition is separated, substantially, completely, or at least in part, from one or more components in an environment.
- compositions that exist in nature, when isolated are substantially free of one or more materials with which they normally associate with in nature, for example, one or more protein, nucleic acid, lipid, carbohydrate or cell membrane.
- isolated does not exclude alternative physical forms of the composition, such as variants, modifications or derivatized forms, fusions and chimeras, multimers/oligomers, etc., or forms expressed in host cells.
- isolated also does not exclude forms ( e.g., pharmaceutical compositions, combination compositions, etc .) in which there are combinations therein, any one of which is produced by the hand of man.
- An “isolated” composition can also be “purified” when free of some, a substantial number of, or most or all of one or more other materials, such as a contaminant or an undesired substance or material.
- the term "recombinant,” when used as a modifier of peptide sequences, nucleic acids encoding peptide sequences, etc., means that the compositions have been manipulated ( i.e., engineered) in a fashion that generally does not occur in nature (e.g., in vitro).
- a particular example of a recombinant peptide would be where a peptide sequence provided herein is expressed by a cell transfected with a nucleic acid encoding the peptide sequence.
- a particular example of a recombinant nucleic acid would be a nucleic acid (e.g., genomic or cDNA) encoding a peptide sequence cloned into a plasmid, with or without 5', 3' or intron regions that the gene is normally contiguous within the genome of the organism.
- a recombinant peptide or nucleic acid is a hybrid or fusion sequence, such as a chimeric peptide sequence comprising a portion of FGF19 and a portion of FGF21.
- compositions and mixtures of peptide sequences provided herein including subsequences, variants and modified forms of the exemplified peptide sequences (including the FGF19 and FGF21 variants and subsequences listed in Table 1 and the Sequence Listing, and the FGF19/FGF21 fusions and chimeras listed in Table 1 and the Sequence Listing).
- a mixture may include one or more peptide sequences and a pharmaceutically acceptable carrier or excipient.
- a mixture may include one or more peptide sequences and an adjunct drug or therapeutic agent, such as a bile acid homeostasis modulating or anti-diabetic, or glucose lowering, drug or therapeutic agent.
- Combinations such as one or more peptide sequences in a pharmaceutically acceptable carrier or excipient, with one or more of a bile acid homeostasis modulating or a treatment for a bile acid-related or associated disorder, or anti-diabetic, or glucose lowering drug or therapeutic agent are also provided.
- a bile acid homeostasis modulating or a treatment for a bile acid-related or associated disorder, or anti-diabetic, or glucose lowering drug or therapeutic agent are also provided.
- Such combinations of a peptide sequence provided herein with another drug or agent, such as a bile acid homeostasis modulating or acid related disorder treating, or glucose lowering drug or therapeutic agent are useful in accordance with the methods and uses provided herein, for example, for treatment of a subject.
- Combinations also include incorporation of peptide sequences or nucleic acids provided herein into particles or a polymeric substances, such as polyesters, carbohydrates, polyamine acids, hydrogel, polyvinyl pyrrolidone, ethylene-vinylacetate, methylcellulose, carboxymethylcellulose, protamine sulfate, or lactide/glycolide copolymers, polylactide/glycolide copolymers, or ethylenevinylacetate copolymers; entrapment in microcapsules prepared by coacervation techniques or by interfacial polymerization, for example, by the use of hydroxymethylcellulose or gelatin-microcapsules, or poly (methylmethacrolate) microcapsules, respectively; incorporation in colloid drug delivery and dispersion systems such as macromolecule complexes, nano-capsules, microspheres, beads, and lipid-based systems ( e.g., N-fatty acyl groups such as N-lauroyl, N-oleoyl, fatty
- peptides provided herein including subsequences, variants and modified forms of the exemplified peptide sequences (including the FGF19 and FGF21 variants and subsequences listed in Table 1 and the Sequence Listing, and the FGF 19/FGF21 fusions and chimeras listed in Table 1 and the Sequence Listing) as set forth herein can be used to modulate glucose metabolism and facilitate transport of glucose from the blood to key metabolic organs such as muscle, liver and fat.
- Such peptide sequences can be produced in amounts sufficient or effective to restore glucose tolerance and/or to improve or provide normal glucose homeostasis.
- kits including, but not limited to, peptide sequences provided herein and/or one or more additional agents for the treatment of a disease, disorder or condition, or a composition comprising the foregoing, and one or more pharmaceutically acceptable or physiologically acceptable diluents, carriers or excipients, optionally in further combination with one or more therapeutic agents distinct from those described above, compositions and pharmaceutical compositions thereof, packaged into suitable packaging material.
- a kit may include a label or packaging insert including a description of the components or instructions for use in vitro, in vivo, or ex vivo, of the components therein. Exemplary instructions include instructions for treatment and/or prevention of a disease or disorder.
- the disease or disorder may be a bile acid-related or associated disorder provided herein.
- the disease or disorder may be a metabolic disorder or associated condition.
- the disease or disorder may be a cancer or tumor.
- packaging material refers to a physical structure housing the components of the kit.
- the packaging material can maintain the components sterilely, and can be made of material commonly used for such purposes (e.g., paper, corrugated fiber, glass, plastic, foil, ampules, vials, tubes, etc .).
- Kits provided herein can include labels or inserts.
- Labels or inserts include "printed matter," e.g. , paper or cardboard, separate or affixed to a component, a kit or packing material (e.g., a box), or attached to, for example, an ampule, tube or vial containing a kit component.
- Labels or inserts can additionally include a computer readable medium, such as a disk ( e.g., hard disk, card, memory disk), optical disk such as CD- or DVD-ROM/RAM, DVD, MP3, magnetic tape, or an electrical storage media such as RAM and ROM or hybrids of these such as magnetic/optical storage media, FLASH media or memory type cards.
- the instructions recite a method provided herein.
- Labels or inserts can include, among other things, identifying information of one or more components therein, dosing parameters, and/or information on the clinical pharmacology of the active ingredient(s), including mechanism of action, pharmacokinetics and pharmacodynamics. Labels or inserts can include information identifying manufacturer information, lot numbers, manufacturer location and date.
- Labels or inserts can include information on a condition, disorder, disease or symptom for which a kit component may be used.
- Labels or inserts can include instructions for the clinician or for a subject for using one or more of the kit components in a method, treatment protocol or therapeutic regimen. Instructions can include dosage amounts, frequency or duration, and instructions for practicing any of the methods, treatment protocols or therapeutic regimens set forth herein. Exemplary instructions include instructions for treatment or use of a peptide sequence as set forth herein and/or the use of an additional agent or treatment modality useful in treating a bile acid-related or associated disorder, or a disorder of bile acid homeostasis. Kits provided herein therefore can additionally include labels or instructions for practicing any of the methods and uses provided herein, including treatment methods and uses.
- Labels or inserts can include information on any benefit that a component may provide, such as a prophylactic or therapeutic benefit. Labels or inserts can include information on potential adverse side effects, such as warnings to the subject or clinician regarding situations where it would not be appropriate to use a particular composition. Adverse effects could also occur when the subject has, will be, or is currently taking one or more other medications that may be incompatible with the composition, or the subject has, will be, or is currently undergoing another treatment protocol or therapeutic regimen which would be incompatible with the composition and, therefore, instructions could include information regarding such incompatibilities.
- Kits provided herein can additionally include other components. Each component of the kit can be enclosed within an individual container and all of the various containers can be within a single package. Kits may be designed for cold storage. Kits provided herein can further be designed to contain peptide sequences provided herein, or that contain nucleic acids encoding peptide sequences. Kits provided herein can also be designed to contain, either separately or in combination with the peptide sequences provided herein, one or more additional agents useful in the treatment or prevention of a disease or disorder provided herein. Any cells in the kit can be maintained under appropriate storage conditions until ready to use.
- reference to a range of 90-100% includes 91-99%, 92-98%, 93-95%, 91-98%, 91-97%, 91-96%, 91-95%, 91-94%, 91-93%, and so forth.
- Reference to a range of 90-100% also includes 91%, 92%, 93%, 94%, 95%, 96%, 97%, etc., as well as 91.1%, 91.2%, 91.3%, 91.4%, 91.5%, etc., 92.1%, 92.2%, 92.3%, 92.4%, 92.5%, etc., and so forth.
- reference to a range of 1-3, 3-5, 5-10, 10-20, 20-30, 30-40, 40-50, 50-60, 60-70, 70-80, 80-90, 90-100, 100-110, 110-120, 120-130, 130-140, 140-150, 150-160, 160-170, 170-180, 180-190, 190-200, 200-225, 225-250 includes 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, etc.
- reference to a range of 25-250, 250-500, 500-1000, 1000-2500, 2500-5000, 5000-25,000, or 5000-50,000 includes any numerical value or range within or encompassing such values, e.g., 25, 26, 27, 28, 29...250, 251, 252, 253, 254....500, 501, 502, 503, 504..., etc.
- the use of a series of ranges includes combinations of the upper and lower ranges to provide another range. This construction applies regardless of the breadth of the range and in all contexts throughout this patent document.
- ranges such as 5-10, 10-20, 20-30, 30-40, 40-50, 50-75, 75-100, 100-150, includes ranges such as 5-20, 5-30, 5-40, 5-50, 5-75, 5-100, 5-150, and 10-30, 10-40, 10-50, 10-75, 10-100, 10-150, and 20-40, 20-50, 20-75, 20-100, 20-150, and so forth.
- molecular weight is weight average molecular weight
- temperature is in degrees Celsius (°C)
- pressure is at or near atmospheric.
- ⁇ M micromolar
- mM millimolar
- M molar
- kDa kilodalton
- i.m. intramuscular(ly); i.p.
- the volume in vials was 0.5-1 mL/vial at temperatures -80°C; 2-8°C, and 37°C at time points of 0 weeks, 1 week, 2 weeks, 4 weeks, 3 months and 6 months.
- Buffer Composition Spec pH (4C) Actual pH (4C) 1 10 mM Kphos, 150 mM NaCl, 0.01% TWEEN-20 7.3 7.252 2 20 mM Kphos, 125 mM NaCl, 0.01% TWEEN-20 7.3 7.261 3 20 mM Kphos, 125 mM NaCl, 0.01% TWEEN-20 7.5 7.540 4 20 mM Kphos, 125 mM NaCl, 0.01% TWEEN-20 8.0 8.120 5 20 mM Tris, 8.2% Trehalose, 0.01% TWEEN-20 7.5 7.586 6 20 mM Tris, 8.2% Trehalose, 0.01% TWEEN-20 8 8.053 7 20 mM Tris, 8.2% Trehalose, 0.01% TWEEN-20 8.5 8.562 8 20 mM Tris, 140 mM NaCl, 0.01% TWEEN-20 7.5 7.499 9 20 mM Tris, 140 mM NaCl,
- samples were dialyzed overnight into each buffer using Slide-A-Lyzer ® cassette with 10 KMWCO. All vials were flushed with air to remove dust, and then autoclaved on dry cycle for 2 hours at 121°C to ensure sterility. Samples were sterile filtered through 0.22 ⁇ M filter in fumehood. The vials fills were performed in tissue culture fumehood to ensure stability.
- Buffer Composition Buffer without protein (mOsm) 1mg/mL M70 in buffer (mOsm) 10mg/mL M70 in buffer (mOsm) Standard 100 mmol/kg 98 / 97 - - Standard 290 mmol/kg 284 / 284 - - Standard 1000 mmol/kg 987 / 986 - - 1 10 mM Kphos, 150 mM NaCl, 0.01% TWEEN-20 314 316 314 2 20 mM Kphos, 125 mM NaCl, 0.01% TWEEN-20 284 287 293 3 20 mM Kphos, 125 mM NaCl, 0.01% TWEEN-20 285 288 289 4 20 mM Kphos, 125 mM NaCl, 0.01% TWEEN-20 285 288 289 4 20 mM Kphos, 125 mM NaCl, 0.01% TWEEN-20 285 288 289 4 20
- a 340 /A 280 measurement was performed at 4 weeks (Nanodrop; 1 mm pathlength), and each sample was blanked against respective formulation buffer.
- Trehalose was noted to be a superior tonicity modifier over NaCl in Tris-containing buffers. Indeed, significant differences in aggregation state at 37°C between 20 mM Tris (pH 8.5) with 8.2% trehalose (buffer 7) or 140 mM NaCl (buffer 10) were observed.
- Buffer 7 (20 mM Tris, 8.2% Trehalose, 0.01% TWEEN-20) was the only formulation buffer without evidence of visual precipitates an any condition, concentration, or time point, and thus was chosen for use in further studies.
- HPLC analysis was performed on samples with no evidence of precipitation based on A 280 /A 340 (ratio ratio ⁇ 0.07) and visual inspection (no visual precipitate) under the following conditions:
- a PBS blank run was performed between every injection to ensure minimal sample carry-over on subsequence injections.
- FIG. 3 The data for HPLC analysis based on SEC AUC of absorbance at A 210 for 1 mg/mL in various buffers is shown in FIG. 3 ; and FIG. 4 shows the data for HPLC analysis based on SEC AUC of absorbance at A 210 for Buffer 7 at 1 mg/mL. The same data is shown for 10 mg/mL samples in FIG. 5 and FIG. 6 , respectively.
- Buffer 7 contains a non-disulfide dimer band that does not break down upon reduction, with approximately 5% of total protein lane intensity at 4 weeks, 37°C and 10 mg/ml.
- the focus was on the 10mg/mL sample analysis to de-risk high concentration formulation (up to 10mg/mL) for clinical needs.
- An additional focus was on the 4°C samples, which could provide a base for liquid formulation storage conditions.
- Buffers 1, 7 and 10 were chosen for further analysis.
- Buffer 1 had 100% recovery for the 10 mg/mL sample (4 weeks a 4°C), and 98.9% monomer at time point analysis.
- there was minimal non-disulfide covelant dimer at t 4wk using other methods for analysis, and showed long-term 4°C stability (data not shown).
- Buffer 10 was essentially equivalent to Buffer 7; however with NaCl formulation for tonicity (data not shown), and added diversity for the excipient range.
- M70 was provided at a concentration of 10 mg/mL, and the Osmol/L target was 300 Osmol/L.
- the following buffer composition (similar to Buffer 7) was used: 20mM Tris pH 8.0 (25°C), 8.3% (w/v) trehalose, 0.01% TWEEN-20.
- the fill volume in vials was 1.0 mL/vial, and 6 aliquots were housed in glass vials that were used in the formulations stability studies discussed above.
- FIG. 12 shows the stability of the M70 formulation after the multiple freeze/thaw cycles. Freeze/thaw cycles do not impact the product stability in the buffer. M70 in 20mM Tris pH 8.0 (25°C), 8.3% Trehalose (w/v), 0.01% Polysorbate-20 ("TTP" buffer) is stabile during freeze/thaw cycling from -80°C to room temperature. There is no detectable differences vs. input (ref. std.) for any of the sample conditions or analyses. Moreover, there is no evidence of reversible oligomer formation via SEC-HPLC using TTP as the mobile phase.
- TTP Polysorbate-20
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Epidemiology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Zoology (AREA)
- Diabetes (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Immunology (AREA)
- Hematology (AREA)
- Obesity (AREA)
- Oil, Petroleum & Natural Gas (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Toxicology (AREA)
- Endocrinology (AREA)
- Emergency Medicine (AREA)
- Nutrition Science (AREA)
- Child & Adolescent Psychology (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Reproductive Health (AREA)
- Pulmonology (AREA)
- Pain & Pain Management (AREA)
- Rheumatology (AREA)
- Cardiology (AREA)
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201462067824P | 2014-10-23 | 2014-10-23 | |
| PCT/US2015/056830 WO2016065106A1 (en) | 2014-10-23 | 2015-10-22 | Pharmaceutical compositions comprising peptide variants and methods of use thereof |
Publications (3)
| Publication Number | Publication Date |
|---|---|
| EP3209681A1 EP3209681A1 (en) | 2017-08-30 |
| EP3209681A4 EP3209681A4 (en) | 2018-10-31 |
| EP3209681B1 true EP3209681B1 (en) | 2025-04-02 |
Family
ID=55761522
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP15853394.3A Active EP3209681B1 (en) | 2014-10-23 | 2015-10-22 | Pharmaceutical compositions comprising peptide variants and methods of use thereof |
Country Status (16)
| Country | Link |
|---|---|
| US (3) | US10517929B2 (enExample) |
| EP (1) | EP3209681B1 (enExample) |
| JP (2) | JP6949711B2 (enExample) |
| KR (1) | KR102569907B1 (enExample) |
| CN (2) | CN114129709A (enExample) |
| AU (1) | AU2015335844B2 (enExample) |
| DK (1) | DK3209681T3 (enExample) |
| ES (1) | ES3026032T3 (enExample) |
| FI (1) | FI3209681T3 (enExample) |
| IL (1) | IL251834B2 (enExample) |
| MX (1) | MX392683B (enExample) |
| PL (1) | PL3209681T3 (enExample) |
| RU (1) | RU2729161C2 (enExample) |
| SG (1) | SG11201702757YA (enExample) |
| UA (1) | UA123763C2 (enExample) |
| WO (1) | WO2016065106A1 (enExample) |
Families Citing this family (27)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| PL2726511T3 (pl) | 2011-07-01 | 2019-12-31 | Ngm Biopharmaceuticals, Inc. | Kompozycje, zastosowania i sposoby leczenia zaburzeń oraz chorób metabolicznych |
| EP3798228A1 (en) | 2012-11-28 | 2021-03-31 | NGM Biopharmaceuticals, Inc. | Compositions and methods for treatment of metabolic disorders and diseases |
| US9290557B2 (en) | 2012-11-28 | 2016-03-22 | Ngm Biopharmaceuticals, Inc. | Compositions comprising variants and fusions of FGF19 polypeptides |
| US9273107B2 (en) | 2012-12-27 | 2016-03-01 | Ngm Biopharmaceuticals, Inc. | Uses and methods for modulating bile acid homeostasis and treatment of bile acid disorders and diseases |
| SG11201504815QA (en) | 2012-12-27 | 2015-07-30 | Ngm Biopharmaceuticals Inc | Methods for modulating bile acid homeostasis and treatment of bile acid disorders and diseases |
| NZ718962A (en) | 2013-10-28 | 2019-12-20 | Ngm Biopharmaceuticals Inc | Cancer models and associated methods |
| AU2015209131B2 (en) | 2014-01-24 | 2020-06-25 | Ngm Biopharmaceuticals, Inc. | Binding proteins and methods of use thereof |
| WO2015183890A2 (en) | 2014-05-28 | 2015-12-03 | Ngm Biopharmaceuticals, Inc. | Methods and compositions for the treatment of metabolic disorders and diseases |
| EP3155005A4 (en) | 2014-06-16 | 2018-07-11 | NGM Biopharmaceuticals, Inc. | Methods and uses for modulating bile acid homeostasis and treatment of bile acid disorders and diseases |
| CN114129709A (zh) | 2014-10-23 | 2022-03-04 | 恩格姆生物制药公司 | 包含肽变异体的药物组合物及其使用方法 |
| US10434144B2 (en) | 2014-11-07 | 2019-10-08 | Ngm Biopharmaceuticals, Inc. | Methods for treatment of bile acid-related disorders and prediction of clinical sensitivity to treatment of bile acid-related disorders |
| WO2017019957A2 (en) | 2015-07-29 | 2017-02-02 | Ngm Biopharmaceuticals, Inc. | Binding proteins and methods of use thereof |
| CA3003616C (en) | 2015-11-09 | 2020-07-28 | Ngm Biopharmaceuticals, Inc. | Methods for treatment of bile acid-related disorders |
| EP3463427A4 (en) | 2016-05-25 | 2020-03-11 | Board of Regents, The University of Texas System | METHOD AND COMPOSITIONS FOR TREATING SECRETORIC DISEASES |
| CA3034399A1 (en) | 2016-08-26 | 2018-03-01 | Ngm Biopharmaceuticals, Inc. | Methods of treating fibroblast growth factor 19-mediated cancers and tumors |
| US20190307847A1 (en) * | 2016-08-29 | 2019-10-10 | Ngm Biopharmaceuticals, Inc. | Methods for treatment of bile acid-related disorders |
| US11524029B2 (en) | 2018-08-13 | 2022-12-13 | Viscera Labs, Inc. | Therapeutic composition and methods |
| US11590161B2 (en) | 2018-08-13 | 2023-02-28 | Viscera Labs, Inc. | Therapeutic composition and methods |
| CN112386575B (zh) * | 2019-08-19 | 2023-03-21 | 鲁南制药集团股份有限公司 | 一种代谢调节融合蛋白的冻干制剂 |
| CN111420030B (zh) * | 2020-05-12 | 2021-01-29 | 江南大学 | Fgf21在制备用于治疗结直肠癌药物中的应用 |
| CN119367551A (zh) | 2021-03-11 | 2025-01-28 | 89生物公司 | 包含突变型fgf-21肽peg化缀合物的液体制剂 |
| CN117120070B (zh) * | 2021-03-11 | 2024-11-15 | 89生物公司 | 包含突变型fgf-21肽peg化缀合物的液体制剂 |
| CN113735959B (zh) * | 2021-03-12 | 2023-07-04 | 江南大学 | 一种治疗nash的fgf类似物 |
| CN113105561B (zh) * | 2021-04-30 | 2021-12-03 | 江南大学 | 一种双靶点融合蛋白的制备方法和应用 |
| CN117327193B (zh) * | 2023-08-21 | 2025-07-29 | 温州医科大学 | 一种成纤维细胞生长因子21-透皮肽融合蛋白、制备方法及其应用 |
| KR20250054871A (ko) * | 2023-10-16 | 2025-04-24 | (주)케어젠 | 피부 상태 개선 활성을 갖는 펩타이드 및 이의 용도 |
| CN120623308B (zh) * | 2025-08-15 | 2025-10-28 | 温州医科大学 | Fgf19突变蛋白及其应用 |
Family Cites Families (203)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3881A (en) * | 1845-01-10 | Apparatus por drying the sizing on cotton | ||
| US4235871A (en) | 1978-02-24 | 1980-11-25 | Papahadjopoulos Demetrios P | Method of encapsulating biologically active materials in lipid vesicles |
| US4501728A (en) | 1983-01-06 | 1985-02-26 | Technology Unlimited, Inc. | Masking of liposomes from RES recognition |
| US4837028A (en) | 1986-12-24 | 1989-06-06 | Liposome Technology, Inc. | Liposomes with enhanced circulation time |
| US5273876A (en) | 1987-06-26 | 1993-12-28 | Syntro Corporation | Recombinant human cytomegalovirus containing foreign gene |
| CA2045129A1 (en) | 1989-02-01 | 1990-08-02 | Alfred I. Geller | Herpes simplex virus type i expression vector |
| US5614396A (en) | 1990-06-14 | 1997-03-25 | Baylor College Of Medicine | Methods for the genetic modification of endogenous genes in animal cells by homologous recombination |
| WO1992003917A1 (en) | 1990-08-29 | 1992-03-19 | Genpharm International | Homologous recombination in mammalian cells |
| US5252714A (en) | 1990-11-28 | 1993-10-12 | The University Of Alabama In Huntsville | Preparation and use of polyethylene glycol propionaldehyde |
| GB9105383D0 (en) | 1991-03-14 | 1991-05-01 | Immunology Ltd | An immunotherapeutic for cervical cancer |
| FR2686899B1 (fr) | 1992-01-31 | 1995-09-01 | Rhone Poulenc Rorer Sa | Nouveaux polypeptides biologiquement actifs, leur preparation et compositions pharmaceutiques les contenant. |
| AU3972893A (en) | 1992-04-03 | 1993-11-08 | Baylor College Of Medicine | Gene therapy using the intestine |
| AU6014094A (en) | 1992-12-02 | 1994-06-22 | Baylor College Of Medicine | Episomal vectors for gene therapy |
| EP0705334A1 (en) | 1993-06-14 | 1996-04-10 | Basf Aktiengesellschaft | Tight control of gene expression in eucaryotic cells by tetracycline-responsive promoters |
| US5643575A (en) | 1993-10-27 | 1997-07-01 | Enzon, Inc. | Non-antigenic branched polymer conjugates |
| US5919455A (en) | 1993-10-27 | 1999-07-06 | Enzon, Inc. | Non-antigenic branched polymer conjugates |
| AU7353494A (en) | 1993-11-12 | 1995-05-29 | Case Western Reserve University | Episomal expression vector for human gene therapy |
| US5731172A (en) | 1994-03-09 | 1998-03-24 | Sumitomo Pharmaceuticals Company, Ltd. | Recombinant adenovirus and process for producing the same |
| US5604090A (en) | 1994-06-06 | 1997-02-18 | Fred Hutchinson Cancer Research Center | Method for increasing transduction of cells by adeno-associated virus vectors |
| US5693508A (en) | 1994-11-08 | 1997-12-02 | Chang; Lung-Ji | Retroviral expression vectors containing MoMLV/CMV-IE/HIV-TAR chimeric long terminal repeats |
| US5932462A (en) | 1995-01-10 | 1999-08-03 | Shearwater Polymers, Inc. | Multiarmed, monofunctional, polymer for coupling to molecules and surfaces |
| JP3770333B2 (ja) | 1995-03-15 | 2006-04-26 | 大日本住友製薬株式会社 | 組換えdnaウイルスおよびその製造方法 |
| US6110456A (en) | 1995-06-07 | 2000-08-29 | Yale University | Oral delivery or adeno-associated viral vectors |
| US5695977A (en) | 1995-08-31 | 1997-12-09 | Genetic Information Research Institute | Site directed recombination |
| US6013516A (en) | 1995-10-06 | 2000-01-11 | The Salk Institute For Biological Studies | Vector and method of use for nucleic acid delivery to non-dividing cells |
| JP4162267B2 (ja) | 1996-08-27 | 2008-10-08 | カイロン コーポレイション | Neisseria meningitidis血清型B複合糖質およびその使用法 |
| WO2002008284A2 (en) | 2000-07-20 | 2002-01-31 | Genentech, Inc. | Compositions and methods for the diagnosis and treatment of disorders involving angiogenesis |
| US20020042367A1 (en) | 1997-11-25 | 2002-04-11 | Genentech, Inc. | Fibroblast growth factor-19 (FGF-19) nucleic acids and polypeptides and methods of use for the treatment of obesity and related disorders |
| US20060246540A1 (en) | 1997-08-26 | 2006-11-02 | Ashkenazi Avi J | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
| US20020012961A1 (en) | 1999-04-15 | 2002-01-31 | Genentech, Inc. | Fibroblast growth factor- 19 |
| US20030113718A1 (en) | 1997-09-17 | 2003-06-19 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
| US20030049676A1 (en) | 1997-09-17 | 2003-03-13 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
| US6806352B2 (en) | 1997-09-17 | 2004-10-19 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
| JP2001516580A (ja) | 1997-09-17 | 2001-10-02 | ジェネンテック・インコーポレーテッド | 分泌性の、および膜貫通性のポリぺプチド、およびそれをコードする核酸 |
| US20040126852A1 (en) | 1997-11-25 | 2004-07-01 | Genentech, Inc. | Fibroblast growth factor-19 (FGF-19) nucleic acids and polypeptides and methods of use for the treatment of obesity |
| US20050026832A1 (en) | 1997-11-25 | 2005-02-03 | Genentech, Inc. | Fibroblast growth factor-19 (FGF-19) nucleic acids and polypeptides and methods of use for the treatment of obesity and related disorders |
| US20020155543A1 (en) | 1997-11-25 | 2002-10-24 | Genentech, Inc. | Fibroblast growth factor-19 (FGF-19) nucleic acids and polypeptides and methods of use for the treatment of obesity and related disorders |
| US5985263A (en) | 1997-12-19 | 1999-11-16 | Enzon, Inc. | Substantially pure histidine-linked protein polymer conjugates |
| PT2193809E (pt) * | 1999-02-22 | 2015-08-24 | Baxter Int | Formulações de fator viii livres de albumina |
| WO2000060085A1 (en) | 1999-04-02 | 2000-10-12 | Millennium Pharmaceuticals, Inc. | Fibroblast growth factor-20 |
| US7390879B2 (en) | 1999-06-15 | 2008-06-24 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
| US7129072B1 (en) | 1999-08-30 | 2006-10-31 | New York University | Crystal of fibroblast growth factor receptor 1 in complex with fibroblast growth factor |
| US7459540B1 (en) | 1999-09-07 | 2008-12-02 | Amgen Inc. | Fibroblast growth factor-like polypeptides |
| AU7368100A (en) | 1999-09-10 | 2001-04-10 | Curagen Corporation | Fibroblast growth factor polypeptide and nucleic acids encoding same |
| US6797695B1 (en) | 1999-10-22 | 2004-09-28 | Kyoto University | Human FGF-20 gene and gene expression products |
| EP2163626A1 (en) | 1999-11-18 | 2010-03-17 | Novartis Vaccines and Diagnostics, Inc. | Human FGF-21 gene and gene expression products |
| US6716626B1 (en) | 1999-11-18 | 2004-04-06 | Chiron Corporation | Human FGF-21 nucleic acids |
| DE10160151A1 (de) | 2001-01-09 | 2003-06-26 | Ribopharma Ag | Verfahren zur Hemmung der Expression eines vorgegebenen Zielgens |
| US20020081663A1 (en) | 2000-01-05 | 2002-06-27 | Conklin Darrell C. | Novel FGF homolog ZFGF11 |
| US20010044525A1 (en) | 2000-01-05 | 2001-11-22 | Conklin Darrell C. | Novel FGF Homolog zFGF12 |
| JP2003518944A (ja) | 2000-01-05 | 2003-06-17 | ザイモジェネティクス,インコーポレイティド | 新規fgf相同体zfgf12 |
| WO2001049849A1 (en) | 2000-01-05 | 2001-07-12 | Zymogenetics, Inc. | Novel fgf homolog zfgf11 |
| CA2398603A1 (en) | 2000-02-15 | 2001-08-23 | Amgen, Inc. | Fibroblast growth factor-23 molecules and uses thereof |
| US20060160181A1 (en) | 2000-02-15 | 2006-07-20 | Amgen Inc. | Fibroblast Growth Factor-23 molecules and uses thereof |
| US20030180312A1 (en) | 2000-02-22 | 2003-09-25 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
| US20030105302A1 (en) | 2000-03-08 | 2003-06-05 | Nobuyuki Itoh | Human FGF-23 gene and gene expression products |
| JP2003531583A (ja) | 2000-03-08 | 2003-10-28 | カイロン コーポレイション | ヒトfgf−23遺伝子および遺伝子発現産物 |
| AU5056501A (en) | 2000-03-31 | 2001-10-08 | Nobuyuki Itoh | Fibroblast growth factor-like molecules and uses thereof |
| US20030065140A1 (en) | 2000-04-03 | 2003-04-03 | Vernet Corine A.M. | Novel proteins and nucleic acids encoding same |
| JP2002112772A (ja) | 2000-07-10 | 2002-04-16 | Takeda Chem Ind Ltd | 新規ポリペプチドおよびそのdna |
| JP2004504063A (ja) | 2000-07-19 | 2004-02-12 | アドバンスド リサーチ & テクノロジー インスティテュート | 新規線維芽細胞増殖因子(fgf23)および使用方法 |
| US6812339B1 (en) | 2000-09-08 | 2004-11-02 | Applera Corporation | Polymorphisms in known genes associated with human disease, methods of detection and uses thereof |
| US20070037165A1 (en) | 2000-09-08 | 2007-02-15 | Applera Corporation | Polymorphisms in known genes associated with human disease, methods of detection and uses thereof |
| US7164009B2 (en) | 2000-09-15 | 2007-01-16 | Genentech, Inc. | Pro9821 polypeptides |
| IL139380A0 (en) | 2000-10-31 | 2001-11-25 | Prochon Biotech Ltd | Active variants of fibroblast growth factor |
| AU2002230531A1 (en) | 2000-11-22 | 2002-06-03 | Bayer Corporation | Use of fgf-19 for inhibiting angiogenesis |
| US20020151496A1 (en) | 2000-12-08 | 2002-10-17 | Bringmann Peter W. | Novel fibroblast growth factors |
| DE10100588A1 (de) | 2001-01-09 | 2002-07-18 | Ribopharma Ag | Verfahren zur Hemmung der Expression eines Zielgens |
| DE10100587C1 (de) | 2001-01-09 | 2002-11-21 | Ribopharma Ag | Verfahren zur Hemmung der Expression eines Zielgens |
| US20030119112A1 (en) | 2001-06-20 | 2003-06-26 | Genentech, Inc. | Compositions and methods for the diagnosis and treatment of disorders involving angiogenesis |
| AU2003225903A1 (en) | 2002-03-21 | 2003-10-08 | Curagen Corporation | Methods of using farnesoid x receptor (fxr) agonists |
| US6987121B2 (en) | 2002-04-25 | 2006-01-17 | Smithkline Beecham Corporation | Compositions and methods for hepatoprotection and treatment of cholestasis |
| AU2003243400B2 (en) | 2002-06-07 | 2009-10-29 | Genentech, Inc. | Compositions and methods for the diagnosis and treatment of tumor |
| DE10227232A1 (de) * | 2002-06-18 | 2004-01-15 | Aventis Pharma Deutschland Gmbh | Saure Insulinzubereitungen mit verbesserter Stabilität |
| EP1517921B1 (en) | 2002-06-28 | 2006-06-07 | Domantis Limited | Dual specific ligands with increased serum half-life |
| WO2004026228A2 (en) | 2002-09-18 | 2004-04-01 | Eli Lilly And Company | Method for reducing morbidity and mortality in critically ill patients |
| US20050181375A1 (en) | 2003-01-10 | 2005-08-18 | Natasha Aziz | Novel methods of diagnosis of metastatic cancer, compositions and methods of screening for modulators of metastatic cancer |
| CN1802167A (zh) | 2003-06-12 | 2006-07-12 | 伊莱利利公司 | 融合蛋白质 |
| MXPA06000508A (es) | 2003-07-18 | 2006-04-05 | Amgen Inc | Agentes de union especifica al factor del crecimiento de los hepatocitos. |
| AU2004303783A1 (en) | 2003-12-10 | 2005-07-07 | Eli Lilly And Company | Muteins of fibroblast growth factor 21 |
| CA2558738C (en) | 2004-03-11 | 2013-02-05 | Fresenius Kabi Deutschland Gmbh | Conjugates of hydroxyalkyl starch and a protein, prepared by reductive amination |
| CN102895663A (zh) * | 2004-04-14 | 2013-01-30 | 健泰科生物技术公司 | 含有用于调节血管发育的egfl7拮抗剂的组合物及方法 |
| DK1751184T3 (da) | 2004-05-13 | 2009-11-23 | Lilly Co Eli | FGF-21 fusionsproteiner |
| TW200607523A (en) | 2004-06-01 | 2006-03-01 | Domantis Ltd | Drug compositions, fusions and conjugates |
| JP2006016323A (ja) | 2004-06-30 | 2006-01-19 | Hiroshima Industrial Promotion Organization | 生理活性バイオマテリアル |
| MX2007002616A (es) | 2004-09-02 | 2007-05-16 | Lilly Co Eli | Muteinas de factor de crecimiento de fibroblasto 21. |
| WO2006028714A1 (en) | 2004-09-02 | 2006-03-16 | Eli Lilly And Company | Muteins of fibroblast growth factor 21 |
| CN101724071A (zh) | 2004-10-08 | 2010-06-09 | 杜门蒂斯有限公司 | 抗肿瘤坏死因子受体1的单域抗体及其使用方法 |
| EP1817335A2 (en) | 2004-10-29 | 2007-08-15 | Genentech, Inc. | Disruptions of genes encoding secreted proteins, compositions and methods relating thereto |
| US20060134663A1 (en) | 2004-11-03 | 2006-06-22 | Paul Harkin | Transcriptome microarray technology and methods of using the same |
| US7655627B2 (en) | 2004-12-14 | 2010-02-02 | Eli Lilly And Company | Muteins of fibroblast growth factor 21 |
| US20060275794A1 (en) | 2005-03-07 | 2006-12-07 | Invitrogen Corporation | Collections of matched biological reagents and methods for identifying matched reagents |
| UY29460A1 (es) | 2005-04-08 | 2006-11-30 | Noxxon Pharma Ag | Acidos nucleicos de union a ghrelin |
| EP2083081A1 (en) | 2005-07-22 | 2009-07-29 | Five Prime Therapeutics, Inc. | Compositions and methods of treating disease with FGFR fusion proteins |
| US20090081658A1 (en) | 2005-08-24 | 2009-03-26 | Abdelmajid Belouchi | Genemap of the human genes associated with crohn's disease |
| US20090312265A1 (en) | 2006-02-10 | 2009-12-17 | Dermagen Ab | Novel antimicrobial peptides and use thereof |
| CA2637988A1 (en) * | 2006-02-10 | 2007-11-29 | Genentech, Inc. | Anti-fgf19 antibodies and methods using same |
| WO2007130673A2 (en) | 2006-05-05 | 2007-11-15 | Beth Israel Deaconess Medical Center | Methods for the diagnosis and treatment of female infertility using molecular markers |
| US8168169B2 (en) | 2006-08-09 | 2012-05-01 | Mclean Hospital Corporation | Methods and compositions for the treatment of medical disorders |
| CN101563597A (zh) | 2006-09-01 | 2009-10-21 | 美国菌种保藏中心 | 用于诊断和治疗2型糖尿病的组合物和方法 |
| WO2008052796A1 (en) | 2006-11-03 | 2008-05-08 | U3 Pharma Gmbh | Fgfr4 antibodies |
| EP2457997B1 (en) | 2007-01-03 | 2016-08-31 | NeoStem Oncology, LLC | Stem cell growth media and methods of making and using same |
| PL2068909T3 (pl) | 2007-03-30 | 2012-09-28 | Ambrx Inc | Modyfikowane polipeptydy fgf-21 i ich zastosowanie |
| RS57149B1 (sr) | 2007-04-02 | 2018-07-31 | Genentech Inc | Kloto-beta agonist antitelo za primenu u tretmanu dijabetes melitusa ili otpornosti na insulin |
| EP2036539A1 (en) | 2007-09-11 | 2009-03-18 | Novo Nordisk A/S | Stable formulations of amylin and its analogues |
| US20090104210A1 (en) * | 2007-10-17 | 2009-04-23 | Tota Michael R | Peptide compounds for treating obesity and insulin resistance |
| US20120142546A1 (en) | 2007-12-10 | 2012-06-07 | The Johns Hopkins University | Hypomethylated genes in cancer |
| EP2080812A1 (en) | 2008-01-18 | 2009-07-22 | Transmedi SA | Compositions and methods of detecting post-stop peptides |
| TW200936156A (en) | 2008-01-28 | 2009-09-01 | Novartis Ag | Methods and compositions using Klotho-FGF fusion polypeptides |
| US8420088B2 (en) | 2008-01-28 | 2013-04-16 | Novartis Ag | Methods and compositions using FGF23 fusion polypeptides |
| US20090226459A1 (en) | 2008-01-29 | 2009-09-10 | Cold Spring Harbor Laboratory | Role of fgf-19 in cancer diagnosis and treatment |
| NZ602702A (en) | 2008-03-19 | 2014-03-28 | Ambrx Inc | Modified fgf-21 polypeptides and their uses |
| WO2009117622A2 (en) | 2008-03-19 | 2009-09-24 | Ambrx, Inc. | Modified fgf-23 polypeptides and their uses |
| AU2009226246A1 (en) | 2008-03-21 | 2009-09-24 | Podiceps B.V. | Diagnostic of pre-symptomatic metabolic syndrome |
| CN101591653B (zh) | 2008-05-27 | 2013-07-31 | 中国人民解放军军事医学科学院野战输血研究所 | 低表达cyp7a1的肝细胞及其构建方法 |
| EA024751B8 (ru) | 2008-06-04 | 2020-01-31 | Амген Инк. | Мутанты fgf21 и их применение |
| US8363365B2 (en) | 2008-06-17 | 2013-01-29 | Semiconductor Energy Laboratory Co., Ltd. | Semiconductor device |
| MX2010014228A (es) | 2008-06-18 | 2011-03-29 | Abbott Laboratories Star | Metodos y productos de diagnostico del p/gf-1 acompañante. |
| FR2933702A1 (fr) | 2008-07-08 | 2010-01-15 | Sanofi Aventis | Antagonistes specifiques du recepteur fgf-r4 |
| WO2010006214A1 (en) | 2008-07-09 | 2010-01-14 | Ambrx, Inc. | Fgf-21 neutralizing antibodies and their uses |
| BRPI0916904A2 (pt) | 2008-08-04 | 2016-10-11 | Fiveprime Therapeutics Inc | polipeptídeos, moléculares de fusão ecd fgfr4, composições farmacêuticas, polinucleotídio e métodos de tratamento de desordem angiogênica, câncer em paciente e degeneração macular em paciente e respectivos usos |
| EP2358749B1 (en) | 2008-10-10 | 2018-07-18 | Amgen, Inc | Fgf21 mutants and uses thereof |
| WO2010065439A1 (en) | 2008-12-05 | 2010-06-10 | Eli Lilly And Company | Variants of fibroblast growth factor 21 |
| WO2010080730A2 (en) | 2009-01-09 | 2010-07-15 | Mayo Foundation For Medical Education And Research | Methods and materials for delivering bile acids |
| US20120035105A1 (en) | 2009-01-09 | 2012-02-09 | Sdg, Inc. | Insulin Therapies for the Treatment of Diabetes, Diabetes Related Ailments, and/or Diseases or Conditions Other Than Diabetes or Diabetes Related Ailments |
| US20100274362A1 (en) | 2009-01-15 | 2010-10-28 | Avner Yayon | Cartilage particle tissue mixtures optionally combined with a cancellous construct |
| SI2393828T1 (sl) | 2009-02-03 | 2017-01-31 | Amunix Operating Inc. | Podaljšani rekombinantni polipetidi in sestavki, ki jih obsegajo |
| US20120052069A1 (en) | 2009-05-05 | 2012-03-01 | Amgen Inc | Fgf21 mutants and uses thereof |
| SMT202400036T1 (it) | 2009-05-05 | 2024-03-13 | Amgen Inc | Mutanti fgf21 e loro utilizzi |
| US8461111B2 (en) | 2009-05-20 | 2013-06-11 | Florida State University Research Foundation | Fibroblast growth factor mutants having improved functional half-life and methods of their use |
| US10241093B2 (en) | 2009-05-28 | 2019-03-26 | The Cleveland Clinic Foundation | Trimethylamine-containing compounds for diagnosis and prediction of disease |
| WO2010139741A1 (en) | 2009-06-04 | 2010-12-09 | Novartis Ag | Fgf-21 for treating cancers |
| US20120172298A1 (en) | 2009-06-11 | 2012-07-05 | Novo Nordisk A/S | Glp-1 and fgf21 combinations for treatment of diabetes type 2 |
| AU2010262927A1 (en) | 2009-06-17 | 2012-01-19 | Amgen Inc. | Chimeric FGF19 polypeptides and uses thereof |
| CN101993485B (zh) | 2009-08-20 | 2013-04-17 | 重庆富进生物医药有限公司 | 促胰岛素分泌肽类似物同源二聚体及其用途 |
| JP6016636B2 (ja) | 2009-10-15 | 2016-10-26 | ジェネンテック, インコーポレイテッド | 改変したレセプター特異性を持つキメラ線維芽細胞増殖因子 |
| US8889621B2 (en) | 2009-10-30 | 2014-11-18 | New York University | Inhibiting binding of FGF23 to the binary FGFR-Klotho complex for the treatment of hypophosphatemia |
| UA109888C2 (uk) | 2009-12-07 | 2015-10-26 | ІЗОЛЬОВАНЕ АНТИТІЛО АБО ЙОГО ФРАГМЕНТ, ЩО ЗВ'ЯЗУЄТЬСЯ З β-КЛОТО, РЕЦЕПТОРАМИ FGF І ЇХНІМИ КОМПЛЕКСАМИ | |
| US20110312881A1 (en) | 2009-12-21 | 2011-12-22 | Amunix, Inc. | Bifunctional polypeptide compositions and methods for treatment of metabolic and cardiovascular diseases |
| EP2359843A1 (en) | 2010-01-21 | 2011-08-24 | Sanofi | Pharmaceutical composition for treating a metabolic syndrome |
| US20110195077A1 (en) | 2010-01-29 | 2011-08-11 | Novartis Ag | Methods and compositions using fgf23 fusion ppolypeptides |
| US9517264B2 (en) | 2010-04-15 | 2016-12-13 | Amgen Inc. | Human FGF receptor and β-Klotho binding proteins |
| CA2796459C (en) | 2010-04-16 | 2016-05-24 | Salk Institute For Biological Studies | Methods for treating metabolic disorders using fgf-1 |
| JP2013533227A (ja) | 2010-06-08 | 2013-08-22 | ノヴォ ノルディスク アー/エス | Fgf21類似体および誘導体 |
| CN103415300B (zh) | 2010-07-20 | 2018-02-23 | 诺沃—诺迪斯克有限公司 | N‑末端修饰的fgf21化合物 |
| CN103221039A (zh) | 2010-09-09 | 2013-07-24 | 三叶草私人有限公司 | 血管生成抑制剂的气道给药 |
| CN103339145A (zh) * | 2010-09-22 | 2013-10-02 | 安姆根有限公司 | 运载体免疫球蛋白及其用途 |
| CN102464712A (zh) | 2010-11-11 | 2012-05-23 | 重庆富进生物医药有限公司 | 缺失型人成纤维细胞生长因子21变异体及其偶联物 |
| US9023791B2 (en) | 2010-11-19 | 2015-05-05 | Novartis Ag | Fibroblast growth factor 21 mutations |
| JP5613547B2 (ja) | 2010-12-14 | 2014-10-22 | 株式会社スクウェア・エニックス | タスクベースの並列プログラミング言語 |
| SG191252A1 (en) | 2010-12-22 | 2013-07-31 | Marcadia Biotech Inc | Methods for treating metabolic disorders and obesity with gip and glp-1 receptor-active glucagon-based peptides |
| JP5850435B2 (ja) | 2010-12-24 | 2016-02-03 | 国立研究開発法人産業技術総合研究所 | ヒトfgf19活性の正確で高感度な測定方法ならびにヒトfgf19活性の制御剤 |
| US10752664B2 (en) | 2011-04-08 | 2020-08-25 | Amgen Inc. | Method of treating or ameliorating metabolic disorders using growth differentiation factor 15 (GDF-15) |
| WO2012140650A2 (en) | 2011-04-12 | 2012-10-18 | Hepacore Ltd. | Conjugates of carboxy polysaccharides with fibroblast growth factors and variants thereof |
| US20140189893A1 (en) | 2011-05-10 | 2014-07-03 | Amgen Inc. | Method of identifying compounds that specifically modulate the interaction of fgfr1 and beta klotho |
| PE20140995A1 (es) | 2011-05-16 | 2014-08-23 | Genentech Inc | Agonistas de fgfr1 y sus metodos de uso |
| US9574002B2 (en) | 2011-06-06 | 2017-02-21 | Amgen Inc. | Human antigen binding proteins that bind to a complex comprising β-Klotho and an FGF receptor |
| CA2838207A1 (en) | 2011-06-08 | 2012-12-13 | Denovo Biopharma (Hangzhou) Ltd. Co. | Methods and compositions of predicting activity of retinoid x receptor modulator |
| EP2723391B1 (en) | 2011-06-24 | 2018-06-13 | University of Miami | Fibroblast growth factor receptor inhibition for the treatment of disease |
| PL2726511T3 (pl) | 2011-07-01 | 2019-12-31 | Ngm Biopharmaceuticals, Inc. | Kompozycje, zastosowania i sposoby leczenia zaburzeń oraz chorób metabolicznych |
| EP2548570A1 (en) | 2011-07-19 | 2013-01-23 | Sanofi | Pharmaceutical composition for treating a metabolic syndrome |
| JP2014522868A (ja) * | 2011-07-29 | 2014-09-08 | イレブン・バイオセラピユーテイクス・インコーポレイテツド | 精製タンパク質 |
| WO2013027191A1 (en) | 2011-08-25 | 2013-02-28 | Novartis Ag | Methods and compositions using fgf23 fusion polypeptides |
| CA2845357A1 (en) | 2011-08-31 | 2013-03-07 | Amgen Inc. | Method of treating or ameliorating type 1 diabetes using fgf21 |
| UY34346A (es) * | 2011-09-26 | 2013-04-30 | Novartis Ag | Proteínas de fusión para tratar trastornos metabólicos |
| UY34347A (es) | 2011-09-26 | 2013-04-30 | Novartis Ag | Proteínas de función dual para tratar trastornos metabólicos |
| AR087973A1 (es) | 2011-10-04 | 2014-04-30 | Lilly Co Eli | Variantes del factor 21 del crecimiento de fibroblastos |
| CN103127503B (zh) | 2011-11-23 | 2017-11-10 | 上海医学生命科学研究中心有限公司 | 拮抗和/或阻断IL‑6/IL‑6R/gp130信号通路在抗肝癌治疗中的用途 |
| JP2015506944A (ja) | 2012-01-18 | 2015-03-05 | ジェネンテック, インコーポレイテッド | Fgf19修飾薬を使用する方法 |
| US9475856B2 (en) | 2012-03-02 | 2016-10-25 | New York University | Chimeric FGF21 proteins with enhanced binding affinity for β-klotho for the treatment of type II diabetes, obesity, and related metabolic disorders |
| JP2013194049A (ja) | 2012-03-23 | 2013-09-30 | Kazuo Todokoro | ヒト造血幹細胞を増幅させるための組成物及び方法 |
| EP2834259A4 (en) | 2012-04-02 | 2016-08-24 | Moderna Therapeutics Inc | MODIFIED POLYNUCLEOTIDES |
| BR112014025037A2 (pt) * | 2012-04-09 | 2018-07-31 | Daiichi Sankyo Company, Limited | anticorpo ou um fragmento funcional do mesmo, nucleotídeo, vetor recombinante, célula, métodos para a produção de um anticorpo ou fragmento funcional, para detecção ou ensaio de fgfr2 humano iiib, para a identificação de um indivíduo receptor de uma composição farmacêutica, e, para identificar e para produzir uma substância, forma modificada, composição, e, reagente |
| US9771567B2 (en) | 2012-04-16 | 2017-09-26 | Tel Hashomer Medical Research Infrastructure And Services Ltd. | Klotho variant polypeptides |
| HK1202800A1 (en) | 2012-05-15 | 2015-10-09 | Eli Lilly And Company | Therapeutic uses of fibroblast growth factor 21 proteins |
| US9474785B2 (en) | 2012-06-07 | 2016-10-25 | New York University | Chimeric fibroblast growth factor 19 proteins and methods of use |
| US9464126B2 (en) | 2012-06-07 | 2016-10-11 | New York University | Chimeric fibroblast growth factor 21 proteins and methods of use |
| US9657075B2 (en) | 2012-06-07 | 2017-05-23 | New York University | Chimeric fibroblast growth factor 23 proteins and methods of use |
| KR20150006059A (ko) | 2012-06-11 | 2015-01-15 | 일라이 릴리 앤드 캄파니 | 섬유모세포 성장 인자 21 변이체 |
| TWI513705B (zh) | 2012-06-11 | 2015-12-21 | Lilly Co Eli | 纖維母細胞生長因子21蛋白質 |
| DK2872491T3 (da) | 2012-07-11 | 2021-08-09 | Blueprint Medicines Corp | Inhibitorer af fibroblastvækstfaktorreceptoren |
| TW201420606A (zh) | 2012-08-22 | 2014-06-01 | Lilly Co Eli | 同源二聚體蛋白 |
| AU2013311777B2 (en) | 2012-09-07 | 2018-02-01 | Sanofi | Fusion proteins for treating a metabolic syndrome |
| US9290557B2 (en) | 2012-11-28 | 2016-03-22 | Ngm Biopharmaceuticals, Inc. | Compositions comprising variants and fusions of FGF19 polypeptides |
| EP3798228A1 (en) | 2012-11-28 | 2021-03-31 | NGM Biopharmaceuticals, Inc. | Compositions and methods for treatment of metabolic disorders and diseases |
| SG11201504815QA (en) * | 2012-12-27 | 2015-07-30 | Ngm Biopharmaceuticals Inc | Methods for modulating bile acid homeostasis and treatment of bile acid disorders and diseases |
| US9273107B2 (en) | 2012-12-27 | 2016-03-01 | Ngm Biopharmaceuticals, Inc. | Uses and methods for modulating bile acid homeostasis and treatment of bile acid disorders and diseases |
| WO2014105849A1 (en) * | 2012-12-28 | 2014-07-03 | Xoma (Us) Llc | Antibodies specific for fgfr4 and methods of use |
| WO2014130659A1 (en) | 2013-02-22 | 2014-08-28 | New York University | Chimeric fibroblast growth factor 23 proteins and methods of use |
| WO2014152090A1 (en) | 2013-03-14 | 2014-09-25 | Georgetown University | Compositions and treatments of metabolic disorders using fgf binding protein 3 and fgf 19 |
| WO2014152089A1 (en) | 2013-03-14 | 2014-09-25 | Georgetown University | Compositions and treatments of metabolic disorders using fgf binding protein 3 |
| WO2014149699A1 (en) | 2013-03-15 | 2014-09-25 | Eli Lilly And Company | Bifunctional protein |
| CA2928135A1 (en) | 2013-10-21 | 2015-04-30 | Salk Institute For Biological Studies | Mutated fibroblast growth factor (fgf) 1 and methods of use |
| NZ718962A (en) | 2013-10-28 | 2019-12-20 | Ngm Biopharmaceuticals Inc | Cancer models and associated methods |
| AU2015209131B2 (en) | 2014-01-24 | 2020-06-25 | Ngm Biopharmaceuticals, Inc. | Binding proteins and methods of use thereof |
| WO2015183890A2 (en) | 2014-05-28 | 2015-12-03 | Ngm Biopharmaceuticals, Inc. | Methods and compositions for the treatment of metabolic disorders and diseases |
| EP3155005A4 (en) | 2014-06-16 | 2018-07-11 | NGM Biopharmaceuticals, Inc. | Methods and uses for modulating bile acid homeostasis and treatment of bile acid disorders and diseases |
| WO2016048995A2 (en) | 2014-09-23 | 2016-03-31 | Salk Institute For Biological Studies | Fgf19 truncations and mutants and uses thereof |
| CN114129709A (zh) | 2014-10-23 | 2022-03-04 | 恩格姆生物制药公司 | 包含肽变异体的药物组合物及其使用方法 |
| US10434144B2 (en) | 2014-11-07 | 2019-10-08 | Ngm Biopharmaceuticals, Inc. | Methods for treatment of bile acid-related disorders and prediction of clinical sensitivity to treatment of bile acid-related disorders |
| CA3003616C (en) | 2015-11-09 | 2020-07-28 | Ngm Biopharmaceuticals, Inc. | Methods for treatment of bile acid-related disorders |
| CA3034399A1 (en) | 2016-08-26 | 2018-03-01 | Ngm Biopharmaceuticals, Inc. | Methods of treating fibroblast growth factor 19-mediated cancers and tumors |
| US20190307847A1 (en) | 2016-08-29 | 2019-10-10 | Ngm Biopharmaceuticals, Inc. | Methods for treatment of bile acid-related disorders |
-
2015
- 2015-10-22 CN CN202111301507.7A patent/CN114129709A/zh active Pending
- 2015-10-22 ES ES15853394T patent/ES3026032T3/es active Active
- 2015-10-22 SG SG11201702757YA patent/SG11201702757YA/en unknown
- 2015-10-22 CN CN201580070309.0A patent/CN107108711B/zh active Active
- 2015-10-22 US US15/519,289 patent/US10517929B2/en active Active
- 2015-10-22 UA UAA201703593A patent/UA123763C2/uk unknown
- 2015-10-22 AU AU2015335844A patent/AU2015335844B2/en active Active
- 2015-10-22 EP EP15853394.3A patent/EP3209681B1/en active Active
- 2015-10-22 KR KR1020177013879A patent/KR102569907B1/ko active Active
- 2015-10-22 MX MX2017004488A patent/MX392683B/es unknown
- 2015-10-22 FI FIEP15853394.3T patent/FI3209681T3/fi active
- 2015-10-22 PL PL15853394.3T patent/PL3209681T3/pl unknown
- 2015-10-22 DK DK15853394.3T patent/DK3209681T3/da active
- 2015-10-22 IL IL251834A patent/IL251834B2/en unknown
- 2015-10-22 WO PCT/US2015/056830 patent/WO2016065106A1/en not_active Ceased
- 2015-10-22 JP JP2017519922A patent/JP6949711B2/ja active Active
- 2015-10-22 RU RU2017112738A patent/RU2729161C2/ru active
-
2019
- 2019-12-18 US US16/719,448 patent/US20200197490A1/en not_active Abandoned
-
2021
- 2021-05-24 JP JP2021087034A patent/JP2021152020A/ja active Pending
- 2021-06-22 US US17/355,002 patent/US20220047675A1/en not_active Abandoned
Non-Patent Citations (1)
| Title |
|---|
| SUSHANT BHATNAGAR ET AL: "Fibroblast Growth Factor-19, a Novel Factor That Inhibits Hepatic Fatty Acid Synthesis", JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 284, no. 15, 20 February 2009 (2009-02-20), US, pages 10023 - 10033, XP055470565, ISSN: 0021-9258, DOI: 10.1074/jbc.M808818200 * |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20220047675A1 (en) | Pharmaceutical compositions comprising peptide variants and methods of use thereof | |
| US11141460B2 (en) | Methods for treatment of bile acid-related disorders and prediction of clinical sensitivity to treatment of bile acid-related disorders | |
| US20220088140A1 (en) | Methods of Using Compositions Comprising Variants and Fusions of FGF19 Polypeptides for Treatment of Metabolic Disorders and Diseases | |
| US20200390859A1 (en) | Methods for treatment of bile acid-related disorders | |
| US9963494B2 (en) | Methods of using compositions comprising variants and fusions of FGF19 polypeptides for reducing glucose levels in a subject | |
| US9290557B2 (en) | Compositions comprising variants and fusions of FGF19 polypeptides | |
| US20200330555A1 (en) | Methods of treating gastrointestinal motility-related disorders using variants and fusions of fgf19/fgf21 polypeptides | |
| CA2964782C (en) | Pharmaceutical compositions comprising peptide variants and methods of use thereof | |
| BR112017007816B1 (pt) | Composições farmacêuticas e uso das mesmas |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE |
|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE |
|
| 17P | Request for examination filed |
Effective date: 20170410 |
|
| AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR |
|
| AX | Request for extension of the european patent |
Extension state: BA ME |
|
| DAV | Request for validation of the european patent (deleted) | ||
| DAX | Request for extension of the european patent (deleted) | ||
| REG | Reference to a national code |
Ref country code: HK Ref legal event code: DE Ref document number: 1235417 Country of ref document: HK |
|
| RIC1 | Information provided on ipc code assigned before grant |
Ipc: A61K 9/08 20060101ALI20180511BHEP Ipc: G01N 33/68 20060101ALI20180511BHEP Ipc: C07K 14/50 20060101AFI20180511BHEP |
|
| A4 | Supplementary search report drawn up and despatched |
Effective date: 20180927 |
|
| RIC1 | Information provided on ipc code assigned before grant |
Ipc: A61K 9/08 20060101ALI20180922BHEP Ipc: G01N 33/68 20060101ALI20180922BHEP Ipc: C07K 14/50 20060101AFI20180922BHEP |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: EXAMINATION IS IN PROGRESS |
|
| 17Q | First examination report despatched |
Effective date: 20210506 |
|
| RIC1 | Information provided on ipc code assigned before grant |
Ipc: A61P 3/00 20060101ALI20230712BHEP Ipc: A61P 35/00 20060101ALI20230712BHEP Ipc: A61P 29/00 20060101ALI20230712BHEP Ipc: A61P 15/00 20060101ALI20230712BHEP Ipc: A61P 11/00 20060101ALI20230712BHEP Ipc: A61P 9/00 20060101ALI20230712BHEP Ipc: A61P 3/10 20060101ALI20230712BHEP Ipc: A61P 3/08 20060101ALI20230712BHEP Ipc: A61P 3/06 20060101ALI20230712BHEP Ipc: A61P 3/04 20060101ALI20230712BHEP Ipc: A61P 3/02 20060101ALI20230712BHEP Ipc: A61P 1/00 20060101ALI20230712BHEP Ipc: A61K 9/19 20060101ALI20230712BHEP Ipc: A61K 47/26 20060101ALI20230712BHEP Ipc: A61K 47/18 20170101ALI20230712BHEP Ipc: A61K 38/18 20060101ALI20230712BHEP Ipc: A61K 9/08 20060101ALI20230712BHEP Ipc: G01N 33/68 20060101ALI20230712BHEP Ipc: C07K 14/50 20060101AFI20230712BHEP |
|
| GRAP | Despatch of communication of intention to grant a patent |
Free format text: ORIGINAL CODE: EPIDOSNIGR1 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: GRANT OF PATENT IS INTENDED |
|
| RIC1 | Information provided on ipc code assigned before grant |
Ipc: A61P 3/00 20060101ALI20241121BHEP Ipc: A61P 35/00 20060101ALI20241121BHEP Ipc: A61P 29/00 20060101ALI20241121BHEP Ipc: A61P 15/00 20060101ALI20241121BHEP Ipc: A61P 11/00 20060101ALI20241121BHEP Ipc: A61P 9/00 20060101ALI20241121BHEP Ipc: A61P 3/10 20060101ALI20241121BHEP Ipc: A61P 3/08 20060101ALI20241121BHEP Ipc: A61P 3/06 20060101ALI20241121BHEP Ipc: A61P 3/04 20060101ALI20241121BHEP Ipc: A61P 3/02 20060101ALI20241121BHEP Ipc: A61P 1/00 20060101ALI20241121BHEP Ipc: A61K 9/19 20060101ALI20241121BHEP Ipc: A61K 47/26 20060101ALI20241121BHEP Ipc: A61K 47/18 20170101ALI20241121BHEP Ipc: A61K 38/18 20060101ALI20241121BHEP Ipc: A61K 9/08 20060101ALI20241121BHEP Ipc: G01N 33/68 20060101ALI20241121BHEP Ipc: C07K 14/50 20060101AFI20241121BHEP |
|
| INTG | Intention to grant announced |
Effective date: 20241129 |
|
| GRAS | Grant fee paid |
Free format text: ORIGINAL CODE: EPIDOSNIGR3 |
|
| GRAA | (expected) grant |
Free format text: ORIGINAL CODE: 0009210 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE PATENT HAS BEEN GRANTED |
|
| AK | Designated contracting states |
Kind code of ref document: B1 Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR |
|
| REG | Reference to a national code |
Ref country code: GB Ref legal event code: FG4D |
|
| REG | Reference to a national code |
Ref country code: CH Ref legal event code: EP |
|
| REG | Reference to a national code |
Ref country code: DE Ref legal event code: R096 Ref document number: 602015091363 Country of ref document: DE |
|
| REG | Reference to a national code |
Ref country code: IE Ref legal event code: FG4D |
|
| REG | Reference to a national code |
Ref country code: NL Ref legal event code: FP |
|
| REG | Reference to a national code |
Ref country code: DK Ref legal event code: T3 Effective date: 20250430 |
|
| REG | Reference to a national code |
Ref country code: FI Ref legal event code: FGE Ref country code: SE Ref legal event code: TRGR |
|
| REG | Reference to a national code |
Ref country code: ES Ref legal event code: FG2A Ref document number: 3026032 Country of ref document: ES Kind code of ref document: T3 Effective date: 20250610 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: PT Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20250804 |
|
| REG | Reference to a national code |
Ref country code: LT Ref legal event code: MG9D |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: GR Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20250703 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: BG Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20250402 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: HR Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20250402 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: RS Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20250702 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: IS Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20250802 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: LV Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20250402 |
|
| REG | Reference to a national code |
Ref country code: DE Ref legal event code: R097 Ref document number: 602015091363 Country of ref document: DE |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: SM Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20250402 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: CZ Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20250402 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: EE Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20250402 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: RO Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20250402 Ref country code: SK Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20250402 |
|
| PLBE | No opposition filed within time limit |
Free format text: ORIGINAL CODE: 0009261 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: NO OPPOSITION FILED WITHIN TIME LIMIT |
|
| REG | Reference to a national code |
Ref country code: CH Ref legal event code: L10 Free format text: ST27 STATUS EVENT CODE: U-0-0-L10-L00 (AS PROVIDED BY THE NATIONAL OFFICE) Effective date: 20260211 |
|
| 26N | No opposition filed |
Effective date: 20260105 |