EP3171882A1 - Treatment of cancer using a cll-1 chimeric antigen receptor - Google Patents
Treatment of cancer using a cll-1 chimeric antigen receptorInfo
- Publication number
- EP3171882A1 EP3171882A1 EP15744448.0A EP15744448A EP3171882A1 EP 3171882 A1 EP3171882 A1 EP 3171882A1 EP 15744448 A EP15744448 A EP 15744448A EP 3171882 A1 EP3171882 A1 EP 3171882A1
- Authority
- EP
- European Patent Office
- Prior art keywords
- seq
- cll
- car
- amino acid
- acid sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7042—Compounds having saccharide radicals and heterocyclic rings
- A61K31/7052—Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides
- A61K31/706—Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom
- A61K31/7064—Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines
- A61K31/7068—Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines having oxo groups directly attached to the pyrimidine ring, e.g. cytidine, cytidylic acid
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
- A61K35/14—Blood; Artificial blood
- A61K35/17—Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001102—Receptors, cell surface antigens or cell surface determinants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/11—T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/30—Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
- A61K40/31—Chimeric antigen receptors [CAR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
- A61K40/421—Immunoglobulin superfamily
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
- A61K40/4214—Receptors for cytokines
- A61K40/4217—Receptors for interleukins [IL]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/08—Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70578—NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2851—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the lectin superfamily, e.g. CD23, CD72
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/515—Animal cells
- A61K2039/5156—Animal cells expressing foreign proteins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/31—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the route of administration
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/38—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the dose, timing or administration schedule
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
- A61K2239/48—Blood cells, e.g. leukemia or lymphoma
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
Definitions
- the present invention relates generally to the use of immune effector cells (e.g., T cells, NK cells) engineered to express a Chimeric Antigen Receptor (CAR) to treat a disease associated with expression of C-type lectin-like- 1 (CLL-1).
- immune effector cells e.g., T cells, NK cells
- CAR Chimeric Antigen Receptor
- C-type lectin-like- 1 (CLL-1) is also known as MICL, CLEC12A, CLEC-1, Dendritic Cell- Associated Lectin 1, and DCAL-2.
- CLL-1 is a glycoprotein receptor and member of the large family of C-type lectin-like receptors involved in immune regulation. CLL-1 is expressed in hematopoietic cells, primarily on innate immune cells including monocytes, DCs, pDCs, and granulocytes (Cancer Res. 2004; J Immunol 2009) and myeloid progenitor cells (Blood, 2007).
- CLL-1 is also found on acute myeloid leukemia (AML) blasts and leukemic stem cells (e.g., CD34 + /CD38 " ) (Zhao et al., Haematologica. 2010, 95(l):71-78.). CLL-1 expression may also be relevant for other myeloid leukemias, such as acute myelomonocytic leukemia, acute monocytic leukemia, acute promyelocytic leukemia, chronic myeloid leukemia (CML), and myelodysplasia syndrome (MDS).
- AML acute myeloid leukemia
- CML chronic myeloid leukemia
- MDS myelodysplasia syndrome
- the invention features an isolated nucleic acid molecule encoding a chimeric antigen receptor (CAR), wherein the CAR comprises an antibody or antibody fragment which includes a human anti-CLL-1 binding domain, a transmembrane domain, and an intracellular signaling domain (e.g., an intracellular signaling domain comprising a costimulatory domain and/or a primary signaling domain).
- CAR chimeric antigen receptor
- the CAR comprises an antibody or antibody fragment which includes a human anti-CLL-1 binding domain described herein, a transmembrane domain described herein, and an intracellular signaling domain described herein (e.g., an intracellular signaling domain comprising a costimulatory domain and/or a primary signaling domain).
- the CAR comprises a human anti-CLL-1 binding domain, a transmembrane domain, and an intracellular signaling domain, and wherein said anti-CLL- lbinding domain comprises a heavy chain complementary determining region 1 (HC CDRl), a heavy chain complementary determining region 2 (HC CDR2), and a heavy chain
- the human CLL-lbinding domain further comprises a light chain complementary determining region 1 (LC CDRl), a light chain complementary determining region 2 (LC CDR2), and a light chain complementary determining region 3 (LC CDR3).
- the human CLL-1 binding domain comprises a light chain complementary determining region 1 (LC CDRl), a light chain complementary determining region 2 (LC CDR2), and a light chain complementary determining region 3 (LC CDR3) of any CLL-1 light chain binding domain amino acid sequences listed in Table 2.
- the CAR comprises an antibody or antibody fragment which includes a human CLL-lbinding domain, a transmembrane domain, and an intracellular signaling domain comprising a costimulatory domain and/or a primary signaling domain
- said CLL-lbinding domain comprises one or more of light chain complementary determining region 1 (LC CDR1), light chain complementary determining region 2 (LC CDR2), and light chain complementary determining region 3 (LC CDR3) of any CLL-1 light chain binding domain amino acid sequences listed in Table 2, and one or more of heavy chain complementary determining region 1 (HC CDR1), heavy chain complementary determining region 2 (HC CDR2), and heavy chain complementary determining region 3 (HC CDR3) of any CLL-lheavy chain binding domain amino acid sequences listed in Table 2.
- LC CDR1 light chain complementary determining region 1
- HC CDR2 light chain complementary determining region 2
- HC CDR3 heavy chain complementary determining region 3
- the encoded human anti-CLL-1 binding domain comprises one or more (e.g., all three) light chain complementary determining region 1 (LC CDR1), light chain complementary determining region 2 (LC CDR2), and light chain complementary determining region 3 (LC CDR3) of a human anti-CLL-1 binding domain described herein, and/or one or more (e.g., all three) heavy chain complementary determining region 1 (HC CDR1), heavy chain complementary determining region 2 (HC CDR2), and heavy chain complementary determining region 3 (HC CDR3) of a human anti-CLL-1 binding domain described herein, e.g., a human anti-CLL-1 binding domain comprising one or more, e.g., all three, LC CDRs and one or more, e.g., all three, HC CDRs.
- LC CDR1 light chain complementary determining region 1
- HC CDR2 light chain complementary determining region 2
- HC CDR3 light chain complementary determining region 3
- the encoded human anti-CLL-1 binding domain comprises a light chain variable region described herein (e.g., in Table 2) and/or a heavy chain variable region described herein (e.g., in Table 2).
- the encoded human anti-CLL-1 binding domain is a scFv comprising a light chain and a heavy chain of an amino acid sequence of Table 2.
- the human anti-CLL-1 binding domain (e.g., an scFv) comprises: a light chain variable region comprising an amino acid sequence having at least one, two or three modifications (e.g., substitutions, e.g., conservative substitutions) but not more than 30, 20 or 10 modifications (e.g., substitutions, e.g., conservative substitutions) of an amino acid sequence of a light chain variable region provided in Table 2, or a sequence with 95-99% identity with an amino acid sequence of Table 2; and/or a heavy chain variable region comprising an amino acid sequence having at least one, two or three modifications (e.g., substitutions, e.g., conservative substitutions) but not more than 30, 20 or 10 modifications (e.g., substitutions, e.g., conservative substitutions) of an amino acid sequence of a heavy chain variable region provided in Table 2, or a sequence with 95-99% identity to an amino acid sequence of Table 2.
- the encoded CLL-1 binding domain comprises a HC CDR1
- the CLL-1 binding domain further comprises a LC CDRl, a LC CDR2, and a LC CDR3.
- the CLL-1 binding domain comprises a LC CDRl, a LC CDR2, and a LC CDR3 of any CLL-1 light chain binding domain amino acid sequences listed in Table 2.
- the encoded CLL-1 binding domain comprises one, two or all of
- the encoded human anti-CLL-1 binding domain comprises an amino acid sequence selected from a group consisting of SEQ ID NO:39-51, 65-77, 195, 78-90, or 196.
- the encoded CLL-1 binding domain (e.g., an scFv) comprises an amino acid sequence having at least one, two or three modifications (e.g., substitutions, e.g., conservative substitutions) but not more than 30, 20 or 10 modifications (e.g., substitutions, e.g., conservative substitutions) of an amino acid sequence of SEQ ID NO: 39-51, 65-77, 195, 78-90, or 196, or a sequence with 95-99% identity with an amino acid sequence of SEQ ID NO: 39-51, 65-77, 195, 78-90, or 196.
- the encoded CLL-1 binding domain comprises a heavy chain variable region comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 65-77, or 195, or a sequence with 95-99% identity thereof.
- the encoded CLL-1 binding domain comprises a light chain variable region comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 66-74, or 196, or a sequence with 95-99% identity thereof.
- the nucleic acid molecule comprises a nucleotide sequence selected from the group consisting of SEQ ID NO: 52-64, or a sequence with 95-99% identity thereof.
- the encoded humanized anti-CLL-1 binding domain includes a (Gly4-Ser)n linker, wherein n is 1, 2, 3, 4, 5, or 6, preferably 3 or 4 (SEQ ID NO:26).
- the light chain variable region and heavy chain variable region of a scFv can be, e.g., in any of the following orientations: light chain variable region-linker-heavy chain variable region or heavy chain variable region-linker-light chain variable region.
- the encoded CAR includes a transmembrane domain that comprises a transmembrane domain of a protein selected from the group consisting of the alpha, beta or zeta chain of the T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137 and CD154.
- the encoded transmembrane domain comprises the sequence of SEQ ID NO: 6.
- the encoded transmembrane domain comprises an amino acid sequence comprising at least one, two or three modifications but not more than 20, 10 or 5 modifications of the amino acid sequence of SEQ ID NO:6, or a sequence with 95-99% identity to an amino acid sequence of SEQ ID NO:6.
- the nucleic acid sequence encoding the transmembrane domain comprises the sequence of SEQ ID NO: 17, or a sequence with 95-99% identity thereof.
- the encoded anti-CLL-1 binding domain is connected to the transmembrane domain by a hinge region, e.g., a hinge region described herein.
- the encoded hinge region comprises SEQ ID NO:2, or a sequence with 95-99% identity thereof.
- the nucleic acid sequence encoding the hinge region comprises the sequence of SEQ ID NO: 13, or a sequence with 95-99% identity thereof.
- the isolated nucleic acid molecule further comprises a sequence encoding a costimulatory domain, e.g., a costimulatory domain described herein.
- a costimulatory domain e.g., a costimulatory domain described herein.
- the intracellular signaling domain comprises a costimulatory domain. In embodiments, the intracellular signaling domain comprises a primary signaling domain. In embodiments, the intracellular signaling domain comprises a costimulatory domain and a primary signaling domain. In one embodiment, the encoded costimulatory domain is a functional signaling domain obtained from a protein selected from the group consisting of a MHC class I molecule, TNF receptor proteins, Immunoglobulin-like proteins, cytokine receptors, integrins, signaling lymphocytic activation molecules (SLAM proteins), activating NK cell receptors, BTLA, a Toll ligand receptor, OX40, CD2, CD7, CD27, CD28, CD30, CD40, CDS, ICAM-1, LFA-1
- CDl la/CD18 4-1BB (CD137), B7-H3, CDS, ICAM-1, ICOS (CD278), GITR, BAFFR,
- the encoded co stimulatory domain comprises 4-1BB, CD27, CD28, or ICOS.
- the encoded costimulatory domain of 4- IBB comprises the amino acid sequence of SEQ ID NO:7.
- the encoded costimulatory domain comprises an amino acid sequence having at least one, two or three modifications but not more than 20, 10 or 5 modifications of the amino acid sequence of SEQ ID NO:7, or a sequence with 95-99% identity to the amino acid sequence of SEQ ID NO:7.
- the nucleic acid sequence encoding the costimulatory domain comprises the nucleotide sequence of SEQ ID NO: 18, or a sequence with 95-99% identity thereof.
- the encoded costimulatory domain of CD28 comprises the amino acid sequence of SEQ ID NO:482.
- the encoded costimulatory domain comprises an amino acid sequence having at least one, two or three modifications but not more than 20, 10 or 5 modifications of an amino acid sequence of SEQ ID NO:482, or a sequence with 95-99% identity to an amino acid sequence of SEQ ID NO:482.
- the nucleic acid sequence encoding the costimulatory domain of CD28 comprises the nucleotide sequence of SEQ ID NO:483, or a sequence with 95-99% identity thereof.
- the encoded costimulatory domain of CD27 comprises the amino acid sequence of SEQ ID NO: 8.
- the encoded costimulatory domain comprises an amino acid sequence having at least one, two or three modifications but not more than 20, 10 or 5 modifications of an amino acid sequence of SEQ ID NO:8, or a sequence with 95-99% identity to an amino acid sequence of SEQ ID NO: 8.
- the nucleic acid sequence encoding the costimulatory domain of CD27 comprises the nucleotide sequence of SEQ ID NO: 19, or a sequence with 95-99% identity thereof.
- the encoded costimulatory domain of ICOS comprises the amino acid sequence of SEQ ID NO:484.
- the encoded costimulatory domain comprises an amino acid sequence having at least one, two or three modifications but not more than 20, 10 or 5 modifications of an amino acid sequence of SEQ ID NO:484, or a sequence with 95-99% identity to an amino acid sequence of SEQ ID NO:484.
- the nucleic acid sequence encoding the costimulatory domain of ICOS comprises the nucleotide sequence of SEQ ID NO:485, or a sequence with 95-99% identity thereof.
- the encoded primary signaling domain comprises a functional signaling domain of CD3 zeta.
- the functional signaling domain of CD3 zeta comprises the sequence of SEQ ID NO: 9 (mutant CD3 zeta) or SEQ ID NO: 10 (wild- type human CD3 zeta), or a sequence with 95-99% identity thereof.
- the encoded intracellular signaling domain comprises a functional signaling domain of 4- IBB and/or a functional signaling domain of CD3 zeta.
- the encoded intracellular signaling domain of 4-1BB comprises the amino acid sequence of SEQ ID NO: 7 and/or the CD3 zeta amino acid sequence of SEQ ID NO:9 or SEQ ID NO: 10.
- the intracellular signaling domain comprises an amino acid sequence having at least one, two or three modifications but not more than 20, 10 or 5 modifications of an amino acid sequence of SEQ ID NO:7 and/or an amino acid sequence of SEQ ID NO:9 or SEQ ID NO: 10, or a sequence with 95-99% identity to an amino acid sequence of SEQ ID NO:7 and/or an amino acid sequence of SEQ ID NO:9 or SEQ ID NO:10.
- the encoded intracellular signaling domain comprises the sequence of SEQ ID NO:7 and the sequence of SEQ ID NO:9 or SEQ ID NO: 10, wherein the sequences comprising the intracellular signaling domain are expressed in the same frame and as a single polypeptide chain.
- the nucleic acid sequence encoding the intracellular signaling domain of 4-1BB comprises the nucleotide sequence of SEQ ID NO:18, or a sequence with 95-99% identity thereof, and/or a sequence of SEQ ID NO:20 or SEQ ID NO:21, or the CD3 zeta nucleotide sequence with 95-99% identity thereof.
- the encoded intracellular signaling domain comprises a functional signaling domain of CD27 and/or a functional signaling domain of CD3 zeta.
- the encoded intracellular signaling domain of CD27 comprises the amino acid sequence of SEQ ID NO: 8 and/or the CD3 zeta amino acid sequence of SEQ ID NO:9 or SEQ ID NO: 10.
- the intracellular signaling domain comprises an amino acid sequence having at least one, two or three modifications but not more than 20, 10 or 5 modifications of an amino acid sequence of SEQ ID NO: 8 and/or an amino acid sequence of SEQ ID NO:9 or SEQ ID NO: 10, or a sequence with 95-99% identity to an amino acid sequence of SEQ ID NO:8 and/or an amino acid sequence of SEQ ID NO:9 or SEQ ID NO:10.
- the encoded intracellular signaling domain comprises the sequence of SEQ ID NO:8 and the sequence of SEQ ID NO:9 or SEQ ID NO: 10, wherein the sequences comprising the intracellular signaling domain are expressed in the same frame and as a single polypeptide chain.
- the nucleic acid sequence encoding the intracellular signaling domain of CD27 comprises the nucleotide sequence of SEQ ID NO: 19, or a sequence with 95-99% identity thereof, and/or the CD3 zeta nucleotide sequence of SEQ ID NO:20 or SEQ ID NO:21, or a sequence with 95-99% identity thereof.
- the encoded intracellular signaling domain comprises a functional signaling domain of CD28 and/or a functional signaling domain of CD3 zeta.
- the encoded intracellular signaling domain of CD28 comprises the amino acid sequence of SEQ ID NO: 482 and/or the CD3 zeta amino acid sequence of SEQ ID NO:9 or SEQ ID NO: 10.
- the intracellular signaling domain comprises an amino acid sequence having at least one, two or three modifications but not more than 20, 10 or 5 modifications of an amino acid sequence of SEQ ID NO:482 and/or an amino acid sequence of SEQ ID NO:9 or SEQ ID NO: 10, or a sequence with 95-99% identity to an amino acid sequence of SEQ ID NO:482 and/or an amino acid sequence of SEQ ID NO:9 or SEQ ID NO: 10.
- the encoded intracellular signaling domain comprises the sequence of SEQ ID NO:482 and the sequence of SEQ ID NO:9 or SEQ ID NO: 10, wherein the sequences comprising the intracellular signaling domain are expressed in the same frame and as a single polypeptide chain.
- the nucleic acid sequence encoding the intracellular signaling domain of CD28 comprises the nucleotide sequence of SEQ ID NO:483, or a sequence with 95-99% identity thereof, and/or the CD3 zeta nucleotide sequence of SEQ ID NO:20 or SEQ ID NO:21, or a sequence with 95-99% identity thereof.
- the encoded intracellular signaling domain comprises a functional signaling domain of ICOS and/or a functional signaling domain of CD3 zeta.
- the encoded intracellular signaling domain of ICOS comprises the amino acid sequence of SEQ ID NO: 484 and/or the CD3 zeta amino acid sequence of SEQ ID NO:9 or SEQ ID NO: 10.
- the intracellular signaling domain comprises an amino acid sequence having at least one, two or three modifications but not more than 20, 10 or 5 modifications of an amino acid sequence of SEQ ID NO:484 and/or an amino acid sequence of SEQ ID NO:9 or SEQ ID NO: 10, or a sequence with 95-99% identity to an amino acid sequence of SEQ ID NO:484 and/or an amino acid sequence of SEQ ID NO:9 or SEQ ID NO: 10.
- the encoded intracellular signaling domain comprises the sequence of SEQ ID NO:484 and the sequence of SEQ ID NO:9 or SEQ ID NO: 10, wherein the sequences comprising the intracellular signaling domain are expressed in the same frame and as a single polypeptide chain.
- the nucleic acid sequence encoding the intracellular signaling domain of ICOS comprises the nucleotide sequence of SEQ ID NO:485, or a sequence with 95-99% identity thereof, and/or the CD3 zeta nucleotide sequence of SEQ ID NO:20 or SEQ ID NO:21, or a sequence with 95-99% identity thereof.
- the isolated CAR molecule further comprises a leader sequence, e.g., a leader sequence described herein.
- the leader sequence comprises an amino acid sequence of SEQ ID NO: 1, or a sequence with 95-99% identity to an amino acid sequence of SEQ ID NO:l.
- the invention pertains to an isolated nucleic acid molecule encoding a CAR construct comprising a leader sequence, e.g., a leader sequence described herein, e.g., the amino acid sequence of SEQ ID NO: 1, an anti-CLL-1 binding domain described herein, e.g., human anti-CLL-1 binding domain comprising a LC CDR1, a LC CDR2, a LC CDR3, a HC CDR1, a HC CDR2 and a HC CDR3 described herein, e.g., a human anti-CLL-1 binding domain described in Table 2, or a sequence with 95-99% identify thereof, a hinge region described herein, e.g., the amino acid sequence of SEQ ID NO:2, a transmembrane domain described herein, e.g., having a sequence of SEQ ID NO: 6, and an intracellular signaling domain, e.g., an intracellular signaling domain described herein.
- a leader sequence e.g.
- the encoded intracellular signaling domain comprises a costimulatory domain, e.g., a costimulatory domain described herein (e.g., a 4-1BB costimulatory domain having the amino acid sequence of SEQ ID NO:7, a CD28 costimulatory domain having the amino acid sequence of SEQ ID NO: 482, or an ICOS costimulatory domain having the amino acid sequence of SEQ ID NO: 484, or a CD27 costimulatory domain having the amino acid sequence of SEQ ID NO: 8), and/or a primary signaling domain, e.g., a primary signaling domain described herein, (e.g., a CD3 zeta stimulatory domain having a sequence of SEQ ID NO:9 or SEQ ID NO: 10).
- a costimulatory domain described herein e.g., a 4-1BB costimulatory domain having the amino acid sequence of SEQ ID NO:7, a CD28 costimulatory domain having the amino acid sequence of SEQ ID NO: 48
- the isolated nucleic acid molecule encoding the CAR construct includes a human anti-CLL-1 binding domain sequence encoded by the nucleic acid sequence of SEQ ID NO:52, SEQ ID NO:53, SEQ ID NO:54, SEQ ID NO:55, SEQ ID NO:56, SEQ ID NO:57, SEQ ID NO:58, SEQ ID NO:59, SEQ ID NO:60, SEQ ID N0:61, SEQ ID NO:62, SEQ ID NO:63, and SEQ ID NO:64, or a sequence with 95-99% identity thereto.
- the isolated nucleic acid molecule comprises (e.g., consists of) a nucleic acid encoding a CAR amino acid sequence of SEQ ID NO: 91, SEQ ID NO: 92, SEQ ID NO: 93, SEQ ID NO: 94, SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97, SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO:103, or SEQ ID NO: 197; or an amino acid sequence having one, two or three modifications (e.g., substitutions, e.g., conservative substitutions) but not more than 30, 20, or 10 modifications of an amino acid sequence of SEQ ID NO: 91, SEQ ID NO: 92, SEQ ID NO: 93, SEQ ID NO: 94, SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97, SEQ ID NO:
- the isolated nucleic acid molecule comprises (e.g., consists of) a nucleic acid sequence of SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO:
- the invention pertains to an isolated nucleic acid molecule encoding an anti-CLL-1 binding domain, wherein the anti-CLL-1 binding domain comprises one or more (e.g., all three) light chain complementary determining region 1 (LC CDR1), light chain complementary determining region 2 (LC CDR2), and light chain complementary determining region 3 (LC CDR3) of an anti-CLL-1 binding domain described herein, and/or one or more (e.g., all three) heavy chain complementary determining region 1 (HC CDR1), heavy chain complementary determining region 2 (HC CDR2), and heavy chain complementary
- LC CDR1 light chain complementary determining region 1
- HC CDR2 heavy chain complementary determining region 2
- HC CDR3 heavy chain complementary determining region 3
- determining region 3 of an anti-CLL-1 binding domain described herein, e.g., a human anti-CLL-1 binding domain comprising one or more, e.g., all three, LC CDRs and one or more, e.g., all three, HC CDRs.
- the CLL-1 binding domain comprises a HC CDRl, a HC CDR2, and a HC CDR3 of any CLL-1 heavy chain binding domain amino acid sequences listed in Table 2.
- the CLL-1 binding domain further comprises a LC CDRl, a LC
- the CLL-1 binding domain comprises a LC CDRl, a LC CDR2, and a LC CDR3) ⁇ of any CLL-1 light chain binding domain amino acid sequences listed in Table 2.
- the CLL-1 binding domain comprises one, two or all of LC CDRl, LC CDR2, and LC CDR3 of any CLL-1 light chain binding domain amino acid sequences listed in Table 2, and one, two or all of HC CDRl, HC CDR2, and HC CDR3 of any CLL-1 heavy chain binding domain amino acid sequences listed in Table 2.
- the encoded anti-CLL-1 binding domain comprises a light chain variable region described herein (e.g., in SEQ ID NO:78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, or 196) and/or a heavy chain variable region described herein (e.g., in SEQ ID NO:65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, or 195).
- a light chain variable region described herein e.g., in SEQ ID NO:78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, or 196
- a heavy chain variable region described herein e.g., in SEQ ID NO:65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, or
- the encoded anti- CLL-1 binding domain is a scFv comprising a light chain and a heavy chain of an amino acid sequence of in SEQ ID NO:39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, or 51.
- the anti-CLL-1 binding domain (e.g., an scFv) comprises: a light chain variable region comprising an amino acid sequence having at least one, two or three modifications (e.g., substitutions, e.g., conservative substitutions) but not more than 30, 20 or 10 modifications (e.g., substitutions, e.g., conservative substitutions) of an amino acid sequence of a light chain variable region provided in SEQ ID NO: 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, or 196, or a sequence with 95-99% identity with an amino acid sequence of SEQ ID NO: 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, or 196; and/or a heavy chain variable region comprising an amino acid sequence having at least one, two or three modifications (e.g., substitutions, e.g., conservative substitutions)
- the anti-CLL-1 binding domain comprises a sequence selected from a group consisting of SEQ ID NO: 39, SEQ ID NO:40, SEQ ID NO:41, SEQ ID NO:42, SEQ ID NO:43, SEQ ID NO:44, SEQ ID NO:45, SEQ ID NO:46, SEQ ID NO:47, SEQ ID NO:48, SEQ ID NO:49, SEQ ID NO:50, and SEQ ID NO:51, or a sequence with 95-99% identify thereof.
- the encoded anti- CLL-1 binding domain is a scFv, and a light chain variable region comprising an amino acid sequence described herein, e.g., in Table 2, is attached to a heavy chain variable region comprising an amino acid sequence described herein, e.g., in Table 2, via a linker, e.g., a linker described herein.
- the encoded anti-CLL-1 binding domain includes a (Gly 4 -Ser)n linker, wherein n is 1, 2, 3, 4, 5, or 6, preferably 4 (SEQ ID NO: 26).
- the light chain variable region and heavy chain variable region of a scFv can be, e.g., in any of the following orientations: light chain variable region-linker-heavy chain variable region or heavy chain variable region-linker-light chain variable region.
- the isolated nucleic acid sequence encoding the human anti-CLL-1 binding domain comprises a sequence selected from a group consisting of SEQ ID NO:52, SEQ ID NO:53, SEQ ID NO:54, SEQ ID NO:55, SEQ ID NO:56, SEQ ID NO:57, SEQ ID NO:58, SEQ ID NO:59, SEQ ID NO:60, SEQ ID NO:61, SEQ ID NO:62, SEQ ID NO:63, and SEQ ID NO:64, or a sequence with 95- 99% identity thereof.
- the invention pertains to an isolated CAR (e.g., a polypeptide) molecule encoded by the nucleic acid molecule.
- the isolated CAR molecule comprises a sequence selected from the group consisting of SEQ ID NO:91, SEQ ID NO:92, SEQ ID NO:93, SEQ ID NO:94, SEQ ID NO:95, SEQ ID NO:96, SEQ ID NO:97, SEQ ID NO:98, SEQ ID NO:99, SEQ ID NO:100, SEQ ID NO:101, SEQ ID NO:102, SEQ ID NO: 103, and SEQ ID NO: 197 or a sequence with 95-99% identify thereof.
- the invention pertains to an isolated chimeric antigen receptor (CAR) molecule (e.g., polypeptide) comprising an anti-CLL-1 binding domain (e.g., a human antibody or antibody fragment that specifically binds to CLL-1), a transmembrane domain, and an intracellular signaling domain (e.g., an intracellular signaling domain comprising a CAR molecule
- CAR chimeric antigen receptor
- the CAR comprises an antibody or antibody fragment which includes an anti-CLL-1 binding domain described herein (e.g., a human antibody or antibody fragment that specifically binds to CLL-1 as described herein), a transmembrane domain described herein, and an intracellular signaling domain described herein (e.g., an intracellular signaling domain comprising a costimulatory domain and/or a primary signaling domain described herein).
- an anti-CLL-1 binding domain described herein e.g., a human antibody or antibody fragment that specifically binds to CLL-1 as described herein
- a transmembrane domain described herein e.g., a transmembrane domain described herein
- an intracellular signaling domain described herein e.g., an intracellular signaling domain comprising a costimulatory domain and/or a primary signaling domain described herein.
- the anti-CLL-1 binding domain comprises one or more (e.g., all three) light chain complementary determining region 1 (LC CDRl), light chain complementary determining region 2 (LC CDR2), and light chain complementary determining region 3 (LC CDR3) of an anti-CLL-1 binding domain described herein, and/or one or more (e.g., all three) heavy chain complementary determining region 1 (HC CDRl), heavy chain complementary determining region 2 (HC CDR2), and heavy chain complementary determining region 3 (HC CDR3) of an anti-CLL-1 binding domain described herein, e.g., a human anti-CLL-1 binding domain comprising one or more, e.g., all three, LC CDRs and one or more, e.g., all three, HC CDRs.
- LC CDRl light chain complementary determining region 1
- HC CDR2 light chain complementary determining region 2
- HC CDR3 light chain complementary determining region 3
- the anti-CLL-1 binding domain comprises a light chain variable region described herein (e.g., in Table 2) and/or a heavy chain variable region described herein (e.g., in Table 2).
- the anti-CLL-1 binding domain is a scFv comprising a light chain and a heavy chain of an amino acid sequence listed in Table 2.
- the anti-CLL-1 binding domain (e.g., an scFv) comprises: a light chain variable region comprising an amino acid sequence having at least one, two or three modifications (e.g., substitutions, e.g., conservative substitutions) but not more than 30, 20 or 10 modifications (e.g., substitutions, e.g., conservative substitutions) of an amino acid sequence of a light chain variable region provided in Table 2, or a sequence with 95-99% identity with an amino acid sequence provided in Table 2; and/or a heavy chain variable region comprising an amino acid sequence having at least one, two or three modifications (e.g., substitutions, e.g., conservative substitutions) but not more than 30, 20 or 10 modifications (e.g., substitutions, e.g., conservative substitutions) of an amino acid sequence of a heavy chain variable region provided in Table 2, or a sequence with 95-99% identity to an amino acid sequence provided in Table 2.
- a light chain variable region comprising an amino acid sequence having at least one, two or three modifications
- the encoded CLL-1 binding domain comprises a HC CDRl, a HC CDR2, and a HC CDR3 of any CLL-1 heavy chain binding domain amino acid sequences listed in Table 2.
- the CLL-1 binding domain further comprises a LC CDRl, a LC CDR2, and a LC CDR3.
- the CLL-1 binding domain comprises a LC CDRl, a LC CDR2, and a LC CDR3 of any CLL-1 light chain binding domain amino acid sequences listed in Table 2.
- the encoded CLL-1 binding domain comprises one, two or all of LC CDR1, LC CDR2, and LC CDR3 of any CLL-1 light chain binding domain amino acid sequences listed in Table 2, and one, two or all of HC CDR1, HC CDR2, and HC CDR3 of any CLL-1 heavy chain binding domain amino acid sequences listed in Table 2.
- the anti-CLL-1 binding domain comprises a sequence selected from a group consisting of SEQ ID NO:39, SEQ ID NO:40, SEQ ID NO:41, SEQ ID NO:42, SEQ ID NO:43, SEQ ID NO:44, SEQ ID NO:45, SEQ ID NO:46, SEQ ID NO:47, SEQ ID NO:48, SEQ ID NO:49, SEQ ID NO:50, SEQ ID NO:51, SEQ ID NO: 65-90, or SEQ ID NO: 195-196, or an amino acid sequence having at least one, two or three modifications (e.g., substitutions, e.g., conservative substitutions) but not more than 30, 20 or 10 modifications (e.g., substitutions, e.g., conservative substitutions) to any of the aforesaid sequences; or a sequence with 95-99% identify thereof.
- modifications e.g., substitutions, e.g., conservative substitutions
- substitutions e.g., conservative substitutions
- the anti-CLL-1 binding domain is a scFv, and a light chain variable region comprising an amino acid sequence described herein, e.g., in Table 2, is attached to a heavy chain variable region comprising an amino acid sequence described herein, e.g., in Table 2, via a linker, e.g., a linker described herein.
- a linker e.g., a linker described herein.
- the anti-CLL-1 binding domain includes a (Gly 4 -Ser)n linker, wherein n is 1, 2, 3, 4, 5, or 6, preferably 4 (SEQ ID NO: 26).
- the light chain variable region and heavy chain variable region of a scFv can be, e.g., in any of the following orientations: light chain variable region-linker-heavy chain variable region or heavy chain variable region-linker- light chain variable region.
- the isolated CAR molecule comprises a transmembrane domain of a protein selected from the group consisting of the alpha, beta or zeta chain of the T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD 134, CD 137 and CD 154.
- the transmembrane domain comprises a sequence of SEQ ID NO: 6.
- the transmembrane domain comprises an amino acid sequence having at least one, two or three modifications (e.g., substitutions, e.g., conservative substitutions) but not more than 20, 10 or 5 modifications (e.g., substitutions, e.g., conservative substitutions) of an amino acid sequence of SEQ ID NO: 6, or a sequence with 95-99% identity to an amino acid sequence of SEQ ID NO: 6.
- the anti-CLL-1 binding domain is connected to the transmembrane domain by a hinge region, e.g., a hinge region described herein.
- the encoded hinge region comprises SEQ ID NO:2, or a sequence with 95-99% identity thereof.
- the intracellular signaling domain of the isolated CAR molecule comprises a costimulatory domain. In embodiments, the intracellular signaling domain of the isolated CAR molecule comprises a primary signaling domain. In embodiments, the intracellular signaling domain of the isolated CAR molecule comprises a costimulatory domain and a primary signaling domain. In one embodiment, the isolated CAR molecule further comprises a sequence encoding a costimulatory domain, e.g., a costimulatory domain described herein.
- the costimulatory domain comprises a functional signaling domain of a protein selected from the group consisting of a MHC class I molecule, TNF receptor proteins, Immunoglobulin-like proteins, cytokine receptors, integrins, signaling lymphocytic activation molecules (SLAM proteins), activating NK cell receptors, BTLA, a Toll ligand receptor, OX40, CD2, CD7, CD27, CD28, CD30, CD40, CDS, ICAM-1, LFA-1
- a functional signaling domain of a protein selected from the group consisting of a MHC class I molecule, TNF receptor proteins, Immunoglobulin-like proteins, cytokine receptors, integrins, signaling lymphocytic activation molecules (SLAM proteins), activating NK cell receptors, BTLA, a Toll ligand receptor, OX40, CD2, CD7, CD27, CD28, CD30, CD40, CDS, ICAM-1, LFA-1
- CDl la/CD18 4-lBB (CD137), B7-H3, CDS, ICAM-1, ICOS (CD278), GITR, BAFFR, LIGHT, HVEM (LIGHTR), KIRDS2, SLAMF7, NKp80 (KLRF1), NKp44, NKp30, NKp46, CD19, CD4, CD8alpha, CD8beta, IL2R beta, IL2R gamma, IL7R alpha, ITGA4, VLA1, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CDl ld, ITGAE, CD103, ITGAL, CDl la, LFA-1, ITGAM, CDl lb, ITGAX, CDl lc, ITGB1, CD29, ITGB2, CD18, LFA-1, ITGB7, NKG2D, NKG2C, TNFR2, TRANCE/RANKL, DNAM1 (CD226),
- the costimulatory domain of 4-lBB comprises the amino acid sequence of SEQ ID NO:7.
- the costimulatory domain comprises an amino acid sequence having at least one, two or three modifications (e.g., substitutions, e.g., conservative substitutions) but not more than 20, 10 or 5 modifications (e.g., substitutions, e.g., conservative substitutions) of an amino acid sequence of SEQ ID NO:7, or a sequence with 95-99% identity to an amino acid sequence of SEQ ID NO:7.
- the costimulatory domain of CD28 comprises the amino acid sequence of SEQ ID NO:482.
- the costimulatory domain comprises an amino acid sequence having at least one, two or three modifications but not more than 20, 10 or 5 modifications of an amino acid sequence of SEQ ID NO:482, or a sequence with 95-99% identity to an amino acid sequence of SEQ ID NO:482.
- the costimulatory domain of CD27 comprises the amino acid sequence of SEQ ID NO: 8.
- the costimulatory domain comprises an amino acid sequence having at least one, two or three modifications but not more than 20, 10 or 5 modifications of an amino acid sequence of SEQ ID NO:8, or a sequence with 95-99% identity to an amino acid sequence of SEQ ID NO: 8.
- the costimulatory domain of ICOS comprises the amino acid sequence of SEQ ID NO:484.
- the costimulatory domain comprises an amino acid sequence having at least one, two or three modifications but not more than 20, 10 or 5 modifications of an amino acid sequence of SEQ ID NO:484, or a sequence with 95-99% identity to an amino acid sequence of SEQ ID NO:484.
- the primary signaling domain comprises a functional signaling domain of CD3 zeta.
- the functional signaling domain of CD3 zeta comprises the amino acid sequence of SEQ ID NO: 9 (mutant CD3 zeta) or SEQ ID NO: 10 (wild type human CD3 zeta), or a sequence with 95-99% identity thereof.
- the intracellular signaling domain comprises a functional signaling domain of 4- IBB and/or a functional signaling domain of CD3 zeta. In one embodiment, the intracellular signaling domain comprises the sequence of SEQ ID NO: 7 and/or the sequence of SEQ ID NO:9 or SEQ ID NO: 10.
- the intracellular signaling domain comprises an amino acid sequence having at least one, two or three modifications (e.g., substitutions, e.g., conservative substitutions) but not more than 20, 10 or 5 modifications (e.g., substitutions, eg., conservative substitutions) of an amino acid sequence of SEQ ID NO: 7 and/or the sequence of SEQ ID NO:9 or SEQ ID NO: 10., or a sequence with 95-99% identity to an amino acid sequence of SEQ ID NO: 7 and/or the sequence of SEQ ID NO:9 or SEQ ID NO: 10..
- the intracellular signaling domain comprises the sequence of SEQ ID NO: 7 and/or the sequence of SEQ ID NO:9 or SEQ ID NO: 10, wherein the sequences comprising the intracellular signaling domain are expressed in the same frame and as a single polypeptide chain.
- the intracellular signaling domain comprises a functional signaling domain of CD27 and/or a functional signaling domain of CD3 zeta.
- the intracellular signaling domain of CD27 comprises the amino acid sequence of SEQ ID NO: 8 and/or the CD3 zeta amino acid sequence of SEQ ID NO:9 or SEQ ID NO: 10.
- the intracellular signaling domain comprises an amino acid sequence having at least one, two or three modifications but not more than 20, 10 or 5 modifications of an amino acid sequence of SEQ ID NO:8 and/or an amino acid sequence of SEQ ID NO:9 or SEQ ID NO: 10, or a sequence with 95-99% identity to an amino acid sequence of SEQ ID NO:8 and/or an amino acid sequence of SEQ ID NO:9 or SEQ ID NO: 10.
- the intracellular signaling domain comprises the sequence of SEQ ID NO: 8 and the sequence of SEQ ID NO:9 or SEQ ID NO: 10, wherein the sequences comprising the intracellular signaling domain are expressed in the same frame and as a single polypeptide chain.
- the intracellular signaling domain comprises a functional signaling domain of CD28 and/or a functional signaling domain of CD3 zeta.
- the encoded intracellular signaling domain of CD28 comprises the amino acid sequence of SEQ ID NO: 482 and/or the CD3 zeta amino acid sequence of SEQ ID NO:9 or SEQ ID NO: 10.
- the intracellular signaling domain comprises an amino acid sequence having at least one, two or three modifications but not more than 20, 10 or 5 modifications of an amino acid sequence of SEQ ID NO: 482 and/or an amino acid sequence of SEQ ID NO:9 or SEQ ID NO: 10, or a sequence with 95-99% identity to an amino acid sequence of SEQ ID NO: 482 and/or an amino acid sequence of SEQ ID NO:9 or SEQ ID NO: 10.
- the intracellular signaling domain comprises the sequence of SEQ ID NO: 482 and the sequence of SEQ ID NO:9 or SEQ ID NO: 10, wherein the sequences comprising the intracellular signaling domain are expressed in the same frame and as a single polypeptide chain.
- the intracellular signaling domain comprises a functional signaling domain of ICOS and/or a functional signaling domain of CD3 zeta.
- the encoded intracellular signaling domain of ICOS comprises the amino acid sequence of SEQ ID NO: 484 and/or the CD3 zeta amino acid sequence of SEQ ID NO:9 or SEQ ID NO: 10.
- the intracellular signaling domain comprises an amino acid sequence having at least one, two or three modifications but not more than 20, 10 or 5 modifications of an amino acid sequence of SEQ ID NO: 484 and/or an amino acid sequence of SEQ ID NO:9 or SEQ ID NO: 10, or a sequence with 95-99% identity to an amino acid sequence of SEQ ID NO: 482 and/or an amino acid sequence of SEQ ID NO:9 or SEQ ID NO: 10.
- the intracellular signaling domain comprises the sequence of SEQ ID NO: 484 and the sequence of SEQ ID NO:9 or SEQ ID NO: 10, wherein the sequences comprising the intracellular signaling domain are expressed in the same frame and as a single polypeptide chain.
- the isolated CAR molecule further comprises a leader sequence, e.g., a leader sequence described herein.
- the leader sequence comprises an amino acid sequence of SEQ ID NO: 1, or a sequence with 95-99% identity to an amino acid sequence of SEQ ID NO:l.
- the invention pertains to an isolated CAR molecule comprising a leader sequence, e.g., a leader sequence described herein, e.g., a leader sequence of SEQ ID NO: 1, or having 95-99% identity thereof, an anti-CLL-1 binding domain described herein, e.g., an anti-CLL-1 binding domain comprising a LC CDR1, a LC CDR2, a LC CDR3, a HC CDR1, a HC CDR2 and a HC CDR3 described herein, e.g., an anti-CLL-1 binding domain described in Table 2, or a sequence with 95-99% identify thereof, a hinge region, e.g., a hinge region described herein, e.g., a hinge region of SEQ ID NO:2, or having 95-99% identity thereof, a transmembrane domain, e.g., a transmembrane domain described herein, e.g., a transmembrane domain having a sequence of
- the intracellular signaling domain comprises a costimulatory domain, e.g., a costimulatory domain described herein, e.g., a 4-1BB costimulatory domain having a sequence of SEQ ID NO:7, or having 95-99% identity thereof, and/or a primary signaling domain, e.g., a primary signaling domain described herein, e.g., a CD3 zeta stimulatory domain having a sequence of SEQ ID NO:9 or SEQ ID NO: 10, or having 95-99% identity thereof.
- the intracellular signaling domain comprises a costimulatory domain, e.g., a costimulatory domain described herein, e.g., a 4-1BB
- costimulatory domain having a sequence of SEQ ID NO:7, and/or a primary signaling domain, e.g., a primary signaling domain described herein, e.g., a CD3 zeta stimulatory domain having a sequence of SEQ ID NO:9 or SEQ ID NO: 10.
- the isolated CAR molecule comprises (e.g., consists of) an amino acid sequence of SEQ ID NO:91, SEQ ID NO:92, SEQ ID NO:93, SEQ ID NO:94, SEQ ID NO:95, SEQ ID NO:96, SEQ ID NO:97, SEQ ID NO:98, SEQ ID NO:99, SEQ ID NO: 100, SEQ ID NO:101, SEQ ID NO:102, SEQ ID NO: 103, or SEQ ID NO:197, or an amino acid sequence having at least one, two, three, four, five, 10, 15, 20 or 30 modifications (e.g., substitutions, e.g., conservative substitutions) but not more than 60, 50 or 40 modifications (e.g., substitutions, e.g., conservative substitutions) of an amino acid sequence of SEQ ID NO:91, SEQ ID NO:92, SEQ ID NO:93, SEQ ID NO:94, SEQ ID NO:95, SEQ ID NO:96, SEQ ID NO:97, SEQ
- the invention pertains to an anti-CLL-1 binding domain comprising one or more (e.g., all three) light chain complementary determining region 1 (LC CDRl), light chain complementary determining region 2 (LC CDR2), and light chain complementary determining region 3 (LC CDR3) of an anti-CLL-1 binding domain described herein, and/or one or more (e.g., all three) heavy chain complementary determining region 1 (HC CDRl), heavy chain complementary determining region 2 (HC CDR2), and heavy chain
- HC CDR3 complementary determining region 3 of an anti-CLL-1 binding domain described herein, e.g., a human anti-CLL-1 binding domain comprising one or more, e.g., all three, LC CDRs and one or more, e.g., all three, HC CDRs.
- the encoded CLL-1 binding domain comprises a HC CDRl, a
- the CLL-1 binding domain further comprises a LC CDRl, a LC CDR2, and a LC CDR3.
- the CLL-1 binding domain comprises a LC CDRl, a LC CDR2, and a LC CDR3 of any CLL-1 light chain binding domain amino acid sequences listed in Table 2.
- the encoded CLL-1 binding domain comprises one, two or all of LC CDRl, LC CDR2, and LC CDR3 of any CLL-1 light chain binding domain amino acid sequences listed in Table 2, and one, two or all of HC CDRl, HC CDR2, and HC CDR3 of any CLL-1 heavy chain binding domain amino acid sequences listed in Table 2.
- the anti-CLL-1 binding domain comprises a light chain variable region described herein (e.g., in SEQ ID NO: 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, or 196) and/or a heavy chain variable region described herein (e.g.
- the anti-CLL-1 binding domain is a scFv comprising a light chain and a heavy chain of an amino acid sequence of SEQ ID NO:39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, or 51.
- the anti-CLL-1 binding domain (e.g., an scFv) comprises: a light chain variable region comprising an amino acid sequence having at least one, two or three modifications (e.g., substitutions, e.g., conservative substitutions) but not more than 30, 20 or 10 modifications (e.g., substitutions, e.g., conservative substitutions) of an amino acid sequence of a light chain variable region provided, in SEQ ID NO: 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, or 196 or a sequence with 95-99% identity with an amino acid sequence in SEQ ID NO: 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, or 196; and/or a heavy chain variable region comprising an amino acid sequence having at least one, two or three modifications (e.g., substitutions, e.g., conservative substitutions)
- the anti-CLL-1 binding domain comprises a sequence selected from a group consisting of SEQ ID NO:39, SEQ ID NO:40, SEQ ID NO:41, SEQ ID NO:42, SEQ ID NO:43, SEQ ID NO:44, SEQ ID NO:45, SEQ ID NO:46, SEQ ID NO:47, SEQ ID NO:48, SEQ ID NO:49, SEQ ID NO:50, or SEQ ID NO:51 or a sequence with 95-99% identify thereof.
- the anti-CLL-1 binding domain is a scFv, and a light chain variable region comprising an amino acid sequence described herein, e.g., in Table 2, is attached to a heavy chain variable region comprising an amino acid sequence described herein, e.g., in Table 2, via a linker, e.g., a linker described herein.
- the anti-CLL-1 binding domain includes a (Gly 4 -Ser)n linker, wherein n is 1, 2, 3, 4, 5, or 6, preferably 4 (SEQ ID NO: 26).
- the light chain variable region and heavy chain variable region of a scFv can be, e.g., in any of the following orientations: light chain variable region-linker- heavy chain variable region or heavy chain variable region-linker-light chain variable region.
- the invention pertains to a vector comprising a nucleic acid molecule described herein, e.g., a nucleic acid molecule encoding a CAR described herein.
- the vector is selected from the group consisting of a DNA, a RNA, a plasmid, a lentivirus vector, adenoviral vector, or a retrovirus vector.
- the vector is a lentivirus vector.
- the vector further comprises a promoter.
- the promoter is an EF-1 promoter.
- the EF-1 promoter comprises a sequence of SEQ ID NO: 11.
- the promoter is a PGK promoter, e.g., a truncated PGK promoter as described herein.
- the vector is an in vitro transcribed vector, e.g., a vector that transcribes RNA of a nucleic acid molecule described herein.
- the nucleic acid sequence in the vector further comprises a poly(A) tail, e.g., a poly A tail described herein, e.g., comprising about 150 adenosine bases (SEQ ID NO:312).
- the nucleic acid sequence in the vector further comprises a 3'UTR, e.g., a 3' UTR described herein, e.g., comprising at least one repeat of a 3'UTR derived from human beta-globulin.
- the nucleic acid sequence in the vector further comprises promoter, e.g., a T2A promoter.
- the invention pertains to a cell comprising a vector described herein.
- the cell is a cell described herein, e.g., an immune effector cell, e.g., a human T cell, e.g., a human T cell described herein; or a human NK cell, e.g., a human NK cell described herein.
- the human T cell is a CD8+ T cell.
- the CAR-expressing cell described herein can further express another agent, e.g., an agent which enhances the activity of a CAR-expressing cell.
- the agent can be an agent which inhibits an inhibitory molecule.
- inhibitory molecules include PD1, PD-L1, PD-L2, CTLA4, TIM3, CEACAM (e.g., CEACAM- 1, CEACAM-3 and/or CEACAM-5), LAG3, VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4, CD80, CD86, B7-H3 (CD276), B7-H4 (VTCN1), HVEM (TNFRSF14 or CD270), KIR, A2aR, MHC class I, MHC class II, GAL9, adenosine, and TGFR beta.
- the agent which inhibits an inhibitory molecule comprises a first polypeptide, e.g., an inhibitory molecule, associated with a second polypeptide that provides a positive signal to the cell, e.g., an intracellular signaling domain described herein.
- the agent comprises a first polypeptide, e.g., of an inhibitory molecule such as PD1, PD-L1, PD-L2, CTLA4, TIM3, CEACAM (e.g., CEACAM-1, CEACAM-3 and/or CEACAM-5), LAG3, VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4, CD80, CD86, B7-H3 (CD276), B7-H4 (VTCN1), HVEM (TNFRSF14 or CD270), KIR, A2aR, MHC class I, MHC class II, GAL9, adenosine, and TGFR beta, or a fragment of any of these (e.g., at least a portion of the extracellular domain of any of these), and a second polypeptide which is an intracellular signaling domain described herein (e.g., comprising a costimulatory domain (e.g., 41BB, CD27 or CD28, e.g., as described
- the agent comprises a first polypeptide of PD1 or a fragment thereof (e.g., at least a portion of the extracellular domain of PD1), and a second polypeptide of an intracellular signaling domain described herein (e.g., a CD28 signaling domain described herein and/or a CD3 zeta signaling domain described herein).
- a first polypeptide of PD1 or a fragment thereof e.g., at least a portion of the extracellular domain of PD1
- a second polypeptide of an intracellular signaling domain described herein e.g., a CD28 signaling domain described herein and/or a CD3 zeta signaling domain described herein.
- the invention pertains to a method of making a cell comprising transducing a cell described herein, e.g., an immune effector cell described herein, e.g., a T cell or a NK cell described herein, with a vector of comprising a nucleic acid encoding a CAR, e.g., a CAR described herein.
- the present invention also provides a method of generating a population of RNA- engineered cells, e.g., cells described herein, e.g., immune effector cells, e.g., T cells or NK cells, transiently expressing exogenous RNA.
- the method comprises introducing an in vitro transcribed RNA or synthetic RNA into a cell, where the RNA comprises a nucleic acid encoding a CAR molecule described herein.
- the invention pertains to a method of providing an anti-tumor immunity in a mammal comprising administering to the mammal an effective amount of a cell expressing a CAR molecule, e.g., a cell expressing a CAR molecule described herein.
- the cell is an autologous immune effector cell, e.g., T cell.
- the cell is an allogeneic immune effector cell, e.g., T cell.
- the mammal is a human, e.g., a patient with a hematologic cancer.
- the invention pertains to a method of treating a mammal having a disease associated with expression of CLL-1 (e.g., a proliferative disease, a precancerous condition, and a noncancer related indication associated with the expression of CLL-1) comprising administering to the mammal an effective amount of the cells expressing a CAR molecule, e.g., a CAR molecule described herein.
- the mammal is a human, e.g., a patient with a hematologic cancer.
- the disease is a disease described herein.
- the disease associated with CLL-1 expression is selected from a hematologic cancer such as acute leukemias including but not limited to acute myeloid leukemia (AML); myelodysplastic syndrome; myeloproliferative neoplasms; chronic myeloid leukemia (CML); Blastic plasmacytoid dendritic cell neoplasm; and to disease associated with CLL-1 expression including, but not limited to atypical and/or non-classical cancers, malignancies, precancerous conditions or proliferative diseases expressing CLL-1; and combinations thereof.
- AML acute myeloid leukemia
- CML chronic myeloid leukemia
- Blastic plasmacytoid dendritic cell neoplasm Blastic plasmacytoid dendritic cell neoplasm
- the disease associated with CLL-1 expression is a hematologic cancer selected from the group consisting of one or more acute leukemias including but not limited to acute myelogenous leukemia (or acute myeloid leukemia, AML); chronic myelogenous leukemia (or chronic myeloid leukemia, CML): acute lymphoid leukemia (or acute lymphoblastic leukemia, ALL); chronic lymphoid leukemia (or chronic lymphocytic leukemia, CLL) and
- BALL B-cell acute lymphoid leukemia
- TALL T-cell acute lymphoid leukemia
- ALL acute lymphoid leukemia
- ALL one or more chronic leukemias including but not limited to chronic myelogenous leukemia (CML), chronic lymphocytic leukemia (CLL);
- additional hematologic cancers or hematologic conditions including, but not limited to B cell prolymphocytic leukemia, blastic plasmacytoid dendritic cell neoplasm, lymphomas including but not limited to multiple myeloma; non-Hodgkin's lymphoma; Burkitt's lymphoma; small cell-follicular lymphoma; and large cell-follicular lymphomaBurkitt's lymphoma, diffuse large B cell lymphoma, follicular lymphoma, hairy cell leukemia, small cell- or a large cell-follicular lymphoma, malignant lymphoproliferative conditions, MALT lymphoma, mantle cell lymphoma, Marginal zone lymphoma, multiple myeloma, myelodysplasia and myelodysplastic syndrome, Hodgkin's lymphoma, plasmablastic lymphoma, plasmacytoid dendritic cell neoplasm
- the invention pertains to a method of conditioning a subject prior to cell transplantation comprising administering to the subject an effective amount of the cell of comprising a CAR molecule disclosed herein.
- the cell transplantation is a stem cell transplantation.
- the stem cell transplantation is a hematopoietic stem cell stransplantation or a bone marrow transplantation.
- the cell transplantation is allogeneic or autologous.
- the conditioning a subject prior to cell transplantation comprises reducing the number of CLL-1 -expressing cells in a subject.
- the CLL-1 -expressing cells in the subject are CLL-1 -expressing normal cells or CLL-1 -expressing cancer cells, and in some cases, the condition in the subject will reduce both CLL-1 -expressing normal and cancer cells prior to a cell transplantation.
- the cells expressing a CAR molecule are administered in combination with an agent that increases the efficacy of a cell expressing a CAR molecule, e.g., an agent described herein.
- the cells expressing a CAR molecule are administered in combination with a low, immune enhancing dose of an mTOR inhibitor.
- a low, immune enhancing, dose e.g., a dose that is insufficient to completely suppress the immune system but sufficient to improve immune function
- treatment with a low, immune enhancing, dose is accompanied by a decrease in PD-1 positive T cells or an increase in PD-1 negative cells.
- PD-1 positive T cells, but not PD-1 negative T cells can be exhausted by engagement with cells which express a PD-1 ligand, e.g., PD-L1 or PD-L2.
- this approach can be used to optimize the performance of CAR cells described herein in the subject. While not wishing to be bound by theory, it is believed that, in an embodiment, the performance of endogenous, non-modified immune effector cells, e.g., T cells, is improved. While not wishing to be bound by theory, it is believed that, in an embodiment, the performance of of a CLL-1 CAR expressing cell is improved.
- cells e.g., T cells, which have, or will be that expresses a CAR
- cells can be treated ex vivo by contact with an amount of an mTOR inhibitor that increases the number of PD1 negative immune effector cells, e.g., T cells or increases the ratio of PD1 negative immune effector cells, e.g., T cells/ PD1 positive immune effector cells, e.g., T cells.
- administering is initiated prior to administration of an CAR expressing cell described herein, e.g., T cells.
- an mTOR inhibitor e.g., an allosteric inhibitor, e.g., RAD001, or a catalytic inhibitor
- the CAR cells are administered after a sufficient time, or sufficient dosing, of an mTOR inhibitor, such that the level of PDl negative immune effector cells, e.g., T cells, or the ratio of PDl negative immune effector cells, e.g., T cells/ PDl positive immune effector cells, e.g., T cells, has been, at least transiently, increased.
- the invention provides an mTOR inhibitor for use in the treatment of a subject, wherein said mTOR inhibitor enhances an immune response of said subject, and wherein said subject has received, is receiving or is about to receive an immune effector cell that expresses a CLL-1 CAR as described herein.
- the cell, e.g., T cell, to be engineered to express a CAR is harvested after a sufficient time, or after sufficient dosing of the low, immune enhancing, dose of an mTOR inhibitor, such that the level of PDl negative immune effector cells, e.g., T cells, or the ratio of PDl negative immune effector cells, e.g., T cells/ PDl positive immune effector cells, e.g., T cells, in the subject or harvested from the subject has been, at least transiently, increased.
- the cells expressing a CAR molecule are administered in combination with an agent that ameliorates one or more side effect associated with administration of a cell expressing a CAR molecule, e.g., an agent described herein.
- the cells expressing a CAR molecule are administered in combination with an agent that treats the disease associated with CLL-1, e.g., an agent described herein.
- the cells expressing a CAR molecule are administered in combination with a chemotherapeutic agent, e.g., a chemotherapeutic agent described herein.
- the chemotherapeutic agent is administered prior to administration of the cell expressing a CAR molecule, e.g., a CAR molecule described herein.
- the chemotherapeutic regimen is initiated or completed prior to administration of a cell expressing a CAR molecule, e.g., a CAR molecule described herein.
- the chemotherapeutic agent is administered at least 5 days, 10 days, 15 days, 30 days prior to administration of the cell expressing the CAR molecule.
- the chemotherapeutic agent is administered at least 5 days, 10 days, 15 days, 30 days prior to administration of the cell expressing the CAR molecule.
- the chemotherapeutic agent is administered at least 5 days, 10 days, 15 days, 30 days prior to administration of the cell expressing the CAR molecule.
- chemotherapeutic agent is a chemotherapeutic agent that increases CLL-1 expression on the cancer cells, e.g., the tumor cells, e.g., as compared to CLL-1 expression on normal or non- cancer cells.
- the chemotherapeutic agent is cytarabine (Ara-C).
- the combination of chemotherapy and a cell expressing a CAR molecule described herein is useful for treating a hematological cancer, e.g., a leukemia, e.g., AML, or a minimal residual disease (MRD) of a hematological cancer described herein.
- the invention pertains to the isolated nucleic acid molecule encoding a CAR of the invention, the isolated polypeptide molecule of a CAR of the invention, the vector comprising a CAR of the invention, and the cell comprising a CAR of the invention for use as a medicament, e.g., as described herein.
- the invention pertains to a the isolated nucleic acid molecule encoding a CAR of the invention, the isolated polypeptide molecule of a CAR of the invention, the vector comprising a CAR of the invention, and the cell comprising a CAR of the invention for use in the treatment of a disease expressing CLL-1, e.g., a disease expressing CLL-1 as described herein.
- the CLL-1 CAR molecule e.g., a CLL-1 CAR nucleic acid or a CLL-1 CAR polypeptide as described herein
- the CLL-1 binding domain as described herein includes one, two or three CDRs from the heavy chain variable region (e.g., HC CDRl, HC CDR2 and/or HC CDR3), provided in Table 3; and/or one, two or three CDRs from the light chain variable region (e.g., LC CDRl, LC CDR2 and/or LC CDR3) of CLL-1 CAR-1, CLL-1 CAR-2, CLL-1 CAR-3, CLL-1 CAR-4, CLL-1 CAR-5, CLL-1 CAR-6, CLL-1 CAR-7, CLL-1 CAR-8, CLL-1 CAR-9, CLL-1 CAR- 10, CLL-1 CAR-11, CLL-1 CAR-
- the heavy chain variable region e.g., HC CDRl, HC CDR2 and/or HC C
- the CLL-1 CAR molecule e.g., a CLL-1 CAR nucleic acid or a CLL-1 CAR polypeptide as described herein, or the CLL-1 binding domain as described herein, includes one, two or three CDRs from the heavy chain variable region (e.g., HC CDRl, HC CDR2 and/or HC CDR3), provided in Table 5; and/or one, two or three CDRs from the light chain variable region (e.g., LC CDRl, LC CDR2 and/or LC CDR3) of CLL-1 CAR-1, CLL-1 CAR-2, CLL-1 CAR-3, CLL-1 CAR-4, CLL-1 CAR-5, CLL-1 CAR-6, CLL-1 CAR-7, CLL-1 CAR-8, CLL-1 CAR-9, CLL-1 CAR- 10, CLL-1 CAR-11, CLL-1 CAR- 12, CLL-1 CAR-13
- the heavy chain variable region e.g., HC CDRl, HC C
- the CLL-1 CAR molecule (e.g., a CLL-1 CAR nucleic acid or a CLL-1 CAR polypeptide as described herein), or the CLL-1 binding domain as described herein, includes one, two or three CDRs from the heavy chain variable region (e.g., HC CDRl, HC CDR2 and/or HC CDR3), provided in Table 7; and/or one, two or three CDRs from the light chain variable region (e.g., LC CDRl, LC CDR2 and/or LC CDR3) of CLL-1 CAR-1, CLL-1 CAR-2, CLL-1 CAR-3, CLL-1 CAR-4, CLL-1 CAR-5, CLL-1 CAR-6, CLL-1 CAR-7, CLL-1 CAR-8, CLL-1 CAR-9, CLL-1 CAR- 10, CLL-1 CAR-11, CLL-1 CAR- 12, CLL-1 CAR-13, or 181268 provided in Table 8; or a sequence substantially identical (e.g.,
- the CAR molecule described herein (e.g., the CAR nucleic acid or the CAR polypeptide) includes:
- LC CDRs chosen from one of the following:
- the CAR molecule described herein e.g., the CAR nucleic acid or the CAR polypeptide
- a CLL-1 binding domain includes:
- LC CDRs chosen from one of the following:
- SEQ ID NO: 391 of CLL-1 CAR-8 or (ix) a LC CDRl of SEQ ID NO: 364, LC CDR2 of SEQ ID NO: 378 and LC CDR3 of SEQ ID NO: 392 of CLL-1 CAR-9;
- the CAR molecule described herein (e.g., the CAR nucleic acid or the CAR polypeptide) includes:
- LC CDRs chosen from one of the following:
- SEQ ID NO: 476 of CLL-1 CAR-9 (x) a LC CDRl of SEQ ID NO: 449, LC CDR2 of SEQ ID NO: 463 and LC CDR3 of SEQ ID NO: 477 of CLL-1 CAR-10;
- Figure 1 comprising Figures 1A IB, and 1C, is a series of images demonstrating luciferase levels in target-positive (PL21, THP1, HL60, U937) or target-negative (K562) cell lines mixed with a JNL cell line transduced with anti-CLL-1 CAR.
- Figure 2 comprising Figures 2A, 2B, and 2C, is a series of images demonstrating CAR expression as evaluated by FACS in a JNL cell line transduced with anti-CLL-1 CAR.
- Figure 3 is a series of images demonstrating histogram plots of relative fluorescent intensity from that FACS showed the percentage of transduced T cells.
- Figure 3A shows detection of CART expression in primary T cells using Protein L.
- Figure 3B shows detection of CART expression in primary T cells using recombinant CLL-1 protein.
- Figure 4 is a series of images demonstrating anti- CLL-1 CART cell killing of luciferized PL21 (Fig. 4A), HL60 (Fig. 4B) and U87 cells (Fig. 4C).
- Figure 5 is a series of images demonstrating cytokine production in CART-CLL-1 cells.
- Untransduced T cells UTD
- TNF-alpha Fig. 5A
- IL-2 Fig. 5B
- IFN interferon-gamma
- Figure 6 is an image demonstrating that CLL-1 is expressed in most primary patient samples with AML (AML blasts were gated using standard side scatter
- CLL-1 was measured by flow cytometry using a commercially available antibody (clone HIM3-4, eBioscience)
- Figure 7 is a series of images demonstrating the transduction efficiency of T cells transduced with CAR.
- Figure 8 is a series of images demonstrating that CLL1-CART cells undergo specific degranulation to CLL1+ cell lines and primary AML samples.
- CD107a degranulation was measured by flow cytometry (Fig. 8A).
- CLL-1 CART cells underwent specific degranulation to THP1 and primary AML samples and not to the control cell line (Fig. 8B).
- Figure 9 is a series of images demonstrating CLL1- CART cells produce TNF-a after incubation with CLL1+ cell line and primary AML samples.
- Figure 10 is a series of images demonstrating CLLl-CART cells produce IL-2 after incubation with CLL1+ cell line and primary AML samples..
- Figure 11 is a series of images demonstrating CLL1- CART cells specifically kill the CLL-1 + cell lines MOLM14 and THP-1 and primary AML samples.
- CLLl-CART cells results in specific lysis of MOLM14 (Fig. 11D), THP-1 (Fig. 11 A) and the primary AML sample (Fig. 11B) and not to the control cell line JEKO (Fig. 11C), at the indicated E:T ratios.
- Figure 12 is a series of images demonstrating CLL1- CART cells proliferate in response to MOLM14, THP-1 and primary AML samples.
- Figure 13 is an image illustrating a schematic diagram for assaying hematopoietic stem cell yoxicity of CLL-1 CART cells using autologous xenografts.
- Figure 14 comprising Figures 14A, 14B, and 14C, is a series of images demonstrating that CLL-1 is expressed on different myeloid lineage cells and B cells in humanized mice.
- a representative FACS plots of the peripheral blood analysis of one mouse is shown (Fig. 14A).
- CLL-1 is expressed on monocytes (CD14+ cells), myeloid cells (CD33+ and CD123+ cells), B cells (CD19+ cells), but not on platelets (CD41+ cells) or T cells (CD3+ cells).
- monocytes CD14+ cells
- myeloid cells CD33+ and CD123+ cells
- B cells CD19+ cells
- CD41+ cells CD41+ cells
- T cells CD3+ cells
- FIG. 14B A schematic plot representation of peripheral blood analysis from 24 mice is shown (Fig. 14C).
- Figure 15, comprising Figures 15A, 15B, 15C, and 15D, is a series of images demonstrating CLL-1 is expressed on different myeloid lineage cells and B cells in humanized mice.
- Figure 16 comprising Figures 16A, 16B, 16C, and 16D, is a series of images demonstrating that CLL-1 is expressed on different myeloid progenitors and on hematopoietic stem cells in humanized mice.
- Figure 17 is an image illustrating a schematic diagram for assaying hematopoietic stem cell toxicity of CLL-1 CART cells using a Humanized Immune System (HIS) xenografts.
- HIS Humanized Immune System
- Figure 18, is a series of images demonstrating bone marrow analysis 4 weeks post CLL-1 CAR T cell infusions. Flow cytometry analysis was performed in the CD34+CD38- component (hematopoietic stem cells) (Fig. 18A) and
- CD34+CD38+ component (Progenitor cells) (Fig. 18B).
- Figure 19 comprising Figures 19A, 19B, 19C, 19D, and 19E, is a series of images demonstrating bone marrow analysis 4 weeks post T cells.
- Figure 20 is an image demonstrating bone marrow analysis in HIS mice 4 weeks post T cells. Hematopoietic stem cell toxicity of CLL1-CART cells using HIS xenografts.
- Figure 21 is a series of images demonstrating borne marrow analysis in HIS mice 4 weeks post T cells. Representative plots of bone marrows from mice treated with different CART cells are shown.
- Figure 22, comprising Figures 22A and 22B, is a series of histogram plots showing the relative fluorescent intensity from FACS analysis showing the percentage of transduced T cells.
- Figure 22A shows detection of CART expression in primary T cells using Protein L.
- Figure 22B shows detection of CART expression in primary T cells using recombinant CLL-1 protein.
- Figure 23 comprising Figures 23 A and 23B, are two graphs showing the proliferation capacity of the CLL-1 CART cells when cultured with target cells.
- Figure 24 is a graphic representation demonstrating AML disease progression in the PL- 21-luc xenograft model after treatment with CLL-1 CAR T cells.
- Mean bioluminescence (+/- SEM) of the tumor cells show disease burden in the whole animal is shown as photons/second (p/s) of the ROI (region of interest), which is the whole mouse.
- Figure 25, comprising Figures 25 A and 25B, are two graphs showing the quantification of CD4 + (Fig. 25A) and CD8 + (Fig. 25B) CAR + T cells in the peripheral blood of PL-21-luc tumor-bearing mice.
- Figure 26, comprising Figures 26A, 26B, 26C, and 26D, are bar graphs quantifying the CD4 + T cells (Fig. 26A), CD4 + CLL-1 CAR-expressing T cells (Fig. 26B), CD8 + T cells (Fig. 26C), and the CD8 + CLL-1 CAR-expressing T cells (Fig. 26D) in the bone marrow of the PL- 21-luc tumor-bearing mice. Mean T cell number (+/- SEM) per million bone marrow cells is shown. Significance is calculated by one way ANOVA and is denoted as * P ⁇ 0.05 and
- Figure 27 comprising Figures 27A, 27B, 27C, and 27D, are bar graphs quantifying the CD4 + T cells (Fig. 27 A), CD4 + CLL-1 CAR-expressing T cells (Fig. 27B), CD8 + T cells (Fig. 27C), and the CD8 + CLL-1 CAR-expressing T cells (Fig. 27D) in the spleen of the PL-21-luc tumor-bearing mice. Mean T cell number (+/- SEM) per million splenocytes is shown.
- Figure 28 shows treatment with induction chemotherapy followed by CLL1-CART cells results in leukemic eradication in primary AML xenografts.
- Figure 28 A is a schematic illustrating the experimental schema for the combined therapy of chemotherapy and CLL-1 -CART cells in primary AML xenografts.
- Figure 28B is a bar graph showing the the mean fluorescence intensity (MFI) of CLL1 in leukemic cells (live huCD45dim compartment).
- Figure 28C is a graph showing the
- FIG. 28D is a graph showing the survival of the AML xenografts.
- Figure 29, shows the various configurations on a single vector, e.g., where the U6 regulated shRNA is upstream or downstream of the EFl alpha regulated CAR encoding elements.
- the transcription occurs through the U6 and EFl alpha promoters in the same direction.
- the transcription occurs through the U6 and EFl alpha promoters in different directions.
- the shRNA (and corresponding U6 promoter) is on a first vector
- the CAR (and corresponding EFl alpha promoter) is on a second vector.
- Figure 30 depicts the structures of two exemplary RCAR configurations.
- the antigen binding members comprise an antigen binding domain, a transmembrane domain, and a switch domain.
- the intracellular binding members comprise a switch domain, a co- stimulatory signaling domain and a primary signaling domain.
- the two configurations demonstrate that the first and second switch domains described herein can be in different orientations with respect to the antigen binding member and the intracellular binding member.
- Other RCAR configurations are further described herein.
- Figure 31 shows that the proliferation of CAR-expressing, transduced T cells is enhanced by low doses of RADOOl in a cell culture system. CARTs were co-cultured with Nalm-6 cells in the presence of different concentrations of RADOOl. The number of CAR- positive CD3-positive T cells (black) and total T cells (gray) was assessed after 4 days of co- culture.
- Figure 32 depicts tumor growth measurements of NALM6-luc cells with daily RADOOl dosing at 0.3, 1, 3, and 10 mg/kg (mpk) or vehicle dosing. Circles denote the vehicle; squares denote the 10 mg/kg dose of RADOOl; triangles denote the 3 mg/kg dose of RADOOl, inverted triangles denote the 1 mg/kg dose of RADOOl; and diamonds denote the 0.3 mg/kg dose of RADOOl.
- Figure 33 shows pharmacokinetic curves showing the amount of RADOOl in the blood of NSG mice with NALM6 tumors.
- FIG. 33A shows day 0 PK following the first dose of RADOOl.
- FIG. 33B shows Day 14 PK following the final RADOOl dose.
- Diamonds denote the 10 mg/kg dose of RADOOl; squares denote the 1 mg/kg dose of RADOOl; triangles denote the 3 mg/kg dose of RADOOl; and x's denote the 10 mg/kg dose of RADOOl.
- Figure 34 shows in vivo proliferation of humanized CD19 CART cells with and without RADOOl dosing. Low doses of RADOOl (0.003 mg/kg) daily lead to an enhancement in CAR T cell proliferation, above the normal level of huCAR19 proliferation.
- Figures 34A shows CD4 + CAR T cells;
- FIG. 34B shows CD8 + CAR T cells.
- Circles denote PBS; squares denote huCTL019; triangles denote huCTL019 with 3 mg/kg RADOOl; inverted triangles denote huCTL019 with 0.3 mg/kg RADOOl; diamonds denote huCTL019 with 0.03 mg/kg RADOOl; and circles denote huCTL019 with 0.003 mg/kg RADOOl.
- CAR Chimeric Antigen Receptor
- recombinant polypeptide construct comprising at least an extracellular antigen binding domain, a transmembrane domain and a cytoplasmic signaling domain (also referred to herein as "an intracellular signaling domain") comprising a functional signaling domain derived from a stimulatory molecule as defined below.
- an intracellular signaling domain also referred to herein as "an intracellular signaling domain” comprising a functional signaling domain derived from a stimulatory molecule as defined below.
- domains in the CAR polypeptide construct are in the same polypeptide chain, e.g.,
- the domains in the CAR comprise a chimeric fusion protein.
- the domains in the CAR comprise a chimeric fusion protein.
- polypeptide construct are not contiguous with each other, e.g., are in different
- polypeptide chains e.g., as provided in an RCAR as described herein
- the stimulatory molecule of the CAR is the zeta chain associated with the T cell receptor complex.
- the cytoplasmic signaling domain comprises a primary signaling domain (e.g., a primary signaling domain of CD3-zeta).
- the cytoplasmic signaling domain further comprises one or more functional signaling domains derived from at least one costimulatory molecule as defined below.
- the costimulatory molecule is chosen from 4-1BB (i.e., CD137), CD27, ICOS, and/or CD28.
- the CAR comprises a chimeric fusion protein comprising an extracellular antigen recognition domain, a transmembrane domain and an intracellular signaling domain comprising a functional signaling domain derived from a stimulatory molecule. In one aspect, the CAR comprises a chimeric fusion protein comprising an extracellular antigen recognition domain, a transmembrane domain and an intracellular signaling domain comprising a functional signaling domain derived from a co- stimulatory molecule and a functional signaling domain derived from a stimulatory molecule.
- the CAR comprises a chimeric fusion protein comprising an extracellular antigen recognition domain, a transmembrane domain and an intracellular signaling domain comprising two functional signaling domains derived from one or more co-stimulatory molecule(s) and a functional signaling domain derived from a stimulatory molecule.
- the CAR comprises a chimeric fusion protein comprising an extracellular antigen recognition domain, a transmembrane domain and an intracellular signaling domain comprising at least two functional signaling domains derived from one or more co-stimulatory molecule(s) and a functional signaling domain derived from a stimulatory molecule.
- the CAR comprises an optional leader sequence at the amino-terminus (N-ter) of the CAR fusion protein.
- the CAR further comprises a leader sequence at the N-terminus of the extracellular antigen recognition domain, wherein the leader sequence is optionally cleaved from the antigen recognition domain (e.g., aa scFv) during cellular processing and localization of the CAR to the cellular membrane.
- the antigen recognition domain e.g., aa scFv
- a CAR that comprises an antigen binding domain e.g., a scFv, a single domain antibody, or TCR (e.g., a TCR alpha binding domain or TCR beta binding domain)) that specifically binds a specific tumor marker X, wherein X can be a tumor marker as described herein, is also referred to as XCAR.
- a CAR that comprises an antigen binding domain that specifically binds CLL-1 is referred to as CLL-1 CAR.
- the CAR can be expressed in any cell, e.g., an immune effector cell as described herein (e.g., a T cell or an NK cell).
- signaling domain refers to the functional portion of a protein which acts by transmitting information within the cell to regulate cellular activity via defined signaling pathways by generating second messengers or functioning as effectors by responding to such messengers.
- CLL-1 refers to C-type lectin-like molecule- 1, which is an antigenic determinant detectable on leukemia precursor cells and on normal immune cells.
- C- type lectin-like- 1 (CLL-1) is also known as MICL, CLEC12A, CLEC-1, Dendritic Cell- Associated Lectin 1, and DCAL-2.
- the human and murine amino acid and nucleic acid sequences can be found in a public database, such as GenBank, UniProt and Swiss-Prot.
- the amino acid sequence of human CLL-1 can be found as UniProt/Swiss-Prot Accession No.
- the antigen-binding portion of the CAR recognizes and binds an epitope within the extracellular domain of the CLL-1 protein or a fragment thereof.
- the CLL-1 protein is expressed on a cancer cell.
- antibody refers to a protein, or polypeptide sequence derived from an immunoglobulin molecule which specifically binds with an antigen.
- Antibodies can be polyclonal or monoclonal, multiple or single chain, or intact
- immunoglobulins may be derived from natural sources or from recombinant sources.
- Antibodies can be tetramers of immunoglobulin molecules.
- antibody fragment refers to at least one portion of an intact antibody, or recombinant variants thereof, and refers to the antigen binding domain, e.g., an antigenic determining variable region of an intact antibody, that is sufficient to confer recognition and specific binding of the antibody fragment to a target, such as an antigen.
- antibody fragments include, but are not limited to, Fab, Fab', F(ab') 2 , and Fv fragments, scFv antibody fragments, linear antibodies, single domain antibodies such as sdAb (either VL or VH), camelid VHH domains, and multi- specific molecules formed from antibody fragments such as a bivalent fragment comprising two or more, e.g., two, Fab fragments linked by a disulfide bridge at the hinge region, or two or more, e.g., two, isolated CDR or other epitope binding fragments of an antibody linked.
- An antibody fragment can also be incorporated into single domain antibodies, maxibodies, minibodies, nanobodies, intrabodies, diabodies, triabodies, tetrabodies, v-NAR and bis-scFv (see, e.g., Hollinger and Hudson, Nature Biotechnology 23:1126-1136, 2005).
- Antibody fragments can also be grafted into scaffolds based on polypeptides such as a fibronectin type III (Fn3) (see U.S. Patent No.: 6,703,199, which describes fibronectin polypeptide minibodies).
- Fn3 fibronectin type III
- scFv refers to a fusion protein comprising at least one antibody fragment comprising a variable region of a light chain and at least one antibody fragment comprising a variable region of a heavy chain, wherein the light and heavy chain variable regions are contiguously linked via a short flexible polypeptide linker, and capable of being expressed as a single chain polypeptide, and wherein the scFv retains the specificity of the intact antibody from which it is derived.
- an scFv may have the VL and VH variable regions in either order, e.g., with respect to the N-terminal and C-terminal ends of the polypeptide, the scFv may comprise VL-linker-VH or may comprise VH-linker-VL.
- CDR complementarity determining region
- HCDR1, HCDR2, and HCDR3 three CDRs in each heavy chain variable region
- LCDR1, LCDR2, and LCDR3 three CDRs in each light chain variable region
- the precise amino acid sequence boundaries of a given CDR can be determined using any of a number of well-known schemes, including those described by Kabat et al. (1991), “Sequences of Proteins of Immunological Interest,” 5th Ed.
- the CDR amino acid residues in the heavy chain variable domain (VH) are numbered 31-35 (HCDR1), 50-65 (HCDR2), and 95-102 (HCDR3); and the CDR amino acid residues in the light chain variable domain (VL) are numbered 24-34 (LCDR1), 50-56 (LCDR2), and 89-97 (LCDR3).
- the CDR amino acids in the VH are numbered 26-32 (HCDR1), 52-56 (HCDR2), and 95-102 (HCDR3); and the CDR amino acid residues in the VL are numbered 26-32 (LCDR1), 50-52 (LCDR2), and 91-96 (LCDR3).
- the CDRs correspond to the amino acid residues that are part of a Kabat CDR, a Chothia CDR, or both.
- the CDRs correspond to amino acid residues 26-35 (HCDR1), 50-65 (HCDR2), and 95-102 (HCDR3) in a VH, e.g., a mammalian VH, e.g., a human VH; and amino acid residues 24-34 (LCDR1), 50-56 (LCDR2), and 89-97 (LCDR3) in a VL, e.g., a mammalian VL, e.g., a human VL.
- the portion of the CAR composition of the invention comprising an antibody or antibody fragment thereof may exist in a variety of forms, for example, where the antigen binding domain is expressed as part of a polypeptide chain including, for example, a single domain antibody fragment (sdAb), a single chain antibody (scFv), e.g., a human antibody (Harlow et al., 1999, In: Using Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, NY; Harlow et al., 1989, In: Antibodies: A Laboratory Manual, Cold Spring Harbor, New York; Houston et al., 1988, Proc. Natl. Acad. Sci. USA 85:5879-5883; Bird et al., 1988, Science 242:423-426).
- sdAb single domain antibody fragment
- scFv single chain antibody
- the antigen binding domain of a CAR composition of the invention comprises an antibody fragment.
- the CAR comprises an antibody fragment that comprises a scFv.
- binding domain or "antibody molecule” (also referred to herein as “anti-target (e.g., CLL-1) binding domain”) refers to a protein, e.g., an immunoglobulin chain or fragment thereof, comprising at least one immunoglobulin variable domain sequence.
- binding domain or “antibody molecule” encompasses antibodies and antibody fragments.
- an antibody molecule is a multispecific antibody molecule, e.g., it comprises a plurality of immunoglobulin variable domain sequences, wherein a first immunoglobulin variable domain sequence of the plurality has binding specificity for a first epitope and a second immunoglobulin variable domain sequence of the plurality has binding specificity for a second epitope.
- a multispecific antibody molecule is a bispecific antibody molecule.
- a bispecific antibody has specificity for no more than two antigens.
- a bispecific antibody molecule is characterized by a first immunoglobulin variable domain sequence which has binding specificity for a first epitope and a second
- immunoglobulin variable domain sequence that has binding specificity for a second epitope.
- antibody heavy chain refers to the larger of the two types of polypeptide chains present in antibody molecules in their naturally occurring conformations, and which normally determines the class to which the antibody belongs.
- antibody light chain refers to the smaller of the two types of polypeptide chains present in antibody molecules in their naturally occurring conformations.
- Kappa ( ⁇ ) and lambda ( ⁇ ) light chains refer to the two major antibody light chain isotypes.
- recombinant antibody refers to an antibody which is generated using recombinant DNA technology, such as, for example, an antibody expressed by a bacteriophage or yeast expression system.
- the term should also be construed to mean an antibody which has been generated by the synthesis of a DNA molecule encoding the antibody and which DNA molecule expresses an antibody protein, or an amino acid sequence specifying the antibody, wherein the DNA or amino acid sequence has been obtained using recombinant DNA or amino acid sequence technology which is available and well known in the art.
- antigen or “Ag” refers to a molecule that provokes an immune response.
- This immune response may involve either antibody production, or the activation of specific immunologically-competent cells, or both.
- any macromolecule including virtually all proteins or peptides, can serve as an antigen.
- antigens can be derived from recombinant or genomic DNA.
- any DNA which comprises a nucleotide sequences or a partial nucleotide sequence encoding a protein that elicits an immune response therefore encodes an "antigen" as that term is used herein.
- an antigen need not be encoded solely by a full length nucleotide sequence of a gene. It is readily apparent that the present invention includes, but is not limited to, the use of partial nucleotide sequences of more than one gene and that these nucleotide sequences are arranged in various combinations to encode polypeptides that elicit the desired immune response.
- an antigen need not be encoded by a "gene” at all. It is readily apparent that an antigen can be generated synthesized or can be derived from a biological sample, or might be macromolecule besides a polypeptide. Such a biological sample can include, but is not limited to a tissue sample, a tumor sample, a cell or a fluid with other biological components.
- anti-tumor effect refers to a biological effect which can be manifested by various means, including but not limited to, e.g., a decrease in tumor volume, a decrease in the number of tumor cells, a decrease in the number of metastases, an increase in life expectancy, decrease in tumor cell proliferation, decrease in tumor cell survival, or amelioration of various physiological symptoms associated with the cancerous condition.
- An "anti-tumor effect” can also be manifested by the ability of the peptides, polynucleotides, cells and antibodies of the invention in prevention of the occurrence of tumor in the first place.
- autologous refers to any material derived from the same individual to whom it is later to be re-introduced into the individual.
- allogeneic refers to any material derived from a different animal of the same species as the individual to whom the material is introduced. Two or more individuals are said to be allogeneic to one another when the genes at one or more loci are not identical. In some aspects, allogeneic material from individuals of the same species may be sufficiently unlike genetically to interact antigenically
- xenogeneic refers to a graft derived from an animal of a different species.
- an apheresis sample refers to a sample obtained using apheresis.
- combination refers to either a fixed combination in one dosage unit form, or a combined administration where a compound of the present invention and a combination partner (e.g.
- terapéutica agent another drug as explained below, also referred to as “therapeutic agent” or “co- agent”
- therapeutic agent may be administered independently at the same time or separately within time intervals, especially where these time intervals allow that the combination partners show a cooperative, e.g. synergistic effect.
- the single components may be packaged in a kit or separately.
- One or both of the components e.g., powders or liquids
- co-administration or “combined administration” or the like as utilized herein are meant to encompass administration of the selected combination partner to a single subject in need thereof (e.g. a patient), and are intended to include treatment regimens in which the agents are not necessarily administered by the same route of
- pharmaceutical combination means a product that results from the mixing or combining of more than one active ingredient and includes both fixed and non-fixed combinations of the active ingredients.
- fixed combination means that the active ingredients, e.g. a compound of the present invention and a combination partner, are both administered to a patient simultaneously in the form of a single entity or dosage.
- non-fixed combination means that the active ingredients, e.g. a compound of the present invention and a combination partner, are both administered to a patient as separate entities either simultaneously, concurrently or sequentially with no specific time limits, wherein such administration provides therapeutically effective levels of the two compounds in the body of the patient.
- cocktail therapy e.g. the administration of three or more active ingredients
- cancer refers to a disease characterized by the rapid and uncontrolled growth of aberrant cells. Cancer cells can spread locally or through the bloodstream and lymphatic system to other parts of the body. Examples of various cancers are described herein and include but are not limited to, breast cancer, prostate cancer, ovarian cancer, cervical cancer, skin cancer, pancreatic cancer, colorectal cancer, renal cancer, liver cancer, brain cancer, lymphoma, leukemia, lung cancer and the like.
- tumor and “cancer” are used interchangeably herein, e.g., both terms encompass solid and liquid, e.g., diffuse or circulating, tumors.
- cancer or “tumor” includes premalignant, as well as malignant cancers and tumors.
- "Derived from” as that term is used herein indicates a relationship between a first and a second molecule. It generally refers to structural similarity between the first molecule and a second molecule and does not connotate or include a process or source limitation on a first molecule that is derived from a second molecule. For example, in the case of an intracellular signaling domain that is derived from a CD3zeta molecule, the intracellular signaling domain retains sufficient CD3zeta structure such that is has the required function, namely, the ability to generate a signal under the appropriate conditions.
- disease associated with expression of CLL-1 includes, but is not limited to, a disease associated with a cell which expresses CLL-1 or condition associated with a cell which expresses CLL-1 including, e.g., proliferative diseases such as a cancer or malignancy or a precancerous condition such as a myelodysplasia, a myelodysplastic syndrome or a preleukemia; or a noncancer related indication associated with a cell which expresses CLL-1 (e.g., wild-type or mutant CLL-1).
- proliferative diseases such as a cancer or malignancy or a precancerous condition such as a myelodysplasia, a myelodysplastic syndrome or a preleukemia
- a noncancer related indication associated with a cell which expresses CLL-1 (e.g., wild-type or mutant CLL-1).
- a disease associated with expression of CLL-1 may include a condition associated with a cell which do not presently express CLL-1, e.g., because CLL-1 expression has been downregulated, e.g., due to treatment with a molecule targeting CLL-1, e.g., a CLL-1 inhibitor described herein, but which at one time expressed CLL-1.
- a cancer associated with expression of CLL-1 is a hematological cancer.
- a hematological cancer includes but is not limited to leukemia (such as acute myelogenous leukemia, chronic myelogenous leukemia, acute lymphoid leukemia, chronic lymphoid leukemia and myelodysplastic syndrome) and malignant lymphoproliferative conditions, including lymphoma (such as multiple myeloma, non- Hodgkin's lymphoma, Burkitt's lymphoma, and small cell- and large cell-follicular lymphoma).
- leukemia such as acute myelogenous leukemia, chronic myelogenous leukemia, acute lymphoid leukemia, chronic lymphoid leukemia and myelodysplastic syndrome
- lymphoma such as multiple myeloma, non- Hodgkin's lymphoma, Burkitt's lymphoma, and small cell- and large cell-follicular lymphoma.
- cancers include, but not limited to, e.g., atypical and/or non-classical cancers, malignancies, precancerous conditions or proliferative diseases associated with expression of CLL-1.
- Non-cancer related indications associated with expression of CLL-1 may also be included.
- the tumor antigen-expressing cell expresses, or at any time expressed, mRNA encoding the tumor antigen.
- the tumor antigen-expressing cell produces the tumor antigen protein (e.g., wild-type or mutant), and the tumor antigen protein may be present at normal levels or reduced levels.
- the tumor antigen-expressing cell produced detectable levels of a tumor antigen protein at one point, and subsequently produced substantially no detectable tumor antigen protein.
- conservative sequence modifications refers to amino acid modifications that do not significantly affect or alter the binding characteristics of the antibody or antibody fragment containing the amino acid sequence. Such conservative modifications include amino acid substitutions, additions and deletions. Modifications can be introduced into an antibody or antibody fragment of the invention by standard techniques known in the art, such as site-directed mutagenesis and PCR- mediated mutagenesis.
- Conservative substitutions are ones in which the amino acid residue is replaced with an amino acid residue having a similar side chain.
- Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine, tryptophan), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
- amino acids with basic side chains
- stimulation refers to a primary response induced by binding of a stimulatory molecule (e.g., a TCR/CD3 complex) with its cognate ligand thereby mediating a signal transduction event, such as, but not limited to, signal transduction via the TCR/CD3 complex.
- a stimulatory molecule e.g., a TCR/CD3 complex
- signal transduction event such as, but not limited to, signal transduction via the TCR/CD3 complex.
- Stimulation can mediate altered expression of certain molecules, such as
- the term "stimulatory molecule,” refers to a molecule expressed by a T cell that provides the primary cytoplasmic signaling sequence(s) that regulate primary activation of the TCR complex in a stimulatory way for at least some aspect of the T cell signaling pathway.
- the primary signal is initiated by, for instance, binding of a TCR/CD3 complex with an MHC molecule loaded with peptide, and which leads to mediation of a T cell response, including, but not limited to, proliferation, activation, differentiation, and the like.
- a primary cytoplasmic signaling sequence (also referred to as a "primary signaling domain") that acts in a stimulatory manner may contain a signaling motif which is known as immunoreceptor tyrosine- based activation motif or IT AM.
- IT AM immunoreceptor tyrosine- based activation motif
- Examples of an IT AM containing primary cytoplasmic signaling sequence that is of particular use in the invention includes, but is not limited to, those derived from TCR zeta, FcR gamma, FcR beta, CD3 gamma, CD3 delta , CD3 epsilon, CD5, CD22, CD79a, CD79b, CD278 (also known as "ICOS”), FcsRI, CD66d, DAP10, and DAP12.
- the intracellular signaling domain in any one or more CARS of the invention comprises an intracellular signaling sequence, e.g., a primary signaling sequence of CD3-zeta.
- the primary signaling sequence of CD3-zeta is the sequence provided as SEQ ID NO:9, or the equivalent residues from a non- human species, e.g., mouse, rodent, monkey, ape and the like.
- the primary signaling sequence of CD3-zeta is the sequence as provided in SEQ ID NO: 10, or the equivalent residues from a non-human species, e.g., mouse, rodent, monkey, ape and the like.
- an immune system cell such as an accessory cell (e.g., a B-cell, a dendritic cell, and the like) that displays a foreign antigen complexed with major histocompatibility complexes (MHC's) on its surface.
- MHC's major histocompatibility complexes
- T-cells may recognize these complexes using their T-cell receptors (TCRs).
- APCs process antigens and present them to T-cells.
- intracellular signaling domain refers to an intracellular portion of a molecule.
- the intracellular signaling domain generates a signal that promotes an immune effector function of the CAR containing cell, e.g., a CART cell.
- immune effector function e.g., in a CART cell
- helper activity including the secretion of cytokines.
- the intracellular signal domain transduces the effector function signal and directs the cell to perform a specialized function. While the entire intracellular signaling domain can be employed, in many cases it is not necessary to use the entire chain.
- intracellular signaling domain is thus meant to include any truncated portion of the intracellular signaling domain sufficient to transduce the effector function signal.
- the intracellular signaling domain can comprise a primary intracellular signaling domain.
- Exemplary primary intracellular signaling domains include those derived from the molecules responsible for primary stimulation, or antigen dependent simulation.
- the intracellular signaling domain can comprise a costimulatory intracellular domain.
- Exemplary costimulatory intracellular signaling domains include those derived from molecules responsible for costimulatory signals, or antigen independent stimulation.
- a primary intracellular signaling domain can comprise a cytoplasmic sequence of a T cell receptor
- a costimulatory intracellular signaling domain can comprise cytoplasmic sequence from co-receptor or costimulatory molecule.
- a primary intracellular signaling domain can comprise a signaling motif which is known as an immunoreceptor tyrosine-based activation motif or ITAM.
- ITAM immunoreceptor tyrosine-based activation motif
- ⁇ containing primary cytoplasmic signaling sequences include, but are not limited to, those derived from CD3 zeta, FcR gamma, FcR beta, CD3 gamma, CD3 delta, CD3 epsilon, CD5, CD22, CD79a, CD79b, CD278 (also known as "ICOS”), FcsRI, CD66d, DAP10, and DAP12.
- zeta or alternatively “zeta chain”, “CD3-zeta” or “TCR-zeta” is defined as the protein provided as GenBan Acc. No. BAG36664.1, or the equivalent residues from a non- human species, e.g., mouse, rodent, monkey, ape and the like, and a "zeta stimulatory domain” or alternatively a "CD3-zeta stimulatory domain” or a “TCR-zeta stimulatory domain” is defined as the amino acid residues from the cytoplasmic domain of the zeta chain that are sufficient to functionally transmit an initial signal necessary for T cell activation.
- the cytoplasmic domain of zeta comprises residues 52 through 164 of GenBank Acc. No.
- the "zeta stimulatory domain” or a "CD3-zeta stimulatory domain” is the sequence provided as SEQ ID NO:9. In one aspect, the "zeta stimulatory domain” or a “CD3-zeta stimulatory domain” is the sequence provided as SEQ ID NO: 10.
- costimulatory molecule refers to the cognate binding partner on a T cell that specifically binds with a costimulatory ligand, thereby mediating a costimulatory response by the T cell, such as, but not limited to, proliferation.
- Costimulatory molecules are cell surface molecules other than antigen receptors or their ligands that are required for an efficient immune response.
- Costimulatory molecules include, but are not limited to an a MHC class I molecule, TNF receptor proteins, Immunoglobulin-like proteins, cytokine receptors, integrins, signaling lymphocytic activation molecules (SLAM proteins), activating NK cell receptors, BTLA, a Toll ligand receptor, OX40, CD2, CD7, CD27, CD28, CD30, CD40, CDS, ICAM-1, LFA-1
- CDl la/CD18 4-1BB (CD137), B7-H3, CDS, ICAM-1, ICOS (CD278), GITR, BAFFR, LIGHT, HVEM (LIGHTR), KIRDS2, SLAMF7, NKp80 (KLRF1), NKp44, NKp30, NKp46, CD19, CD4, CD8alpha, CD8beta, IL2R beta, IL2R gamma, IL7R alpha, ITGA4, VLA1, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CDl ld, ITGAE, CD103, ITGAL, CDl la, LFA-1, ITGAM, CDl lb, ITGAX, CDl lc, ITGB1, CD29, ⁇ 2, CD18, LFA-1, ITGB7, NKG2D, NKG2C, TNFR2, TRANCE/RANKL, DNAM1 (CD226),
- a costimulatory intracellular signaling domain refers to the intracellular portion of a costimulatory molecule.
- the intracellular signaling domain can comprise the entire intracellular portion, or the entire native intracellular signaling domain, of the molecule from which it is derived, or a functional fragment thereof.
- 4- IBB refers to a member of the TNFR superfamily with an amino acid sequence provided as GenBank Acc. No. AAA62478.2, or the equivalent residues from a non- human species, e.g., mouse, rodent, monkey, ape and the like; and a "4-1BB costimulatory domain” is defined as amino acid residues 214-255 of GenBank Acc. No. AAA62478.2, or the equivalent residues from a non-human species, e.g., mouse, rodent, monkey, ape and the like.
- the "4- IBB costimulatory domain” is the sequence provided as SEQ ID NO:7 or the equivalent residues from a non-human species, e.g., mouse, rodent, monkey, ape and the like.
- Immuno effector cell refers to a cell that is involved in an immune response, e.g., in the promotion of an immune effector response.
- immune effector cells include T cells, e.g., alpha/beta T cells and gamma/delta T cells, B cells, natural killer (NK) cells, natural killer T (NKT) cells, mast cells, and myeloic-derived phagocytes.
- T cells e.g., alpha/beta T cells and gamma/delta T cells
- B cells natural killer (NK) cells, natural killer T (NKT) cells, mast cells, and myeloic-derived phagocytes.
- NK natural killer
- NKT natural killer T
- an immune effector function or response refers a property of a T or NK cell that promotes killing or the inhibition of growth or proliferation, of a target cell.
- primary stimulation and co-stimulation are examples of immune effector function or response.
- effector function refers to a specialized function of a cell. Effector function of a T cell, for example, may be cytolytic activity or helper activity including the secretion of cytokines.
- encoding refers to the inherent property of specific sequences of nucleotides in a polynucleotide, such as a gene, a cDNA, or an mRNA, to serve as templates for synthesis of other polymers and macromolecules in biological processes having either a defined sequence of nucleotides (e.g., rRNA, tRNA and mRNA) or a defined sequence of amino acids and the biological properties resulting therefrom.
- a gene, cDNA, or RNA encodes a protein if transcription and translation of mRNA corresponding to that gene produces the protein in a cell or other biological system.
- nucleotide sequence encoding an amino acid sequence includes all nucleotide sequences that are degenerate versions of each other and that encode the same amino acid sequence.
- nucleotide sequence that encodes a protein or a RNA may also include introns to the extent that the nucleotide sequence encoding the protein may in some version contain an intron(s).
- effective amount or “therapeutically effective amount” are used
- endogenous refers to any material from or produced inside an organism, cell, tissue or system.
- exogenous refers to any material introduced from or produced outside an organism, cell, tissue or system.
- transfer vector refers to a composition of matter which comprises an isolated nucleic acid and which can be used to deliver the isolated nucleic acid to the interior of a cell. Numerous vectors are known in the art including, but not limited to, linear
- transfer vector includes an autonomously replicating plasmid or a virus.
- the term should also be construed to further include non-plasmid and non-viral compounds which facilitate transfer of nucleic acid into cells, such as, for example, a polylysine compound, liposome, and the like.
- viral transfer vectors include, but are not limited to, adenoviral vectors, adeno-associated virus vectors, retroviral vectors, lenti viral vectors, and the like.
- expression vector refers to a vector comprising a recombinant
- polynucleotide comprising expression control sequences operatively linked to a nucleotide sequence to be expressed.
- An expression vector comprises sufficient cis-acting elements for expression; other elements for expression can be supplied by the host cell or in an in vitro expression system.
- Expression vectors include all those known in the art, including cosmids, plasmids (e.g., naked or contained in liposomes) and viruses (e.g., lentiviruses, retroviruses, adenoviruses, and adeno-associated viruses) that incorporate the recombinant polynucleotide.
- lentivirus refers to a genus of the Retroviridae family. Lentiviruses are unique among the retroviruses in being able to infect non-dividing cells; they can deliver a significant amount of genetic information into the DNA of the host cell, so they are one of the most efficient methods of a gene delivery vector. HIV, SIV, and FIV are all examples of lentiviruses.
- lentiviral vector refers to a vector derived from at least a portion of a lentivirus genome, including especially a self-inactivating lentiviral vector as provided in Milone et al., Mol. Ther. 17(8): 1453-1464 (2009).
- Other examples of lentivirus vectors that may be used in the clinic include but are not limited to, e.g., the LENTIVECTOR® gene delivery technology from Oxford BioMedica, the LENTIMAXTM vector system from Lentigen and the like. Nonclinical types of lentiviral vectors are also available and would be known to one skilled in the art.
- homologous refers to the subunit sequence identity between two polymeric molecules, e.g., between two nucleic acid molecules, such as, two DNA molecules or two RNA molecules, or between two polypeptide molecules.
- two nucleic acid molecules such as, two DNA molecules or two RNA molecules
- polypeptide molecules between two polypeptide molecules.
- a subunit position in both of the two molecules is occupied by the same monomeric subunit; e.g., if a position in each of two DNA molecules is occupied by adenine, then they are homologous or identical at that position.
- the homology between two sequences is a direct function of the number of matching or homologous positions; e.g., if half (e.g., five positions in a polymer ten subunits in length) of the positions in two sequences are homologous, the two sequences are 50% homologous; if 90% of the positions (e.g., 9 of 10), are matched or homologous, the two sequences are 90% homologous.
- Humanized forms of non-human (e.g., murine) antibodies are chimeric
- immunoglobulins immunoglobulin chains or fragments thereof (such as Fv, Fab, Fab', F(ab')2 or other antigen-binding subsequences of antibodies) which contain minimal sequence derived from non-human immunoglobulin.
- humanized antibodies and antibody fragments thereof are human immunoglobulins (recipient antibody or antibody fragment) in which residues from a complementary-determining region (CDR) of the recipient are replaced by residues from a CDR of a non-human species (donor antibody) such as mouse, rat or rabbit having the desired specificity, affinity, and capacity.
- CDR complementary-determining region
- donor antibody such as mouse, rat or rabbit having the desired specificity, affinity, and capacity.
- Fv framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues.
- a humanized antibody/antibody fragment can comprise residues which are found neither in the recipient antibody nor in the imported CDR or framework sequences. These modifications can further refine and optimize antibody or antibody fragment performance.
- the humanized antibody or antibody fragment thereof will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or a significant portion of the FR regions are those of a human immunoglobulin sequence.
- the humanized antibody or antibody fragment can also comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
- Fc immunoglobulin constant region
- Fully human refers to an immunoglobulin, such as an antibody or antibody fragment, where the whole molecule is of human origin or consists of an amino acid sequence identical to a human form of the antibody or immunoglobulin.
- isolated means altered or removed from the natural state.
- a nucleic acid or a peptide naturally present in a living animal is not “isolated,” but the same nucleic acid or peptide partially or completely separated from the coexisting materials of its natural state is “isolated.”
- An isolated nucleic acid or protein can exist in substantially purified form, or can exist in a non-native environment such as, for example, a host cell.
- A refers to adenosine
- C refers to cytosine
- G refers to guanosine
- T refers to thymidine
- U refers to uridine.
- operably linked refers to functional linkage between a regulatory sequence and a heterologous nucleic acid sequence resulting in expression of the latter.
- a first nucleic acid sequence is operably linked with a second nucleic acid sequence when the first nucleic acid sequence is placed in a functional relationship with the second nucleic acid sequence.
- a promoter is operably linked to a coding sequence if the promoter affects the transcription or expression of the coding sequence.
- Operably linked DNA sequences can be contiguous with each other and, e.g., where necessary to join two protein coding regions, are in the same reading frame.
- parenteral administration of an immunogenic composition includes, e.g., subcutaneous (s.c), intravenous (i.v.), intramuscular (i.m.), or intrasternal injection,
- nucleic acid or “polynucleotide” refers to deoxyribonucleic acids (DNA) or ribonucleic acids (RNA) and polymers thereof in either single- or double- stranded form.
- nucleic acids containing known analogues of natural nucleotides that have similar binding properties as the reference nucleic acid and are metabolized in a manner similar to naturally occurring nucleotides.
- a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g., degenerate codon substitutions), alleles, orthologs, SNPs, and complementary sequences as well as the sequence explicitly indicated.
- degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues (Batzer et al., Nucleic Acid Res. 19:5081 (1991); Ohtsuka et al., J. Biol. Chem. 260:2605-2608 (1985); and Rossolini et al., Mol. Cell. Probes 8:91-98 (1994)).
- peptide refers to a compound comprised of amino acid residues covalently linked by peptide bonds.
- a protein or peptide must contain at least two amino acids, and no limitation is placed on the maximum number of amino acids that can comprise a protein's or peptide's sequence.
- Polypeptides include any peptide or protein comprising two or more amino acids joined to each other by peptide bonds.
- the term refers to both short chains, which also commonly are referred to in the art as peptides, oligopeptides and oligomers, for example, and to longer chains, which generally are referred to in the art as proteins, of which there are many types.
- Polypeptides include, for example, biologically active fragments, substantially homologous polypeptides, oligopeptides, homodimers, heterodimers, variants of polypeptides, modified polypeptides, derivatives, analogs, fusion proteins, among others.
- a polypeptide includes a natural peptide, a recombinant peptide, or a combination thereof.
- promoter refers to a DNA sequence recognized by the synthetic machinery of the cell, or introduced synthetic machinery, required to initiate the specific transcription of a polynucleotide sequence.
- promoter/regulatory sequence refers to a nucleic acid sequence which is required for expression of a gene product operably linked to the promoter/regulatory sequence. In some instances, this sequence may be the core promoter sequence and in other instances, this sequence may also include an enhancer sequence and other regulatory elements which are required for expression of the gene product.
- the promoter/regulatory sequence may, for example, be one which expresses the gene product in a tissue specific manner.
- constitutive promoter refers to a nucleotide sequence which, when operably linked with a polynucleotide which encodes or specifies a gene product, causes the gene product to be produced in a cell under most or all physiological conditions of the cell.
- inducible promoter refers to a nucleotide sequence which, when operably linked with a polynucleotide which encodes or specifies a gene product, causes the gene product to be produced in a cell substantially only when an inducer which corresponds to the promoter is present in the cell.
- tissue-specific promoter refers to a nucleotide sequence which, when operably linked with a polynucleotide encodes or specified by a gene, causes the gene product to be produced in a cell substantially only if the cell is a cell of the tissue type corresponding to the promoter.
- flexible polypeptide linker or "linker” as used in the context of a scFv refers to a peptide linker that consists of amino acids such as glycine and/or serine residues used alone or in combination, to link variable heavy and variable light chain regions together.
- the flexible polypeptide linkers include, but are not limited to, (Gly4 Ser) 4 (SEQ ID NO:27) or (Gly4 Ser)3 (SEQ ID NO:28).
- the linkers include multiple repeats of (GlyiSer), (GlySer) or (GlysSer) (SEQ ID NO:29). Also included within the scope of the invention are linkers described in WO2012/138475, incorporated herein by reference.
- a 5' cap (also termed an RNA cap, an RNA 7-methylguanosine cap or an RNA m G cap) is a modified guanine nucleotide that has been added to the "front" or 5' end of a eukaryotic messenger RNA shortly after the start of transcription.
- the 5' cap consists of a terminal group which is linked to the first transcribed nucleotide. Its presence is critical for recognition by the ribosome and protection from RNases. Cap addition is coupled to transcription, and occurs co-transcriptionally, such that each influences the other. Shortly after the start of transcription, the 5' end of the mRNA being synthesized is bound by a cap- synthesizing complex associated with RNA polymerase.
- in vitro transcribed RNA refers to RNA, preferably mRNA, that has been synthesized in vitro. Generally, the in vitro transcribed RNA is generated from an in vitro transcription vector. The in vitro transcription vector comprises a template that is used to generate the in vitro transcribed RNA.
- poly(A) is a series of adenosines attached by polyadenylation to the mRNA.
- the polyA is between 50 and 5000 (SEQ ID NO: 30), preferably greater than 64, more preferably greater than 100, most preferably greater than 300 or 400.
- poly(A) sequences can be modified chemically or enzymatically to modulate mRNA functionality such as localization, stability or efficiency of translation.
- polyadenylation refers to the covalent linkage of a polyadenylyl moiety, or its modified variant, to a messenger RNA molecule.
- mRNA messenger RNA
- the 3' poly(A) tail is a long sequence of adenine nucleotides (often several hundred) added to the pre-mRNA through the action of an enzyme, polyadenylate polymerase.
- poly(A) tail is added onto transcripts that contain a specific sequence, the polyadenylation signal.
- Polyadenylation is also important for transcription termination, export of the mRNA from the nucleus, and translation. Polyadenylation occurs in the nucleus immediately after transcription of DNA into RNA, but additionally can also occur later in the cytoplasm.
- the mRNA chain is cleaved through the action of an endonuclease complex associated with RNA polymerase.
- the cleavage site is usually characterized by the presence of the base sequence AAUAAA near the cleavage site.
- adenosine residues are added to the free 3' end at the cleavage site.
- transient refers to expression of a non-integrated transgene for a period of hours, days or weeks, wherein the period of time of expression is less than the period of time for expression of the gene if integrated into the genome or contained within a stable plasmid replicon in the host cell.
- the terms “treat”, “treatment” and “treating” refer to the reduction or amelioration of the progression, severity and/or duration of a proliferative disorder, or the amelioration of one or more symptoms (preferably, one or more discernible symptoms) of a proliferative disorder resulting from the administration of one or more therapies (e.g., one or more therapeutic agents such as a CAR of the invention).
- the terms “treat”, “treatment” and “treating” refer to the amelioration of at least one measurable physical parameter of a proliferative disorder, such as growth of a tumor, not necessarily discernible by the patient.
- the terms “treat”, “treatment” and “treating” -refer to the inhibition of the progression of a proliferative disorder, either physically by, e.g., stabilization of a discernible symptom, physiologically by, e.g., stabilization of a physical parameter, or both.
- the terms “treat”, “treatment” and “treating” refer to the reduction or stabilization of tumor size or cancerous cell count.
- signal transduction pathway refers to the biochemical relationship between a variety of signal transduction molecules that play a role in the transmission of a signal from one portion of a cell to another portion of a cell.
- cell surface receptor includes molecules and complexes of molecules capable of receiving a signal and transmitting signal across the membrane of a cell.
- a substantially purified cell refers to a cell that is essentially free of other cell types.
- a substantially purified cell also refers to a cell which has been separated from other cell types with which it is normally associated in its naturally occurring state.
- a population of substantially purified cells refers to a homogenous population of cells. In other instances, this term refers simply to cell that have been separated from the cells with which they are naturally associated in their natural state.
- the cells are cultured in vitro. In other aspects, the cells are not cultured in vitro.
- terapéutica as used herein means a treatment.
- a therapeutic effect is obtained by reduction, suppression, remission, or eradication of a disease state.
- prophylaxis means the prevention of or protective treatment for a disease or disease state.
- tumor antigen or “hyperproliferative disorder antigen” or “antigen associated with a hyperproliferative disorder” refers to antigens that are common to specific hyperproliferative disorders.
- the hyperproliferative disorder antigens of the present invention are derived from, cancers including but not limited to primary or metastatic melanoma, thymoma, lymphoma, sarcoma, lung cancer, liver cancer, non-Hodgkin's lymphoma, Hodgkins lymphoma, leukemias, uterine cancer, cervical cancer, bladder cancer, kidney cancer and adenocarcinomas such as breast cancer, prostate cancer, ovarian cancer, pancreatic cancer, and the like.
- transfected or “transformed” or “transduced” refers to a process by which exogenous nucleic acid is transferred or introduced into the host cell.
- a “transfected” or “transformed” or “transduced” cell is one which has been transfected, transformed or transduced with exogenous nucleic acid.
- the cell includes the primary subject cell and its progeny.
- the term “specifically binds,” refers to an antibody, or a ligand, which recognizes and binds with a cognate binding partner (e.g., a stimulatory and/or costimulatory molecule present on a T cell) protein present in a sample, but which antibody or ligand does not substantially recognize or bind other molecules in the sample.
- a cognate binding partner e.g., a stimulatory and/or costimulatory molecule present on a T cell
- RCAR Regular chimeric antigen receptor
- an RCAR comprises at least an extracellular antigen binding domain, a transmembrane and a cytoplasmic signaling domain (also referred to herein as "an intracellular signaling domain") comprising a functional signaling domain derived from a stimulatory molecule and/or costimulatory molecule as defined herein in the context of a CAR molecule.
- the RCAR includes a dimerization switch that, upon the presence of a dimerization molecule, can couple the polypeptides to one another, e.g., can couple an antigen binding domain to an intracellular signaling domain.
- the RCAR is expressed in a cell (e.g., an immune effector cell) as described herein, e.g., an RCAR-expressing cell (also referred to herein as "RCARX cell").
- the RCARX cell is a T cell, and is referred to as a RCART cell.
- the RCARX cell is an NK cell, and is referred to as a RCARN cell.
- the RCAR can provide the RCAR- expressing cell with specificity for a target cell, typically a cancer cell, and with regulatable intracellular signal generation or proliferation, which can optimize an immune effector property of the RCAR-expressing cell.
- an RCAR cell relies at least in part, on an antigen binding domain to provide specificity to a target cell that comprises the antigen bound by the antigen binding domain.
- Membrane anchor or “membrane tethering domain”, as that term is used herein, refers to a polypeptide or moiety, e.g., a myristoyl group, sufficient to anchor an extracellular or intracellular domain to the plasma membrane.
- Switch domain refers to an entity, typically a polypeptide-based entity, that, in the presence of a dimerization molecule, associates with another switch domain. The association results in a functional coupling of a first entity linked to, e.g., fused to, a first switch domain, and a second entity linked to, e.g., fused to, a second switch domain.
- a first and second switch domain are collectively referred to as a dimerization switch.
- the first and second switch domains are the same as one another, e.g., they are polypeptides having the same primary amino acid sequence, and are referred to collectively as a homodimerization switch. In embodiments, the first and second switch domains are different from one another, e.g., they are polypeptides having different primary amino acid sequences, and are referred to collectively as a heterodimerization switch. In embodiments, the switch is intracellular. In embodiments, the switch is extracellular. In embodiments, the switch domain is a polypeptide-based entity, e.g., FKBP or FRB-based, and the dimerization molecule is small molecule, e.g., a rapalogue. In embodiments, the switch domain is a polypeptide-based entity, e.g., an scFv that binds a myc peptide, and the
- dimerization molecule is a polypeptide, a fragment thereof, or a multimer of a polypeptide, e.g., a myc ligand or multimers of a myc ligand that bind to one or more myc scFvs.
- the switch domain is a polypeptide-based entity, e.g., myc receptor, and the dimerization molecule is an antibody or fragments thereof, e.g., myc antibody.
- dimerization molecule refers to a molecule that promotes the association of a first switch domain with a second switch domain.
- the dimerization molecule does not naturally occur in the subject, or does not occur in concentrations that would result in significant dimerization.
- the dimerization molecule is a small molecule, e.g., rapamycin or a rapalogue, e.g, RAD001.
- bioequivalent refers to an amount of an agent other than the reference compound (e.g., RAD001), required to produce an effect equivalent to the effect produced by the reference dose or reference amount of the reference compound (e.g., RAD001).
- the effect is the level of mTOR inhibition, e.g., as measured by P70 S6 kinase inhibition, e.g., as evaluated in an in vivo or in vitro assay, e.g., as measured by an assay described herein, e.g., the Boulay assay, or measurement of phosphorylated S6 levels by western blot .
- the effect is alteration of the ratio of PD-1 positive/PD-1 negative T cells, as measured by cell sorting.
- a bioequivalent amount or dose of an mTOR inhibitor is the amount or dose that achieves the same level of P70 S6 kinase inhibition as does the reference dose or reference amount of a reference compound.
- a bioequivalent amount or dose of an mTOR inhibitor is the amount or dose that achieves the same level of alteration in the ratio of PD-1 positive/PD-1 negative T cells as does the reference dose or reference amount of a reference compound.
- low, immune enhancing, dose when used in conjuction with an mTOR inhibitor, e.g., an allosteric mTOR inhibitor, e.g., RAD001 or rapamycin, or a catalytic mTOR inhibitor, refers to a dose of mTOR inhibitor that partially, but not fully, inhibits mTOR activity, e.g., as measured by the inhibition of P70 S6 kinase activity. Methods for evaluating mTOR activity, e.g., by inhibition of P70 S6 kinase, are discussed herein. The dose is insufficient to result in complete immune suppression but is sufficient to enhance the immune response.
- an mTOR inhibitor e.g., an allosteric mTOR inhibitor, e.g., RAD001 or rapamycin, or a catalytic mTOR inhibitor
- the low, immune enhancing, dose of mTOR inhibitor results in a decrease in the number of PD-1 positive T cells and/or an increase in the number of PD-1 negative T cells, or an increase in the ratio of PD-1 negative T cells/PD-1 positive T cells. In an embodiment, the low, immune enhancing, dose of mTOR inhibitor results in an increase in the number of naive T cells.
- the low, immune enhancing, dose of mTOR inhibitor results in one or more of the following: an increase in the expression of one or more of the following markers: CD62L hlgh , CD127 high , CD27 + , and BCL2, e.g., on memory T cells, e.g., memory T cell precursors; a decrease in the expression of KLRG1, e.g., on memory T cells, e.g., memory T cell precursors; and an increase in the number of memory T cell precursors, e.g., cells with any one or combination of the following characteristics: increased CD62L hlgh , increased CD127 hlgh , increased CD27 + , decreased KLRG1, and increased BCL2; wherein any of the changes described above occurs, e.g., at least transiently, e.g., as compared to a non-treated subject.
- any of the changes described above occurs, e.g., at least transiently, e.g., as
- Refractory refers to a disease, e.g., cancer, that does not respond to a treatment.
- a refractory cancer can be resistant to a treatment before or at the beginning of the treatment. In other embodiments, the refractory cancer can become resistant during a treatment.
- a refractory cancer is also called a resistant cancer.
- Relapsed or a “relapse” as used herein refers to the reappearance of a disease (e.g., cancer) or the signs and symptoms of a disease such as cancer after a period of improvement or responsiveness, e.g., after prior treatment of a therapy, e.g., cancer therapy.
- the period of responsiveness may involve the level of cancer cells falling below a certain threshold, e.g., below 20%, 1%, 10%, 5%, 4%, 3%, 2%, or 1%.
- the reappearance may involve the level of cancer cells rising above a certain threshold, e.g., above 20%, 1%, 10%, 5%, 4%, 3%, 2%, or 1%.
- ranges throughout this disclosure, various aspects of the invention can be presented in a range format. It should be understood that the description in range format is merely for convenience and brevity and should not be construed as an inflexible limitation on the scope of the invention. Accordingly, the description of a range should be considered to have specifically disclosed all the possible subranges as well as individual numerical values within that range. For example, description of a range such as from 1 to 6 should be considered to have specifically disclosed subranges such as from 1 to 3, from 1 to 4, from 1 to 5, from 2 to 4, from 2 to 6, from 3 to 6 etc., as well as individual numbers within that range, for example, 1, 2, 2.7, 3, 4, 5, 5.3, and 6.
- a range such as 95-99% identity includes something with 95%, 96%, 97%, 98% or 99% identity, and includes subranges such as 96-99%, 96-98%, 96-97%, 97-99%, 97-98% and 98-99% identity. This applies regardless of the breadth of the range.
- CAR CLL-1 chimeric antigen receptors
- the invention provides a number of chimeric antigen receptors (CAR) comprising an antibody or antibody fragment engineered for specific binding to a CLL-1 protein or a fragment thereof.
- CAR chimeric antigen receptors
- the invention provides a cell (e.g., an immune effector cell, e.g., a T cell or a NK cell) engineered to express a CAR, wherein the CAR T cell ("CART") exhibits an antitumor property.
- a cell is transformed with the CAR and at least part of the CAR construct is expressed on the cell surface.
- the cell (e.g., an immune effector cell, e.g., a T cell or a NK cell) is transduced with a viral vector encoding a CAR.
- the viral vector is a retroviral vector.
- the viral vector is a lentiviral vector.
- the cell may stably express the CAR.
- the cell e.g., an immune effector cell, e.g., a T cell or a NK cell
- a nucleic acid e.g., mRNA, cDNA, DNA, encoding a CAR.
- the cell may transiently express the CAR.
- the human anti-CLL-1 protein binding portion of the CAR is a scFv antibody fragment.
- antibody fragments are functional in that they retain the equivalent binding affinity, e.g., they bind the same antigen with comparable efficacy, as the IgG antibody having the same heavy and light chain variable regions.
- antibody fragments are functional in that they provide a biological response that can include, but is not limited to, activation of an immune response, inhibition of signal-transduction origination from its target antigen, inhibition of kinase activity, and the like, as will be understood by a skilled artisan.
- the antibodies of the invention are incorporated into a chimeric antigen receptor (CAR).
- CAR comprises the polypeptide sequence provided herein as SEQ ID NO: 91-103.
- the anti- CLL-1 binding domain, e.g., human scFv, portion of a CAR of the invention is encoded by a transgene whose sequence has been codon optimized for expression in a mammalian cell.
- entire CAR construct of the invention is encoded by a transgene whose entire sequence has been codon optimized for expression in a mammalian cell. Codon optimization refers to the discovery that the frequency of occurrence of synonymous codons (i.e., codons that code for the same amino acid) in coding DNA is biased in different species. Such codon degeneracy allows an identical polypeptide to be encoded by a variety of nucleotide sequences.
- a variety of codon optimization methods is known in the art, and include, e.g., methods disclosed in at least US Patent Numbers 5,786,464 and 6,114,148.
- the human CLL-1 binding domain comprises the scFv portion provided in SEQ ID NOs:39-51. In one embodiment, the human anti-CLL-1 binding domain comprises the scFv portion provided in SEQ ID NO:39. In one embodiment, the human anti- CLL-1 binding domain comprises the scFv portion provided in SEQ ID NO:40. In one embodiment, the human anti-CLL-1 binding domain comprises the scFv portion provided in SEQ ID NO:41. In one embodiment, the human anti-CLL-1 binding domain comprises the scFv portion provided in SEQ ID NO:42. In one embodiment, the human anti-CLL-1 binding domain comprises the scFv portion provided in SEQ ID NO:43.
- the human anti-CLL-1 binding domain comprises the scFv portion provided in SEQ ID NO:44. In one embodiment, the human anti-CLL-1 binding domain comprises the scFv portion provided in SEQ ID NO:45. In one embodiment, the human anti-CLL-1 binding domain comprises the scFv portion provided in SEQ ID NO:46. In one embodiment, the human anti-CLL-1 binding domain comprises the scFv portion provided in SEQ ID NO:47. In one embodiment, the human anti-CLL-1 binding domain comprises the scFv portion provided in SEQ ID NO:48. In one embodiment, the human anti-CLL-1 binding domain comprises the scFv portion provided in SEQ ID NO:49.
- the human anti-CLL-1 binding domain comprises the scFv portion provided in SEQ ID NO:50. In one embodiment, the human anti-CLL-1 binding domain comprises the scFv portion provided in SEQ ID NO:51.
- the CARs of the invention combine an antigen binding domain of a specific antibody with an intracellular signaling molecule.
- the intracellular signaling molecule includes, but is not limited to, CD3-zeta chain, 4- IBB and CD28 signaling modules and combinations thereof.
- the antigen binding domain binds to CLL-1.
- the CLL-1 CAR comprises a CAR selected from the sequence provided in one or more of SEQ ID NOs: 91-103 or 197.
- the CLL-1 CAR comprises the sequence provided in SEQ ID NO:91. In one aspect, the CLL-1 CAR comprises the sequence provided in SEQ ID NO:92. In one aspect, the CLL-1 CAR comprises the sequence provided in SEQ ID NO:93. In one aspect, the CLL-1 CAR comprises the sequence provided in SEQ ID NO:94. In one aspect, the CLL-1 CAR comprises the sequence provided in SEQ ID NO:95. In one aspect, the CLL-1 CAR comprises the sequence provided in SEQ ID NO:96. In one aspect, the CLL-1 CAR comprises the sequence provided in SEQ ID NO: 97. In one aspect, the CLL-1 CAR comprises the sequence provided in SEQ ID NO:98.
- the CLL-1 CAR comprises the sequence provided in SEQ ID NO:99. In one aspect, the CLL-1 CAR comprises the sequence provided in SEQ ID NO: 100. In one aspect, the CLL-1 CAR comprises the sequence provided in SEQ ID NO: 101. In one aspect, the CLL-1 CAR comprises the sequence provided in SEQ ID NO: 102. In one aspect, the CLL-1 CAR comprises the sequence provided in SEQ ID NO: 103. In one aspect, the CLL- 1 CAR comprises the sequence provided in SEQ ID NO: 197. Furthermore, the present invention provides CLL-1 CAR compositions and their use in medicaments or methods for treating, among other diseases, cancer or any malignancy or autoimmune diseases involving cells or tissues which express CLL-1.
- the CAR of the invention can be used to eradicate CLL-1 -expressing normal cells, thereby applicable for use as a cellular conditioning therapy prior to cell transplantation.
- the CLL-1 -expressing normal cell is a CLL-1 -expressing normal stem cell and the cell transplantation is a stem cell transplantation.
- the invention provides a cell (e.g., an immune effector cell, e.g., a T cell or a NK cell) engineered to express a chimeric antigen receptor (CAR) of the present invention, wherein the cell (e.g., CAR-expressing immune effector cell, e.g., CAR T cell, e.g., "CART") exhibits an antitumor property.
- CAR chimeric antigen receptor
- a preferred antigen is CLL-1.
- the antigen binding domain of the CAR comprises a human anti- CLL-1 antibody fragment.
- the antigen binding domain of the CAR comprises human anti- CLL-1 antibody fragment comprising an scFv.
- the antigen binding domain of the CAR comprises a human anti-CLL-1 scFv.
- the invention provides a CLL-1 -CAR that comprises an anti- CLL-1 binding domain and is engineered into an immune effector cell, e.g., a T cell or a NK cell and methods of their use for adoptive therapy.
- the CLL-1 -CAR comprises a human anti-CLL-1 binding domain.
- the CLL-1 -CAR comprises at least one intracellular domain selected from the group of a CD137 (4-1BB) signaling domain, a CD28 signaling domain, a CD3zeta signal domain, and any combination thereof.
- the CLL-1 -CAR comprises at least one intracellular signaling domain is from one or more co- stimulatory molecule(s) other than a CD137 (4-1BB) or CD28.
- the present invention provides a CAR (e..g., a CAR polypeptide) that comprises an anti-CLL-1 binding domain (e.g., human or humanized CLL-1 binding domain as described herein), a transmembrane domain, and an intracellular signaling domain, and wherein said anti- CLL-1 binding domain comprises a heavy chain complementary determining region 1 (HC CDR1), a heavy chain complementary determining region 2 (HC CDR2), and a heavy chain complementary determining region 3 (HC CDR3) of any anti-CLL-1 heavy chain binding domain amino acid sequences listed in Table 2.
- HC CDR1 heavy chain complementary determining region 1
- HC CDR2 heavy chain complementary determining region 2
- HC CDR3 heavy chain complementary determining region 3
- the anti-CLL-1 binding domain of the CAR can further comprise a light chain complementary determining region 1 (LC CDR1), a light chain complementary determining region 2 (LC CDR2), and a light chain complementary determining region 3 (LC CDR3) of any anti-CLL-1 light chain binding domain amino acid sequences listed in Table 2.
- LC CDR1 light chain complementary determining region 1
- LC CDR2 light chain complementary determining region 2
- LC CDR3 light chain complementary determining region 3
- the present invention also provides nucleic acid molecules encoding the CAR as described herein, e.g., encoding a CAR that comprises an anti-CLL-1 binding domain (e.g., human or humanized CLL-1 binding domain as described herein), a transmembrane domain, and an intracellular signaling domain, and wherein said anti-CLL-1 binding domain comprises a heavy chain complementary determining region 1 (HC CDR1), a heavy chain complementary determining region 2 (HC CDR2), and a heavy chain complementary determining region 3 (HC CDR3) of any anti-CLL-1 heavy chain binding domain amino acid sequences listed in Table 2.
- the encoded anti-CLL-1 binding domain of the CAR can further comprise a light chain complementary determining region 1 (LC CDR1), a light chain complementary determining region 2 (LC CDR2), and a light chain complementary
- a CAR construct of the invention comprises a scFv domain selected from the group consisting of SEQ ID NOs:39-51, wherein the scFv may be preceded by an optional leader sequence such as provided in SEQ ID NO: 1, and followed by an optional hinge sequence such as provided in SEQ ID NO:2 or SEQ ID NO:3 or SEQ ID NO:4 or SEQ ID NO:5, a transmembrane region such as provided in SEQ ID NO:6, an intracellular signalling domain that includes SEQ ID NO:7 or SEQ ID NO: 8 and a CD3 zeta sequence that includes SEQ ID NO:9 or SEQ ID NO: 10, e.g., wherein the domains are contiguous with and in the same reading frame to form a single fusion protein.
- an exemplary CLL-1 CAR constructs comprise an optional leader sequence, an extracellular antigen binding domain, a hinge, a transmembrane domain, and an intracellular stimulatory domain.
- an exemplary CLL-1 CAR construct comprises an optional leader sequence, an extracellular antigen binding domain, a hinge, a transmembrane domain, an intracellular co stimulatory domain and an intracellular stimulatory domain.
- full-length CAR sequences are also provided herein as SEQ ID NOs: 91-103, as shown in Table 2.
- An exemplary leader sequence is provided as SEQ ID NO: 1.
- An exemplary leader sequence is provided as SEQ ID NO: 1.
- SEQ ID NO:2 amino acid sequence
- SEQ ID NO:3 amino acid sequence
- SEQ ID NO:4 amino acid sequence
- SEQ ID NO:5 amino acid sequence
- SEQ ID NO:6 amino acid sequence
- SEQ ID NO: 7 amino acid sequence of the intracellular signaling domain of the 4-1BB protein
- SEQ ID NO: 8 amino acid sequence of the intracellular signaling domain of CD27
- SEQ ID NO: 9 amino acid sequence of the intracellular signaling domain of CD27
- the present invention encompasses a recombinant nucleic acid construct comprising a nucleic acid molecule encoding a CAR, wherein the nucleic acid molecule comprises the nucleic acid sequence encoding a CLL-1 binding domain, e.g., described herein, e.g., that is contiguous with and in the same reading frame as a nucleic acid sequence encoding an intracellular signaling domain.
- the CLL-1 binding domain is selected from one or more of SEQ ID NOs:39-51.
- the CLL-1 binding domain comprises SEQ ID NO:39.
- the CLL-1 binding domain comprises SEQ ID NO:40.
- the CLL-1 binding domain comprises SEQ ID NO:41. In one embodiment, the CLL-1 binding domain comprises SEQ ID NO:42. In one embodiment, the CLL-1 binding domain comprises SEQ ID NO:43. In one embodiment, the CLL-1 binding domain comprises SEQ ID NO:44. In one embodiment, the CLL-1 binding domain comprises SEQ ID NO:45. In one embodiment, the CLL-1 binding domain comprises SEQ ID NO:46. In one embodiment, the CLL-1 binding domain comprises SEQ ID NO:47. In one embodiment, the CLL-1 binding domain comprises SEQ ID NO:48. In one embodiment, the CLL-1 binding domain comprises SEQ ID NO:49. In one embodiment, the CLL-1 binding domain comprises SEQ ID NO:50.
- the CLL-1 binding domain comprises SEQ ID NO:51.
- the present invention encompasses a recombinant nucleic acid construct comprising a transgene encoding a CAR, wherein the nucleic acid molecule comprises a nucleic acid sequence encoding an anti- CLL-1 binding domain selected from one or more of SEQ ID NOs:39-51, wherein the sequence is contiguous with and in the same reading frame as the nucleic acid sequence encoding an intracellular signaling domain.
- An exemplary intracellular signaling domain that can be used in the CAR includes, but is not limited to, one or more intracellular signaling domains of, e.g., CD3-zeta, CD28, 4-lBB, and the like.
- the CAR can comprise any combination of CD3-zeta, CD28, 4- IBB, and the like.
- the nucleic acid sequence of a CAR construct of the invention is selected from one or more of SEQ ID NOs:104-116, or 198.
- the nucleic acid sequence of a CAR construct is SEQ ID NO: 104.
- the nucleic acid sequence of a CAR construct is SEQ ID NO: 105.
- the nucleic acid sequence of a CAR construct is SEQ ID NO:106.
- the nucleic acid sequence of a CAR construct is SEQ ID NO:107.
- the nucleic acid sequence of a CAR construct is SEQ ID NO: 108.
- nucleic acid sequence of a CAR construct is SEQ ID NO: 109. In one aspect the nucleic acid sequence of a CAR construct is SEQ ID NO: 110. In one aspect the nucleic acid sequence of a CAR construct is SEQ ID NO:l l l. In one aspect the nucleic acid sequence of a CAR construct is SEQ ID NO: 112. In one aspect the nucleic acid sequence of a CAR construct is SEQ ID NO:113. In one aspect the nucleic acid sequence of a CAR construct is SEQ ID NO:114. In one aspect the nucleic acid sequence of a CAR construct is SEQ ID NO: 115. In one aspect the nucleic acid sequence of a CAR construct is SEQ ID NO: 116.
- the nucleic acid sequence of a CAR construct is SEQ ID NO: 198.
- the nucleic acid sequences coding for the desired molecules can be obtained using recombinant methods known in the art, such as, for example by screening libraries from cells expressing the gene, by deriving the gene from a vector known to include the same, or by isolating directly from cells and tissues containing the same, using standard techniques.
- the nucleic acid of interest can be produced synthetically, rather than cloned.
- the present invention includes retroviral and lentiviral vector constructs expressing a CAR that can be directly transduced into a cell.
- the present invention also includes an RNA construct that can be directly transfected into a cell.
- a method for generating mRNA for use in transfection involves in vitro transcription (IVT) of a template with specially designed primers, followed by polyA addition, to produce a construct containing 3' and 5' untranslated sequence ("UTR"), a 5' cap and/or Internal Ribosome Entry Site (IRES), the nucleic acid to be expressed, and a polyA tail, typically 50-2000 bases in length (SEQ ID NO:35).
- RNA so produced can efficiently transfect different kinds of cells.
- the template includes sequences for the CAR.
- an RNA CAR vector is transduced into a T cell by electroporation.
- the CARs of the present invention comprise a target- specific binding domain.
- the choice of moiety depends upon the type and number of ligands that define the surface of a target cell.
- the antigen binding domain may be chosen to recognize a ligand that acts as a cell surface marker on target cells associated with a particular disease state.
- cell surface markers that may act as ligands for the antigen binding domain in a CAR of the invention include those associated with viral, bacterial and parasitic infections, autoimmune disease and cancer cells.
- the CAR-mediated T-cell response can be directed to an antigen of interest by way of engineering an antigen binding domain that specifically binds a desired antigen into the CAR.
- the CAR of the present invention comprises a binding domain that specifically binds CLL-1.
- the antigen binding domain specifically binds human CLL-1.
- the antigen binding domain can be any domain that binds to the antigen including but not limited to a monoclonal antibody, a polyclonal antibody, a recombinant antibody, a human antibody, a humanized antibody, and a functional fragment thereof, including but not limited to a single-domain antibody such as a heavy chain variable domain (VH), a light chain variable domain (VL) and a variable domain (VHH) of camelid derived nanobody, and to an alternative scaffold known in the art to function as antigen binding domain, such as a recombinant fibronectin domain, and the like.
- VH heavy chain variable domain
- VL light chain variable domain
- VHH variable domain
- it is beneficial for the antigen binding domain to be derived from the same species in which the CAR will ultimately be used in.
- the antigen binding domain it is beneficial for the antigen binding domain to be derived from the same species in which the CAR will ultimately be used in.
- the antigen binding domain of the CAR may be beneficial for the antigen binding domain of the CAR to comprise human or humanized residues for the antigen binding domain of an antibody or antibody fragment.
- the antigen binding domain comprises a human antibody or an antibody fragment.
- the antigen binding domain comprises a human antibody or an antibody fragment.
- the human anti- CLL-1 binding domain comprises one or more (e.g., all three) light chain complementary determining region 1 (LC CDR1), light chain complementary determining region 2 (LC CDR2), and light chain complementary determining region 3 (LC CDR3) of a human anti- CLL-lbinding domain described herein, and/or one or more (e.g., all three) heavy chain complementary determining region 1 (HC CDR1), heavy chain complementary determining region 2 (HC CDR2), and heavy chain complementary determining region 3 (HC CDR3) of a human anti- CLL-1 binding domain described herein, e.g., a human anti- CLL-1 binding domain comprising one or more, e.g., all three, LC CDRs and one or more, e.g., all three, HC CDRs.
- the human anti- CLL-1 binding domain comprises one or more (e.g., all three) heavy chain complementary determining region 1 (HC C
- the human anti-CLL-1 binding domain has two variable heavy chain regions, each comprising a HC CDR1, a HC CDR2 and a HC CDR3 described herein.
- the human anti- CLL-1 binding domain comprises a human light chain variable region described herein (e.g., in Table 4) and/or a human heavy chain variable region described herein (e.g., in Table 3).
- the human anti- CLL-1 binding domain comprises a human heavy chain variable region described herein (e.g., in Table 3), e.g., at least two human heavy chain variable regions described herein (e.g., in Table 3).
- the anti- CLL-1 binding domain is a scFv comprising a light chain and a heavy chain of an amino acid sequence of Table 4.
- the anti- CLL-1 binding domain (e.g., an scFv) comprises: a light chain variable region comprising an amino acid sequence having at least one, two or three modifications (e.g., substitutions, e.g., conservative substitutions) but not more than 30, 20 or 10 modifications (e.g., substitutions, e.g., conservative substitutions) of an amino acid sequence of a light chain variable region provided in Table 4, or a sequence with 95-99% identity with an amino acid sequence of Table 4; and/or a heavy chain variable region comprising an amino acid sequence having at least one, two or three modifications (e.g., substitutions, e.g., conservative substitutions) but not more than 30, 20 or 10 modifications (e.g., substitutions, e.g., conservative substitutions) of an amino acid sequence of a heavy chain variable region provided in Table 3, or a sequence with 95-99% identity to an amino acid sequence of Table 3.
- a light chain variable region comprising an amino acid sequence having at least one, two or three modifications (e
- the human anti- CLL- lbinding domain comprises a sequence selected from a group consisting of SEQ ID NO:39-51, or a sequence with 95-99% identity thereof.
- the nucleic acid sequence encoding the human anti- CLL-1 binding domain comprises a sequence selected from a group consisting of SEQ ID NO:52-64, or a sequence with 95-99% identity thereof.
- the human anti- CLL-1 binding domain is a scFv, and a light chain variable region comprising an amino acid sequence described herein, e.g., in Table 2, is attached to a heavy chain variable region comprising an amino acid sequence described herein, e.g., in Table 2, via a linker, e.g., a linker described herein.
- the human anti- CLL-1 binding domain includes a (Gly 4 -Ser)n linker, wherein n is 1, 2, 3, 4, 5, or 6, preferably 3 or 4 (SEQ ID NO:26).
- the light chain variable region and heavy chain variable region of a scFv can be, e.g., in any of the following orientations: light chain variable region-linker-heavy chain variable region or heavy chain variable region-linker-light chain variable region.
- the antigen binding domain portion comprises one or more sequence selected from SEQ ID NOs:39-41.
- the CAR is selected from one or more sequence selected from SEQ ID NOs: 91-103, or 197.
- the anti- CLL-1 binding domain is characterized by particular functional features or properties of an antibody or antibody fragment.
- the portion of a CAR composition of the invention that comprises an antigen binding domain specifically binds human CLL-1.
- the invention relates to an antigen binding domain comprising an antibody or antibody fragment, wherein the antibody binding domain specifically binds to a CLL-1 protein or fragment thereof, wherein the antibody or antibody fragment comprises a variable light chain and/or a variable heavy chain that includes an amino acid sequence of SEQ ID NO: 39-51.
- the antigen binding domain comprises an amino acid sequence of an scFv selected from SEQ ID NOs: 39-51.
- the scFv is contiguous with and in the same reading frame as a leader sequence.
- the leader sequence is the polypeptide sequence provided as SEQ ID NO:l.
- the human anti- CLL-1 binding domain is a fragment, e.g., a single chain variable fragment (scFv).
- the human anti- CLL-1 binding domain is a Fv, a Fab, a (Fab')2, or a bi-functional (e.g. bi-specific) hybrid antibody (e.g., Lanzavecchia et al., Eur. J. Immunol. 17, 105 (1987)).
- the antibodies and fragments thereof of the invention binds a CLL-1 protein or a fragment thereof with wild- type or enhanced affinity.
- a human scFv be derived from a display library.
- a display library is a collection of entities; each entity includes an accessible polypeptide component and a recoverable component that encodes or identifies the polypeptide component.
- the polypeptide component is varied so that different amino acid sequences are represented.
- the polypeptide component can be of any length, e.g. from three amino acids to over 300 amino acids.
- a display library entity can include more than one polypeptide component, for example, the two polypeptide chains of a Fab.
- a display library can be used to identify a human CLL-1 binding domain. In a selection, the polypeptide component of each member of the library is probed with CLL-1, or a fragment there, and if the polypeptide component binds to CLL-1, the display library member is identified, typically by retention on a support.
- Retained display library members are recovered from the support and analyzed.
- the analysis can include amplification and a subsequent selection under similar or dissimilar conditions. For example, positive and negative selections can be alternated.
- the analysis can also include determining the amino acid sequence of the polypeptide component, i.e., the CLL- 1 binding domain, and purification of the polypeptide component for detailed characterization.
- phage display the protein component is typically covalently linked to a
- the linkage results from translation of a nucleic acid encoding the protein component fused to the coat protein.
- the linkage can include a flexible peptide linker, a protease site, or an amino acid incorporated as a result of suppression of a stop codon.
- Phage display is described, for example, in U.S. 5,223,409; Smith (1985) Science 228:1315-1317; WO 92/18619; WO 91/17271; WO 92/20791; WO 92/15679; WO 93/01288; WO 92/01047; WO 92/09690; WO 90/02809; de Haard et al. (1999) J. Biol. Chem 274:18218-30;
- Bacteriophage displaying the protein component can be grown and harvested using standard phage preparatory methods, e.g. PEG precipitation from growth media. After selection of individual display phages, the nucleic acid encoding the selected protein components can be isolated from cells infected with the selected phages or from the phage themselves, after amplification. Individual colonies or plaques can be picked, the nucleic acid isolated and sequenced.
- display formats include cell based display (see, e.g., WO 03/029456), protein- nucleic acid fusions (see, e.g., US 6,207,446), ribosome display (See, e.g., Mattheakis et al. (1994) Proc. Natl. Acad. Sci. USA 91:9022 and Hanes et al. (2000) Nat Biotechnol. 18:1287- 92; Hanes et al. (2000) Methods Enzymol. 328:404-30; and Schaffitzel et al. (1999) J Immunol Methods. 231(l-2):119-35), and E.
- scFvs can be prepared according to method known in the art (see, for example, Bird et al., (1988) Science 242:423-426 and Huston et al., (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883).
- ScFv molecules can be produced by linking VH and VL regions together using flexible polypeptide linkers.
- the scFv molecules comprise a linker (e.g., a Ser- Gly linker) with an optimized length and/or amino acid composition. The linker length can greatly affect how the variable regions of a scFv fold and interact.
- WO2007/024715 is incorporated herein by reference.
- An scFv can comprise a linker of at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, 50, or more amino acid residues between its VL and VH regions.
- the linker sequence may comprise any naturally occurring amino acid.
- the linker sequence comprises amino acids glycine and serine.
- the linker sequence comprises sets of glycine and serine repeats such as (Gly 4 Ser)n, where n is a positive integer equal to or greater than 1 (SEQ ID NO:25).
- the linker can be (Gly 4 Ser) 4 (SEQ ID NO:27) or (Gly 4 Ser) 3 (SEQ ID NO:28). Variation in the linker length may retain or enhance activity, giving rise to superior efficacy in activity studies.
- Exemplary CLL-1 CAR constructs disclose herein comprise an scFv (e.g., a human scFv as disclosed in Tables 2 herein, optionally preceded with an optional leader sequence (e.g., SEQ ID NO:l and SEQ ID NO: 12 for exemplary leader amino acid and nucleotide sequences, respectively).
- scFv e.g., a human scFv as disclosed in Tables 2 herein, optionally preceded with an optional leader sequence (e.g., SEQ ID NO:l and SEQ ID NO: 12 for exemplary leader amino acid and nucleotide sequences, respectively).
- the sequences of the human scFv fragments are provided herein in Table 2.
- the CLL-1 CAR construct can further include an optional hinge domain, e.g., a CD8 hinge domain (e.g., including the amino acid sequence of SEQ ID NO: 2 or encoded by a nucleic acid sequence of SEQ ID NO: 13); a transmembrane domain, e.g., a CD8
- transmembrane domain e.g., including the amino acid sequence of SEQ ID NO: 6 or encoded by the nucleotide sequence of SEQ ID NO: 17
- an intracellular domain e.g., a 4-1BB intracellular domain (e.g., including the amino acid sequence of SEQ ID NO: 7 or encoded by the nucleotide sequence of SEQ ID NO: 18
- a functional signaling domain e.g., a CD3 zeta domain (e.g., including amino acid sequence of SEQ ID NO: 9 or 10, or encoded by the nucleotide sequence of SEQ ID NO: 20 or 21).
- the domains are contiguous with and in the same reading frame to form a single fusion protein.
- the domain are in separate polypeptides, e.g., as in an RCAR molecule as described herein.
- the full length CLL-1 CAR molecule includes the amino acid sequence of, or is encoded by the nucleotide sequence of, CLL-1 CAR-1, CLL-1 CAR-2, CLL- 1 CAR-3, CLL-1 CAR-4, CLL-1 CAR-5, CLL-1 CAR-6, CL-L1 CAR-7, CLL-1 CAR-8, CLL- 1 CAR-9, CLL-1 CAR-10, CLL-1 CAR-11, CLL-1 CAR-12, CLL-1 CAR-13, 181268 provided in Table 2, or a sequence substantially (e.g., 95-99%) identical thereto.
- the CLL-1 CAR molecule, or the anti-CLL-1 antigen binding domain includes the scFv amino acid sequence of CLL-1 CAR-1, CLL-1 CAR-2, CLL-1 CAR-3, CLL-1 CAR-4, CLL-1 CAR-5, CLL-1 CAR-6, CL-L1 CAR-7, CLL-1 CAR-8, CLL-1 CAR-9, CLL-1 CAR-10, CLL-1 CAR-11, CLL-1 CAR-12, CLL-1 CAR-13, 181268, provided in Table 2; or includes the scFv amino acid sequence of, or is encoded by the nucleotide sequence of, CLL-1 CAR-1, CLL-1 CAR-2, CLL-1 CAR-3, CLL-1 CAR-4, CLL-1 CAR-5, CLL-1 CAR-6, CL-L1 CAR-7, CLL-1 CAR-8, CLL-1 CAR-9, CLL-1 CAR-10, CLL-1 CAR- 11, CLL-1 CAR-12, CLL-1 CAR
- the CLL-1 CAR molecule, or the anti-CLL-1 antigen binding domain includes the heavy chain variable region and/or the light chain variable region of CLL- 1 CAR-1, CLL-1 CAR-2, CLL-1 CAR-3, CLL-1 CAR-4, CLL-1 CAR-5, CLL-1 CAR-6, CLLI CAR-7, CLL-1 CAR-8, CLL-1 CAR-9, CLL-1 CAR-10, CLL-1 CAR-11, CLL-1 CAR-12, CLL-1 CAR-13, 181268, provided in Table 2, or a sequence substantially identical (e.g., 95- 99% identical, or up to 20, 15, 10, 8, 6, 5, 4, 3, 2, or 1 amino acid changes, e.g., substitutions (e.g., conservative substitutions)) to any of the aforesaid sequences.
- substitutions e.g., conservative substitutions
- the CLL-1 CAR molecule, or the anti-CLL-1 antigen binding domain includes one, two or three CDRs from the heavy chain variable region (e.g., HCDR1, HCDR2 and/or HCDR3), provided in Table 3; and/or one, two or three CDRs from the light chain variable region (e.g., LCDRl, LCDR2 and/or LCDR3) of CLL-1 CAR-1, CLL-1 CAR-2, CLL-1 CAR-3, CLL-1 CAR-4, CLL-1 CAR-5, CLL-1 CAR-6, CL-L1 CAR-7, CLL-1 CAR-8, CLL-1 CAR-9, CLL-1 CAR-10, CLL-1 CAR-11, CLL-1 CAR-12, CLL-1 CAR-13, 181268, provided in Table 4; or a sequence substantially identical (e.g., 95-99% identical, or up to 5, 4, 3, 2, or 1 amino acid changes, e.g., substitutions (e.g., conservative substitutions))
- the CLL-1 CAR molecule, or the anti-CLL-1 antigen binding domain includes one, two or three CDRs from the heavy chain variable region (e.g., HCDR1, HCDR2 and/or HCDR3), provided in Table 5; and/or one, two or three CDRs from the light chain variable region (e.g., LCDRl, LCDR2 and/or LCDR3) of CLL-1 CAR-1, CLL-1 CAR-2, CLL-1 CAR-3, CLL-1 CAR-4, CLL-1 CAR-5, CLL-1 CAR-6, CL-L1 CAR-7, CLL-1 CAR-8, CLL-1 CAR-9, CLL-1 CAR-10, CLL-1 CAR-11, CLL-1 CAR-12, CLL-1 CAR-13, 181268, provided in Table 6; or a sequence substantially identical (e.g., 95-99% identical, or up to 5, 4, 3, 2, or 1 amino acid changes, e.g., substitutions (e.g., conservative substitutions))
- the CLL-1 CAR molecule, or the anti-CLL-1 antigen binding domain includes one, two or three CDRs from the heavy chain variable region (e.g., HCDR1, HCDR2 and/or HCDR3), provided in Table 7; and/or one, two or three CDRs from the light chain variable region (e.g., LCDRl, LCDR2 and/or LCDR3) of CLL-1 CAR-1, CLL-1 CAR-2, CLL-1 CAR-3, CLL-1 CAR-4, CLL-1 CAR-5, CLL-1 CAR-6, CL-Ll CAR-7, CLL-1 CAR-8, CLL-1 CAR-9, CLL-1 CAR- 10, CLL-1 CAR-11, CLL-1 CAR-12, CLL-1 CAR- 13, 181268, provided in Table 8; or a sequence substantially identical (e.g., 95-99% identical, or up to 5, 4, 3, 2, or 1 amino acid changes, e.g., substitutions (e.g., conservative substitutions))
- the CDRs provided in Tables 3 and 4 are according to a combination of the Kabat and Chothia numbering scheme.
- the CAR molecule described herein (e.g., the CAR nucleic acid or the CAR polypeptide) includes:
- LC CDRs chosen from one of the following: (i) a LC CDRl of SEQ ID NO: 156, LC CDR2 of SEQ ID NO: 169 and LC CDR3 of
- the CAR molecule described herein e.g., the CAR nucleic acid or the CAR polypeptide
- a CLL-1 binding domain includes:
- LC CDRs chosen from one of the following:
- the CAR molecule described herein (e.g., the CAR nucleic acid or the CAR polypeptide) includes:
- LC CDRs chosen from one of the following:
- the order in which the VL and VH domains appear in the scFv is varied (i.e., VL-VH, or VH-VL orientation), and where either three or four copies of the "G4S' (SEQ ID NO:25) subunit, in which each subunit comprises the sequence GGGGS (SEQ ID NO:25) (e.g., (G4S) 3 (SEQ ID NO:28) or (G4S) 4 (SEQ ID NO:27)), connect the variable domains to create the entirety of the scFv domain, as shown in Table 2.
- the amino acid and nucleic acid sequences of the CLL-1 scFv domains and CLL-1 CAR molecules are provided in Table 2.
- amino acid sequences for the variable heavy chain and variable light chain for each scFv is also provided in Table 2 It is noted that the scFv fragments (SEQ ID NOs: 39-51) with a leader sequence (e.g., the amino acid sequence of SEQ ID NO: 1 or the nucleotide sequence of SEQ ID NO: 12) are also encompassed by the present invention.
- CD8 hinge amino acid sequence (SEQ ID NO: 2)
- CD28 Intracellular domain (amino acid sequence) (SEQ ID NO: 482) RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS (SEQ ID NO: 482)
- CD28 Intracellular domain (nucleotide sequence) (SEQ ID NO: 483)
- ICOS Intracellular domain (amino acid sequence) (SEQ ID NO: 484)
- ICOS Intracellular domain (nucleotide sequence) (SEQ ID NO: 485)
- CD3 zeta domain (amino acid sequence) (SEQ ID NO: 9)
- CD3 zeta domain (amino acid sequence; NCBI Reference Sequence NM_000734.3) (SEQ ID NO:10)
- CD3 zeta nucleic acid sequence; NCBI Reference Sequence NM_000734.3); (SEQ ID NO: 1
- IgG4 Hinge amino acid sequence (SEQ ID NO:36)
- IgG4 Hinge (nucleotide sequence) (SEQ ID NO:37)
- these clones (e.g., in Table 2) all contained a Q/K residue change in the signal domain of the co-stimulatory domain derived from CD3zeta chain.
- the CAR scFv fragments were then cloned into lentiviral vectors to create a full length CAR construct in a single coding frame, and using the EF1 alpha promoter for expression (SEQ ID NO: 11).
- Gly/Ser SEQ ID NO:26: This sequence may encompass 1-6 "Gly Gly Gly Gly Ser" repeating units
- PolyA (A) 500 o (SEQ ID NO:30)
- This sequence may encompass 50-5000 adenines.
- This sequence may encompass 50-5000 thymines.
- PolyA (A) 500 o (SEQ ID NO:33)
- This sequence may encompass 100-5000 adenines.
- PolyA (A) 400 (SEQ ID NO:34) PolyA: (A) 2000 (SEQ ID NO:35) Gly/Ser (SEQ ID NO:38): This sequence may encompass 1-10 "Gly Gly Gly Ser" repeating units
- the CLL-1 CAR may comprise one or more, e.g., one, two, or three, CDRs of the heavy chain variable domain and/or one or more, e.g., one, two, or three, CDRs of the light chain variable domain, or the variable heavy chain (VH) or the variable light chain (VL) of of the anti-CLL-1 (CLEC12A) antibody disclosed in PCT Publication
- the CAR scFv fragments can be cloned into lenti viral vectors to create a full length
- the CAR construct can include a Gly/Ser linker having one or more of the following sequences: GGGGS (SEQ ID NO:25); encompassing 1-6 "Gly Gly Gly Gly Ser" repeating units, e.g., GGGGSGGGGS GGGGSGGGGS GGGGSGGGGS (SEQ ID NO:26);
- GGGGSGGGGS GGGGSGGGGS SEQ ID NO:27
- GGGGSGGGGS GGGGS SEQ ID NO:28
- GGGS SEQ ID NO:29
- Gly Gly Gly Ser repeating units, e.g., GGGSGGGSGG GSGGGSGGGSGGGSGG GSGGGSGGGS (SEQ ID NO:38).
- the CAR construct include a poly A sequence, e.g., a sequence encompassing 50-5000 or 100-5000 adenines (e.g., SEQ ID NO:30, SEQ ID NO:33, SEQ ID NO:34 or SEQ ID NO:35), or a sequence encompassing 50-5000 thymines (e.g., SEQ ID NO:31, SEQ ID NO:32).
- the CAR construct can include, for example, a linker including the sequence GSTSGSGKPGSGEGSTKG (SEQ ID NO: 486)
- a multispecific antibody molecule is a bispecific antibody molecule.
- a bispecific antibody has specificity for no more than two antigens.
- a bispecific antibody molecule is characterized by a first immunoglobulin variable domain sequence which has binding specificity for a first epitope and a second immunoglobulin variable domain sequence that has binding specificity for a second epitope.
- the first and second epitopes are on the same antigen, e.g., the same protein (or subunit of a multimeric protein).
- the first and second epitopes overlap.
- the first and second epitopes do not overlap.
- first and second epitopes are on different antigens, e.g., different proteins (or different subunits of a multimeric protein).
- a bispecific antibody molecule comprises a heavy chain variable domain sequence and a light chain variable domain sequence which have binding specificity for a first epitope and a heavy chain variable domain sequence and a light chain variable domain sequence which have binding specificity for a second epitope.
- a bispecific antibody molecule comprises a half antibody having binding specificity for a first epitope and a half antibody having binding specificity for a second epitope.
- a bispecific antibody molecule comprises a half antibody, or fragment thereof, having binding specificity for a first epitope and a half antibody, or fragment thereof, having binding specificity for a second epitope.
- a bispecific antibody molecule comprises a scFv, or fragment thereof, have binding specificity for a first epitope and a scFv, or fragment thereof, have binding specificity for a second epitope.
- the antibody molecule is a multi- specific (e.g., a bispecific or a trispecific) antibody molecule.
- Protocols for generating bispecific or heterodimeric antibody molecules are known in the art; including but not limited to, for example, the "knob in a hole" approach described in, e.g., US 5731168; the electrostatic steering Fc pairing as described in, e.g., WO 09/089004, WO 06/106905 and WO 2010/129304; Strand Exchange Engineered Domains (SEED) heterodimer formation as described in, e.g., WO 07/110205; Fab arm exchange as described in, e.g., WO 08/119353, WO 2011/131746, and WO 2013/060867;
- SEED Strand Exchange Engineered Domains
- double antibody conjugate e.g., by antibody cross-linking to generate a bi-specific structure using a heterobifunctional reagent having an amine-reactive group and a sulfhydryl reactive group as described in, e.g., US 4433059; bispecific antibody determinants generated by recombining half antibodies (heavy-light chain pairs or Fabs) from different antibodies through cycle of reduction and oxidation of disulfide bonds between the two heavy chains, as described in, e.g., US 4444878; Afunctional antibodies, e.g., three Fab' fragments cross-linked through sulfhdryl reactive groups, as described in, e.g., US5273743; biosynthetic binding proteins, e.g., pair of scFvs cross-linked through C-terminal tails preferably through disulfide or amine- reactive chemical cross-linking, as described in, e.g., US5534254; bifunctional antibodies, e.g.,
- the VH can be upstream or downstream of the VL.
- the upstream antibody or antibody fragment e.g., scFv
- the downstream antibody or antibody fragment is arranged with its VL (VL 2 ) upstream of its VH (VH 2 ), such that the overall bispecific antibody molecule has the arrangement VHi-VLi-VL 2 -VH 2 .
- the upstream antibody or antibody fragment (e.g., scFv) is arranged with its VL (VLi) upstream of its VH (VHi) and the downstream antibody or antibody fragment (e.g., scFv) is arranged with its VH (VH 2 ) upstream of its VL (VL 2 ), such that the overall bispecific antibody molecule has the arrangement VLi- VHi-VH 2 -VL 2 .
- a linker is disposed between the two antibodies or antibody fragments (e.g., scFvs), e.g., between VLi and VL 2 if the construct is arranged as VH VLi- VL 2 -VH 2 , or between VHi and VH 2 if the construct is arranged as VLi-VH VH 2 -VL 2 .
- the linker may be a linker as described herein, e.g., a (Gly 4 -Ser)n linker, wherein n is 1, 2, 3, 4, 5, or 6, preferably 4 (SEQ ID NO: 64).
- the linker between the two scFvs should be long enough to avoid mispairing between the domains of the two scFvs.
- a linker is disposed between the VL and VH of the first scFv.
- a linker is disposed between the VL and VH of the second scFv.
- any two or more of the linkers can be the same or different.
- a bispecific CAR comprises VLs, VHs, and optionally one or more linkers in an arrangement as described herein.
- the bispecific antibody molecule is characterized by a first immunoglobulin variable domain sequence, e.g., a scFv, which has binding specificity for CLL-1, e.g., comprises a scFv as described herein, e.g., as described in Table 2, or comprises the light chain CDRs and/or heavy chain CDRs from a CLL-1 scFv described herein, and a second immunoglobulin variable domain sequence that has binding specificity for a second epitope on a different antigen.
- the second immunoglobulin variable domain sequence has binding specificity for an antigen expressed on AML cells, e.g., an antigen other than CLL-1.
- the second immunoglobulin variable domain sequence has binding specificity for CD123.
- the second immunoglobulin variable domain sequence has binding specificity for CD33.
- the second immunoglobulin variable domain sequence has binding specificity for CD34.
- the second immunoglobulin variable domain sequence has binding specificity for FLT3.
- the second immunoglobulin variable domain sequence has binding specificity for folate receptor beta.
- the second immunoglobulin variable domain sequence has binding specificity for an antigen expressed on B-cells, for example, CD19, CD20, CD22 or ROR1.
- the CLL-1 antibodies and antibody fragments of the present invention can be grafted to one or more constant domain of a T cell receptor (“TCR") chain, for example, a TCR alpha or TCR beta chain, to create an chimeric TCR that binds specificity to CLL-1.
- TCR T cell receptor
- chimeric TCRs will signal through the TCR complex upon antigen binding.
- a CLL-1 scFv as disclosed herein can be grafted to the constant domain, e.g., at least a portion of the extracellular constant domain, the transmembrane domain and the cytoplasmic domain, of a TCR chain, for example, the TCR alpha chain and/or the TCR beta chain.
- a CLL-1 antibody fragment for example a VL domain as described herein
- a CLL-1 antibody fragment for example a VH domain as described herein
- a VL domain may be grafted to the constant domain of the TCR beta chain
- a VH domain may be grafted to a TCR alpha chain
- the CDRs of a CLL-1 antibody or antibody fragment may be grafted into a TCR alpha and/or beta chain to create a chimeric TCR that binds specifically to CLL-1.
- the LCDRs disclosed herein may be grafted into the variable domain of a TCR alpha chain and the HCDRs disclosed herein may be grafted to the variable domain of a TCR beta chain, or vice versa.
- Such chimeric TCRs may be produced by methods known in the art (For example, Willemsen RA et al, Gene Therapy 2000; 7: 1369-1377; Zhang T et al, Cancer Gene Ther 2004; 11 : 487- 496; Aggen et al, Gene Ther. 2012 Apr;19(4):365-74).
- a CAR can be designed to comprise a transmembrane domain that is attached to the extracellular domain of the CAR.
- a transmembrane domain can include one or more additional amino acids adjacent to the transmembrane region, e.g., one or more amino acid associated with the extracellular region of the protein from which the transmembrane was derived (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 up to 15 amino acids of the extracellular region) and/or one or more additional amino acids associated with the intracellular region of the protein from which the transmembrane protein is derived (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 up to 15 amino acids of the intracellular region).
- the transmembrane domain is one that is associated with one of the other domains of the CAR is used.
- the transmembrane domain can be selected or modified by amino acid substitution to avoid binding of such domains to the transmembrane domains of the same or different surface membrane proteins, e.g., to minimize interactions with other members of the receptor complex.
- the transmembrane domain is capable of
- the amino acid sequence of the transmembrane domain may be modified or substituted so as to minimize interactions with the binding domains of the native binding partner present in the same CART.
- the transmembrane domain may be derived either from a natural or from a recombinant source. Where the source is natural, the domain may be derived from any membrane-bound or transmembrane protein. In one aspect the transmembrane domain is capable of signaling to the intracellular domain(s) whenever the CAR has bound to a target.
- a transmembrane domain of particular use in this invention may include at least the transmembrane region(s) of e.g., the alpha, beta or zeta chain of the T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD 8 (e.g., CD8 alpha, CD8 beta), CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154.
- a transmembrane domain may include at least the transmembrane region(s) of a costimulatory molecule, e.g., a MHC class I molecule, TNF receptor proteins, Immunoglobulin-like proteins, cytokine receptors, integrins, signaling lymphocytic activation molecules (SLAM proteins), activating NK cell receptors, BTLA, a Toll ligand receptor, OX40, CD2, CD7, CD27, CD28, CD30, CD40, CDS, ICAM-1, LFA-1
- a costimulatory molecule e.g., a MHC class I molecule, TNF receptor proteins, Immunoglobulin-like proteins, cytokine receptors, integrins, signaling lymphocytic activation molecules (SLAM proteins), activating NK cell receptors, BTLA, a Toll ligand receptor, OX40, CD2, CD7, CD27, CD28, CD30, CD40, CDS, ICAM-1
- CDl la/CD18 4-1BB (CD137), B7-H3, CDS, ICAM-1, ICOS (CD278), GITR, BAFFR, LIGHT, HVEM (LIGHTR), KIRDS2, SLAMF7, NKp80 (KLRF1), NKp44, NKp30, NKp46, CD19, CD4, CD8alpha, CD8beta, IL2R beta, IL2R gamma, IL7R alpha, ITGA4, VLA1, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CDl ld, ITGAE, CD103, ITGAL, CDl la, LFA-1, ITGAM, CDl lb, ITGAX, CDl lc, ITGB1, CD29, ⁇ 2, CD18,
- the transmembrane domain can be attached to the extracellular region of the CAR, e.g., the antigen binding domain of the CAR, via a hinge, e.g., a hinge from a human protein.
- a hinge e.g., a hinge from a human protein.
- the hinge can be a human Ig
- the hinge or spacer comprises (e.g., consists of) the amino acid sequence of SEQ ID NO:2.
- the transmembrane domain comprises (e.g., consists of) a transmembrane domain of SEQ ID NO: 6.
- the hinge or spacer comprises an IgG4 hinge.
- the hinge or spacer comprises a hinge of the amino acid sequence
- the hinge or spacer comprises a hinge encoded by a nucleotide sequence of
- the hinge or spacer comprises an IgD hinge.
- the hinge or spacer comprises a hinge of the amino acid sequence
- the hinge or spacer comprises a hinge encoded by a nucleotide sequence of
- the transmembrane domain may be recombinant, in which case it will comprise predominantly hydrophobic residues such as leucine and valine.
- a triplet of phenylalanine, tryptophan and valine can be found at each end of a recombinant
- a short oligo- or polypeptide linker may form the linkage between the transmembrane domain and the cytoplasmic region of the CAR.
- a glycine- serine doublet provides a particularly suitable linker.
- the linker comprises the amino acid sequence of GGGGSGGGGS (SEQ ID NO:5).
- the linker is encoded by a nucleotide sequence of
- the hinge or spacer comprises a KIR2DS2 hinge.
- the cytoplasmic domain or region of a CAR of the present invention includes an intracellular signaling domain.
- An intracellular signaling domain is generally responsible for activation of at least one of the normal effector functions of the immune cell in which the CAR has been introduced.
- intracellular signaling domains for use in the CAR of the invention include the cytoplasmic sequences of the T cell receptor (TCR) and co-receptors that act in concert to initiate signal transduction following antigen receptor engagement, as well as any derivative or variant of these sequences and any recombinant sequence that has the same functional capability.
- TCR T cell receptor
- T cell activation can be said to be mediated by two distinct classes of cytoplasmic signaling sequences: those that initiate antigen-dependent primary activation through the TCR (primary intracellular signaling domains) and those that act in an antigen-independent manner to provide a secondary or costimulatory signal (secondary cytoplasmic domain, e.g., a costimulatory domain).
- primary intracellular signaling domains that act in a stimulatory manner may contain signaling motifs which are known as immunoreceptor tyrosine-based activation motifs or ITAMs.
- IT AM containing primary intracellular signaling domains examples include those of TCR zeta, FcR gamma, FcR beta, CD3 gamma, CD3 delta , CD3 epsilon, CD5, CD22, CD79a, CD79b, , CD278 (also known as "ICOS"), FcsRI, DAP10, DAP12, and CD66d.
- a CAR of the invention comprises an intracellular signaling domain, e.g., a primary signaling domain of CD3-zeta.
- a primary signaling domain comprises a modified ITAM domain, e.g., a mutated ITAM domain which has altered (e.g., increased or decreased) activity as compared to the native ITAM domain.
- a primary signaling domain comprises a modified ITAM-containing primary intracellular signaling domain, e.g., an optimized and/or truncated ITAM-containing primary intracellular signaling domain.
- a primary signaling domain comprises one, two, three, four or more ITAM motifs.
- molecules containing a primary intracellular signaling domain that are of particular use in the invention include those of DAP10, DAP12, and CD32.
- the intracellular signalling domain of the CAR can comprise the primary signalling domain, e.g., CD3-zeta signaling domain, by itself or it can be combined with any other desired intracellular signaling domain(s) useful in the context of a CAR of the invention.
- the intracellular signaling domain of the CAR can comprise a primary signalling domain, e.g., CD3 zeta chain portion, and a costimulatory signaling domain.
- the costimulatory signaling domain refers to a portion of the CAR comprising the intracellular domain of a costimulatory molecule.
- a costimulatory molecule is a cell surface molecule other than an antigen receptor or its ligands that is required for an efficient response of lymphocytes to an antigen.
- MHC class I molecules examples include a MHC class I molecule, TNF receptor proteins, Immunoglobulin-like proteins, cytokine receptors, integrins, signaling lymphocytic activation molecules (SLAM proteins), activating NK cell receptors, BTLA, a Toll ligand receptor, OX40, CD2, CD7, CD27, CD28, CD30, CD40, CDS, ICAM-1, LFA-1 (CDl la/CD18), 4-1BB (CD137), B7-H3, CDS, ICAM-1, ICOS (CD278), GITR, BAFFR, LIGHT, HVEM (LIGHTR), KIRDS2,
- TRANCE/RANKL DNAM1 (CD226), SLAMF4 (CD244, 2B4), CD84, CD96 (Tactile), CEACAM1, CRT AM, Ly9 (CD229), CD160 (BY55), PSGL1, CD100 (SEMA4D), CD69, SLAMF6 (NTB-A, Lyl08), SLAM (SLAMF1, CD150, IPO-3), BLAME (SLAMF8), SELPLG (CD162), LTBR, LAT, GADS, SLP-76, PAG/Cbp, CD19a, and a ligand that specifically binds with CD83, and the like.
- the intracellular signaling sequences within the cytoplasmic portion of the CAR of the invention may be linked to each other in a random or specified order.
- a short oligo- or polypeptide linker for example, between 2 and 10 amino acids (e.g., 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acids) in length may form the linkage between intracellular signaling sequence.
- a glycine- serine doublet can be used as a suitable linker.
- a single amino acid e.g., an alanine, a glycine, can be used as a suitable linker.
- the intracellular signaling domain is designed to comprise two or more, e.g., 2, 3, 4, 5, or more, costimulatory signaling domains.
- the two or more, e.g., 2, 3, 4, 5, or more, costimulatory signaling domains are separated by a linker molecule, e.g., a linker molecule described herein.
- the intracellular signaling domain comprises two costimulatory signaling domains.
- the linker molecule is a glycine residue. In some embodiments, the linker is an alanine residue.
- the intracellular signaling domain is designed to comprise the signaling domain of CD3-zeta and the signaling domain of CD28. In one aspect, the intracellular signaling domain is designed to comprise the signaling domain of CD3-zeta and the signaling domain of 4-1BB. In one aspect, the signaling domain of 4-1BB is a signaling domain of SEQ ID NO: 7. In one aspect, the signaling domain of CD3-zeta is a signaling domain of SEQ ID NO: 9 (mutant CD3 zeta) or SEQ ID NO: 10 (wild- type human CD3 zeta).
- the intracellular signaling domain is designed to comprise the signaling domain of CD3-zeta and the signaling domain of CD27.
- the signaling domain of CD27 comprises an amino acid sequence of
- the signaling domain of CD27 is encoded by a nucleic acid sequence of
- the intracellular is designed to comprise the signaling domain of CD3- zeta and the signaling domain of CD28.
- the signaling domain of CD28 comprises an amino acid sequence of SEQ ID NO: 482.
- the signaling domain of CD28 is encoded by a nucleic acid sequence of SEQ ID NO: 483.
- the intracellular is designed to comprise the signaling domain of CD3- zeta and the signaling domain of ICOS.
- the signaling domain of CD28 comprises an amino acid sequence of SEQ ID NO: 484.
- the signaling domain of ICOS is encoded by a nucleic acid sequence of SEQ ID NO: 485.
- the CAR-expressing cell described herein can further comprise a second
- the CAR e.g., a second CAR that includes a different antigen binding domain, e.g., to the same target (CLL-1) or a different target (e.g., CD123, CD33, CD34, FLT3, or folate receptor beta).
- the second CAR includes an antigen binding domain to a target expressed on acute myeloid leukemia cells, such as, e.g., CD123, CD33, CD34, FLT3, or folate receptor beta.
- the CAR-expressing cell comprises a first CAR that specifically binds a first antigen and includes an intracellular signaling domain having a costimulatory signaling domain but not a primary signaling domain, and a second CAR that specifically binds a second, different, antigen and includes an intracellular signaling domain having a primary signaling domain but not a costimulatory signaling domain.
- a costimulatory signaling domain e.g., 4-1BB, CD28, CD27, ICOS, or OX-40
- placement of a costimulatory signaling domain e.g., 4-1BB, CD28, CD27, ICOS, or OX-40
- the primary signaling domain e.g.,CD3 zeta
- the CAR expressing cell comprises a first CLL-1 CAR that includes a CLL-1 binding domain, a transmembrane domain and a costimulatory domain and a second CAR that specifically binds an antigen other than CLL-1 (e.g., an antigen expressed on AML cells, e.g., CD123, CD33, CD34, FLT3, or folate receptor beta) and includes an antigen binding domain, a transmembrane domain and a primary signaling domain.
- an antigen other than CLL-1 e.g., an antigen expressed on AML cells, e.g., CD123, CD33, CD34, FLT3, or folate receptor beta
- the CAR expressing cell comprises a first CLL-1 CAR that includes a CLL-1 binding domain, a transmembrane domain and a primary signaling domain and a second CAR that specifically binds an antigen other than CLL-1 (e.g., an antigen expressed on AML cells, e.g., CD123, CD33, CD34, FLT3, or folate receptor beta) and includes an antigen binding domain to the antigen, a transmembrane domain and a costimulatory signaling domain.
- an antigen other than CLL-1 e.g., an antigen expressed on AML cells, e.g., CD123, CD33, CD34, FLT3, or folate receptor beta
- the CAR-expressing cell comprises a CLL-1 CAR described herein and an inhibitory CAR.
- the inhibitory CAR comprises an antigen binding domain that binds an antigen found on normal cells but not cancer cells, e.g., normal cells that also express CLL.
- the inhibitory CAR comprises the antigen binding domain, a transmembrane domain and an intracellular domain of an inhibitory molecule.
- the intracellular domain of the inhibitory CAR can be an intracellular domain of PDl, PD-L1, PD-L2, CTLA4, TIM3, CEACAM (e.g., CEACAM-1, CEACAM-3 and/or CEACAM- 5), LAG3, VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4, CD80, CD86, B7-H3 (CD276), B7- H4 (VTCN1), HVEM (TNFRSF14 or CD270), KIR, A2aR, MHC class I, MHC class II, GAL9, adenosine, and TGFR beta.
- CEACAM e.g., CEACAM-1, CEACAM-3 and/or CEACAM- 5
- LAG3, VISTA BTLA
- TIGIT LAIR1
- LAIR1 LAG3, VISTA
- BTLA TIGIT
- LAIR1 LAG3, VISTA
- BTLA TIGIT
- LAIR1 LAIR1
- the antigen binding domains of the different CARs can be such that the antigen binding domains do not interact with one another.
- a cell expressing a first and second CAR can have an antigen binding domain of the first CAR, e.g., as a fragment, e.g., an scFv, that does not form an association with the antigen binding domain of the second CAR, e.g., the antigen binding domain of the second CAR is a VHH.
- the antigen binding domain comprises a single domain antigen binding (SDAB) molecules include molecules whose complementary determining regions are part of a single domain polypeptide. Examples include, but are not limited to, heavy chain variable domains, binding molecules naturally devoid of light chains, single domains derived from conventional 4-chain antibodies, engineered domains and single domain scaffolds other than those derived from antibodies. SDAB molecules may be any of the art, or any future single domain molecules. SDAB molecules may be derived from any species including, but not limited to mouse, human, camel, llama, lamprey, fish, shark, goat, rabbit, and bovine. This term also includes naturally occurring single domain antibody molecules from species other than Camelidae and sharks.
- SDAB single domain antigen binding
- an SDAB molecule can be derived from a variable region of the immunoglobulin found in fish, such as, for example, that which is derived from the
- immunoglobulin isotype known as Novel Antigen Receptor (NAR) found in the serum of shark.
- NAR Novel Antigen Receptor
- Methods of producing single domain molecules derived from a variable region of NAR are described in WO 03/014161 and Streltsov (2005) Protein Sci. 14:2901-2909.
- an SDAB molecule is a naturally occurring single domain antigen binding molecule known as heavy chain devoid of light chains.
- Such single domain molecules are disclosed in WO 9404678 and Hamers-Casterman, C. et al. (1993) Nature 363:446-448, for example.
- this variable domain derived from a heavy chain molecule naturally devoid of light chain is known herein as a VHH or nanobody to distinguish it from the conventional VH of four chain immunoglobulins.
- a VHH molecule can be derived from Camelidae species, for example in camel, llama, dromedary, alpaca and guanaco. Other species besides Camelidae may produce heavy chain molecules naturally devoid of light chain; such VHHs are within the scope of the invention.
- the SDAB molecules can be recombinant, CDR-grafted, humanized, camelized, de- immunized and/or in vitro generated (e.g., selected by phage display).
- cells having a plurality of chimeric membrane embedded receptors comprising an antigen binding domain that interactions between the antigen binding domain of the receptors can be undesirable, e.g., because it inhibits the ability of one or more of the antigen binding domains to bind its cognate antigen.
- cells having a first and a second non-naturally occurring chimeric membrane embedded receptor comprising antigen binding domains that minimize such interactions are also disclosed herein.
- nucleic acids encoding a first and a second non-naturally occurring chimeric membrane embedded receptor comprising a antigen binding domains that minimize such interactions, as well as methods of making and using such cells and nucleic acids.
- the antigen binding domain of one of said first said second non- naturally occurring chimeric membrane embedded receptor comprises an scFv
- the other comprises a single VH domain, e.g., a camelid, shark, or lamprey single VH domain, or a single VH domain derived from a human or mouse sequence.
- the claimed invention comprises a first and second CAR, wherein the antigen binding domain of one of said first CAR said second CAR does not comprise a variable light domain and a variable heavy domain.
- the antigen binding domain of one of said first CAR said second CAR is an scFv, and the other is not an scFv.
- the antigen binding domain of one of said first CAR said second CAR comprises a single VH domain, e.g., a camelid, shark, or lamprey single VH domain, or a single VH domain derived from a human or mouse sequence.
- a single VH domain e.g., a camelid, shark, or lamprey single VH domain, or a single VH domain derived from a human or mouse sequence.
- the antigen binding domain of one of said first CAR said second CAR comprises a nanobody. In some embodiments, the antigen binding domain of one of said first CAR said second CAR comprises a camelid VHH domain. In some embodiments, the antigen binding domain of one of said first CAR said second
- the CAR comprises an scFv, and the other comprises a single VH domain, e.g., a camelid, shark, or lamprey single VH domain, or a single VH domain derived from a human or mouse sequence.
- the antigen binding domain of one of said first CAR said second CAR comprises an scFv, and the other comprises a nanobody.
- the antigen binding domain of one of the first CAR or the second CAR comprises an scFv, and the other comprises a camelid VHH domain.
- binding of the antigen binding domain of said first CAR to its cognate antigen is not substantially reduced by the presence of said second CAR. In some embodiments, binding of the antigen binding domain of said first CAR to its cognate antigen in the presence of said second CAR is 85%, 90%, 95%, 96%, 97%, 98% or 99% of binding of the antigen binding domain of said first CAR to its cognate antigen in the absence of said second CAR.
- the antigen binding domains of said first CAR said second CAR when present on the surface of a cell, associate with one another less than if both were scFv antigen binding domains. In some embodiments, the antigen binding domains of said first CAR said second CAR, associate with one another 85%, 90%, 95%, 96%, 97%, 98% or 99% less than if both were scFv antigen binding domains.
- the CAR-expressing cell described herein can further express another agent, e.g., an agent which enhances the activity of a CAR-expressing cell.
- the agent can be an agent which inhibits an inhibitory molecule.
- Inhibitory molecules e.g., PDl, can, in some embodiments, decrease the ability of a CAR-expressing cell to mount an immune effector response.
- inhibitory molecules include PDl, PD-Ll, PD-L2, CTLA4, TIM3, CEACAM (e.g., CEACAM-1, CEACAM-3 and/or CEACAM-5), LAG3, VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4, CD80, CD86, B7-H3 (CD276), B7-H4 (VTCNl), HVEM (TNFRSF14 or CD270), KIR, A2aR, MHC class I, MHC class II, GAL9, adenosine, and TGFR beta.
- CEACAM e.g., CEACAM-1, CEACAM-3 and/or CEACAM-5
- LAG3, VISTA e.g., VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4, CD80, CD86, B7-H3 (CD276), B7-H4 (VTCNl), HVEM (TNFRSF14 or CD270)
- KIR A2
- the agent which inhibits an inhibitory molecule comprises a first polypeptide, e.g., an inhibitory molecule, associated with a second polypeptide that provides a positive signal to the cell, e.g., an intracellular signaling domain described herein.
- the agent comprises a first polypeptide, e.g., of an inhibitory molecule such as PDl, PD-Ll, PD-L2, CTLA4, TIM3, CEACAM (e.g., CEACAM- 1, CEACAM-3 and/or CEACAM-5), LAG3, VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4, CD80, CD86, B7-H3 (CD276), B7-H4 (VTCNl), HVEM (TNFRSF14 or CD270), KIR, A2aR, MHC class I, MHC class II, GAL9, adenosine, and TGFR beta, or a fragment of any of these (e.g., at least a portion of an extracellular domain of any of these), and a second polypeptide which is an intracellular signaling domain described herein (e.g., comprising a costimulatory domain (e.g., 4-1BB, CD27, ICOS, or CD28,
- the agent comprises a first polypeptide of PDl or a fragment thereof (e.g., at least a portion of an extracellular domain of PDl), and a second polypeptide of an intracellular signaling domain described herein (e.g., a CD28 signaling domain described herein and/or a CD3 zeta signaling domain described herein).
- the CAR-expressing cell described herein comprises a switch costimulatory receptor, e.g., as described in WO 2013/019615, which is incorporated herein by reference in its entirety.
- PDl is an inhibitory member of the CD28 family of receptors that also includes CD28, CTLA-4, ICOS, and BTLA.
- PD-1 is expressed on activated B cells, T cells and myeloid cells (Agata et al. 1996 Int. Immunol 8:765-75).
- Two ligands for PDl, PD-Ll and PD-L2 have been shown to downregulate T cell activation upon binding to PDl (Freeman et a. 2000 J Exp Med 192:1027-34; Latchman et al. 2001 Nat Immunol 2:261-8; Carter et al. 2002 Eur J Immunol 32:634-43).
- PD-L1 is abundant in human cancers (Dong et al. 2003 J Mol Med 81:281-7; Blank et al. 2005 Cancer Immunol.
- the agent comprises the extracellular domain (ECD) of an inhibitory molecule, e.g., Programmed Death 1 (PD1), can be fused to a transmembrane domain and intracellular signaling domains such as 4 IBB and CD3 zeta (also referred to herein as a PD1 CAR).
- the PD1 CAR when used in combinations with a CLL-1 CAR described herein, improves the persistence of the CAR-expressing cell, e.g., T cell or NK cell.
- the CAR is a PD1 CAR comprising the extracellular domain of PD1 indicated as underlined in SEQ ID NO: 24.
- the PD1 CAR comprises the amino acid sequence of SEQ ID NO: 24.
- the PD1 CAR comprises the amino acid sequence provided below (SEQ ID NO:22). pgwfldspdrpwnpptfspallvvtegdnatftcsfsntsesfylnwyrmspsnqtdklaafpedrsqpgqdcrfrvtqlp ngrdfhmsvyrarrndsgtylcgaislapkaqikeslraelrvterraevptahpspsprpagqfqtlvtttpaprpptpaptiasqplslr peacrpaaggavhtrgldfacdiyiwaplagtcgvlllslvitlyclfl-grldcllyifkqpfmrpvqttqeedgcscrfpeeee kfsrsadapaykqgqn
- the nucleic acid sequence for the PD1 CAR is shown below, with the PD1 ECD underlined below in SEQ ID NO: 23 atggccctccctgtcactgccctgcttctcccctcgcactcctgctccacgccgctagaccacccggatggtttctggactctc cggatcgcccgtggaatcccccaaccttctcaccggcactcttggttgtgactgagggcgataatgcgaccttcacgtgctcgttctccaa cacctccgaatcattcgtgctgaactggtaccgcatgagcccgtcaaaccagaccgacaagctcccgcgttccggaagatcggt
- the present invention provides a population of CAR-expressing cells, e.g., CART cells or CAR-expressing NK cells.
- the population of CAR- expressing cells comprises a mixture of cells expressing different CARs.
- the population of CAR-expressing cells e.g., CART cells or CAR-expressing NK cells
- the population of CAR-expressing cells can include a first cell expressing a CAR that includes an anti- CLL-1 binding domain, e.g., as described herein, and a second cell expressing a CAR that includes an antigen binding domain to a target other than CLL-1 (e.g., CD123, CD33, CD34, FLT3, or folate receptor beta).
- the population of CAR-expressing cells includes, e.g., a first cell expressing a CAR that includes a primary intracellular signaling domain, and a second cell expressing a CAR that includes a secondary signaling domain, e.g., a costimulatory signaling domain.
- the present invention provides a population of cells wherein at least one cell in the population expresses a CAR having an anti- CLL-1 domain described herein, and a second cell expressing another agent, e.g., an agent which enhances the activity of a CAR-expressing cell.
- the agent can be an agent which inhibits an inhibitory molecule.
- Inhibitory molecules e.g., can, in some embodiments, decrease the ability of a CAR-expressing cell to mount an immune effector response.
- inhibitory molecules include PDl, PD-L1, PD-L2, CTLA4, TIM3, CEACAM (e.g., CEACAM- 1, CEACAM-3 and/or CEACAM-5), LAG3, VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4, CD80, CD86, B7-H3 (CD276), B7-H4 (VTCN1), HVEM (TNFRSF14 or CD270), KIR, A2aR, MHC class I, MHC class II, GAL9, adenosine, and TGFR beta.
- CEACAM e.g., CEACAM- 1, CEACAM-3 and/or CEACAM-5
- LAG3, VISTA e.g., VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4, CD80, CD86, B7-H3 (CD276), B7-H4 (VTCN1), HVEM (TNFRSF14 or CD270), KIR, A2aR
- the agent which inhibits an inhibitory molecule comprises a first polypeptide, e.g., an inhibitory molecule, associated with a second polypeptide that provides a positive signal to the cell, e.g., an intracellular signaling domain described herein.
- the agent comprises a first polypeptide, e.g., of an inhibitory molecule such as PDl, PD-L1, PD-L2, CTLA4, TIM3, CEACAM (e.g., CEACAM-1, CEACAM-3 and/or CEACAM-5), LAG3, VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4, CD80, CD86, B7-H3 (CD276), B7-H4 (VTCN1), HVEM (TNFRSF14 or CD270), KIR, A2aR, MHC class I, MHC class II, GAL9, adenosine, and TGFR beta, or a fragment of any of these (e.g., at least a portion of an extracellular domain of any of these), and a second polypeptide which is an intracellular signaling domain described herein (e.g., comprising a costimulatory domain (e.g., 4-1BB, CD27 ICOS, or CD28, e
- the agent comprises a first polypeptide of PDl or a fragment thereof (e.g., at least a portion of the extracellular domain of PDl), and a second polypeptide of an intracellular signaling domain described herein (e.g., a CD28 signaling domain described herein and/or a CD3 zeta signaling domain described herein).
- a first polypeptide of PDl or a fragment thereof e.g., at least a portion of the extracellular domain of PDl
- a second polypeptide of an intracellular signaling domain described herein e.g., a CD28 signaling domain described herein and/or a CD3 zeta signaling domain described herein.
- the present invention provides methods comprising administering a population of CAR-expressing cells (e.g., CART cells or CAR-expressing NK cells), e.g., a mixture of cells expressing different CARs, in combination with another agent, e.g., a kinase inhibitor, such as a kinase inhibitor described herein.
- a population of CAR-expressing cells e.g., CART cells or CAR-expressing NK cells
- another agent e.g., a kinase inhibitor, such as a kinase inhibitor described herein.
- the present invention provides methods comprising administering a population of cells wherein at least one cell in the population expresses a CAR having an anti- cancer associated antigen binding domain as described herein, and a second cell expressing another agent, e.g., an agent which enhances the activity of a CAR-expressing cell, in combination with another agent, e.g., a kinase inhibitor, such as a kinase inhibitor described herein.
- another agent e.g., an agent which enhances the activity of a CAR-expressing cell
- another agent e.g., a kinase inhibitor, such as a kinase inhibitor described herein.
- the CAR molecule described herein comprises one or more components of a natural killer cell receptor (NKR), thereby forming an NKR-CAR.
- the NKR component can be a transmembrane domain, a hinge domain, or a cytoplasmic domain from any of the following natural killer cell receptors: killer cell immunoglobulin-like receptor (KIR), e.g., KIR2DL1, KIR2DL2/L3, KIR2DL4, KIR2DL5A, KIR2DL5B, KIR2DS1,
- KIR killer cell immunoglobulin-like receptor
- the NKR-CAR molecules described herein may interact with an adaptor molecule or intracellular signaling domain, e.g., DAP12.
- a regulatable CAR where the CAR activity canbe controlled is desirable to optimize the safety and efficacy of a CAR therapy.
- a regulatable CAR for example, inducing apoptosis using, e.g., a caspase fused to a dimerization domain (see, e.g., Di et al., N Engl. J. Med. 2011 Nov. 3; 365(18):1673- 1683), can be used as a safety switch in the CAR therapy of the instant invention.
- CAR-expressing cells can also express an inducible Caspase-9 (iCaspase-9) molecule that, upon administration of a dimerizer drug (e.g., rimiducid (also called AP1903 (Bellicum Pharmaceuticals) or AP20187 (Ariad)) leads to activation of the Caspase-9 and apoptosis of the cells.
- a dimerizer drug e.g., rimiducid (also called AP1903 (Bellicum Pharmaceuticals) or AP20187 (Ariad)
- AP1903 also called AP1903 (Bellicum Pharmaceuticals)
- AP20187 AP20187
- the iCaspase-9 molecule is encoded by a nucleic acid molecule separate from the CAR-encoding vector(s). In some cases, the iCaspase-9 molecule is encoded by the same nucleic acid molecule as the CAR-encoding vector.
- the iCaspase-9 can provide a safety switch to avoid any toxicity of CAR-expressing cells. See, e.g., Song et al. Cancer Gene Ther. 2008; 15(10):667-75; Clinical Trial Id. No. NCT02107963; and Di Stasi et al. N. Engl. J. Med. 2011; 365:1673-83.
- Alternative strategies for regulating the CAR therapy of the instant invention include utilizing small molecules or antibodies that deactivate or turn off CAR activity, e.g., by deleting CAR-expressing cells, e.g., by inducing antibody dependent cell-mediated cytotoxicity
- CAR-expressing cells described herein may also express an antigen that is recognized by molecules capable of inducing cell death, e.g., ADCC or compliment-induced cell death.
- CAR expressing cells described herein may also express a receptor capable of being targeted by an antibody or antibody fragment.
- receptors examples include EpCAM, VEGFR, integrins (e.g., integrins ⁇ 3, ⁇ 4, ⁇ 3 ⁇ 4 ⁇ 3, ⁇ 4 ⁇ 7, ⁇ 5 ⁇ 1, ⁇ 3, ⁇ ), members of the TNF receptor superfamily (e.g., TRAIL-R1 , TRAIL-R2), PDGF Receptor, interferon receptor, folate receptor, GPNMB, ICAM-1 , HLA-DR, CEA, CA-125, MUC1 , TAG-72, IL-6 receptor, 5T4, GD2, GD3, CD2, CD3, CD4, CD5, CD1 1 , CD1 1 a/LFA-1 , CD15, CD18/ITGB2, CD19, CD20, CD22, CD23/lgE Receptor, CD25, CD28, CD30, CD33, CD38, CD40, CD41 , CD44, CD51 , CD52, CD62L, CD74, CD80, CD125, CD147/basigin, CD152/CT
- CAR-expressing cells described herein may also express a truncated epidermal growth factor receptor (EGFR) which lacks signaling capacity but retains the epitope that is recognized by molecules capable of inducing ADCC, e.g., cetuximab (ERBITUX®), such that administration of cetuximab induces ADCC and subsequent depletion of the CAR-expressing cells (see, e.g., WO2011/056894, and
- Another strategy includes expressing a highly compact marker/suicide gene that combines target epitopes from both CD32 and CD20 antigens in the CAR-expressing cells described herein, which binds rituximab, resulting in selective depletion of the CAR-expressing cells, e.g., by ADCC (see, e.g., Philip et al., Blood. 2014; 124(8)1277-1287).
- CAMPATH a monoclonal anti-CD52 antibody that selectively binds and targets mature lymphocytes, e.g., CAR-expressing cells, for destruction, e.g., by inducing ADCC.
- the CAR-expressing cell can be selectively targeted using a
- the CAR ligand e.g., an anti-idiotypic antibody.
- the anti-idiotypic antibody can cause effector cell activity, e.g, ADCC or ADC activities, thereby reducing the number of CAR-expressing cells.
- the CAR ligand, e.g., the anti-idiotypic antibody can be coupled to an agent that induces cell killing, e.g., a toxin, thereby reducing the number of CAR-expressing cells.
- the CAR molecules themselves can be configured such that the activity can be regulated, e.g., turned on and off, as described below.
- a RCAR comprises a set of polypeptides, typically two in the simplest embodiments, in which the components of a standard CAR described herein, e.g., an antigen binding domain and an intracellular signaling domain, are partitioned on separate polypeptides or members.
- the set of polypeptides include a dimerization switch that, upon the presence of a dimerization molecule, can couple the polypeptides to one another, e.g., can couple an antigen binding domain to an intracellular signaling domain.
- an RCAR comprises two polypeptides or members: 1) an intracellular signaling member comprising an intracellular signaling domain, e.g., a primary intracellular signaling domain described herein, and a first switch domain; 2) an antigen binding member comprising an antigen binding domain, e.g., that specifically binds a tumor antigen described herein, as described herein and a second switch domain.
- the RCAR comprises a transmembrane domain described herein.
- a transmembrane domain can be disposed on the intracellular signaling member, on the antigen binding member, or on both.
- the order can be as provided, but other orders are included as well.
- the order is as set out in the text, but in other embodiments, the order can be different.
- the order of elements on one side of a transmembrane region can be different from the example, e.g., the placement of a switch domain relative to a intracellular signaling domain can be different, e.g., reversed).
- the first and second switch domains can form an intracellular or an extracellular dimerization switch.
- the dimerization switch can be a homodimerization switch, e.g., where the first and second switch domain are the same, or a heterodimerization switch, e.g., where the first and second switch domain are different from one another.
- an RCAR can comprise a "multi switch.”
- a multi switch can comprise heterodimerization switch domains or homodimerization switch domains.
- a multi switch comprises a plurality of, e.g., 2, 3, 4, 5, 6, 7, 8, 9, or 10, switch domains, independently, on a first member, e.g., an antigen binding member, and a second member, e.g., an intracellular signaling member.
- the first member can comprise a plurality of first switch domains, e.g., FKBP-based switch domains
- the second member can comprise a plurality of second switch domains, e.g., FRB-based switch domains.
- the first member can comprise a first and a second switch domain, e.g., a FKBP-based switch domain and a FRB-based switch domain
- the second member can comprise a first and a second switch domain, e.g., a FKBP-based switch domain and a FRB-based switch domain.
- the intracellular signaling member comprises one or more intracellular signaling domains, e.g., a primary intracellular signaling domain and one or more costimulatory signaling domains.
- the antigen binding member may comprise one or more intracellular signaling domains, e.g., one or more costimulatory signaling domains.
- the antigen binding member comprises a plurality, e.g., 2 or 3 costimulatory signaling domains described herein, e.g., selected from 4- IBB, CD28, CD27, ICOS, and OX40, and in
- the antigen binding member comprises the following costimulatory signaling domains, from the extracellular to intracellular direction: 4-1BB-CD27; 4-1BB-CD27; CD27-4-1BB; 4-1BB- CD28; CD28-4-1BB; OX40-CD28; CD28-OX40; CD28-4-1BB; or 4-1BB-CD28.
- the intracellular binding member comprises a CD3zeta domain.
- the RCAR comprises (1) an antigen binding member comprising, an antigen binding domain, a transmembrane domain, and two costimulatory domains and a first switch domain; and (2) an intracellular signaling domain comprising a transmembrane domain or membrane tethering domain and at least one primary intracellular signaling domain, and a second switch domain.
- An embodiment provides RCARs wherein the antigen binding member is not tethered to the surface of the CAR cell. This allows a cell having an intracellular signaling member to be conveniently paired with one or more antigen binding domains, without transforming the cell with a sequence that encodes the antigen binding member.
- the RCAR comprises: 1) an intracellular signaling member comprising: a first switch domain, a transmembrane domain, an intracellular signaling domain, e.g., a primary intracellular signaling domain, and a first switch domain; and 2) an antigen binding member comprising: an antigen binding domain, and a second switch domain, wherein the antigen binding member does not comprise a transmembrane domain or membrane tethering domain, and, optionally, does not comprise an intracellular signaling domain.
- the RCAR may further comprise 3) a second antigen binding member comprising: a second antigen binding domain, e.g., a second antigen binding domain that binds a different antigen than is bound by the antigen binding domain; and a second switch domain.
- a second antigen binding domain e.g., a second antigen binding domain that binds a different antigen than is bound by the antigen binding domain
- a second switch domain e.g., a second switch domain.
- the antigen binding member comprises bispecific activation and targeting capacity.
- the antigen binding member can comprise a plurality, e.g., 2, 3, 4, or 5 antigen binding domains, e.g., scFvs, wherein each antigen binding domain binds to a target antigen, e.g.
- the plurality of antigen binding domains are in tandem, and optionally, a linker or hinge region is disposed between each of the antigen binding domains. Suitable linkers and hinge regions are described herein.
- an embodiment provides RCARs having a configuration that allows switching of proliferation.
- the RCAR comprises: 1) an intracellular signaling member comprising: optionally, a transmembrane domain or membrane tethering domain; one or more co-stimulatory signaling domain, e.g., selected from 4- IBB, CD28, CD27, ICOS, and OX40, and a switch domain; and 2) an antigen binding member comprising: an antigen binding domain, a transmembrane domain, and a primary intracellular signaling domain, e.g., a CD3zeta domain, wherein the antigen binding member does not comprise a switch domain, or does not comprise a switch domain that dimerizes with a switch domain on the intracellular signaling member.
- an intracellular signaling member comprising: optionally, a transmembrane domain or membrane tethering domain; one or more co-stimulatory signaling domain, e.g., selected from 4- IBB, CD28, CD27, ICOS,
- the antigen binding member does not comprise a co- stimulatory signaling domain.
- the intracellular signaling member comprises a switch domain from a homodimerization switch.
- the intracellular signaling member comprises a first switch domain of a heterodimerization switch and the RCAR comprises a second intracellular signaling member which comprises a second switch domain of the heterodimerization switch.
- the second intracellular signaling member comprises the same intracellular signaling domains as the intracellular signaling member.
- the dimerization switch is intracellular. In an embodiment, the dimerization switch is extracellular.
- the first and second switch domains comprise a FKBP-FRB based switch as described herein.
- RCARX cell Any cell that is engineered to express a RCAR can be used as a RCARX cell.
- the RCARX cell is a T cell, and is referred to as a RCART cell.
- the RCARX cell is an NK cell, and is referred to as a RCARN cell.
- nucleic acids and vectors comprising RCAR encoding sequences. Sequence encoding various elements of an RCAR can be disposed on the same nucleic acid molecule, e.g., the same plasmid or vector, e.g., viral vector, e.g., lentiviral vector.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Immunology (AREA)
- Medicinal Chemistry (AREA)
- Epidemiology (AREA)
- Pharmacology & Pharmacy (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Cell Biology (AREA)
- Engineering & Computer Science (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- Toxicology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Physical Education & Sports Medicine (AREA)
- Oncology (AREA)
- Hematology (AREA)
- Biotechnology (AREA)
- Rheumatology (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Virology (AREA)
- Developmental Biology & Embryology (AREA)
- Biomedical Technology (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
Applications Claiming Priority (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN2014082602 | 2014-07-21 | ||
| CN2014090500 | 2014-11-06 | ||
| PCT/US2015/041337 WO2016014535A1 (en) | 2014-07-21 | 2015-07-21 | Treatment of cancer using a cll-1 chimeric antigen receptor |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| EP3171882A1 true EP3171882A1 (en) | 2017-05-31 |
Family
ID=53761606
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP15744448.0A Withdrawn EP3171882A1 (en) | 2014-07-21 | 2015-07-21 | Treatment of cancer using a cll-1 chimeric antigen receptor |
Country Status (16)
| Country | Link |
|---|---|
| US (2) | US10568947B2 (OSRAM) |
| EP (1) | EP3171882A1 (OSRAM) |
| JP (2) | JP6736540B2 (OSRAM) |
| KR (1) | KR20170037625A (OSRAM) |
| CN (1) | CN107109420A (OSRAM) |
| AR (1) | AR101829A1 (OSRAM) |
| AU (2) | AU2015292811B2 (OSRAM) |
| BR (1) | BR112017000939A2 (OSRAM) |
| CA (1) | CA2955465A1 (OSRAM) |
| CO (1) | CO2017000506A2 (OSRAM) |
| IL (1) | IL250116B (OSRAM) |
| MX (1) | MX2017001013A (OSRAM) |
| RU (1) | RU2741120C2 (OSRAM) |
| SG (2) | SG11201700418VA (OSRAM) |
| TW (1) | TWI718992B (OSRAM) |
| WO (1) | WO2016014535A1 (OSRAM) |
Families Citing this family (152)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP4282419A1 (en) | 2012-12-20 | 2023-11-29 | Purdue Research Foundation | Chimeric antigen receptor-expressing t cells as anti-cancer therapeutics |
| US9573988B2 (en) | 2013-02-20 | 2017-02-21 | Novartis Ag | Effective targeting of primary human leukemia using anti-CD123 chimeric antigen receptor engineered T cells |
| LT2958943T (lt) | 2013-02-20 | 2020-01-27 | The Trustees Of The University Of Pennsylvania | Vėžio gydymas, naudojant humanizuotą anti-egfrviii chimerinio antigeno receptorių |
| EP2970426B1 (en) | 2013-03-15 | 2019-08-28 | Michael C. Milone | Targeting cytotoxic cells with chimeric receptors for adoptive immunotherapy |
| TWI654206B (zh) | 2013-03-16 | 2019-03-21 | 諾華公司 | 使用人類化抗-cd19嵌合抗原受體治療癌症 |
| CN105899232A (zh) * | 2013-11-13 | 2016-08-24 | 诺华股份有限公司 | 用于增强免疫应答的mTOR抑制剂 |
| CA2931684C (en) | 2013-12-19 | 2024-02-20 | Novartis Ag | Human mesothelin chimeric antigen receptors and uses thereof |
| EP3087101B1 (en) | 2013-12-20 | 2024-06-05 | Novartis AG | Regulatable chimeric antigen receptor |
| WO2015112626A1 (en) | 2014-01-21 | 2015-07-30 | June Carl H | Enhanced antigen presenting ability of car t cells by co-introduction of costimulatory molecules |
| IL322264A (en) | 2014-04-07 | 2025-09-01 | Novartis Ag | Cancer treatment using chimeric antigen receptor (CAR) against CD19 |
| US11542488B2 (en) | 2014-07-21 | 2023-01-03 | Novartis Ag | Sortase synthesized chimeric antigen receptors |
| US9777061B2 (en) | 2014-07-21 | 2017-10-03 | Novartis Ag | Treatment of cancer using a CD33 chimeric antigen receptor |
| MY181834A (en) | 2014-07-21 | 2021-01-08 | Novartis Ag | Treatment of cancer using humanized anti-bcma chimeric antigen receptor |
| JP6736540B2 (ja) | 2014-07-21 | 2020-08-05 | ノバルティス アーゲー | Cll−1キメラ抗原受容体を使用した癌の処置 |
| SG11201700770PA (en) | 2014-08-19 | 2017-03-30 | Novartis Ag | Anti-cd123 chimeric antigen receptor (car) for use in cancer treatment |
| ES2891332T3 (es) | 2014-09-17 | 2022-01-27 | Novartis Ag | Direccionamiento a células citotóxicas con receptores quiméricos para la inmunoterapia adoptiva |
| AU2015330898B2 (en) | 2014-10-08 | 2022-03-10 | Novartis Ag | Biomarkers predictive of therapeutic responsiveness to chimeric antigen receptor therapy and uses thereof |
| CN107567461A (zh) | 2014-12-29 | 2018-01-09 | 诺华股份有限公司 | 制备嵌合抗原受体表达细胞的方法 |
| US11459390B2 (en) | 2015-01-16 | 2022-10-04 | Novartis Ag | Phosphoglycerate kinase 1 (PGK) promoters and methods of use for expressing chimeric antigen receptor |
| WO2016120218A1 (en) * | 2015-01-26 | 2016-08-04 | Cellectis | ANTI-CLL1 SPECIFIC SINGLE-CHAIN CHIMERIC ANTIGEN RECEPTORS (scCARS) FOR CANCER IMMUNOTHERAPY |
| US11161907B2 (en) | 2015-02-02 | 2021-11-02 | Novartis Ag | Car-expressing cells against multiple tumor antigens and uses thereof |
| CN107531805A (zh) | 2015-03-05 | 2018-01-02 | 弗雷德哈钦森癌症研究中心 | 免疫调节融合蛋白及其用途 |
| MX2017012939A (es) | 2015-04-08 | 2018-05-22 | Novartis Ag | Terapias cd20, terapias cd22 y terapias de combinacion con una celula que expresa un receptor quimerico de antigeno (car) de cd19. |
| AU2016249005B2 (en) | 2015-04-17 | 2022-06-16 | Novartis Ag | Methods for improving the efficacy and expansion of chimeric antigen receptor-expressing cells |
| EP3286211A1 (en) | 2015-04-23 | 2018-02-28 | Novartis AG | Treatment of cancer using chimeric antigen receptor and protein kinase a blocker |
| EP3297629A1 (en) | 2015-05-20 | 2018-03-28 | Novartis AG | Pharmaceutical combination of everolimus with dactolisib |
| EP3317399B1 (en) | 2015-06-30 | 2024-06-26 | Cellectis | Methods for improving functionality in nk cell by gene inactivation using specific endonuclease |
| WO2017015427A1 (en) | 2015-07-21 | 2017-01-26 | Novartis Ag | Methods for improving the efficacy and expansion of immune cells |
| US11667691B2 (en) | 2015-08-07 | 2023-06-06 | Novartis Ag | Treatment of cancer using chimeric CD3 receptor proteins |
| CN116334205A (zh) | 2015-09-03 | 2023-06-27 | 诺华股份有限公司 | 预测细胞因子释放综合征的生物标志物 |
| CN108699557B (zh) | 2015-12-04 | 2025-08-15 | 诺华股份有限公司 | 用于免疫肿瘤学的组合物和方法 |
| PT3393504T (pt) | 2015-12-22 | 2025-12-30 | Novartis Ag | Recetor de antigénio quimérico (car) de mesotelina e anticorpo contra o inibidor de pd-l1 para utilização combinada em terapia anticancerígena |
| CA3009852A1 (en) | 2015-12-28 | 2017-07-06 | Novartis Ag | Methods of making chimeric antigen receptor-expressing cells |
| BR112018013074A2 (en) | 2015-12-30 | 2018-12-11 | Novartis Ag | immune effector cell therapies with enhanced efficacy |
| EP3405492B1 (en) * | 2016-01-21 | 2020-10-21 | Novartis AG | Multispecific molecules targeting cll-1 |
| CA3016287A1 (en) | 2016-03-04 | 2017-09-08 | Novartis Ag | Cells expressing multiple chimeric antigen receptor (car) molecules and uses therefore |
| US11549099B2 (en) | 2016-03-23 | 2023-01-10 | Novartis Ag | Cell secreted minibodies and uses thereof |
| WO2017172981A2 (en) * | 2016-03-29 | 2017-10-05 | University Of Southern California | Chimeric antigen receptors targeting cancer |
| US10603380B2 (en) | 2016-04-01 | 2020-03-31 | Kite Pharma, Inc. | Chimeric antigen and T cell receptors and methods of use |
| KR102608405B1 (ko) * | 2016-04-01 | 2023-12-01 | 카이트 파마 인코포레이티드 | 키메라 수용체 및 그의 사용 방법 |
| US10689450B2 (en) | 2016-04-01 | 2020-06-23 | Kite Pharma, Inc | BCMA binding molecules and methods of use thereof |
| US12144850B2 (en) | 2016-04-08 | 2024-11-19 | Purdue Research Foundation | Methods and compositions for car T cell therapy |
| EP3443001B1 (en) | 2016-04-11 | 2025-04-30 | Obsidian Therapeutics, Inc. | REGULATED BIOCIRCUIT SYSTEMS |
| EP3443096B1 (en) | 2016-04-15 | 2023-03-01 | Novartis AG | Compositions and methods for selective expression of chimeric antigen receptors |
| US12048718B2 (en) * | 2016-06-07 | 2024-07-30 | Max-Delbrück-Centrum für Molekulare Medizin in der Helmholtz-Geminschaft | Chimeric antigen receptor and CAR-T cells that bind BCMA |
| SG11201900344YA (en) | 2016-07-15 | 2019-02-27 | Novartis Ag | Treatment and prevention of cytokine release syndrome using a chimeric antigen receptor in combination with a kinase inhibitor |
| CN110214150A (zh) | 2016-07-28 | 2019-09-06 | 诺华股份有限公司 | 嵌合抗原受体和pd-1抑制剂的组合疗法 |
| EP3490590A2 (en) | 2016-08-01 | 2019-06-05 | Novartis AG | Treatment of cancer using a chimeric antigen receptor in combination with an inhibitor of a pro-m2 macrophage molecule |
| EP3515503B1 (en) * | 2016-09-23 | 2025-10-29 | The Regents Of The University Of Michigan | Engineered lymphocytes |
| WO2018064387A1 (en) | 2016-09-28 | 2018-04-05 | Novartis Ag | Porous membrane-based macromolecule delivery system |
| AU2017338846B2 (en) * | 2016-10-04 | 2020-09-24 | Precision Biosciences, Inc. | Co-stimulatory domains for use in genetically-modified cells |
| WO2018067992A1 (en) | 2016-10-07 | 2018-04-12 | Novartis Ag | Chimeric antigen receptors for the treatment of cancer |
| PL3529262T3 (pl) * | 2016-10-21 | 2021-12-27 | Inserm - Institut National De La Santé Et De La Recherche Médicale | Sposoby wspomagania odpowiedzi limfocytów t |
| BR112019010470A2 (pt) | 2016-11-23 | 2019-09-10 | Novartis Ag | métodos de realce de resposta imune com everolimo, dactolisib ou ambos |
| EP3574005B1 (en) | 2017-01-26 | 2021-12-15 | Novartis AG | Cd28 compositions and methods for chimeric antigen receptor therapy |
| AU2018219226B2 (en) | 2017-02-07 | 2024-12-19 | Seattle Children's Hospital (dba Seattle Children's Research Institute) | Phospholipid ether (PLE) CAR T cell tumor targeting (CTCT) agents |
| ES3010559T3 (en) | 2017-02-28 | 2025-04-03 | Endocyte Inc | Compositions and methods for car t cell therapy |
| IL268895B2 (en) | 2017-02-28 | 2025-05-01 | Vor Biopharma Inc | Compositions and methods for inhibition of lineage specific proteins |
| US20200048359A1 (en) | 2017-02-28 | 2020-02-13 | Novartis Ag | Shp inhibitor compositions and uses for chimeric antigen receptor therapy |
| MX2019010812A (es) | 2017-03-17 | 2019-12-11 | Hutchinson Fred Cancer Res | Proteinas de fusion inmunomoduladoras y sus usos. |
| KR20190130608A (ko) | 2017-03-22 | 2019-11-22 | 노파르티스 아게 | 면역종양학을 위한 조성물 및 방법 |
| WO2019000146A1 (zh) * | 2017-06-26 | 2019-01-03 | 深圳市博奥康生物科技有限公司 | 一种人程序性死亡受体1基因的siRNA及其应用 |
| KR20200086278A (ko) | 2017-10-18 | 2020-07-16 | 노파르티스 아게 | 선택적 단백질 분해를 위한 조성물 및 방법 |
| WO2019084288A1 (en) | 2017-10-25 | 2019-05-02 | Novartis Ag | METHODS FOR DESIGNING CHIMERIC ANTIGENIC RECEPTOR EXPRESSION CELLS |
| WO2019089798A1 (en) | 2017-10-31 | 2019-05-09 | Novartis Ag | Anti-car compositions and methods |
| WO2019108900A1 (en) * | 2017-11-30 | 2019-06-06 | Novartis Ag | Bcma-targeting chimeric antigen receptor, and uses thereof |
| WO2019108065A1 (en) * | 2017-12-01 | 2019-06-06 | Merus N.V. | Use of bispecific antibody and il-15 for combination therapy |
| EP3729080B1 (en) | 2017-12-21 | 2023-04-19 | F. Hoffmann-La Roche AG | Universal reporter cell assay for specificity test of novel antigen binding moieties |
| EP3729081B1 (en) * | 2017-12-21 | 2025-02-19 | F. Hoffmann-La Roche AG | Car-t cell assay for specificity test of novel antigen binding moieties |
| CN112218651A (zh) | 2018-01-08 | 2021-01-12 | 诺华公司 | 用于与嵌合抗原受体疗法组合的免疫增强rna |
| US11951129B2 (en) | 2018-01-09 | 2024-04-09 | H. Lee Moffitt Cancer Center And Research Institute, Inc. | Compositions and methods for targeting CLEC12A-expressing cancers |
| US11311576B2 (en) | 2018-01-22 | 2022-04-26 | Seattle Children's Hospital | Methods of use for CAR T cells |
| WO2019156795A1 (en) | 2018-02-06 | 2019-08-15 | Seattle Children's Hospital (dba Seattle Children's Research Institute) | Fluorescein-specific cars exhibiting optimal t cell function against fl-ple labelled tumors |
| CA3091674A1 (en) | 2018-02-23 | 2019-08-29 | Endocyte, Inc. | Sequencing method for car t cell therapy |
| WO2019173324A1 (en) * | 2018-03-06 | 2019-09-12 | The Trustees Of The University Of Pennsylvania | Prostate-specific membrane antigen cars and methods of use thereof |
| EP3775902B1 (en) | 2018-04-04 | 2023-02-22 | F. Hoffmann-La Roche AG | Diagnostic assays to detect tumor antigens in cancer patients |
| EP3784351A1 (en) | 2018-04-27 | 2021-03-03 | Novartis AG | Car t cell therapies with enhanced efficacy |
| EP3788369A1 (en) | 2018-05-01 | 2021-03-10 | Novartis Ag | Biomarkers for evaluating car-t cells to predict clinical outcome |
| US12448426B2 (en) * | 2018-05-17 | 2025-10-21 | St. Jude Children's Research Hospital, Inc. | Chimeric antigen receptors with MYD88 and CD40 costimulatory domains |
| WO2019227003A1 (en) | 2018-05-25 | 2019-11-28 | Novartis Ag | Combination therapy with chimeric antigen receptor (car) therapies |
| US20210123075A1 (en) | 2018-06-08 | 2021-04-29 | Novartis Ag | Compositions and methods for immunooncology |
| US20220403001A1 (en) | 2018-06-12 | 2022-12-22 | Obsidian Therapeutics, Inc. | Pde5 derived regulatory constructs and methods of use in immunotherapy |
| AU2019284911B2 (en) | 2018-06-13 | 2026-04-09 | Novartis Ag | BCMA chimeric antigen receptors and uses thereof |
| CN108866088B (zh) * | 2018-06-20 | 2023-06-09 | 上海恒润达生生物科技股份有限公司 | 靶向cll-1嵌合抗原受体及其用途 |
| AR116109A1 (es) | 2018-07-10 | 2021-03-31 | Novartis Ag | Derivados de 3-(5-amino-1-oxoisoindolin-2-il)piperidina-2,6-diona y usos de los mismos |
| GB201813178D0 (en) * | 2018-08-13 | 2018-09-26 | Autolus Ltd | Cell |
| WO2020047164A1 (en) | 2018-08-28 | 2020-03-05 | Vor Biopharma, Inc | Genetically engineered hematopoietic stem cells and uses thereof |
| PT3844267T (pt) | 2018-08-31 | 2025-09-30 | Novartis Ag | Métodos de preparação de células que expressam recetor de antigénio quimérico |
| WO2020047449A2 (en) | 2018-08-31 | 2020-03-05 | Novartis Ag | Methods of making chimeric antigen receptor-expressing cells |
| WO2020052542A1 (en) | 2018-09-10 | 2020-03-19 | Nanjing Legend Biotech Co., Ltd. | Single-domain antibodies against cll1 and constructs thereof |
| US12331320B2 (en) | 2018-10-10 | 2025-06-17 | The Research Foundation For The State University Of New York | Genome edited cancer cell vaccines |
| AU2019361096A1 (en) | 2018-10-19 | 2021-06-03 | Regents Of The University Of Minnesota | NK engager molecules and methods of use thereof |
| WO2020086742A1 (en) | 2018-10-24 | 2020-04-30 | Obsidian Therapeutics, Inc. | Er tunable protein regulation |
| WO2020083406A1 (zh) * | 2018-10-26 | 2020-04-30 | 科济生物医药(上海)有限公司 | 靶向cll1的抗体及其应用 |
| EP3873540A4 (en) | 2018-10-31 | 2022-07-27 | Mayo Foundation for Medical Education and Research | METHODS AND MATERIALS FOR THE TREATMENT OF CANCER |
| CA3116412A1 (en) | 2018-10-31 | 2020-05-07 | Humanigen, Inc. | Materials and methods for treating cancer |
| WO2020092839A1 (en) | 2018-10-31 | 2020-05-07 | Mayo Foundation For Medical Education And Research | Methods and materials for treating cancer |
| KR102335799B1 (ko) * | 2018-12-05 | 2021-12-08 | 주식회사 헤지호그 | 엔도텔린 수용체 a 활성 조절 항체 |
| JP7315256B2 (ja) | 2018-12-05 | 2023-07-26 | ヘッジホッグ,インコーポレイテッド | エンドセリン受容体a活性調節抗体 |
| WO2020123716A1 (en) | 2018-12-11 | 2020-06-18 | Obsidian Therapeutics, Inc. | Membrane bound il12 compositions and methods for tunable regulation |
| EP3895052A4 (en) | 2018-12-14 | 2022-10-26 | 2seventy bio, Inc. | DIMERIZING AGENT REGULATED IMMUNORECEPTOR COMPLEXES |
| WO2020128972A1 (en) | 2018-12-20 | 2020-06-25 | Novartis Ag | Dosing regimen and pharmaceutical combination comprising 3-(1-oxoisoindolin-2-yl)piperidine-2,6-dione derivatives |
| ES3032659T3 (en) | 2019-02-15 | 2025-07-23 | Novartis Ag | 3-(1-oxo-5-(piperidin-4-yl)isoindolin-2-yl)piperidine-2,6-dione derivatives and uses thereof |
| BR112021015672A2 (pt) | 2019-02-15 | 2021-10-05 | Novartis Ag | Derivados de 3-(1-oxoisoindolin-2-il)piperidina-2,6-diona substituída e usos dos mesmos |
| US20220088075A1 (en) | 2019-02-22 | 2022-03-24 | The Trustees Of The University Of Pennsylvania | Combination therapies of egfrviii chimeric antigen receptors and pd-1 inhibitors |
| AU2020229806A1 (en) | 2019-02-25 | 2021-07-29 | Novartis Ag | Mesoporous silica particles compositions for viral delivery |
| KR20210149251A (ko) | 2019-03-08 | 2021-12-08 | 옵시디안 테라퓨틱스, 인크. | 조율가능한 조절을 위한 인간 탄산 무수화효소 2 조성물 및 방법 |
| CN113874400B (zh) | 2019-03-11 | 2025-02-07 | 詹森生物科技公司 | 抗Vβ17/抗CD123双特异性抗体 |
| SG11202110613SA (en) * | 2019-03-27 | 2021-10-28 | Res Inst Nationwide Childrens Hospital | Generation of chimeric antigen receptor (car)-primary nk cells for cancer immunotherapy using a combination of cas9/rnp and aav viruses |
| US20220168389A1 (en) | 2019-04-12 | 2022-06-02 | Novartis Ag | Methods of making chimeric antigen receptor-expressing cells |
| EP3959320A1 (en) | 2019-04-24 | 2022-03-02 | Novartis AG | Compositions and methods for selective protein degradation |
| CA3138972A1 (en) | 2019-05-04 | 2020-11-12 | Inhibrx, Inc. | Clec12a-binding polypeptides and uses thereof |
| SG11202111927QA (en) * | 2019-05-08 | 2021-11-29 | 2Seventy Bio Inc | Cll-1 targeted immunotherapies |
| WO2020252404A1 (en) | 2019-06-12 | 2020-12-17 | Obsidian Therapeutics, Inc. | Ca2 compositions and methods for tunable regulation |
| JP2022537670A (ja) | 2019-06-12 | 2022-08-29 | オブシディアン セラピューティクス, インコーポレイテッド | Ca2の組成物および調整可能な制御方法 |
| EP4010697A4 (en) * | 2019-08-05 | 2022-10-12 | Charles River Laboratories, Inc. | ANTIGEN-BINDING MOLECULES AND THEIR SCREENING METHODS |
| WO2021046451A1 (en) | 2019-09-06 | 2021-03-11 | Obsidian Therapeutics, Inc. | Compositions and methods for dhfr tunable protein regulation |
| EP4028031A4 (en) * | 2019-09-13 | 2023-09-06 | Memorial Sloan Kettering Cancer Center | ANTIGEN RECOGNITION RECEPTORS TARGETING CD371 AND THEIR USES |
| KR20220104217A (ko) | 2019-11-26 | 2022-07-26 | 노파르티스 아게 | Cd19 및 cd22 키메라 항원 수용체 및 이의 용도 |
| EP4065158A2 (en) | 2019-11-26 | 2022-10-05 | Novartis AG | Chimeric antigen receptors binding bcma and cd19 and uses thereof |
| KR20220116257A (ko) | 2019-12-20 | 2022-08-22 | 노파르티스 아게 | 골수섬유증 및 골수이형성 증후군을 치료하기 위한, 데시타빈 또는 항 pd-1 항체 스파르탈리주맙을 포함하거나 또는 포함하지 않는, 항 tim-3 항체 mbg453 및 항 tgf-베타 항체 nis793의 조합물 |
| KR20220163940A (ko) | 2020-02-04 | 2022-12-12 | 시애틀 칠드런즈 호스피탈 디/비/에이 시애틀 칠드런즈 리서치 인스티튜트 | 항-디니트로페놀 키메라 항원 수용체 |
| WO2021158960A1 (en) * | 2020-02-07 | 2021-08-12 | Ellebedy Ali | Antibodies protective against influenza b |
| CN115175695A (zh) | 2020-02-27 | 2022-10-11 | 诺华股份有限公司 | 制备表达嵌合抗原受体的细胞的方法 |
| MX2022010685A (es) | 2020-02-27 | 2022-09-23 | Novartis Ag | Metodos de produccion de celulas que expresan receptores de antigeno quimericos. |
| GB202005216D0 (en) * | 2020-04-08 | 2020-05-20 | Autolus Ltd | Cell |
| CN116096862A (zh) | 2020-06-11 | 2023-05-09 | 诺华股份有限公司 | Zbtb32抑制剂及其用途 |
| CN115916199A (zh) | 2020-06-23 | 2023-04-04 | 诺华股份有限公司 | 包含3-(1-氧代异吲哚啉-2-基)哌啶-2,6-二酮衍生物的给药方案 |
| US20230271940A1 (en) | 2020-08-03 | 2023-08-31 | Novartis Ag | Heteroaryl substituted 3-(1-oxoisoindolin-2-yl)piperidine-2,6-dione derivatives and uses thereof |
| WO2022034022A1 (en) * | 2020-08-10 | 2022-02-17 | Julius-Maximilians-Universität Würzburg | Siglec-6-binding polypeptides |
| TW202227124A (zh) | 2020-08-21 | 2022-07-16 | 瑞士商諾華公司 | 用於體內產生car表現細胞的組成物和方法 |
| AU2021339754A1 (en) | 2020-09-11 | 2023-05-25 | Janssen Biotech, Inc. | Methods and compositions for modulating beta chain mediated immunity |
| US20220089737A1 (en) * | 2020-09-11 | 2022-03-24 | Janssen Biotech, Inc. | Multi-specific immune targeting molecules and uses thereof |
| US12448449B2 (en) | 2020-09-11 | 2025-10-21 | Janssen Biotech, Inc. | Immune targeting molecules and uses thereof |
| JP2024500847A (ja) | 2020-12-18 | 2024-01-10 | センチュリー セラピューティクス,インコーポレイテッド | 適合可能な受容体特異性を有するキメラ抗原受容体システム |
| TW202304979A (zh) | 2021-04-07 | 2023-02-01 | 瑞士商諾華公司 | 抗TGFβ抗體及其他治療劑用於治療增殖性疾病之用途 |
| TW202309294A (zh) | 2021-04-27 | 2023-03-01 | 瑞士商諾華公司 | 病毒載體生產系統 |
| CN113461818B (zh) * | 2021-06-30 | 2022-01-21 | 徐州医科大学 | 靶向CD276的全人源抗体scFv、嵌合抗原受体、工程化免疫细胞及其制备方法 |
| WO2023006117A1 (en) * | 2021-07-30 | 2023-02-02 | Nanjing Legend Biotech Co., Ltd. | Antibodies against cll1 and constructs thereof |
| JP2024531364A (ja) | 2021-08-20 | 2024-08-29 | ノバルティス アーゲー | キメラ抗原受容体発現細胞を作製する方法 |
| US12279845B2 (en) | 2021-10-18 | 2025-04-22 | Cilag Gmbh International | Cable-driven actuation system for robotic surgical tool attachment |
| EP4507794A1 (en) * | 2022-04-11 | 2025-02-19 | Vor Biopharma Inc. | Binding agents and methods of use thereof |
| WO2023212676A1 (en) * | 2022-04-29 | 2023-11-02 | Baylor College Of Medicine | Terminal deoxynucleotidyl transferase antibodies and uses thereof |
| WO2023214325A1 (en) | 2022-05-05 | 2023-11-09 | Novartis Ag | Pyrazolopyrimidine derivatives and uses thereof as tet2 inhibitors |
| WO2023225641A2 (en) * | 2022-05-20 | 2023-11-23 | H. Lee Moffitt Cancer Center And Research Institute Inc. | Compositions and methods for targeting clec12a-expressing cancers |
| WO2024044670A1 (en) | 2022-08-26 | 2024-02-29 | Kite Pharma, Inc. | Improving immune cell function |
| GB202214132D0 (en) | 2022-09-27 | 2022-11-09 | Coding Bio Ltd | CLL1 binding molecules |
| AU2023369684A1 (en) | 2022-10-26 | 2025-04-17 | Novartis Ag | Lentiviral formulations |
| WO2024149225A1 (zh) * | 2023-01-10 | 2024-07-18 | 合源康华医药科技(北京)有限公司 | 一种人源化cll1抗体、嵌合抗原受体及其应用 |
| GB202301949D0 (en) | 2023-02-10 | 2023-03-29 | Coding Bio Ltd | CLL1 and/or CD33 binding molecules |
| EP4720059A1 (en) | 2023-05-24 | 2026-04-08 | Kumquat Biosciences Inc. | Heterocyclic compounds and uses thereof |
| US20250206814A1 (en) * | 2023-12-20 | 2025-06-26 | Dianthus Therapeutics Opco, Inc. | Pharmaceutical compositions comprising antibodies for treatment of c1s mediated disorders and methods of using the same |
Family Cites Families (180)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5906936A (en) | 1988-05-04 | 1999-05-25 | Yeda Research And Development Co. Ltd. | Endowing lymphocytes with antibody specificity |
| US6303121B1 (en) | 1992-07-30 | 2001-10-16 | Advanced Research And Technology | Method of using human receptor protein 4-1BB |
| ATE145428T1 (de) | 1990-12-14 | 1996-12-15 | Cell Genesys Inc | Chimärische ketten zur transduktion von rezeptorverbundenen signalwegen |
| US6319494B1 (en) | 1990-12-14 | 2001-11-20 | Cell Genesys, Inc. | Chimeric chains for receptor-associated signal transduction pathways |
| IL101147A (en) | 1991-03-07 | 2004-06-20 | Gen Hospital Corp | Redirection of cellular immunity by receptor chimeras |
| US6004811A (en) | 1991-03-07 | 1999-12-21 | The Massachussetts General Hospital | Redirection of cellular immunity by protein tyrosine kinase chimeras |
| US7049136B2 (en) | 1991-03-07 | 2006-05-23 | The General Hospital Corporation | Redirection of cellular immunity by receptor chimeras |
| ATE255131T1 (de) | 1991-06-14 | 2003-12-15 | Genentech Inc | Humanisierter heregulin antikörper |
| US8211422B2 (en) | 1992-03-18 | 2012-07-03 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Chimeric receptor genes and cells transformed therewith |
| IL104570A0 (en) | 1992-03-18 | 1993-05-13 | Yeda Res & Dev | Chimeric genes and cells transformed therewith |
| US7211259B1 (en) | 1993-05-07 | 2007-05-01 | Immunex Corporation | 4-1BB polypeptides and DNA encoding 4-1BB polypeptides |
| KR100373813B1 (ko) | 1994-05-02 | 2003-10-08 | 베른트 그로너 | 이관능성단백질,그의제조및용도 |
| US5712149A (en) | 1995-02-03 | 1998-01-27 | Cell Genesys, Inc. | Chimeric receptor molecules for delivery of co-stimulatory signals |
| US6103521A (en) | 1995-02-06 | 2000-08-15 | Cell Genesys, Inc. | Multispecific chimeric receptors |
| JP4170390B2 (ja) | 1995-02-24 | 2008-10-22 | ザ ジェネラル ホスピタル コーポレーション | 受容体キメラによる細胞性免疫の再指示 |
| GB9526131D0 (en) | 1995-12-21 | 1996-02-21 | Celltech Therapeutics Ltd | Recombinant chimeric receptors |
| US5874240A (en) | 1996-03-15 | 1999-02-23 | Human Genome Sciences, Inc. | Human 4-1BB receptor splicing variant |
| US5792648A (en) | 1996-07-31 | 1998-08-11 | Incyte Pharmaceuticals, Inc. | Human macrophage antigen |
| US20030060444A1 (en) | 1997-06-25 | 2003-03-27 | Celltech Therapeutics, Ltd. | Cell activation process and reagents therefor |
| WO2000014257A1 (en) | 1998-09-04 | 2000-03-16 | Sloan-Kettering Institute For Cancer Research | Fusion receptors specific for prostate-specific membrane antigen and uses thereof |
| AU2472400A (en) | 1998-10-20 | 2000-05-08 | City Of Hope | CD20-specific redirected T cells and their use in cellular immunotherapy of CD20+ malignancies |
| AU4418900A (en) | 1999-04-16 | 2000-11-02 | Celltech Therapeutics Limited | Synthetic transmembrane components |
| GB9925848D0 (en) | 1999-11-01 | 1999-12-29 | Celltech Therapeutics Ltd | Biological products |
| PL357448A1 (en) | 2000-02-25 | 2004-07-26 | The Government Of The United States, As Represented By The Secretary Of The Department Of Health And Human Services | Anti-egfrviii scfvs with improved cytotoxicity and yield, immunotoxins based thereon, and methods of use thereof |
| EP2329847B1 (en) | 2000-03-06 | 2016-11-02 | University of Kentucky Research Foundation | Use of an antibody or an immunotoxin that selectively binds to cd123 to impair hematologic cancer progenitor cells |
| ATE475428T1 (de) | 2000-03-29 | 2010-08-15 | Univ Ohio State Res Found | Verfahren zur blockierung der zerstörung von gewebe mittels autoreaktiver t-zellen |
| IL136511A0 (en) | 2000-06-01 | 2001-06-14 | Gavish Galilee Bio Appl Ltd | Genetically engineered mhc molecules |
| GB0025307D0 (en) | 2000-10-16 | 2000-11-29 | Celltech Chiroscience Ltd | Biological products |
| AU2001297703B2 (en) | 2000-11-07 | 2006-10-19 | City Of Hope | CD19-specific redirected immune cells |
| US7177912B1 (en) | 2000-12-22 | 2007-02-13 | Datacore Software Corporation | SCSI transport protocol via TCP/IP using existing network hardware and software |
| US7070995B2 (en) | 2001-04-11 | 2006-07-04 | City Of Hope | CE7-specific redirected immune cells |
| US20090257994A1 (en) | 2001-04-30 | 2009-10-15 | City Of Hope | Chimeric immunoreceptor useful in treating human cancers |
| CA2445746C (en) | 2001-04-30 | 2012-09-18 | City Of Hope | Chimeric immunoreceptor useful in treating human cancers |
| US7514537B2 (en) | 2001-04-30 | 2009-04-07 | City Of Hope | Chimeric immunoreceptor useful in treating human gliomas |
| WO2003013598A2 (en) | 2001-08-09 | 2003-02-20 | Lam Dominic M K | Novel vaccine compositions and methods of vaccine preparation for veterinary and human diseases |
| US20030148982A1 (en) | 2001-11-13 | 2003-08-07 | Brenner Malcolm K. | Bi-spcific chimeric T cells |
| US7638326B2 (en) | 2002-01-03 | 2009-12-29 | The Trustees Of The University Of Pennsylvania | Activation and expansion of T-cells using an engineered multivalent signaling platform |
| AU2003202908A1 (en) | 2002-01-03 | 2003-07-24 | The Trustees Of The University Of Pennsylvania | Activation and expansion of t-cells using an engineered multivalent signaling platform |
| US7745140B2 (en) | 2002-01-03 | 2010-06-29 | The Trustees Of The University Of Pennsylvania | Activation and expansion of T-cells using an engineered multivalent signaling platform as a research tool |
| US7446190B2 (en) | 2002-05-28 | 2008-11-04 | Sloan-Kettering Institute For Cancer Research | Nucleic acids encoding chimeric T cell receptors |
| US20050129671A1 (en) | 2003-03-11 | 2005-06-16 | City Of Hope | Mammalian antigen-presenting T cells and bi-specific T cells |
| US20040242504A1 (en) | 2003-05-30 | 2004-12-02 | Vadim Ivanov | Novel composition and method for the treatment of hypertension |
| AU2004242846A1 (en) | 2003-05-31 | 2004-12-09 | Micromet Ag | Pharmaceutical compositions comprising bispecific anti-CD3, anti-CD19 antibody constructs for the treatment of B-cell related disorders |
| WO2005000894A2 (en) * | 2003-06-25 | 2005-01-06 | Crucell Holland B.V. | Binding molecules for the treatment of myeloid cell malignancies |
| US7736644B2 (en) | 2003-06-27 | 2010-06-15 | Amgen Fremont Inc. | Antibodies directed to the deletion mutants of epidermal growth factor receptor and uses thereof |
| WO2005019429A2 (en) | 2003-08-22 | 2005-03-03 | Potentia Pharmaceuticals, Inc. | Compositions and methods for enhancing phagocytosis or phagocyte activity |
| MXPA06002853A (es) | 2003-09-11 | 2006-06-14 | Kemia Inc | Inhibidores citoquina. |
| US20060094056A1 (en) | 2003-09-15 | 2006-05-04 | Oklahoma Medical Research Foundation | Method of using cytokine assays to diagnose treat, and evaluate inflammatory and autoimmune diseases |
| US7435596B2 (en) | 2004-11-04 | 2008-10-14 | St. Jude Children's Research Hospital, Inc. | Modified cell line and method for expansion of NK cell |
| US20050113564A1 (en) | 2003-11-05 | 2005-05-26 | St. Jude Children's Research Hospital | Chimeric receptors with 4-1BB stimulatory signaling domain |
| CA2559394A1 (en) | 2004-01-23 | 2005-09-29 | Sanofi Pasteur Limited | Cytotoxicity assay |
| CA2568344C (en) | 2004-05-27 | 2016-01-19 | The Trustees Of The University Of Pennsylvania | Novel artificial antigen presenting cells and uses therefor |
| US7994298B2 (en) | 2004-09-24 | 2011-08-09 | Trustees Of Dartmouth College | Chimeric NK receptor and methods for treating cancer |
| EP3530321A1 (en) | 2004-12-10 | 2019-08-28 | Peter MacCallum Cancer Institute | Methods and compositions for adoptive immunotherapy |
| US20060171929A1 (en) | 2005-01-31 | 2006-08-03 | The University Of Washington | Regulation of dendritic cell functions by the DCAL-2 receptor |
| KR20080031001A (ko) | 2005-06-02 | 2008-04-07 | 아스트라제네카 아베 | Cd20에 대한 항체 및 그의 용도 |
| US20070036773A1 (en) | 2005-08-09 | 2007-02-15 | City Of Hope | Generation and application of universal T cells for B-ALL |
| EP1795588A1 (en) | 2005-12-07 | 2007-06-13 | Cellerix, S.L. | Use of adipose tissue derived mesenchymal stem cells for the treatment of graft versus host disease |
| WO2008045437A2 (en) | 2006-10-09 | 2008-04-17 | The General Hospital Corporation | Chimeric t-cell receptors and t-cells targeting egfrviii on tumors |
| US20080131415A1 (en) | 2006-11-30 | 2008-06-05 | Riddell Stanley R | Adoptive transfer of cd8 + t cell clones derived from central memory cells |
| WO2008110491A2 (en) | 2007-03-09 | 2008-09-18 | University Of Basel | Chemotherapy of neoplastic diseases using combinations of rapamycin and compounds modulating mtor pathway alone or in combination with heat |
| JP2008228690A (ja) | 2007-03-23 | 2008-10-02 | Mitsukan Group Honsha:Kk | 甘味を有するタンパク質 |
| PL2856876T3 (pl) | 2007-03-30 | 2018-06-29 | Memorial Sloan-Kettering Cancer Center | Konstytutywna ekspresja ligandów kostymulujących na limfocytach T poddanych transferowi adoptywnemu |
| WO2008127735A1 (en) | 2007-04-13 | 2008-10-23 | Stemline Therapeutics, Inc. | Il3ralpha antibody conjugates and uses thereof |
| EP2014680A1 (en) | 2007-07-10 | 2009-01-14 | Friedrich-Alexander-Universität Erlangen-Nürnberg | Recombinant, single-chain, trivalent tri-specific or bi-specific antibody derivatives |
| US20090088373A1 (en) | 2007-09-28 | 2009-04-02 | Gallo Richard L | Use of compositions to enhance innate immune response |
| US8536310B2 (en) | 2007-10-17 | 2013-09-17 | Arca Biopharma, Inc. | Antibodies to CLL-1 |
| WO2009097140A1 (en) | 2008-01-30 | 2009-08-06 | Memorial Sloan-Kettering Cancer Center | Methods for off -the -shelf tumor immunotherapy using allogeneic t-cell precursors |
| US8379824B2 (en) | 2008-03-06 | 2013-02-19 | At&T Intellectual Property I, Lp | Methods and apparatus to provide a network-based caller identification service in a voice over internet protocol network |
| WO2010012829A1 (en) | 2008-07-31 | 2010-02-04 | Helmholtz Zentrum München Deutsches Forschungszentrum Für Gesundheit Und Umwelt (Gmbh) | Her2/neu specific t cell receptors |
| EP2318002A4 (en) | 2008-08-05 | 2012-11-28 | Univ Emory | USE OF MTOR INHIBITORS FOR INCREASING IMMUNE RESPONSES OF T CELLS |
| US8822647B2 (en) | 2008-08-26 | 2014-09-02 | City Of Hope | Method and compositions using a chimeric antigen receptor for enhanced anti-tumor effector functioning of T cells |
| PT2365802T (pt) | 2008-11-11 | 2017-11-14 | Univ Texas | Microcápsulas de rapamicina e utilização para o tratamento de cancro |
| WO2010083298A1 (en) | 2009-01-14 | 2010-07-22 | Health Research Inc. | Methods and compositions containing mtor inhibitors for enhancing immune responses |
| EP2389443B1 (en) | 2009-01-23 | 2018-11-14 | Roger Williams Hospital | Retroviral vectors encoding multiple highly homologous non-viral polypeptides and the use of same |
| WO2010121141A1 (en) | 2009-04-17 | 2010-10-21 | Biogen Idec Ma Inc. | Compositions and methods to treat acute myelogenous leukemia |
| US8465743B2 (en) | 2009-10-01 | 2013-06-18 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Anti-vascular endothelial growth factor receptor-2 chimeric antigen receptors and use of same for the treatment of cancer |
| JP2013505968A (ja) | 2009-10-01 | 2013-02-21 | シーエスエル、リミテッド | フィラデルフィア染色体陽性白血病の治療方法 |
| WO2011059836A2 (en) | 2009-10-29 | 2011-05-19 | Trustees Of Dartmouth College | T cell receptor-deficient t cell compositions |
| EP2531216B1 (en) | 2010-02-04 | 2019-03-27 | The Trustees Of The University Of Pennsylvania | Icos critically regulates the expansion and function of inflammatory human th17 cells |
| SE535129C2 (sv) | 2010-07-13 | 2012-04-24 | Bostik Ab | Komposition för vidhäftning av ett golvmaterial |
| RU2013110875A (ru) | 2010-08-24 | 2014-09-27 | Ф.Хоффманн-Ля Рош Аг | БИСПЕЦИФИЧЕСКИЕ АНТИТЕЛА, СОДЕРЖАЩИЕ СТАБИЛИЗИРОВАННЫЙ ДИСУЛЬФИДОМ ФРАГМЕНТ Fv |
| WO2012033885A1 (en) | 2010-09-08 | 2012-03-15 | Baylor College Of Medicine | Immunotherapy of cancer using genetically engineered gd2-specific t cells |
| NZ723974A (en) | 2010-10-27 | 2017-03-31 | Baylor College Medicine | Chimeric cd27 receptors for redirecting t cells to cd70-positive malignancies |
| US20130273055A1 (en) | 2010-11-16 | 2013-10-17 | Eric Borges | Agents and methods for treating diseases that correlate with bcma expression |
| US9358233B2 (en) | 2010-11-29 | 2016-06-07 | Boehringer Ingelheim International Gmbh | Method for treating acute myeloid leukemia |
| KR101400194B1 (ko) | 2010-12-01 | 2014-05-27 | 제일모직 주식회사 | 컬러필터용 감광성 수지 조성물 및 이를 이용한 컬러필터 |
| PH12013501201A1 (en) | 2010-12-09 | 2013-07-29 | Univ Pennsylvania | Use of chimeric antigen receptor-modified t cells to treat cancer |
| EP3693017A1 (en) | 2010-12-14 | 2020-08-12 | University of Maryland, Baltimore | Universal anti-tag chimeric antigen receptor-expressing t cells and methods of treating cancer |
| US9402865B2 (en) | 2011-01-18 | 2016-08-02 | The Trustees Of The University Of Pennsylvania | Compositions and methods for treating cancer |
| US9987308B2 (en) | 2011-03-23 | 2018-06-05 | Fred Hutchinson Cancer Research Center | Method and compositions for cellular immunotherapy |
| WO2012127464A2 (en) | 2011-03-23 | 2012-09-27 | Gavish-Galilee Bio Applications Ltd | Constitutively activated t cells for use in adoptive cell therapy |
| AU2012236068A1 (en) | 2011-04-01 | 2013-10-17 | Eureka Therapeutics, Inc. | T cell receptor-like antibodies specific for a WT1 peptide presented by HLA-A2 |
| TR201815488T4 (tr) | 2011-04-08 | 2018-11-21 | Health | Anti-epidermal büyüme faktör reseptörü varyant III kimerik antijen reseptörleri ve kanser tedavisi için kullanımı. |
| CA2832569A1 (en) | 2011-04-08 | 2012-10-11 | Baylor College Of Medicine | Reversing the effects of the tumor microenvironment using chimeric cytokine receptors |
| US20130071414A1 (en) | 2011-04-27 | 2013-03-21 | Gianpietro Dotti | Engineered cd19-specific t lymphocytes that coexpress il-15 and an inducible caspase-9 based suicide gene for the treatment of b-cell malignancies |
| SI3415531T1 (sl) | 2011-05-27 | 2023-12-29 | Glaxo Group Limited | Bcma (cd269/tnfrsf17) - vezni proteini |
| US9334306B2 (en) | 2011-07-09 | 2016-05-10 | The Regents Of The University Of California | Leukemia stem cell targeting ligands and methods of use |
| AU2012286994B2 (en) | 2011-07-25 | 2017-08-10 | Nationwide Children's Hospital, Inc. | Recombinant virus products and methods for inhibition of expression of DUX4 |
| PH12014500247A1 (en) | 2011-07-29 | 2014-03-24 | Univ Pennsylvania | Switch costimulatory receptors |
| US20130078250A1 (en) | 2011-08-23 | 2013-03-28 | Oliver Ast | Bispecific t cell activating antigen binding molecules |
| EP2747781B1 (en) | 2011-08-23 | 2017-11-15 | Roche Glycart AG | Bispecific antibodies specific for t-cell activating antigens and a tumor antigen and methods of use |
| EP3321286B1 (en) | 2011-08-23 | 2021-01-06 | Roche Glycart AG | Bispecific t cell activating antigen binding molecules |
| US9833476B2 (en) | 2011-08-31 | 2017-12-05 | The Trustees Of Dartmouth College | NKP30 receptor targeted therapeutics |
| US10421960B2 (en) | 2011-09-16 | 2019-09-24 | The Trustees Of The University Of Pennsylvania | RNA engineered T cells for the treatment of cancer |
| EP2755487B1 (en) | 2011-09-16 | 2018-12-19 | Baylor College Of Medicine | Targeting the tumor microenvironment using manipulated nkt cells |
| IN2014CN02906A (OSRAM) | 2011-10-20 | 2015-07-03 | Us Health | |
| US9688740B2 (en) | 2011-10-26 | 2017-06-27 | National Cancer Center | Mutant CTLA4 gene transfected T cell and composition including same for anticancer immunotherapy |
| US9272002B2 (en) | 2011-10-28 | 2016-03-01 | The Trustees Of The University Of Pennsylvania | Fully human, anti-mesothelin specific chimeric immune receptor for redirected mesothelin-expressing cell targeting |
| WO2013074916A1 (en) | 2011-11-18 | 2013-05-23 | Board Of Regents, The University Of Texas System | Car+ t cells genetically modified to eliminate expression of t- cell receptor and/or hla |
| JP6441079B2 (ja) | 2011-12-19 | 2018-12-19 | シンイミューン ゲーエムベーハー | 二重特異性抗体分子 |
| EP3594245A1 (en) | 2012-02-13 | 2020-01-15 | Seattle Children's Hospital d/b/a Seattle Children's Research Institute | Bispecific chimeric antigen receptors and therapeutic uses thereof |
| KR20140127816A (ko) | 2012-02-22 | 2014-11-04 | 더 트러스티스 오브 더 유니버시티 오브 펜실바니아 | 암의 치료에 유용한 t 세포의 지속성 집단을 생성시키기 위한 조성물 및 방법 |
| SG11201404769UA (en) | 2012-02-22 | 2014-11-27 | Univ Pennsylvania | Use of icos-based cars to enhance antitumor activity and car persistence |
| SG11201404284SA (en) | 2012-02-22 | 2014-10-30 | Univ Pennsylvania | Use of the cd2 signaling domain in second-generation chimeric antigen receptors |
| WO2013126726A1 (en) | 2012-02-22 | 2013-08-29 | The Trustees Of The University Of Pennsylvania | Double transgenic t cells comprising a car and a tcr and their methods of use |
| CN104394884A (zh) | 2012-03-21 | 2015-03-04 | 爱瑞泰克药物公司 | 用于治疗急性髓细胞白血病(aml)的药剂 |
| CA2868121C (en) | 2012-03-23 | 2021-06-01 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Anti-mesothelin chimeric antigen receptors |
| ES3065694T3 (en) | 2012-04-11 | 2026-05-07 | Us Health | Chimeric antigen receptors targeting b-cell maturation antigen |
| US20130271355A1 (en) | 2012-04-13 | 2013-10-17 | Nokia Corporation | Multi-segment wearable accessory |
| US9163090B2 (en) * | 2012-05-07 | 2015-10-20 | Cellerant Therapeutics, Inc. | Antibodies specific for CLL-1 |
| ES2924722T3 (es) | 2012-05-18 | 2022-10-10 | Aptevo Res & Development Llc | Unión de inmunofusión de scFv biespecífico (BIf) a CD123 y CD3 |
| CN103483452B (zh) | 2012-06-12 | 2021-08-13 | 上海细胞治疗集团有限公司 | 双信号独立的嵌合抗原受体及其用途 |
| AU2013289971A1 (en) | 2012-07-13 | 2015-01-22 | The Trustees Of The University Of Pennsylvania | Enhancing activity of CAR T cells by co-introducing a bispecific antibody |
| CN112375846A (zh) | 2012-07-13 | 2021-02-19 | 宾夕法尼亚大学董事会 | 评估用于施用的转导t细胞的适用性的方法 |
| US20150290244A1 (en) | 2012-07-13 | 2015-10-15 | The Trustees Of The University Of Pennsylvania | Use of cart19 to deplete normal b cells to induce tolerance |
| LT3338794T (lt) | 2012-07-13 | 2020-05-25 | The Trustees Of The University Of Pennsylvania | Car priešnavikinio aktyvumo toksiškumo reguliavimas |
| WO2014011987A1 (en) | 2012-07-13 | 2014-01-16 | The Trustees Of The University Of Pennsylvania | Compositions and methods for regulating car t cells |
| US20160235787A1 (en) | 2012-07-13 | 2016-08-18 | The Trustees Of The University Of Pennsylvania | Epitope Spreading Associated with CAR T-Cells |
| PL3824905T3 (pl) | 2012-08-20 | 2025-05-05 | Fred Hutchinson Cancer Center | Sposób i kompozycje do immunoterapii komórkowej |
| US9937205B2 (en) | 2012-09-04 | 2018-04-10 | The Trustees Of The University Of Pennsylvania | Inhibition of diacylglycerol kinase to augment adoptive T cell transfer |
| PL2900694T3 (pl) | 2012-09-27 | 2018-12-31 | Merus N.V. | Dwuswoiste przeciwciała igg jako aktywatory komórek t |
| CN102875685B (zh) | 2012-09-29 | 2013-12-25 | 郑骏年 | 嵌合抗原受体hFⅦL-CD8-OX40-CD3ζ及其用途 |
| AR092745A1 (es) | 2012-10-01 | 2015-04-29 | Univ Pennsylvania | Composiciones que comprenden un dominio de union anti-fap y metodos para hacer blanco en celulas estromales para el tratamiento del cancer |
| WO2014055657A1 (en) | 2012-10-05 | 2014-04-10 | The Trustees Of The University Of Pennsylvania | Use of a trans-signaling approach in chimeric antigen receptors |
| ES2937015T3 (es) | 2012-11-01 | 2023-03-23 | Max Delbrueck Centrum Fuer Molekulare Medizin Helmholtz Gemeinschaft | Anticuerpo contra CD269 (BCMA) |
| AU2013204922B2 (en) | 2012-12-20 | 2015-05-14 | Celgene Corporation | Chimeric antigen receptors |
| AU2014214850C1 (en) | 2013-02-06 | 2018-12-06 | Celgene Corporation | Modified T lymphocytes having improved specificity |
| LT2958943T (lt) | 2013-02-20 | 2020-01-27 | The Trustees Of The University Of Pennsylvania | Vėžio gydymas, naudojant humanizuotą anti-egfrviii chimerinio antigeno receptorių |
| US9573988B2 (en) | 2013-02-20 | 2017-02-21 | Novartis Ag | Effective targeting of primary human leukemia using anti-CD123 chimeric antigen receptor engineered T cells |
| CN103113470B (zh) | 2013-02-27 | 2015-04-22 | 四川大学 | 靶向人egfr的基因工程化淋巴细胞及其制备方法和用途 |
| EP2970426B1 (en) | 2013-03-15 | 2019-08-28 | Michael C. Milone | Targeting cytotoxic cells with chimeric receptors for adoptive immunotherapy |
| US9657105B2 (en) | 2013-03-15 | 2017-05-23 | City Of Hope | CD123-specific chimeric antigen receptor redirected T cells and methods of their use |
| TWI654206B (zh) | 2013-03-16 | 2019-03-21 | 諾華公司 | 使用人類化抗-cd19嵌合抗原受體治療癌症 |
| EP2986636B1 (en) | 2013-04-17 | 2018-11-14 | Baylor College Of Medicine | Immunosuppressive tgf-beta signal converter |
| EP3974520A1 (en) | 2013-05-14 | 2022-03-30 | Board of Regents, The University of Texas System | Human application of engineered chimeric antigen receptor (car) t-cells |
| CA2931684C (en) | 2013-12-19 | 2024-02-20 | Novartis Ag | Human mesothelin chimeric antigen receptors and uses thereof |
| EP3087101B1 (en) | 2013-12-20 | 2024-06-05 | Novartis AG | Regulatable chimeric antigen receptor |
| WO2015112626A1 (en) | 2014-01-21 | 2015-07-30 | June Carl H | Enhanced antigen presenting ability of car t cells by co-introduction of costimulatory molecules |
| EP3593812A3 (en) | 2014-03-15 | 2020-05-27 | Novartis AG | Treatment of cancer using chimeric antigen receptor |
| US20170081411A1 (en) | 2014-03-15 | 2017-03-23 | Novartis Ag | Regulatable chimeric antigen receptor |
| US9777061B2 (en) | 2014-07-21 | 2017-10-03 | Novartis Ag | Treatment of cancer using a CD33 chimeric antigen receptor |
| WO2016014501A1 (en) | 2014-07-21 | 2016-01-28 | Novartis Ag | Sortase molecules and uses thereof |
| WO2016014530A1 (en) | 2014-07-21 | 2016-01-28 | Novartis Ag | Combinations of low, immune enhancing. doses of mtor inhibitors and cars |
| US11542488B2 (en) | 2014-07-21 | 2023-01-03 | Novartis Ag | Sortase synthesized chimeric antigen receptors |
| JP6736540B2 (ja) | 2014-07-21 | 2020-08-05 | ノバルティス アーゲー | Cll−1キメラ抗原受容体を使用した癌の処置 |
| US20170274014A1 (en) | 2014-07-21 | 2017-09-28 | Jennifer Brogdon | Combinations of low, immune enhancing, doses of mtor inhibitors and cars |
| MY181834A (en) | 2014-07-21 | 2021-01-08 | Novartis Ag | Treatment of cancer using humanized anti-bcma chimeric antigen receptor |
| US20170209492A1 (en) | 2014-07-31 | 2017-07-27 | Novartis Ag | Subset-optimized chimeric antigen receptor-containing t-cells |
| WO2016025880A1 (en) | 2014-08-14 | 2016-02-18 | Novartis Ag | Treatment of cancer using gfr alpha-4 chimeric antigen receptor |
| SG11201700770PA (en) | 2014-08-19 | 2017-03-30 | Novartis Ag | Anti-cd123 chimeric antigen receptor (car) for use in cancer treatment |
| ES2891332T3 (es) | 2014-09-17 | 2022-01-27 | Novartis Ag | Direccionamiento a células citotóxicas con receptores quiméricos para la inmunoterapia adoptiva |
| AU2015330898B2 (en) | 2014-10-08 | 2022-03-10 | Novartis Ag | Biomarkers predictive of therapeutic responsiveness to chimeric antigen receptor therapy and uses thereof |
| WO2016061368A1 (en) | 2014-10-15 | 2016-04-21 | The Children's Hospital Of Philadelphia | Compositions and methods for treating b-lymphoid malignancies |
| CN107567461A (zh) | 2014-12-29 | 2018-01-09 | 诺华股份有限公司 | 制备嵌合抗原受体表达细胞的方法 |
| US11459390B2 (en) | 2015-01-16 | 2022-10-04 | Novartis Ag | Phosphoglycerate kinase 1 (PGK) promoters and methods of use for expressing chimeric antigen receptor |
| US11161907B2 (en) | 2015-02-02 | 2021-11-02 | Novartis Ag | Car-expressing cells against multiple tumor antigens and uses thereof |
| EP3280795B1 (en) | 2015-04-07 | 2021-03-24 | Novartis AG | Combination of chimeric antigen receptor therapy and amino pyrimidine derivatives |
| MX2017012939A (es) | 2015-04-08 | 2018-05-22 | Novartis Ag | Terapias cd20, terapias cd22 y terapias de combinacion con una celula que expresa un receptor quimerico de antigeno (car) de cd19. |
| AU2016249005B2 (en) | 2015-04-17 | 2022-06-16 | Novartis Ag | Methods for improving the efficacy and expansion of chimeric antigen receptor-expressing cells |
| EP3286211A1 (en) | 2015-04-23 | 2018-02-28 | Novartis AG | Treatment of cancer using chimeric antigen receptor and protein kinase a blocker |
| WO2017015427A1 (en) | 2015-07-21 | 2017-01-26 | Novartis Ag | Methods for improving the efficacy and expansion of immune cells |
| US11667691B2 (en) | 2015-08-07 | 2023-06-06 | Novartis Ag | Treatment of cancer using chimeric CD3 receptor proteins |
| CN116334205A (zh) | 2015-09-03 | 2023-06-27 | 诺华股份有限公司 | 预测细胞因子释放综合征的生物标志物 |
| HK1250517A1 (zh) | 2015-09-17 | 2018-12-21 | Novartis Ag | 增强功效的car t细胞疗法 |
| PT3393504T (pt) | 2015-12-22 | 2025-12-30 | Novartis Ag | Recetor de antigénio quimérico (car) de mesotelina e anticorpo contra o inibidor de pd-l1 para utilização combinada em terapia anticancerígena |
| BR112018013074A2 (en) | 2015-12-30 | 2018-12-11 | Novartis Ag | immune effector cell therapies with enhanced efficacy |
| CN110214150A (zh) | 2016-07-28 | 2019-09-06 | 诺华股份有限公司 | 嵌合抗原受体和pd-1抑制剂的组合疗法 |
| EP3490590A2 (en) | 2016-08-01 | 2019-06-05 | Novartis AG | Treatment of cancer using a chimeric antigen receptor in combination with an inhibitor of a pro-m2 macrophage molecule |
| WO2018067992A1 (en) | 2016-10-07 | 2018-04-12 | Novartis Ag | Chimeric antigen receptors for the treatment of cancer |
-
2015
- 2015-07-21 JP JP2017503488A patent/JP6736540B2/ja not_active Expired - Fee Related
- 2015-07-21 SG SG11201700418VA patent/SG11201700418VA/en unknown
- 2015-07-21 AR ARP150102310A patent/AR101829A1/es unknown
- 2015-07-21 US US14/805,075 patent/US10568947B2/en active Active
- 2015-07-21 CA CA2955465A patent/CA2955465A1/en not_active Abandoned
- 2015-07-21 TW TW104123638A patent/TWI718992B/zh not_active IP Right Cessation
- 2015-07-21 EP EP15744448.0A patent/EP3171882A1/en not_active Withdrawn
- 2015-07-21 MX MX2017001013A patent/MX2017001013A/es unknown
- 2015-07-21 AU AU2015292811A patent/AU2015292811B2/en not_active Ceased
- 2015-07-21 SG SG10201913782UA patent/SG10201913782UA/en unknown
- 2015-07-21 CN CN201580050589.9A patent/CN107109420A/zh active Pending
- 2015-07-21 KR KR1020177004392A patent/KR20170037625A/ko not_active Ceased
- 2015-07-21 BR BR112017000939A patent/BR112017000939A2/pt not_active IP Right Cessation
- 2015-07-21 RU RU2017105161A patent/RU2741120C2/ru active
- 2015-07-21 WO PCT/US2015/041337 patent/WO2016014535A1/en not_active Ceased
-
2017
- 2017-01-15 IL IL250116A patent/IL250116B/en active IP Right Grant
- 2017-01-20 CO CONC2017/0000506A patent/CO2017000506A2/es unknown
-
2019
- 2019-12-27 US US16/728,557 patent/US20200215171A1/en not_active Abandoned
-
2020
- 2020-03-18 AU AU2020201939A patent/AU2020201939A1/en not_active Abandoned
- 2020-07-15 JP JP2020121501A patent/JP2020185001A/ja active Pending
Non-Patent Citations (2)
| Title |
|---|
| None * |
| See also references of WO2016014535A1 * |
Also Published As
| Publication number | Publication date |
|---|---|
| CN107109420A (zh) | 2017-08-29 |
| TWI718992B (zh) | 2021-02-21 |
| CO2017000506A2 (es) | 2017-06-30 |
| BR112017000939A2 (pt) | 2017-11-14 |
| JP6736540B2 (ja) | 2020-08-05 |
| WO2016014535A1 (en) | 2016-01-28 |
| RU2017105161A3 (OSRAM) | 2019-04-01 |
| AU2020201939A1 (en) | 2020-04-09 |
| IL250116B (en) | 2021-06-30 |
| MX2017001013A (es) | 2018-02-21 |
| CA2955465A1 (en) | 2016-01-28 |
| AR101829A1 (es) | 2017-01-18 |
| RU2017105161A (ru) | 2018-08-21 |
| SG10201913782UA (en) | 2020-03-30 |
| US20160051651A1 (en) | 2016-02-25 |
| US10568947B2 (en) | 2020-02-25 |
| RU2741120C2 (ru) | 2021-01-22 |
| IL250116A0 (en) | 2017-03-30 |
| JP2020185001A (ja) | 2020-11-19 |
| SG11201700418VA (en) | 2017-02-27 |
| AU2015292811A1 (en) | 2017-02-02 |
| AU2015292811B2 (en) | 2019-12-19 |
| KR20170037625A (ko) | 2017-04-04 |
| US20200215171A1 (en) | 2020-07-09 |
| TW201619380A (zh) | 2016-06-01 |
| JP2017522879A (ja) | 2017-08-17 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20250353916A1 (en) | Treatment of cancer using a cd33 chimeric antigen receptor | |
| US12214037B2 (en) | Treatment of cancer using humanized anti-BCMA chimeric antigen receptor | |
| US20200215171A1 (en) | Treatment of cancer using a cll-1 chimeric antigen receptor | |
| AU2015305531B2 (en) | Anti-CD123 chimeric antigen receptor (CAR) for use in cancer treatment | |
| EP4716744A2 (en) | Genetically modified cells comprising a heterologous nucleic acid molecule inserted at a cd5 gene locus field | |
| HK1231901A1 (en) | Treatment of cancer using a cd33 chimeric antigen receptor | |
| HK1231901B (en) | Treatment of cancer using a cd33 chimeric antigen receptor | |
| HK1238262A1 (en) | Anti-cd123 chimeric antigen receptor (car) for use in cancer treatment |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE |
|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE |
|
| 17P | Request for examination filed |
Effective date: 20170206 |
|
| AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR |
|
| AX | Request for extension of the european patent |
Extension state: BA ME |
|
| RIN1 | Information on inventor provided before grant (corrected) |
Inventor name: WEI, LAI Inventor name: GLASS, DAVID Inventor name: KENDERIAN, SAAD Inventor name: GILL, SAAR Inventor name: BROGDON, JENNIFER Inventor name: ZHANG, JIQUAN Inventor name: WU, QILONG Inventor name: SINGH, RESHMA Inventor name: RICHARDSON, CELESTE Inventor name: YANG, QIUMEI Inventor name: MANNICK, JOAN Inventor name: MURPHY, LEON Inventor name: EBERSBACH, HILMAR Inventor name: JASCUR, JULIA Inventor name: MILONE, MICHAEL, C. |
|
| DAV | Request for validation of the european patent (deleted) | ||
| RAX | Requested extension states of the european patent have changed |
Extension state: BA Payment date: 20170206 |
|
| REG | Reference to a national code |
Ref country code: HK Ref legal event code: DE Ref document number: 1231768 Country of ref document: HK |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: EXAMINATION IS IN PROGRESS |
|
| 17Q | First examination report despatched |
Effective date: 20181015 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN |
|
| 18D | Application deemed to be withdrawn |
Effective date: 20230201 |
|
| REG | Reference to a national code |
Ref country code: HK Ref legal event code: WD Ref document number: 1231768 Country of ref document: HK |