WO2022241029A1 - Methods and compositions for genomic integration - Google Patents

Methods and compositions for genomic integration Download PDF

Info

Publication number
WO2022241029A1
WO2022241029A1 PCT/US2022/028831 US2022028831W WO2022241029A1 WO 2022241029 A1 WO2022241029 A1 WO 2022241029A1 US 2022028831 W US2022028831 W US 2022028831W WO 2022241029 A1 WO2022241029 A1 WO 2022241029A1
Authority
WO
WIPO (PCT)
Prior art keywords
sequence
cell
genome
encoding
pharmaceutical composition
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2022/028831
Other languages
English (en)
French (fr)
Inventor
Daniel Getts
Yuxiao WANG
Namita BISARIA
Inna SHCHERBAKOVA
Socheata LY
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Create Medicines Inc
Original Assignee
Myeloid Therapeutics Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to CN202280049196.6A priority Critical patent/CN117836009A/zh
Priority to BR112023023642A priority patent/BR112023023642A2/pt
Priority to GB2318472.4A priority patent/GB2623653A/en
Priority to JP2023570260A priority patent/JP2024518100A/ja
Priority to MX2023013381A priority patent/MX2023013381A/es
Priority to IL308445A priority patent/IL308445A/en
Priority to CA3218780A priority patent/CA3218780A1/en
Priority to KR1020237042556A priority patent/KR20240037192A/ko
Application filed by Myeloid Therapeutics Inc filed Critical Myeloid Therapeutics Inc
Priority to AU2022272235A priority patent/AU2022272235A1/en
Priority to EP22808288.9A priority patent/EP4337268A4/en
Publication of WO2022241029A1 publication Critical patent/WO2022241029A1/en
Priority to US18/157,052 priority patent/US12319925B2/en
Anticipated expiration legal-status Critical
Priority to US19/187,426 priority patent/US20250250584A1/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • A61K48/005Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/70Carbohydrates; Sugars; Derivatives thereof
    • A61K31/7088Compounds having three or more nucleosides or nucleotides
    • A61K31/713Double-stranded nucleic acids or oligonucleotides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/7051T-cell receptor (TcR)-CD3 complex
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/87Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
    • C12N15/90Stable introduction of foreign DNA into chromosome
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/09Fusion polypeptide containing a localisation/targetting motif containing a nuclear localisation signal
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/30Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/33Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/10Type of nucleic acid
    • C12N2310/20Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPR]
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2800/00Nucleic acids vectors
    • C12N2800/80Vectors containing sites for inducing double-stranded breaks, e.g. meganuclease restriction sites
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2800/00Nucleic acids vectors
    • C12N2800/90Vectors containing a transposable element
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2830/00Vector systems having a special element relevant for transcription
    • C12N2830/48Vector systems having a special element relevant for transcription regulating transport or export of RNA, e.g. RRE, PRE, WPRE, CTE
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2830/00Vector systems having a special element relevant for transcription
    • C12N2830/50Vector systems having a special element relevant for transcription regulating RNA stability, not being an intron, e.g. poly A signal
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2840/00Vectors comprising a special translation-regulating system
    • C12N2840/20Vectors comprising a special translation-regulating system translation of more than one cistron
    • C12N2840/203Vectors comprising a special translation-regulating system translation of more than one cistron having an IRES

Definitions

  • nucleic acid cargo e.g., large cargo
  • Viral delivery mechanisms are frequently used to deliver large nucleic acid cargo in a cell but are tied to safety issues and cannot be used to express the cargo in some cell types.
  • subjecting a cell to repeated gene manipulation can affect cell health, induce alterations of cell cycle and render the cell unsuitable for therapeutic use.
  • a pharmaceutical composition comprising a therapeutically effective amount of one or more polynucleic acids, or at least one vector encoding the one or more polynucleic acids, the one or more polynucleic acids comprising: a mobile genetic element comprising a sequence encoding a polypeptide; and an insert sequence, wherein the insert sequence comprises a sequence that is a reverse complement of a sequence encoding an exogenous therapeutic polypeptide, wherein the polypeptide encoded by the sequence of the mobile genetic element promotes integration of the insert sequence into a genome of a cell; and wherein the pharmaceutical composition is substantially non-immunogenic to a human subject.
  • the polypeptide encoded by the sequence of the mobile genetic element comprises one or more long interspersed nuclear element (LINE) polypeptides, wherein the one or more LINE polypeptides comprises: human ORF1p or a functional fragment thereof, and human ORF2p or a functional fragment thereof.
  • the insert sequence stably integrates and/or is retrotransposed into the genome of a human cell.
  • the human cell is an immune cell selected from the group consisting of a T cell, a B cell, a myeloid cell, a monocyte, a macrophage and a dendritic cell.
  • the insert sequence is integrated into the genome (i) by cleavage of a DNA strand of a target site by an endonuclease encoded by the one or more polynucleic acids, (ii) via target-primed reverse transcription (TPRT) or (iii) via reverse splicing of the insert sequence into a DNA target site of the genome.
  • the insert sequence is integrated into the genome at a poly T site using specificity of an endonuclease domain of the human ORF2p.
  • the poly T site comprises the sequence TTTTTA.
  • the one or more polynucleic acids comprises homology arms complementary to a target site in the genome.
  • the insert sequence integrates into: (a) the genome at a locus that is not a ribosomal RNA locus; (b) a gene or regulatory region of a gene of the genome, thereby disrupting the gene or downregulating expression of the gene; (c) a gene or regulatory region of a gene of the genome, thereby upregulating expression of the gene; or (d) the genome and replaces a gene of the genome.
  • the pharmaceutical composition further comprises (i) one or more siRNAs and/or (ii) an RNA guide sequence or a polynucleic acid encoding the RNA guide sequence, and wherein the RNA guide sequence targets a DNA target site of the genome and the insert sequence is integrated into the genome at the DNA target site of the genome.
  • the one or more polynucleic acids have a total length of from 3 kb to 20 kb.
  • the one or more polynucleic acids comprises one or more polyribonucleic acids, one or more RNAs or one or more mRNAs.
  • the exogenous therapeutic polypeptide is selected from the group consisting of a ligand, an antibody, a receptor, an enzyme, a transport protein, a structural protein, a hormone, a contractile protein, a storage protein and a transcription factor.
  • the exogenous therapeutic polypeptide is a receptor selected from the group consisting of a chimeric antigen receptor (CAR) and a T cell receptor (TCR).
  • the one or more polynucleic acids comprises a first expression cassette comprising a promoter sequence, a 5’ UTR sequence, a 3’ UTR sequence and a poly A sequence; wherein: the promoter sequence is upstream of the 5’ UTR sequence, the 5’ UTR sequence is upstream of the sequence of the mobile genetic element encoding a polypeptide, the 3’ UTR sequence is downstream of the insert sequence; and the 3’ UTR is upstream of the poly A sequence; and wherein the 5’ UTR sequence, the 3’ UTR sequence or the poly A sequence comprises a binding site for a human ORF2p or a functional fragment thereof.
  • the insert sequence comprises a second expression cassette comprising a sequence that is a reverse complement of a promoter sequence, a sequence that is a reverse complement of a 5’ UTR sequence, a sequence that is a reverse complement of a 3’ UTR sequence and a sequence that is a reverse complement of a poly A sequence; wherein: (i) the sequence that is a reverse complement of a promoter sequence is downstream of the sequence that is a reverse complement of a 5’ UTR sequence, (ii) the sequence that is a reverse complement of a 5’ UTR sequence is downstream of the sequence that is a reverse complement of a sequence encoding an exogenous therapeutic polypeptide, (iii) the sequence that is a reverse complement of a 3’ UTR sequence is upstream of the sequence that is a reverse complement of a sequence encoding an exogenous therapeutic polypeptide, and (iv) the sequence that is a reverse complement of a poly A sequence is upstream of the sequence that is a reverse complement of a 3
  • the promoter sequence of the first expression cassette is different from the promoter sequence of the second expression cassette.
  • the one or more LINE polypeptides comprises a first LINE polypeptide comprising the human ORF1p or functional fragment thereof and a second LINE polypeptide comprising the human ORF2p or functional fragment thereof, wherein the first LINE polypeptide and the second LINE polypeptide are translated from different open reading frames (ORFs).
  • the one or more polynucleic acids comprises a first polynucleic acid molecule encoding the human ORF1p or functional fragment thereof and a second polynucleic acid molecule encoding the human ORF2p or functional fragment thereof.
  • the one or more polynucleic acids comprises a 5’ UTR sequence and a 3’ UTR sequence, wherein the 5’ UTR comprises a 5' UTR from LINE-1 or a sequence with at least 80% sequence identity to ACUCCUCCCCAUCCUCUCCCUCUGUCCCUCUGUCCCUCUGACCCUGCACUGUCCCAGC ACC; and/or the 3’ UTR comprises a 3' UTR from LINE-1 or a sequence with at least 80% sequence identity to CAGGACACAGCCUUGGAUCAGGACAGAGACUUGGGGGCCAUCCUGCCCCUCCAACCC GACAUGUGUACCUCAGCUUUUUCCCUCACUUGCAUCAAUAAAGCUUCUGUGUUUGGA ACAG.
  • the sequence encoding the exogenous therapeutic polypeptide does not comprise introns.
  • the polypeptide encoded by the sequence of the mobile genetic element comprises a C-terminal nuclear localization signal (NLS), an N-terminal NLS or both.
  • the sequence encoding the exogenous polypeptide is not in frame with a sequence encoding the ORF1p or functional fragment thereof and/or is not in frame with a sequence encoding the ORF2p or functional fragment thereof.
  • the one or more polynucleic acids comprises a sequence encoding a nuclease domain, a nuclease domain that is not derived from ORF2p, a megaTAL nuclease domain, a TALEN domain, a Cas9 domain, a Cas6 domain, a Cas7 domain, a Cas8 domain, a zinc finger binding domain from an R2 retroelement, or a DNA binding domain that binds to repeat sequences.
  • the one or more polynucleic acids comprises a sequence encoding the nuclease domain, wherein the nuclease domain does not have nuclease activity or comprises a mutation that reduces activity of the nuclease domain compared to the nuclease domain without the mutation.
  • the ORF2p or functional fragment thereof lacks endonuclease activity or comprises a mutation selected from the group consisting of S228P and Y1180A, and/or wherein the ORF1p or functional fragment comprises a K3R mutation.
  • the insert sequence comprises a sequence that is a reverse complement of a sequence encoding two or more exogenous therapeutic polypeptides.
  • the one or more polynucleic acids comprises one or more polyribonucleic acids, wherein the exogenous therapeutic polypeptide is a receptor selected from the group consisting of a chimeric antigen receptor (CAR) and a T cell receptor (TCR), and wherein the pharmaceutical composition is formulated for systemic administration to a human subject.
  • the one or more polynucleic acids are formulated in a nanoparticle selected from the group consisting of (i) a lipid nanoparticle and a polymeric nanoparticle; and/or (ii) comprises one or more polynucleic acids selected from the group consisting of glycosylated RNAs, circular RNAs and self- replicating RNAs.
  • a method wherein the method is: (i) a method of treating a disease or condition in a human subject in need thereof comprising administering a pharmaceutical composition described herein to the human subject; or (ii) a method of modifying a population of human cells ex vivo comprising contacting a composition to a population of human cell ex vivo, thereby forming an ex vivo modified population of human cells, the composition comprising one or more polynucleic acids, or at least one vector encoding the one or more polynucleic acids, the one or more polynucleic acids comprising: a mobile genetic element comprising a sequence encoding a polypeptide; and an insert sequence, wherein the insert sequence is a reverse complement of a sequence encoding an exogenous therapeutic polypeptide, wherein the ex vivo modified population of human cells is substantially non-immunogenic to a human subject.
  • the one or more polynucleic acids further comprise (i) a sequence encoding an integrase or a fragment thereof for site directed integration of the insert sequence into the genome and (ii) an integrase genomic landing site sequence that operable by the integrase, wherein the genome landing sequence is greater than 4 consecutive nucleotides long.
  • the ORF2 and the integrase are on separate polynucleotides.
  • the ORF2 and the integrase are on a single polynucleotide.
  • the integrase is not integrated into the genome of the cell.
  • the integrase is a mutated or truncated recombinant protein.
  • the integrase genomic landing sequence that is operable by the integrase is greater than 20 nucleotides long, or greater than 30 nucleotides long.
  • the insert sequence comprises an attachment site operable by the integrase.
  • the integrase genomic landing site is inserted into the genome using a guide RNA and a Cas system.
  • the guide RNA, the CAS system and the genomic landing sequence are in a polynucleotide that is separate from the polynucleotide comprising the sequence encoding the LINE1-ORFs and the insert sequence.
  • one or more ORF polypeptide sequence comprises a mutation.
  • a method for a site- specific integration of a heterologous genomic insert sequence into the genome of a mammalian cell comprising: (i) introducing into the cell (a) a polynucleotide comprising sequences encoding one or more human retrotransposon elements associated with the heterologous insert sequence, and (b) a polynucleotide comprising sequence encoding a guide RNA, an RNA guided integrase or a fragment thereof and a landing sequence operable by the integrase; (ii) verifying the integration of the heterologous insert sequence into the site of the genome.
  • the method further comprises a step of incorporating into the genome the genomic landing sequence of greater than 4 consecutive nucleotides long.
  • the step of incorporating into the genome the genomic landing sequence is performed by an RNA-guided CRISPR-Cas system.
  • the RNA-guided CRISPR-Cas system has an editing function capable of incorporating a sequence of greater than 4 consecutive nucleotides long into a specific genome site.
  • the RNA-guided CRISPR-Cas system incorporates an ORF-mRNA binding sequence into a specified location within the genome that has sequence homology to the sequence of the guide RNA.
  • the insert is about 10 kilobases or greater than 10 kilobases.
  • the polynucleotide is mRNA.
  • a method of stably integrating an insert sequence into genomic DNA of a target cell comprising: contacting a composition to the target cell, the composition comprising a polynucleic acid, wherein the polynucleic acid comprises: an insert sequence, wherein the insert sequence comprises a sequence that is a reverse complement of a sequence encoding an exogenous polypeptide, and a mobile genetic element comprising a sequence encoding a polypeptide, wherein the polypeptide encoded by the sequence of the mobile genetic element promotes integration of the insert sequence into genomic DNA; stably integrating the insert sequence into the genomic DNA of the target cell; and expressing an exogenous polypeptide in the target cell, wherein the target cell is a human hepatocyte.
  • the human hepatocyte is a primary cell. In some embodiments, the human hepatocyte is a from a cultured hepatocyte cell line. In some embodiments, incorporating comprises electroporating under conditions optimum for a human hepatocyte. In some embodiments, the method further comprises culturing the human hepatocyte in vitro after incorporating for about 2 hours, about 3 hours, about 4 hours, about 5 hours, about 6 hours, about 8 hours, about 10 hours or about 24 hours. In some embodiments, the method further comprises introducing the human hepatocyte expressing the exogenous polypeptide into a human subject in need thereof.
  • At least 2% of the human hepatocytes express the exogenous polypeptide at day 10 after incorporating.
  • a method of stably integrating an insert sequence into genomic DNA of a target cell comprising: contacting a composition to the target cell, the composition comprising a polynucleic acid, wherein the polynucleic acid comprises: an insert sequence, wherein the insert sequence comprises a sequence that is a reverse complement of a sequence encoding an exogenous polypeptide, and a mobile genetic element comprising a sequence encoding a polypeptide, wherein the polypeptide encoded by the sequence of the mobile genetic element promotes integration of the insert sequence into genomic DNA; stably integrating the insert sequence into the genomic DNA of the target cell; and expressing an exogenous polypeptide in the target cell, wherein the target cell is a human cardiomyocyte.
  • the human cardiomyocyte is a primary cell. In some embodiments, the human cardiomyocyte is a from a cultured cardiomyocyte cell line. In some embodiments, incorporating comprises electroporating under conditions optimum for a human cardiomyocyte. In some embodiments, the method further comprises culturing the cardiomyocyte in vitro after incorporating for about 2 hours, about 3 hours, about 4 hours, about 5 hours, about 6 hours, about 8 hours, about 10 hours or up to 24 hours. In some embodiments, the method further comprises introducing the human cardiomyocyte expressing the exogenous polypeptide into a human subject in need thereof. In some embodiments, at least 2% of the human cardiomyocytes express the exogenous polypeptide at day 10 after incorporating.
  • a method of stably integrating an insert sequence into genomic DNA of a target cell comprising contacting a composition to the target cell, the composition comprising a polynucleic acid, wherein the polynucleic acid comprises: an insert sequence, wherein the insert sequence comprises a sequence that is a reverse complement of a sequence encoding an exogenous polypeptide, and a mobile genetic element comprising a sequence encoding a polypeptide, wherein the polypeptide encoded by the sequence of the mobile genetic element promotes integration of the insert sequence into genomic DNA; stably integrating the insert sequence into the genomic DNA of the target cell; and expressing an exogenous polypeptide in the target cell, wherein the target cell is a human retinal pigment epithelial cell.
  • the human retinal pigment epithelial cell is a primary cell. In some embodiments, the human retinal pigment epithelial is a from a cultured retinal pigment epithelial cell line. In some embodiments, incorporating comprises electroporating under conditions optimum for a human retinal pigment epithelial cell. In some embodiments, the method further comprises culturing the retinal pigment epithelial cell in vitro after incorporating for about 2 hours, about 3 hours, about 4 hours, about 5 hours, about 6 hours, about 8 hours, about 10 hours or up to 24 hours. In some embodiments, the method further comprises introducing the human retinal pigment epithelial cell expressing the exogenous polypeptide into a human subject in need thereof.
  • At least 2% of the human RPE express the exogenous polypeptide at day 10 after incorporating.
  • a method of stably integrating an insert sequence into genomic DNA of a target cell comprising contacting a composition to the target cell, the composition comprising a polynucleic acid, wherein the polynucleic acid comprises: an insert sequence, wherein the insert sequence comprises a sequence that is a reverse complement of a sequence encoding an exogenous polypeptide, and a mobile genetic element comprising a sequence encoding a polypeptide, wherein the polypeptide encoded by the sequence of the mobile genetic element promotes integration of the insert sequence into genomic DNA: stably integrating the insert sequence into the genomic DNA of the target cell; and expressing an exogenous polypeptide in the target cell, wherein the target cell is a human neuronal cell.
  • the human neuronal cell is a primary cell. In some embodiments, the human neuronal cell is a from a cultured neuronal cell line. In some embodiments, incorporating comprises electroporating under conditions optimum for a human neuronal cell. In some embodiments, the method further comprises culturing the neuronal cell in vitro after incorporating for about 2 hours, about 3 hours, about 4 hours, about 5 hours, about 6 hours, about 8 hours, about 10 hours or up to 24 hours. In some embodiments, the method further comprises introducing the human neuronal cell expressing the exogenous polypeptide into a human. In some embodiments, at least 2% of the human neuronal cells express the exogenous polypeptide at day 10 after incorporating.
  • the insert sequence is a human insert sequence.
  • the exogenous polypeptide is an exogenous therapeutic polypeptide.
  • the exogenous polypeptide is an exogenous human polypeptide.
  • the polypeptide encoded by the sequence of the mobile genetic element promotes integration of the insert sequence into genomic DNA via target-primed reverse transcription (TPRT).
  • TPRT target-primed reverse transcription
  • the polynucleic acid is an mRNA or an mRNA molecule.
  • the mobile genetic element comprises a human LINE 1 retrotransposon element.
  • the ORF2p is selected from a non-human species.
  • the ORF2p selected from a non-human species is further modified to enhance retrotransposition efficiency and/or translation efficiency.
  • the cell is an immune cell, a hepatocyte, a cardiomyocyte, a retinal pigment epithelial cell or a neuron.
  • the ORF2p comprises an nuclear localization sequence (NLS).
  • the ORF2p comprises at least 2 NLSs that are the same or different.
  • the NLS is N-terminal to a sequence encoding ORF1p, ORF2p or both.
  • the NLS is C-terminal to a sequence encoding ORF1p, ORF2p or both.
  • the NLS is from SV40. In some embodiments, the NLS is from nucleoplasmin. In some embodiments, a first NLS of the at least 2 NLSs is from SV40 and a second NLS of the at least 2 NLSs is from nucleoplasmin. In some embodiments, a first and a second NLS of the at least 2 NLSs are from SV40. In some embodiments, a first and a second NLS of the at least 2 NLSs are from nucleoplasmin. In some embodiments, each of the at least 2 NLSs are the same.
  • FIG. 1A illustrates a general mechanism of action of retrotransposons.
  • I is a schematic representing the overall lifecycle of an autonomous retrotransposon.
  • II LINE-1 retrotransposon comprises LINE-1 elements, which encode two proteins ORF1p and ORF2p that are expressed as mRNAs.
  • FIG.1B is an illustration of a schematic diagram of an mRNA construct that comprises a genetic payload (left) that can be designed for integration into the genome (right).
  • FIG. 1C illustrates various exemplary designs for integrating an mRNA encoding a transgene into the genome of a cell. GFP shown here in a box is an exemplary transgene.
  • FIG. 1D illustrates various exemplary designs for integrating an mRNA encoding a transgene into the genome of a cell. GFP shown here in a box is an exemplary transgene.
  • FIG. 1E is an illustration a schematic of the LINE-1 retrotransposition cycle showing the mechanism of action of the LINE transposons and introduction of a transgene cargo into a retrotransposon cite. LINE-1 retrotransposons are genomic sequences that encode for two proteins, ORF1 and ORF2.
  • RNA-protein complex with the LINE-1 mRNA, ORF1 trimers, and ORF2, a reverse-transcriptase endonuclease.
  • This complex translocates back into the nuclease where it cleaves DNA at a 5’-TTTT N-3’ motif and is primed for reverse-transcription of the LINE-1 RNA by the ORF2 protein by making an RNA-DNA hybrid with the poly A tail of the mRNA and the resected cleaved DNA.
  • Reverse-transcription of the LINE-1 into cDNA leads to a new LINE-1 integration event.
  • FIG.2A illustrates three exemplary designs for expressing an exemplary transgene GFP by stably incorporating the sequence encoding GFP using the constructs. Expected GFP expression levels at 72 hours are shown on the right side.
  • FIG.2B illustrates three exemplary designs for expressing an exemplary transgene GFP by stably incorporating the sequence encoding RFP, RFP and GFP or ORF2p and GFP using the constructs. Expected GFP and RFP expression levels at 72 hours are shown on the right side.
  • FIG.3A illustrates an exemplary diagram of conventional circRNA structure and formation.
  • FIG.3B illustrates two views of an exemplary RL-GAAA tectoRNA motif designs.
  • FIG. 3C illustrates exemplary structures of chip-flow piece RNAs as platforms for testing potential tectoRNA.
  • FIG.4A illustrates an exemplary schematic showing ORF2p binding to an ORF2 poly A region.
  • FIG.4B illustrates an exemplary schematic showing how a fusion of ORF2p with an MS2 RNA binding domain binds to an MS2 binding RNA sequence in the 3’UTR of an mRNA encoding the ORF2 an increase specificity.
  • FIG.4C illustrates exemplary designs of retrotransposon systems for stably integrating a nucleic acid into the genome of a cell at specific sites.
  • the upper panel shows a design using an ORFp2-MegaTAL DNA binding domain fusion where the DNA binding and endonuclease activity of ORF2p is mutated to be inactive.
  • the middle panel shows a chimeric ORF2p where the endonuclease domain has been replaced with a high specificity and high-fidelity nuclease domain of another protein.
  • the lower panel shows a fusion of a DNA binding domain of a heterologous protein with ORF2p such that the fusion protein binds to ORF2 binding site as well additional DNA sequences in the vicinity of the ORF2 site.
  • FIG. 5 illustrates exemplary constructs (I) – (X) for integrating an mRNA encoding a transgene into the genome of a cell.
  • FIG. 6A illustrates an exemplary construct with a sequence encoding ORF1p for integrating an mRNA encoding a transgene into the genome of a cell.
  • FIG. 6B illustrates an exemplary construct without a sequence encoding ORF1p for integrating an mRNA encoding a transgene into the genome of a cell.
  • FIG. 6A illustrates an exemplary construct with a sequence encoding ORF1p for integrating an mRNA encoding a transgene into the genome of a cell.
  • FIG. 6B illustrates an exemplary construct without a sequence encoding ORF1p for integrating an mRNA encoding a transgene into the genome of a cell.
  • FIG. 7A illustrates exemplary methods of improving mRNA half-life by inhibiting degradation by 5’-3’ exonucleases, such as XRN1, or 3’-5’ exosomal degradation, by introducing structures corresponding to a G-quadruplex, or, a pseudoknot in the 5’UTR; and/or xrRNAs, a triplex motifs and/or a non-A nucleotide residues in the 3’UTR.
  • FIG.7B illustrates an exemplary schematic of a myeloid cell expressing a transgene encoding a chimeric receptor that binds a cancer cell and induces anti-cancer activity.
  • FIG. 7B illustrates an exemplary schematic of a myeloid cell expressing a transgene encoding a chimeric receptor that binds a cancer cell and induces anti-cancer activity.
  • FIG. 7C shows expected results of introducing bulk or purified RNA encoding a chimeric receptor that binds a cancer cell as described in FIG. 7B on increased and prolonged expression of the chimeric receptors.
  • FIG.8A shows an exemplary plasmid design and expected LINE-1 mRNA transcript with a cargo nucleic acid sequence.
  • the plasmid has a LINE-1 sequence (comprising ORF1 and ORF2 protein encoding sequences) and a cargo sequence which is a nucleic acid sequence encoding GFP, where the coding sequence of GFP is interrupted with an intron. The GFP is not expressed until the sequence is integrated in the genome and the intron is spliced.
  • FIG. 8A shows an exemplary plasmid design and expected LINE-1 mRNA transcript with a cargo nucleic acid sequence.
  • the plasmid has a LINE-1 sequence (comprising ORF1 and ORF2 protein encoding sequences) and a cargo sequence which is
  • FIG. 8B shows exemplary results showing successful integration of the mRNA transcript encoded by the plasmid shown in FIG. 8A and expression of GFP relative to mock-transfected cells (fold increase in mean fluorescence intensity of GFP positive cells is shown). Mock transfected cells were transfected by the vector lacking the GFP cargo sequence.
  • FIG.8C shows exemplary flow cytometry results from the results shown in FIG.8B.
  • FIG.9A shows an exemplary plasmid design and expected LINE-1 mRNA transcript with a cargo nucleic acid sequence.
  • the plasmid has a LINE-1 sequence (comprising ORF1 and ORF2 protein encoding sequences) and a cargo sequence which is a nucleic acid sequence encoding a recombinant chimeric fusion receptor protein (ATAK receptor) that has extracellular region capable of binding to CD5 and an intracellular region comprising an FCR intracellular domain and a PI3 kinase recruitment domain.
  • ATAK receptor recombinant chimeric fusion receptor protein
  • the coding sequence of the ATAK receptor is interrupted with an intron.
  • FIG. 9B shows exemplary results showing successful integration of the mRNA transcript encoded by the plasmid shown in FIG. 9A and expression of ATAK relative to mock-transfected cells (fold increase in mean fluorescence intensity of ATAK positive cells is shown).
  • FIG.9C shows exemplary flow cytometry results from the results shown in FIG.9B.
  • FIG. 10A shows an exemplary plasmid design and expected LINE-1 mRNA transcript with a cargo nucleic acid sequence.
  • the plasmid has a LINE-1 sequence (comprising ORF1 and ORF2 protein encoding sequences) and a cargo sequence which is a nucleic acid sequence encoding a recombinant chimeric fusion receptor protein (ATAK receptor) followed by a T2A self-cleavage sequence followed by a split GFP sequence (all in a reverse orientation relative to the LINE-1 sequence).
  • the coding sequence of the GFP is interrupted with an intron. Expected mRNA after reverse transcription and integration of the cargo are depicted.
  • FIG. 10B shows exemplary results showing successful integration of the mRNA transcript encoded by the plasmid shown in FIG.
  • FIG. 10A shows representative flow cytometry data from two separate experimental runs for expression of both GFP and CD5 binder (ATAK) using the experimental setup shown in FIG.10A.
  • FIG. 10D shows representative flow cytometry data from two separate experimental runs for expression of both GFP and CD5 binder (ATAK) using the experimental setup shown in FIG.10A.
  • FIG. 11A shows exemplary mRNA constructs for retrotransposition-based gene delivery.
  • the ORF1 and ORF2 sequences are in two difference mRNA molecules.
  • the ORF2p (ORF2) coding mRNA comprises and inverted GFP coding sequence.
  • FIG.11B depicts exemplary data showing expression of GFP (fold increase in mean fluorescence intensity of GFP positive cells is shown) upon electroporating both ORF1-mRNA and ORF2-FLAG-GFPai mRNA normalized to electroporation of ORF2-FLAG-GFPai mRNA only.
  • FIG.12A depicts exemplary data showing expression of GFP (fold increase in mean fluorescence intensity of GFP positive cells is shown) upon electroporating ORF1-mRNA and ORF2-FLAG-GFPai mRNA at different amounts. Fold increase is relative to 1x ORF2-GFPao and 1x ORF1 mRNA.
  • FIG. 12B shows an exemplary fluorescent microscopy image of GFP+ cells following electroporation of the mRNA depicted in FIG.11A.
  • FIG.13A shows exemplary mRNA constructs where the ORF1 and ORF2 sequences are in two difference mRNA molecules (top panel) and a LINE-1 mRNA transcript comprising ORF1 and ORF2 protein encoding sequences on a single mRNA molecule (bottom panel) for gene delivery.
  • mRNA contains the bicistronic ORF1 and ORF2 sequence with a CMV-GFP sequence in the 3’UTR going from 3’-5’.
  • LINE-1 mRNA Upon retrotransposition of the delivered ORF2-cmv-GFP antisense (LINE-1 mRNA), cells are expected to express GFP.
  • FIG.13B depicts exemplary data showing expression of GFP (fold increase in mean fluorescence intensity of GFP positive cells is shown) upon electroporating the constructs depicted in FIG.13A.
  • FIG.14A shows an exemplary experimental design for testing whether multiple electroporations increases retrotransposition efficiency. HEK293T cells were electroporated every 48 hours with the Maxcyte system and assessed for GFP positive cells using flow after culturing for 24-72 hrs.
  • FIG.14B depicts exemplary data showing expression of GFP at the indicated times (fold increase in mean fluorescence intensity of GFP positive cells is shown) upon electroporating 1-5 times according to FIG.14A.
  • FIG.15A depicts exemplary constructs to enhance retrotransposition via mRNA delivery.
  • a nuclear localization signal (NLS) sequence is fused to the C terminus of the ORF2 sequence (ORF2-NLS fusion).
  • a Minke whale ORF2 sequence was used in place of the human ORF2.
  • a minimal sequence of the Alu element (AJL-H33delta) is inserted in the 3’UTR of the LINE-1 sequence.
  • MS2 hairpins are inserted in the 3’UTR of the LINE-1 sequence and an MS2 hairpin binding protein (MCP) sequence is fused to the ORF2 sequence.
  • MCP MS2 hairpin binding protein
  • FIG.15B depicts exemplary data showing expression of GFP (fold increase in mean fluorescence intensity of GFP positive cells is shown) using the constructs depicted in FIG.15A.
  • FIG.16A shows exemplary plasmid constructs where the ORF1 and ORF2 sequences are in two difference plasmid molecules (top panel) and a plasmid encoding a LINE-1 mRNA transcript comprising ORF1 and ORF2 protein encoding sequences on a single mRNA molecule with various replacements of the inter-ORF sequence between ORF1 and ORF2 (bottom panel) for gene delivery.
  • FIG.16B depicts exemplary data showing expression of GFP (fold increase in mean fluorescence intensity of GFP positive cells is shown) using the constructs depicted in FIG.16A.
  • FIG. 17A depicts an exemplary plasmid construct encoding a LINE-1 mRNA transcript comprising ORF1 and ORF2 protein encoding sequences on a single mRNA molecule with a GFP sequence (top panel) and an exemplary LINE-1 mRNA transcript comprising ORF1 and ORF2 protein encoding sequences on a single mRNA molecule with a GFP sequence.
  • FIG.17B depicts exemplary data showing expression of GFP (fold increase in mean fluorescence intensity of GFP positive cells is shown) in Jurkat cells using the constructs depicted in FIG. 17A.
  • the plasmid construct was transfected, and the mRNA construct was electroporated.
  • FIG. 18A shows an exemplary plasmid design and expected LINE-1 mRNA transcript with a cargo nucleic acid sequence.
  • the plasmid has a LINE-1 sequence (comprising ORF1 and ORF2 protein encoding sequences) and a cargo sequence which is a nucleic acid sequence encoding a recombinant chimeric fusion receptor protein (ATAK receptor) followed by a T2A self-cleavage sequence followed by a split GFP sequence (all in a reverse orientation relative to the LINE-1 sequence).
  • the coding sequence of the GFP is interrupted with an intron.
  • Expected mRNA after reverse transcription and integration of the cargo are depicted.
  • FIG. 18B shows exemplary results showing successful integration of the mRNA transcript encoded by the plasmid shown in FIG.
  • FIG. 19 illustrates an exemplary experimental set up for cell synchronization.
  • a heterogenous cell population is sorted based on cell cycle stage, prior to delivery of an exogenous nucleic acid. Cell cycle synchronization is expected to result in higher expression and stabilization of the exogenous nucleic acid delivered.
  • FIG. 20 illustrates an exemplary method for increasing retrotransposon efficiency by inducing DNA double stranded breaks, with or without inhibiting DNA repair pathways, such as by inducing DNA ligase inhibitor SCR7 or inhibiting host surveillance proteins, for example, using miRNA to HUSH complex TASOR protein.
  • FIG.21 illustrates exemplary constructs for integrating an mRNA encoding a transgene into the genome of a cell.
  • FIG.22 illustrates exemplary constructs for integrating an mRNA encoding a transgene into the genome of a cell.
  • FIG.23 illustrates exemplary constructs for integrating an mRNA encoding a transgene into the genome of a cell.
  • FIG.24 illustrates exemplary constructs for integrating an mRNA encoding a transgene into the genome of a cell.
  • FIG.25 illustrates exemplary constructs for integrating an mRNA encoding a transgene into the genome of a cell.
  • FIG.26 illustrates exemplary constructs for integrating an mRNA encoding a transgene into the genome of a cell.
  • FIG.27 illustrates exemplary constructs for integrating an mRNA encoding a transgene into the genome of a cell.
  • FIG.28 illustrates exemplary constructs for integrating an mRNA encoding a transgene into the genome of a cell.
  • FIG.29 illustrates exemplary retrotransposon constructs (left) with a 2.4 kb cargo with a general mechanism of action of the retrotransposon, and a representative data (right) for expression of a fluorescent GFP marker encoded by the cargo from a nucleic acid sequence integrated into the genome in HEK293 cells. Placement of an antisense GFP gene split with an intron in the sense direction and a promoter sequence in the 3’UTR of the LINE-1 leads to reconstitution and retrotransposition of the GFP cargo.
  • FIG. 30 illustrates exemplary retrotransposon constructs (left) with a 3.0 kb cargo comprising a membrane protein (CD5 binder chimeric antigen receptor, CD5-CAR), and a representative flow cytometry data for expression of the CD5 binder (right) from the nucleic acid sequence integrated into the genome in HEK293 cells. % of CD5 binder positive (+) cells is indicated in the inset.
  • FIG.31 illustrates an exemplary retrotransposon construct (top) with a 3.7 kb cargo comprising a membrane protein (CD5 binder chimeric antigen receptor, CD5-CAR and a GFP separated by an auto- cleavable T2A element), and a representative flow cytometry data (bottom) demonstrating the expression of the CD5 binder and GFP.
  • FIG. 32 illustrates an exemplary retrotransposon construct (top) with a 3.9 kb cargo comprising a membrane protein (HER2 binder chimeric antigen receptor, and a GFP separated by an auto-cleavable T2A element), and a representative flow cytometry data (bottom) demonstrating the expression of the HER2 binder and GFP.
  • FIG.33A shows exemplary data for delivery of retrotransposon elements delivered as mRNA.
  • FIG. 33B shows schematic diagram showing a trans and a cis mRNA design for delivery of LINE1 mRNA with GFP cargo (top panel). Representative results of electroporation of 293T cells with trans mRNAs with separate ORF1 and ORF2 mRNAs.293T cells were electroporated with 100 ug/mL of mRNA either with ORF2 alone, ORF1 + ORF2 mRNAs, each at 100 ug/mL, or a GFP-encoding mRNA with the same 5’ and 3’UTRs as the ORF1 mRNA (left panel of data plots).
  • Retrotransposition events result in GFP-positive cells.
  • Cells were assayed for GFP fluorescence by flow cytometry 4 days and 10 days post-electroporation. Mock electroporated cells serve as the negative control population for gating.
  • Bar graph on the right shows results from a representative experiment indicating titration of trans mRNAs and cis ORF1 and ORF2 containing mRNA concentration during electroporation.
  • Trans mRNAs solid bars and cis mRNA stripes.20X is 2000 ug/mL in the electroporation reaction.
  • FIG. 33C shows titration of the ORF1 and ORF2-GFPai trans mRNAs.
  • FIG. 33D illustrates an exemplary data for the different constructs indicated above each flow cytometry data plot in the figure, the top panel on day 4, and the bottom panel on day 13.
  • Right hand figures illustrate light and fluorescent microscopic images of a the GFP expressing cells in culture. Copies of integrated cargo per construct is demonstrated in the bottom right at day 13.
  • qPCR assay for genomic DNA integration from different LINE-1 plasmid transfected, LINE-1 mRNA (retro-mRNA), and ORF1 and ORF2-GFP mRNA electroporated cells is shown.
  • FIG. 34 illustrates exemplary retrotransposon construct (left) and expression data (right) in the indicated cell lines.
  • FIG.35 illustrates flow cytometry data showing expression of LINE 1 GFP constructs in K562, 293T and THP1 cells (upper panel); and number of integrations of LINE-2-GFP mRNA per cell in K562 and THP-1 cell lines (lower panel).
  • FIG.36 illustrates flow cytometry data showing expression of LINE 1 GFP constructs in primary T cells (left). Integrations per cell are indicated in the graph on the right. Data was collected on day 6 after electroporation.
  • FIG. 37A shows a schematic of activation, culture times, electroporation, and GFP expression assay of isolated primary T cells.
  • FIG.37B illustrates flow cytometry data showing expression of LINE 1 GFP mRNA constructs in primary T cells at the indicated concentrations and before and after freeze-thaw as indicated in the figure. Integrations per cell is shown in the bar diagram. GFP expression using a retro-mRNA electroporation with a GFP cargo. GFP expression was assayed 4 days post electroporation and 15 days of culturing post electroporation. Primary T cells were cryo-preserved and thawed during this time. qPCR integration assay for GFP integration. Genomic DNA from the 20X sample was isolated and assayed for copies of GFP. [0084] FIG.38 demonstrates a summary of results of retrotransposon integration and expression across cell types.
  • FIG.39 shows various applications of the technology described herein, including but not limited to use of CART cells, NK cells, neurons and other cells for cell therapy, and use of in vivo applications in including but not limited to gene therapy, gene editing, transcription regulation, and genome engineering.
  • FIG.40 depicts exemplary flow cytometry data showing sorting and enriching GFP+ 293T cells electroporated with 2000 ng/ ⁇ L LINE1-GFP mRNA. The first panel shows flow cytometry data for mock electroporated cells in the absence of LINE1-GFP mRNA. The second panel shows flow cytometry data collected 5 days post electroporation for unsorted cells electroporated with LINE1-GFP mRNA.
  • FIG. 41A shows a standard curve for GFP (NB2 plasmid) and a housekeeping gene (FAU) for evaluating genomic integration of GFP-encoding nucleic acid per cell using quantitative PCR.
  • FIG. 41A shows a standard curve for GFP (NB2 plasmid) and a housekeeping gene (FAU) for evaluating genomic integration of GFP-encoding nucleic acid per cell using quantitative PCR.
  • FIG. 41B shows results of an exemplary graph depicting interpolation of the standard curves of FIG.41A for quantitation of genomic integration.
  • FIG. 41C shows the number of the GFP gene integrated into genome of 293T cells following LINE1-GFP mRNA electroporation and double sorting as shown in FIG.40. The average number of GFP integrations per cell when gated at 10 ⁇ 3 GFP+ cells and at 10 ⁇ 4 GFP+ cells according to qPCR are shown. [0090] FIG.
  • FIG. 42 depicts exemplary flow cytometry data showing GFP+ 293T cells electroporated with the indicated titrated amounts of LINE1-GFP mRNA, in ng/ ⁇ L in electroporation solution, after culturing for 3 days post-electroporation.
  • FIG. 43 depicts exemplary flow cytometry data showing GFP+ 293T cells electroporated with the indicated titrated amounts of LINE1-GFP mRNA, in ng/ ⁇ L in electroporation solution, after culturing for 5 days post-electroporation.
  • FIG. 43 depicts exemplary flow cytometry data showing GFP+ 293T cells electroporated with the indicated titrated amounts of LINE1-GFP mRNA, in ng/ ⁇ L in electroporation solution, after culturing for 5 days post-electroporation.
  • FIG. 44 depicts exemplary flow cytometry data showing GFP+ 293T cells electroporated with the indicated titrated amounts of LINE1-GFP mRNA, in ng/ ⁇ L in electroporation solution, after culturing for 7 days post-electroporation.
  • FIG. 45 shows a graph of the number of GFP integrations per genome of 293T cells electroporated with the indicated titrated amounts of LINE1-GFP mRNA, in ng/ ⁇ L in electroporation solution, according to qPCR after culturing for 3, 5 or 7 days post-electroporation according to FIGs.42- 44 (top) and a graph of the integration kinetics (bottom) according to the data from FIGs.42-44.
  • FIG.46 depicts exemplary flow cytometry data (right) showing GFP+ K562 cells electroporated with the indicated titrated amounts of LINE1-GFP mRNA, in ng/ ⁇ L in electroporation solution, after culturing for 6 days post-electroporation, and a graph of the number of GFP integrations per genome according to qPCR (left).
  • FIG. 47 depicts exemplary flow cytometry data (top) showing GFP+ human primary monocytes electroporated with the indicated titrated amounts of LINE1-GFP mRNA after culturing for 3 days post- electroporation, and a graph of the number of GFP integrations per genome according to qPCR (bottom).
  • FIG.48 depicts exemplary flow cytometry data (bottom) showing GFP+ 293T cells electroporated with 2000 ng/ ⁇ L LINE1-GFP mRNA and 100 ng/ ⁇ L, 200 ng/ ⁇ L or 300 ng/ ⁇ L of an siRNA targeting BRCA1 (siBRCA1) after culturing for 4 days post-electroporation and a graph of the number of GFP integrations per genome according to qPCR (top).
  • FIG.49 depicts exemplary flow cytometry data (bottom) showing GFP+ 293T cells electroporated with 2000 ng/ ⁇ L LINE1-GFP mRNA and 100 ng/ ⁇ L of an siRNA targeting RNASEL (siRNASEL), ADAR1 (siADAR1), or ADAR2 (siADAR2) after culturing for 6 days post-electroporation and a graph of the number of GFP integrations per genome according to qPCR (top).
  • siRNASEL siRNA targeting RNASEL
  • ADAR1 siADAR1
  • ADAR2 siADAR2
  • FIG. 50 depicts exemplary flow cytometry data (bottom) showing GFP+ 293T cells electroporated with 2000 ng/ ⁇ L LINE1-GFP mRNA and 100 ng/ ⁇ L of an siRNA targeting APOBEC3C (siAPOBEC3C) or FAM208A (siFAM208A) after culturing for 6 days post-electroporation and a graph of the number of GFP integrations per genome according to qPCR (top).
  • siAPOBEC3C siRNA targeting APOBEC3C
  • FAM208A siFAM208A
  • FIG. 51 depicts exemplary flow cytometry data (bottom) showing GFP+ 293T cells electroporated with 1000 ng/ ⁇ L or 1500 ng/ ⁇ L LINE1-GFP mRNA and an siRNA cocktail with 25 ng/ ⁇ L, 50 ng/ ⁇ L or 75 ng/ ⁇ L of each siRNA targeting RNASEL (siRNASEL), ADAR1 (siADAR1), ADAR2 (siADAR2) and BRCA1 (siBRCA1) after culturing for 6 days post-electroporation and a graph of the number of GFP integrations per genome according to qPCR (top). [00100] FIG.
  • FIG. 52 depicts exemplary flow cytometry data (bottom) showing GFP+ K562 cells electroporated with 1000 ng/ ⁇ L LINE1-GFP mRNA and an siRNA cocktail with 25 ng/ ⁇ L, 50 ng/ ⁇ L or 75 ng/ ⁇ L of each siRNA targeting RNASEL (siRNASEL), ADAR1 (siADAR1), ADAR2 (siADAR2) and BRCA1 (siBRCA1) after culturing for 5 days post-electroporation and a graph of the number of GFP integrations per cell according to qPCR (top).
  • siRNASEL siRNASEL
  • ADAR1 siADAR1
  • ADAR2 siADAR2
  • BRCA1 siBRCA1
  • FIG. 53 depicts a schematic showing exemplary locations of extraneous nuclear localization sequences (NLS) and exemplary ORF1p and ORF2p mutations of an exemplary LINE1-GFP mRNA construct.
  • FIG. 54A depicts a schematic showing an exemplary LINE1-GFP construct in which an NLS was inserted at the N-terminal end of the sequence encoding ORF1.
  • FIG.54B depicts a bar graph showing GFP integrations per cell on day 4 post electroporation of the indicated constructs into 293T cells.
  • FIG. 54C depicts exemplary flow cytometry showing GFP+ 293T cells on day 4 post electroporation of the indicated constructs.
  • FIG. 54A depicts a schematic showing an exemplary LINE1-GFP construct in which an NLS was inserted at the N-terminal end of the sequence encoding ORF1.
  • FIG.54B depicts a bar graph showing GFP integrations per cell on day 4 post electroporation of the indicated constructs into
  • FIG. 55A depicts a schematic showing an exemplary LINE1-GFP construct in which an NLS was inserted at the C-terminal end of the sequence encoding ORF1.
  • FIG.55B depicts a bar graph showing GFP integrations per cell on day 4 post electroporation of the indicated constructs into 293T cells.
  • FIG. 55C depicts exemplary flow cytometry showing GFP+ 293T cells on day 4 post electroporation of the indicated constructs.
  • FIG. 56A depicts a schematic showing an exemplary LINE1-GFP construct in which an NLS was inserted at the N-terminal end of the sequence encoding ORF2.
  • FIG.56B depicts a bar graph showing GFP integrations per cell on day 4 post electroporation of the indicated constructs into 293T cells.
  • FIG. 56C depicts exemplary flow cytometry showing GFP+ 293T cells on day 4 post electroporation of the indicated constructs.
  • FIG.57A depicts a schematic showing an exemplary LINE1-GFP construct in which an NLS and a linker was inserted at the N-terminal end of the sequence encoding ORF2.
  • FIG.57B depicts a bar graph showing GFP integrations per cell on day 5 post electroporation of the indicated constructs into 293T cells.
  • FIG. 57C depicts exemplary flow cytometry showing GFP+ 293T cells on day 5 post electroporation of the indicated constructs.
  • FIG. 58A depicts a schematic showing an exemplary LINE1-GFP construct in which an NLS was inserted at the C-terminal end of the sequence encoding ORF2.
  • FIG.58B depicts a bar graph showing GFP integrations per cell on day 5 post electroporation of the indicated constructs into 293T cells.
  • FIG. 58C depicts exemplary flow cytometry showing GFP+ 293T cells on day 5 post electroporation of the indicated constructs.
  • the present invention arises in part from the exciting discovery that a polynucleotide could be designed and developed to accomplish transfer and integration of a genetic cargo (e.g., large genetic cargo) into the genome of a cell.
  • a genetic cargo e.g., large genetic cargo
  • the polynucleotide comprises (i) a genetic material for stable expression, and (ii) a self-integrating genomic integration machinery that allows stable integration of the genetic material into a cell by non-viral means, that is both safe and efficacious.
  • the genetic material may be integrated at a locus other than a ribosomal locus; the genetic material may be integrated site-specifically; and/or the integrated genetic material appear to express without triggering a cell’s natural silencing machinery.
  • CRISPR Clustered Regularly-Interspaced Short Palindromic Repeats
  • HDR homology-directed repair
  • CRISPR/Cas9 is a naturally occurring RNA-guided endonuclease.
  • Zinc finger nucleases ZFNs are a fusion protein of Cys2-His2 zinc finger proteins (ZFPs) and a non-specific DNA restriction enzyme derived from FokI endonucleases.
  • TALENs Transcription activator-like effector nucleases
  • TALE Transcription activator-like effector nucleases
  • the present invention addresses the problems described above by providing new, effective and efficient compositions comprising transposon-based vectors for providing therapy, including gene therapy, to animals and humans.
  • the present invention provides methods of using these compositions for providing therapy to animals and humans.
  • transposon-based vectors can be used in the preparation of a medicament useful for providing a desired effect to a recipient following administration.
  • Gene therapy includes, but is not limited to, introduction of a gene, such as an exogenous gene, into an animal using a transposon-based vector.
  • genes may serve a variety of functions in the recipient such as coding for the production of nucleic acids, for example RNA, or coding for the production of proteins and peptides.
  • the present invention can facilitate efficient incorporation of the polynucleotide sequences, including the genes of interest, promoters, insertion sequences, poly A and any regulatory sequences.
  • the invention is based on the finding that human LINE-1 elements are capable of retrotransposition in human cells as well as cells of other animal species and can be manipulated in a versatile manner to achieve efficient delivery and integration of a genetic cargo into the genome of a cell.
  • Such LINE-1 elements have a variety of uses in human and animal genetics including, but not limited to, uses in diagnosis and treatment of genetic disorders and in cancer.
  • the LINE-1 elements of the invention are also useful for the treatment of various phenotypic effects of various diseases.
  • LINE-1 elements may be used for transfer of DNA encoding anti-tumorigenic gene products into cancer cells.
  • Other uses of the LINE-1 elements of the invention will become apparent to the skilled artisan upon a reading of the present specification.
  • a human LINE-1 element comprises a 5' UTR with an internal promoter, two non- overlapping reading frames (ORF1 and ORF2), a 200 bp 3' UTR and a 3' poly A tail.
  • the LINE-1 retrotransposon can also comprise an endonuclease domain at the LINE-1 ORF2 N-terminus. The finding that LINE-1 encodes an endonuclease demonstrates that the element is capable of autonomous retrotransposition.
  • LINE-1 is a modular protein that contains non-overlapping functional domains which mediate its reverse transcription and integration.
  • the sequence specificity of the LINE-1 endonuclease itself can be altered or the LINE-1 endonuclease can be replaced with another site- specific endonuclease.
  • the LINE-1 retrotransposon may be manipulated using recombinant technology to comprise and/or be contiguous with, other nucleic acid elements which render the retrotransposon suitable for insertion of substantial lengths (up to 1 kb, or greater than 1 kb, e.g. greater than 5, 6, 7, 8, 9, or 10 kb) of heterologous or homologous nucleic acid sequence into the genome of a cell.
  • the LINE-1 retrotransposon may also be manipulated using the same type of technology such that insertion of the nucleic acid sequence of heterologous or homologous nucleic acid into the genome of a cell is site-directed (site into which such DNA is inserted is known). Alternatively, the LINE-1 retrotransposon may be manipulated such that the insertion site of the DNA is random. The retrotransposon may also be manipulated to effect insertion of a desired DNA sequence into regions of DNA which are normally transcriptionally silent, wherein the DNA sequence is expressed in a manner such that it does not disrupt the normal expression of genes in the cell. In some embodiments, the integration or retrotransposition is in the trans orientation. In some embodiments, the integration or retrotransposition occurs in the cis orientation.
  • LINE-1 Since LINE-1 is native to human cells, when the constructs are placed into human cells, they should not be rejected by the immune system as foreign. In addition, the mechanism of LINE-1 retro- integration ensures that only one copy of the gene is integrated at any specific chromosomal location. Accordingly, there is a copy number control built into the system. In contrast, gene transfer procedures using ordinary plasmids offer little or no control regarding copy number and often result in complex arrays of DNA molecules tandemly integrated into the same genomic location. [00123] All terms are intended to be understood as they would be understood by a person skilled in the art. Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which the disclosure pertains.
  • “about” may mean within 1 or more than 1 standard deviation, per the practice in the art. Alternatively, “about” may mean a range of up to 20%, up to 10%, up to 5%, or up to 1% of a given value. Alternatively, particularly with respect to biological systems or processes, the term may mean within an order of magnitude, within 5-fold, and more preferably within 2-fold, of a value. Where particular values are described in the application and claims, unless otherwise stated the term "about” meaning within an acceptable error range for the particular value should be assumed.
  • Apps of the present disclosure encompasses, but are not limited to methods and compositions related to expression of an exogenous nucleic acid in a cell.
  • the exogenous nucleic acid is configured for stable integration in the genome of a cell, such as a myeloid cell.
  • the stable integration of the exogenous nucleic acid may be at specific targets within the genome.
  • the exogenous nucleic acid comprises one or more coding sequences.
  • the exogenous nucleic acid may comprise one or more coding comprising a nucleic acid sequence encoding an immune receptor.
  • the present disclosure provides methods and compositions for a stable incorporation of a nucleic acid encoding a transmembrane receptor implicated in an immune response function (e.g. a phagocytic receptor or synthetic chimeric antigen receptor) into human macrophage or dendritic cell or a suitable myeloid cell or a myeloid precursor cell.
  • An exogenous nucleic acid can refer to a nucleic acid that was not originally in a cell and is added from outside the cell, irrespective of whether it comprises a sequence that may already be present in the cell endogenously.
  • An exogenous nucleic acid may be a DNA or an RNA molecule.
  • An exogenous nucleic acid may comprise a sequence encoding a transgene.
  • An exogenous nucleic acid may encode a recombinant protein, such as a recombinant receptor, or a chimeric antigen receptor (CAR).
  • An exogenous nucleic acid may be referred to as a "genetic cargo" in the context of the exogenous nucleic acid being delivered inside a cell.
  • the genetic cargo may be a DNA or an RNA.
  • Genetic material can generally be delivered inside a cell ex vivo by a few different known techniques using either chemical (CaCl 2 - medicated transfection), or physical (electroporation), or biological (e.g. viral infection or transduction) means. [00132] Provided herein are compositions and methods for stable, non-viral transfer and integration of genetic material into a cell.
  • the genetic material is a self-integrating polynucleotide.
  • the genetic material can be stably integrated in the genome of the cell.
  • the cell may be a human cell.
  • the method is designed for a safe and reliable integration of a genetic material into the genome of a cell.
  • composition comprising a therapeutically effective amount of one or more polynucleic acids, or at least one vector encoding the one or more polynucleic acids, the one or more polynucleic acids comprising: (a) a mobile genetic element comprising a sequence encoding a polypeptide; and (b) an insert sequence, wherein the insert sequence comprises a sequence that is a reverse complement of a sequence encoding an exogenous therapeutic polypeptide, wherein the polypeptide encoded by the sequence of the mobile genetic element promotes integration of the insert sequence into a genome of a cell; and wherein the pharmaceutical composition is substantially non-immunogenic to a human subject.
  • the polypeptide encoded by the sequence of the mobile genetic element comprises one or more long interspersed nuclear element (LINE) polypeptides, wherein the one or more LINE polypeptides comprises: (i) human ORF1p or a functional fragment thereof, and (ii) human ORF2p or a functional fragment thereof.
  • the insert sequence stably integrates and/or is retrotransposed into the genome of a human cell.
  • the human cell is an immune cell selected from the group consisting of a T cell, a B cell, a myeloid cell, a monocyte, a macrophage and a dendritic cell.
  • the insert sequence is integrated into the genome (i) by cleavage of a DNA strand of a target site by an endonuclease encoded by the one or more polynucleic acids, (ii) via target- primed reverse transcription (TPRT) or (iii) via reverse splicing of the insert sequence into a DNA target site of the genome.
  • TPRT target- primed reverse transcription
  • the insert sequence is integrated into the genome at a poly T site using specificity of an endonuclease domain of the human ORF2p.
  • the poly T site comprises the sequence TTTTTA.
  • the one or more polynucleic acids comprises homology arms complementary to a target site in the genome.
  • the insert sequence integrates into: (a) the genome at a locus that is not a ribosomal locus; (b) a gene or regulatory region of a gene of the genome, thereby disrupting the gene or downregulating expression of the gene; (c) a gene or regulatory region of a gene of the genome, thereby upregulating expression of the gene; or (d) the genome and replaces a gene of the genome.
  • the pharmaceutical composition further comprises (i) one or more siRNAs and/or (ii) an RNA guide sequence or a polynucleic acid encoding the RNA guide sequence, and wherein the RNA guide sequence targets a DNA target site of the genome and the insert sequence is integrated into the genome at the DNA target site of the genome.
  • one or more genes are knocked down in the methods provided herein.
  • one or more siRNAs are employed in the compositions or methods described herein. For example, one or more genes can be knocked down to enhance integration, such as through modulating a pathway that may inhibit LINE-1.
  • the one or more genes knocked down include ADAR1, ADAR2 (ADAR1B), APOBEC3C, BRCA1, let-7 miRNA, RNase L, TASHOR (HUSH complex) and/or RAD51.
  • knock down of RNase L can be used to enhance integration by inhibiting or preventing degradation of an mRNA, such as an mRNA transcribed from a LINE-1.
  • knock down of ADAR1, ADAR2 (ADAR1B), and/or BRCA1 can be used to enhance integration by inhibiting or preventing ADAR1, ADAR2 (ADAR1B), and/or BRCA1 from inhibiting the cis binding of ORF2p to a poly A tail for L1 RNP assembly.
  • knock down of let-7 miRNA can be used to enhance integration by inhibiting or preventing let-7 miRNA from inhibiting translation, such as translation of ORF2p. let-7 miRNA.
  • knock down of RAD51 and/or BRCA1 can be used to enhance integration by inhibiting or preventing repair of cleaved DNA by RAD51 and/or BRCA1.
  • the one or more polynucleic acids have a total length of from 3 kb to 20 kb.
  • the one or more polynucleic acids comprises one or more polyribonucleic acids, one or more RNAs or one or more mRNAs.
  • the exogenous therapeutic polypeptide is selected from the group consisting of a ligand, an antibody, a receptor, an enzyme, a transport protein, a structural protein, a hormone, a contractile protein, a storage protein and a transcription factor.
  • the exogenous therapeutic polypeptide is a receptor selected from the group consisting of a chimeric antigen receptor (CAR) and a T cell receptor (TCR).
  • the one or more polynucleic acids comprises a first expression cassette comprising a promoter sequence, a 5’ UTR sequence, a 3’ UTR sequence and a poly A sequence; wherein: (i) the promoter sequence is upstream of the 5’ UTR sequence, (ii) the 5’ UTR sequence is upstream of the sequence of the mobile genetic element encoding a polypeptide, (iii) the 3’ UTR sequence is downstream of the insert sequence; and (iv) the 3’ UTR is upstream of the poly A sequence; and wherein the 5’ UTR sequence, the 3’ UTR sequence or the poly A sequence comprises a binding site for a human ORF2p or a functional fragment thereof.
  • the insert sequence comprises a second expression cassette comprising a sequence that is a reverse complement of a promoter sequence, a sequence that is a reverse complement of a 5’ UTR sequence, a sequence that is a reverse complement of a 3’ UTR sequence and a sequence that is a reverse complement of a poly A sequence; wherein: (i) the sequence that is a reverse complement of a promoter sequence is downstream of the sequence that is a reverse complement of a 5’ UTR sequence, (ii) the sequence that is a reverse complement of a 5’ UTR sequence is downstream of the sequence that is a reverse complement of a sequence encoding an exogenous therapeutic polypeptide (iii) the sequence that is a reverse complement of a 3’ UTR sequence is upstream of the sequence that is a reverse complement of a sequence encoding an exogenous therapeutic polypeptide, and (iv) the sequence that is a reverse complement of a poly A sequence is upstream of the sequence that is a reverse complement of
  • the promoter sequence of the first expression cassette is different from the promoter sequence of the second expression cassette.
  • the one or more LINE polypeptides comprises a first LINE polypeptide comprising the human ORF1p or functional fragment thereof and a second LINE polypeptide comprising the human ORF2p or functional fragment thereof, wherein the first LINE polypeptide and the second LINE polypeptide are translated from different open reading frames (ORFs).
  • the one or more polynucleic acids comprises a first polynucleic acid molecule encoding the human ORF1p or functional fragment thereof and a second polynucleic acid molecule encoding the human ORF2p or functional fragment thereof.
  • the one or more polynucleic acids comprises a 5’ UTR sequence and a 3’ UTR sequence, wherein (a) the 5’ UTR comprises a 5' UTR from LINE-1 or a sequence with at least 80% sequence identity to ACUCCUCCCCAUCCUCUCCCUCUGUCCCUCUGUCCCUCUGACCCUGCACUGUCCCAGCACC ; and/or (b) the 3’ UTR comprises a 3' UTR from LINE-1 or a sequence with at least 80% sequence identity to CAGGACACAGCCUUGGAUCAGGACAGAGACUUGGGGGCCAUCCUGCCCCUCCAACCCGAC AUGUGUACCUCAGCUUUUUCCCUCACUUGCAUCAAUAAAGCUUCUGUGUUUGGAACAG.
  • the sequence encoding the exogenous therapeutic polypeptide does not comprise introns.
  • the polypeptide encoded by the sequence of the mobile genetic element comprises a C-terminal nuclear localization signal (NLS), an N-terminal NLS or both.
  • the sequence encoding the exogenous polypeptide is not in frame with a sequence encoding the ORF1p or functional fragment thereof and/or is not in frame with a sequence encoding the ORF2p or functional fragment thereof.
  • the one or more polynucleic acids comprises a sequence encoding a nuclease domain, a nuclease domain that is not derived from ORF2p, a megaTAL nuclease domain, a TALEN domain, a Cas9 domain, a Cas6 domain, a Cas7 domain, a Cas8 domain, a zinc finger binding domain from an R2 retroelement, or a DNA binding domain that binds to repeat sequences.
  • the one or more polynucleic acids comprises a sequence encoding the nuclease domain, wherein the nuclease domain does not have nuclease activity or comprises a mutation that reduces activity of the nuclease domain compared to the nuclease domain without the mutation.
  • the ORF2p or functional fragment thereof lacks endonuclease activity or comprises a mutation selected from the group consisting of S228P and Y1180A, and/or wherein the ORF1p or functional fragment comprises a K3R mutation.
  • the insert sequence comprises a sequence that is a reverse complement of a sequence encoding two or more exogenous therapeutic polypeptides.
  • the one or more polynucleic acids comprises one or more polyribonucleic acids, wherein the exogenous therapeutic polypeptide is a receptor selected from the group consisting of a chimeric antigen receptor (CAR) and a T cell receptor (TCR), and wherein the pharmaceutical composition is formulated for systemic administration to a human subject.
  • CAR chimeric antigen receptor
  • TCR T cell receptor
  • the one or more polynucleic acids (i) are formulated in a nanoparticle selected from the group consisting of a lipid nanoparticle and a polymeric nanoparticle; and/or (ii) comprises one or more polynucleic acids selected from the group consisting of glycosylated RNAs, circular RNAs and self-replicating RNAs.
  • a method of treating a disease or condition in a human subject in need thereof comprising administering a pharmaceutical composition described herein to the human subject.
  • Also provided herein is a method of modifying a population of human cells ex vivo comprising contacting a composition to a population of human cell ex vivo, thereby forming an ex vivo modified population of human cells, the composition comprising one or more polynucleic acids, or at least one vector encoding the one or more polynucleic acids, the one or more polynucleic acids comprising: (a) a mobile genetic element comprising a sequence encoding a polypeptide; and (b) an insert sequence, wherein the insert sequence is a reverse complement of a sequence encoding an exogenous therapeutic polypeptide, wherein the ex vivo modified population of human cells is substantially non-immunogenic to a human subject.
  • compositions and methods that allow integration of genetic material into the genome of a cell, wherein the genetic material that can be integrated is not specifically restricted by size.
  • the method described herein provides a one-step, single polynucleotide- mediated delivery and integration of genetic "cargo" in the genome of a cell.
  • the genetic material may comprise a coding sequence, e.g., a sequence encoding a transgene, a peptide, a recombinant protein, or an antibody or fragments thereof, wherein the method and compositions ensure stable expression of the transcribed product encoded by the coding sequence.
  • the genetic material may comprise a non-coding sequence, for example, a regulatory RNA sequences, e.g., a regulatory small inhibitory RNA (siRNA), microRNA (miRNA), long non-coding RNA (lncRNA), or one or more transcription regulators such as a promoter and/or an enhancer, and may also include, but not limited to structural biomolecules such as ribosomal RNA (rRNA), transfer RNA (tRNA) or a fragment thereof or a combination thereof.
  • rRNA ribosomal RNA
  • tRNA transfer RNA
  • compositions may be particularly useful in developing a therapeutic, such as a therapeutic comprising a polynucleotide comprising a genetic material and a machinery that allows transfer into a cell and stable integration into the genome of the cell into which the polynucleotide or an mRNA encoding the polynucleotide is transferred.
  • the therapeutic may be a cell that comprises a polynucleotide that has been stably integrated into the genome of the cell using the methods and compositions described herein.
  • the present disclosure provides compositions and methods for stable gene transfer into a cell.
  • the compositions and methods are for stable gene transfer into an immune cell.
  • the immune cell is a myeloid cell.
  • the methods described herein relate to development of myeloid cells for immunotherapy.
  • a method of treating a disease in a subject in need thereof comprising: administering a pharmaceutical composition to the subject wherein the pharmaceutical composition comprises a polycistronic mRNA sequence encoding a gene or fragment thereof, operably linked to a sequence encoding an L1 retrotransposon; wherein the gene or the fragment thereof is at least 10.1 kb in length.
  • a method for integrating a nucleic acid sequence into the genome of a cell comprising contacting the cell with a composition comprising a polycistronic mRNA sequence encoding a gene or fragment thereof, operably linked to a sequence encoding an L1 retrotransposon; wherein the gene or the fragment thereof is at least 10.1 kb in length.
  • the gene or the fragment thereof (e.g., the payload) is at least about 10.2 kb, 10.3kb, 10.4kb, 10.5 kb, 10.6 kb, 10.7 kb, 10.8 kb, 10.9 kb, 11kb, 12 kb, 13kb, 14kb, 15kb, 16kb, 17kb, 18kb, 19kb, 20 kb or more in length.
  • a method for integrating a nucleic acid sequence into the genome of a cell comprising contacting the cell with a composition comprising a polycistronic mRNA sequence encoding a gene or fragment thereof, operably linked to a sequence encoding an L1 retrotransposon; wherein the gene or the fragment thereof is selected from a group consisting of ABCA4, MY07A, CEP290, CDH23, EYS, USH2a, GPR98, ALMS1, GDE, OTOF, and F8.
  • a method of expressing a protein encoded by a recombinant nucleic acid in a cell comprising integrating a nucleic acid sequence into the genome of a cell by contacting the cell with a composition comprising a polycistronic mRNA sequence encoding a gene or fragment thereof, operably linked to a sequence encoding an L1 retrotransposon; and expressing a protein encoded by the gene or fragment thereof, wherein expression of the protein is detectable more than 30 days after (a).
  • the disease is a genetic disease.
  • RP retinitis pigmentosa
  • the method comprises treating Stargardt disease in a subject in need thereof, and wherein the mRNA encodes an ABCA4 gene, or a fragment thereof.
  • the method comprises treating Usher Syndrome Type 1b (Usher 1b) disease in a subject in need thereof, and wherein the mRNA encodes an MY07A gene, or a fragment thereof.
  • the method comprises treating Leber congenital amaurosis (LCA)10 disease in a subject in need thereof, and wherein the mRNA encodes a CEP290 gene, or a fragment thereof.
  • LCA Leber congenital amaurosis
  • the method comprises treating a User Syndrome Type 1D (USH1D) non-syndromic deafness or hearing loss USH1D, DFN12 disease in a subject in need thereof, and wherein the mRNA encodes a CDH23 gene, or a fragment thereof.
  • USH1D User Syndrome Type 1D
  • DFN12 disease DFN12 disease
  • the method comprises treating a retinitis pigmentosa (RP) disease in a subject in need thereof, and wherein the mRNA encodes an EYS gene, or a fragment thereof.
  • RP retinitis pigmentosa
  • the method comprises treating a User Syndrome Type 2A (USH2A) and wherein the mRNA encodes an USH2a gene, or a fragment thereof.
  • the method comprises treating a User Syndrome Type 2C (USH2C) and wherein the mRNA encodes a GPR98 gene, or a fragment thereof.
  • the method comprises treating an Alstrom Syndrome, and wherein the mRNA encodes an ALMS1 gene, or a fragment thereof.
  • the method comprises treating a Glycogen Storage Disease III, and wherein the mRNA encodes a GDE gene, or a fragment thereof.
  • the method comprises treating a non-syndromic deafness or hearing loss and wherein the mRNA encodes an OTOF gene, or a fragment thereof.
  • the method comprises treating Hemophilia A, and the mRNA encodes an Factor VIII (F8) gene, or a fragment thereof.
  • a method for targeted replacement of a genomic nucleic acid sequence of a cell comprising: (A) introducing to the cell a polynucleotide sequence encoding a first protein complex comprising a targeted excision machinery for excising from the genome of the cell a nucleic acid sequence comprising one or more mutations; and (B) a recombinant mRNA encoding a second protein complex, wherein the recombinant mRNA comprises: (i) a nucleic acid sequence comprising the excised nucleic acid sequence in (A) that does not contain the one or more mutations, and (ii) a sequence encoding an L1 retrotransposon ORF2 protein under the influence of an independent promoter.
  • the nucleic acid sequence comprising the one or more mutations comprises a pathogenic variant of a cellular gene.
  • the a nucleic acid sequence in (B) comprising the nucleic acid sequence that does not contain the one or more mutations is operably linked to the ORF2 sequence.
  • the method further comprising introducing a sequence comprising a plurality of thymidine residues at the excision site.
  • introducing the sequence comprises introducing at least four thymidine residues.
  • the targeted excision machinery comprises a sequence guided site-specific excision endonuclease.
  • the targeted excision machinery comprises a CRISPR-CAS system.
  • the targeted excision machinery is a modified recombinant LINE 1 (L1) endonuclease.
  • introducing the sequence comprising a plurality of thymidine residues comprises base extension by prime editing at the excision site.
  • the mRNA sequence encoding an L1 retrotransposon ORF2 protein further comprises a sequence encoding the L1 retrotransposon ORF1 protein.
  • the mRNA comprises a sequence for an inducible promoter.
  • the excised sequence is greater than 1000 bases.
  • the excised sequence is greater than 6kb.
  • the excised sequence is about 10kb.
  • the cell is a lymphocyte.
  • the cell is a myeloid cell.
  • the cell is an epithelial cell.
  • the cell is a cancer cell.
  • the nucleic acid sequence encodes an ATP-binding cassette (ABC) transporter gene, (ABCA4) gene, or a fragment thereof.
  • the nucleic acid sequence encodes an MY07A, CEP290, CDH23, EYS, USH2a, GPR98, ALMS1, GDE, OTOF or an F8 gene or a fragment thereof.
  • introducing comprises introducing to the cell ex vivo. In some embodiments, introducing comprises electroporation. In some embodiments, introducing comprises introducing to the cell in vivo.
  • expression of the nucleic acid sequence comprising the sequence that does not contain the one or more mutations is detectable at least 35 days after introducing to the cell.
  • introducing into the subject comprises direct administration of the mRNA systemically.
  • introducing into the subject comprises local administration of the mRNA.
  • the mRNA sequence comprises a cell targeting moiety.
  • the cell targeting moiety is an aptamer.
  • introducing into the subject comprises introducing the mRNA in the retina of the subject.
  • a method of integrating a nucleic acid sequence into a genome of a cell comprising introducing a recombinant mRNA or a vector encoding an mRNA into the cell, wherein the mRNA comprises: (a) an insert sequence, wherein the insert sequence comprises (i) an exogenous sequence, or (ii) a sequence that is a reverse complement of the exogenous sequence; (b) a 5’ UTR sequence and a 3’ UTR sequence downstream of the 5’ UTR sequence; wherein the 5’ UTR sequence or the 3’ UTR sequence comprises a binding site for a human ORF protein, and wherein the insert sequence is integrated into the genome of the cell, wherein the insert sequence is a gene selected from a group consisting of ABCA4, MY07A, CEP290, CDH23, EYS, USH2a, GPR98, ALMS1, GDE, OTOF, and F8.
  • the insert sequence is a gene selected from a group consisting of ABCA4, MY07
  • the 5’ UTR sequence or the 3’ UTR sequence comprises a binding site for human ORF2p.
  • a method for integrating a nucleic acid sequence into the genome of an immune cell comprising introducing a recombinant mRNA or a vector encoding an mRNA, wherein the mRNA comprises: (a) an insert sequence, wherein the insert sequence comprises (i) an exogenous sequence or (ii) a sequence that is a reverse complement of the exogenous sequence; (b) 5’ UTR sequence and a 3’ UTR sequence downstream of the 5’ UTR sequence, wherein the 5’ UTR sequence or the 3’ UTR sequence comprises an endonuclease binding site and/or a reverse transcriptase binding site, and wherein the insert sequence is integrated into the genome of the immune cell, wherein the insert sequence is a gene selected from a group consisting of ABCA4, MY07A, CEP290, CDH23
  • a method for integrating a nucleic acid sequence into the genome of a cell comprising introducing a recombinant mRNA or a vector encoding an mRNA, wherein the mRNA comprises: (a) an insert sequence, wherein the insert sequence comprises (i) an exogenous sequence or (ii) a sequence that is a reverse complement of the exogenous sequence; (b) a 5’ UTR sequence, a sequence of a human retrotransposon downstream of the 5’ UTR sequence, and a 3’ UTR sequence downstream of the sequence of a human retrotransposon; wherein the 5’ UTR sequence or the 3’ UTR sequence comprises an endonuclease binding site and/or a reverse transcriptase binding site, and wherein the sequence of a human retrotransposon encodes for two proteins that are translated from a single RNA containing two ORFs, and wherein the insert sequence is integrated into the genome of the cell, wherein the insert sequence is integrated into the genome of the cell, wherein the insert
  • the 5’ UTR sequence or the 3’ UTR sequence comprises an ORF2p binding site.
  • the ORF2p binding site is a poly A sequence in the 3' UTR sequence.
  • the mRNA comprises a sequence of a human retrotransposon.
  • the sequence of a human retrotransposon is downstream of the 5’ UTR sequence.
  • the sequence of a human retrotransposon is upstream of the 3’ UTR sequence.
  • the sequence of a human retrotransposon encodes for two proteins that are translated from a single RNA containing two ORFs.
  • the two ORFs are non- overlapping ORFs.
  • the sequence of a human retrotransposon comprises a sequence of a non- LTR retrotransposon.
  • the sequence of a human retrotransposon encodes comprises a LINE-1 retrotransposon.
  • the LINE-1 retrotransposon is a human LINE-1 retrotransposon.
  • the sequence of a human retrotransposon comprises a sequence encoding an endonuclease and/or a reverse transcriptase.
  • the endonuclease and/or a reverse transcriptase is ORF2p.
  • the reverse transcriptase is a group II intron reverse transcriptase domain.
  • the endonuclease and/or a reverse transcriptase is a minke whale endonuclease and/or a reverse transcriptase.
  • the sequence of a human retrotransposon comprises a sequence encoding ORF2p.
  • the insert sequence is integrated into the genome at a poly T site using specificity of an endonuclease domain of the ORF2p.
  • the poly T site comprises the sequence TTTTTA.
  • the retrotransposon comprises an ORF1p and/or the ORF2p fused to a nuclear retention sequence.
  • the nuclear retention sequence is an Alu sequence.
  • the ORF1p and/or the ORF2p is fused to an MS2 coat protein.
  • the 5’ UTR sequence or the 3’ UTR sequence comprises at least one, two, three or more MS2 hairpin sequences.
  • compositions comprising a recombinant mRNA or vector encoding an mRNA, wherein the mRNA comprises a human LINE-1 transposon sequence comprising: (i) a human LINE-1 transposon 5’ UTR sequence, (ii) a sequence encoding ORF1p downstream of the human LINE-1 transposon 5’ UTR sequence, (iii) an inter-ORF linker sequence downstream of the sequence encoding ORF1p, (iv) a sequence encoding ORF2p downstream of the inter-ORF linker sequence, and (v) a 3’ UTR sequence derived from a human LINE-1 transposon downstream of the sequence encoding ORF2p; wherein the 3’ UTR sequence comprises an insert sequence, wherein the insert sequence is a reverse complement of a sequence encoding an exogenous polypeptide or a reverse complement of a sequence encoding an exogenous regulatory element, wherein the insert sequence is a gene selected from
  • composition comprising a nucleic acid comprising a nucleotide sequence encoding (a) a long interspersed nuclear element (LINE) polypeptide, wherein the LINE polypeptide includes human ORF1p and human ORF2p; and (b) an insert sequence, wherein the insert sequence is a reverse complement of a sequence encoding an exogenous polypeptide or a reverse complement of a sequence encoding an exogenous regulatory element, wherein the composition is substantially non- immunogenic, wherein the insert sequence is a gene selected from a group consisting of ABCA4, MY07A, CEP290, CDH23, EYS, USH2a, GPR98, ALMS1, GDE, OTOF, and F8.
  • LINE long interspersed nuclear element
  • Immunotherapy using phagocytic cells involves making and using engineered myeloid cells, such as macrophages or other phagocytic cells that attack and kill diseased cells, such as cancer cells, or infected cells.
  • Engineered myeloid cells, such as macrophages and other phagocytic cells are prepared by incorporating in them via recombinant nucleic acid technology, a synthetic, recombinant nucleic acid encoding an engineered protein, such as a chimeric antigen receptor, that comprises a targeted antigen binding extracellular domain that is designed to bind to specific antigens on the surface of a target, such as a target cell, such as a cancer cell.
  • Binding of the engineered chimeric receptor to an antigen on a target initiates phagocytosis of the target.
  • a target such as cancer antigen (or likewise, a disease target)
  • phagocytosis initiates phagocytosis of the target.
  • two, antigens from the target are digested in the phagolysosome of the myeloid cell, are presented on the surface of the myeloid cell, which then leads to activation of T cells and further activation of the immune response and development of immunological memory.
  • Chimeric receptors are engineered for enhanced phagocytosis and immune activation of the myeloid cell in which it is incorporated and expressed.
  • Chimeric antigen receptors of the disclosure are variously termed herein as a chimeric fusion protein, CFP, phagocytic receptor (PR) fusion protein (PFP), or chimeric antigen receptor for phagocytosis (CAR-P), while each term is directed to the concept of a recombinant chimeric and/or fusion receptor protein.
  • genes encoding non-receptor proteins are also co-expressed in the myeloid cells, typically for an augmentation of the chimeric antigen receptor function.
  • contemplated herein are various engineered receptor and non-receptor recombinant proteins that are designed to augment phagocytosis and or immune response of a myeloid cell against a disease target, and methods and compositions for creating and incorporating recombinant nucleic acids that encode the engineered receptors or non-receptor recombinant protein, such that the methods and compositions are suitable for creating an engineered myeloid cell for immunotherapy.
  • the present disclosure provides compositions and methods for stable gene transfer into a cell, where the cell can be any somatic cell. In some embodiments the compositions and methods are designed for cell-specific or tissue-specific delivery.
  • the methods described herein relate to supplying a functional protein or a fragment thereof to compensate for an absent or defective (mutated) protein in vivo, e.g., for a protein replacement therapy.
  • Incorporation of a recombinant nucleic acid in a cell can be accomplished by one or more gene transfer techniques that are available in the state of the art.
  • incorporation of exogenous genetic (e.g., nucleic acid) elements into the genome for therapeutic purposes still faces several challenges. Achieving stable integration in a safe and dependable manner, and efficient and prolonged expression are a few among them.
  • the methods described herein for generating a myeloid cell for immunotherapy can be a cumulative product of a number of steps and compositions involving but not limited to, for example, selecting a myeloid cell for modifying; method and compositions for incorporating a recombinant nucleic acid in a myeloid cell; methods and compositions for enhancing expression of the recombinant nucleic acid; methods and compositions for selecting and modifying vectors; methods of preparing a recombinant nucleic acid suitable for in vivo administration for uptake and incorporation of the recombinant nucleic acid by a myeloid cell in vivo and therefore generating a myeloid cell for therapy.
  • transposons, or transposable elements are considered herein, for means of incorporating a heterologous, synthetic or recombinant nucleic acid encoding a transgene of interest in a myeloid cell.
  • Transposon, or transposable elements are genetic elements that have the capability to transpose fragments of genetic material into the genome by use of an enzyme known as transposase.
  • Mammalian genomes contain a high number of transposable element (TE)-derived sequences, and up to 70% of our genome represents TE-derived sequences (de Koning et al. 2011; Richardson et al. 2015). These elements could be exploited to introduce genetic material into the genome of a cell.
  • the TE elements are capable of mobilization, often termed as "jumping" genetic material within the genome.
  • TEs generally exist in eukaryotic genomes in a reversibly inactive, epigenetically silenced form. In the present disclosure methods and compositions for efficient and stable integration of transgenes into macrophages and other phagocytic cells.
  • the method is based on use of a transposase and transposable elements mRNA-encoded transposase.
  • Long Interspersed Element-1 (L1) RNAs are used for stable integration and/or retrotransposition of the transgene into a cell (e.g., a macrophage or phagocytic cell.
  • L1 RNAs are used for stable integration and/or retrotransposition of the transgene into a cell (e.g., a macrophage or phagocytic cell.
  • a cell e.g., a macrophage or phagocytic cell.
  • Contemplated herein are methods for retrotransposon mediated stable integration of an exogenous nucleic acid sequence into the genome of a cell. The method may take advantage of the random genomic integration machinery of the retrotransposon into the cell without creating an adverse effect.
  • Methods described herein can be used for robust and versatile incorporation of an exogenous nucleic acid sequence into a cell, such that the exogenous nucleic acid is incorporated at a safe locus within the genome and is expressed without being silenced by the cell’s inherent defense mechanism.
  • the method described herein can be used to incorporate an exogenous nucleic acid that is about 1 kb, about 2 kb, about 3 kb, about 4 kb, about 5 kb, about 6 kb, about 7kb about 8 kb, about 9 kb, about 10 kb, or more in size.
  • the exogenous nucleic acid is not incorporated within a ribosomal locus.
  • the exogenous nucleic acid is not incorporated within a ROSA26 locus, or another safe harbor locus.
  • the methods and compositions described herein can incorporate an exogenous nucleic acid sequence anywhere within the genome of the cell.
  • contemplated herein is a retrotransposition system that is developed to incorporate an exogenous nucleic acid sequence into a specific predetermined site within the genome of a cell, without creating an adverse effect.
  • the disclosed methods and compositions incorporate several mechanisms of engineering the retrotransposons for highly specific incorporation of the exogenous nucleic acid into a cell with high fidelity. Retrotransposons chosen for this purpose may be a human retrotransposon.
  • Methods and compositions described herein represent a salient breakthrough in the molecular systems and mechanisms for manipulating the genome of a cell. Shown here for the first time is a method that exploits a human retrotransposon system into non-virally delivering and stably integrating a large fragment of exogenous nucleic acid sequence (at least greater than 100 nucleobases, at least greater than 1 kb, at least greater than 2 kb, at least greater than 3 kb, etc.) into a non-conserved region of the genome that is not an rDNA or a ribosomal locus or a designated safe-harbor locus such as the ROSA 26 locus.
  • a human retrotransposon system into non-virally delivering and stably integrating a large fragment of exogenous nucleic acid sequence (at least greater than 100 nucleobases, at least greater than 1 kb, at least greater than 2 kb, at least greater than 3 kb, etc.) into a non-
  • a retrotransposable system is used to stably incorporate into the genome and express a non-endogenous nucleic acid, where the non-endogenous nucleic acid comprises retrotransposable elements within the nucleic acid sequence.
  • a cell s endogenous retrotransposable system (e.g., proteins and enzymes) is used to stably express a non-endogenous nucleic acid in the cell.
  • a cell in some embodiments, a cell’s endogenous retrotransposable system (e.g., proteins and enzymes, such as a LINE-1 retrotransposition system) is used, but may further express one or more components of the retrotransposable system to stably express a non-endogenous nucleic acid in the cell.
  • a synthetic nucleic acid is provided herein, the synthetic nucleic acid encoding a transgene, and encoding one or more components for genomic integration and/or retrotransposition.
  • a method of integrating a nucleic acid sequence into a genome of a cell comprising introducing a recombinant mRNA or a vector encoding an mRNA into the cell, wherein the mRNA comprises: an insert sequence, wherein the insert sequence comprises an exogenous sequence, or a sequence that is a reverse complement of the exogenous sequence; a 5’ UTR sequence and a 3’ UTR sequence downstream of the 5’ UTR sequence; wherein the 5’ UTR sequence or the 3’ UTR sequence comprises a binding site for a human ORF protein, and wherein the insert sequence is integrated into the genome of the cell.
  • the 5’ UTR sequence or the 3’ UTR sequence comprises a binding site for human ORF2p.
  • a method for integrating a nucleic acid sequence into the genome of an immune cell comprising introducing a recombinant mRNA or a vector encoding an mRNA, wherein the mRNA comprises an insert sequence, wherein the insert sequence comprises (i) an exogenous sequence or (ii) a sequence that is a reverse complement of the exogenous sequence; 5’ UTR sequence and a 3’ UTR sequence downstream of the 5’ UTR sequence, wherein the 5’ UTR sequence or the 3’ UTR sequence comprises an endonuclease binding site and/or a reverse transcriptase binding site, and wherein the transgene sequence is integrated into the genome of the immune cell.
  • a method for integrating a nucleic acid sequence into the genome of a cell comprising introducing a recombinant mRNA or a vector encoding an mRNA, wherein the mRNA comprises an insert sequence, wherein the insert sequence comprises (i) an exogenous sequence or (ii) a sequence that is a reverse complement of the exogenous sequence; a 5’ UTR sequence, a sequence of a human retrotransposon downstream of the 5’ UTR sequence, and a 3’ UTR sequence downstream of the sequence of a human retrotransposon; wherein the 5’ UTR sequence or the 3’ UTR sequence comprises an endonuclease binding site and/or a reverse transcriptase binding site, and wherein the sequence of a human retrotransposon encodes for two proteins that are translated from a single RNA containing two ORFs, and wherein the insert sequence is integrated into the genome of the cell.
  • the 5’ UTR sequence or the 3’ UTR sequence comprises an ORF2p binding site.
  • the ORF2p binding site is a poly A sequence in the 3' UTR sequence.
  • the mRNA comprises a sequence of a human retrotransposon.
  • the sequence of a human retrotransposon is downstream of the 5’ UTR sequence.
  • the sequence of a human retrotransposon is upstream of the 3’ UTR sequence.
  • the polynucleotide sequence that is desired to be transferred and incorporated into the genome of a cell (e.g., the insert) is inserted at a site 3’ to the sequence encoding ORF1 in a recombinant nucleic acid construct.
  • the polynucleotide sequence that is desired to be transferred and incorporated into the genome of a cell is inserted at a site 3’ to the sequence encoding ORF2 in a recombinant nucleic acid construct.
  • the sequence that is desired to be transferred and incorporated into the genome of a cell is inserted within the 3’-UTR of ORF1 or ORF2, or both.
  • the polynucleotide sequence that is sequence that is desired to be transferred and incorporated into the genome of a cell is inserted upstream of the poly A tail of ORF2 in a recombinant nucleic acid construct.
  • the sequence of a human retrotransposon encodes for two proteins that are translated from a single RNA containing two ORFs.
  • the two ORFs are non- overlapping ORFs.
  • the two ORFs are ORF1 and ORF2.
  • the ORF1 encodes ORF1p and ORF2 encodes ORF2p.
  • the sequence of a human retrotransposon comprises a sequence of a non- LTR retrotransposon. In some embodiments, the sequence of a human retrotransposon comprises a LINE- 1 retrotransposon. In some embodiments, the LINE-1 retrotransposon is a human LINE-1 retrotransposon. In some embodiments, the sequence of a human retrotransposon comprises a sequence encoding an endonuclease and/or a reverse transcriptase. In some embodiments, the endonuclease and/or a reverse transcriptase is ORF2p. In some embodiments, the reverse transcriptase is a group II intron reverse transcriptase domain.
  • the endonuclease and/or a reverse transcriptase is a minke whale endonuclease and/or a reverse transcriptase.
  • the sequence of a human retrotransposon comprises a sequence encoding ORF2p.
  • the insert sequence is integrated into the genome at a poly T site using specificity of an endonuclease domain of the ORF2p.
  • the poly T site comprises the sequence TTTTTA.
  • a polynucleotide construct comprising an mRNA wherein the mRNA comprises a sequence encoding a human retrotransposon, wherein, (i) the sequence of a human retrotransposon comprises a sequence encoding ORF1p, (ii) the mRNA does not comprise a sequence encoding ORF1p, or (iii) the mRNA comprises a replacement of the sequence encoding ORF1p with a 5' UTR sequence from the complement gene.
  • the mRNA comprises a first mRNA molecule encoding ORF1p, and a second mRNA molecule encoding an endonuclease and/or a reverse transcriptase.
  • the mRNA is an mRNA molecule comprising a first sequence encoding ORF1p, and a second sequence encoding an endonuclease and/or a reverse transcriptase.
  • the first sequence encoding ORF1p and the second sequence encoding an endonuclease and/or a reverse transcriptase are separated by a linker sequence.
  • the linker sequence comprises an internal ribosome entry sequence (IRES).
  • the IRES is an IRES from CVB3 or EV71.
  • the linker sequence encodes a self-cleaving peptide sequence.
  • the linker sequence encodes a T2A, a E2A or a P2A sequence [00240]
  • the sequence of a human retrotransposon comprises a sequence that encodes ORF1p fused to an additional protein sequence and/or a sequence that encodes ORF2p fused to an additional protein sequence.
  • the ORF1p and/or the ORF2p is fused to a nuclear retention sequence.
  • the nuclear retention sequence is an Alu sequence.
  • the ORF1p and/or the ORF2p is fused to an MS2 coat protein.
  • the 5’ UTR sequence or the 3’ UTR sequence comprises at least one, two, three or more MS2 hairpin sequences.
  • the 5’ UTR sequence or the 3’ UTR sequence comprises a sequence that promotes or enhances interaction of a poly A tail of the mRNA with the endonuclease and/or a reverse transcriptase.
  • the 5’ UTR sequence or the 3’ UTR sequence comprises a sequence that promotes or enhances interaction of a poly-A-binding proteins (e.g., PABP) with the endonuclease and/or a reverse transcriptase.
  • a poly-A-binding proteins e.g., PABP
  • the 5’ UTR sequence or the 3’ UTR sequence comprises a sequence that increases specificity of the endonuclease and/or a reverse transcriptase to the mRNA relative to another mRNA expressed by the cell.
  • the 5’ UTR sequence or the 3’ UTR sequence comprises an Alu element sequence.
  • the first sequence encoding ORF1p and the second sequence encoding an endonuclease and/or a reverse transcriptase have the same promoter.
  • the insert sequence has a promoter that is different from the promoter of the first sequence encoding ORF1p.
  • the insert sequence has a promoter that is different from the promoter of the second sequence encoding an endonuclease and/or a reverse transcriptase.
  • the first sequence encoding ORF1p and/or the second sequence encoding an endonuclease and/or a reverse transcriptase have a promoter or transcription initiation site selected from the group consisting of an inducible promoter, a CMV promoter or transcription initiation site, a T7 promoter or transcription initiation site, an EF1a promoter or transcription initiation site and combinations thereof.
  • the insert sequence has a promoter or transcription initiation site selected from the group consisting of an inducible promoter, a CMV promoter or transcription initiation site, a T7 promoter or transcription initiation site, an EF1a promoter or transcription initiation site and combinations thereof.
  • the first sequence encoding ORF1p and the second sequence encoding an endonuclease and/or a reverse transcriptase are codon optimized for expression in a human cell.
  • the mRNA comprises a WPRE element.
  • the mRNA comprises a selection marker.
  • the mRNA comprises a sequence encoding an affinity tag.
  • the affinity tag is linked to the sequence encoding an endonuclease and/or a reverse transcriptase.
  • the 3' UTR comprises a poly A sequence or wherein a poly A sequence is added to the mRNA in vitro.
  • the poly A sequence is downstream of a sequence encoding an endonuclease and/or a reverse transcriptase.
  • the insert sequence is upstream of the poly A sequence.
  • the 3' UTR sequence comprises the insert sequence.
  • the insert sequence comprises a sequence that is a reverse complement of the sequence encoding the exogenous polypeptide.
  • the insert sequence comprises a polyadenylation site. In some embodiments, the insert sequence comprises an SV40 polyadenylation site. In some embodiments, the insert sequence comprises a polyadenylation site upstream of the sequence that is a reverse complement of the sequence encoding the exogenous polypeptide. In some embodiments, the insert sequence is integrated into the genome at a locus that is not a ribosomal locus. In some embodiments, the insert sequence is integrated into the genome at a locus that is not a rDNA locus. In some embodiments, the insert sequence integrates into a gene or regulatory region of a gene, thereby disrupting the gene or downregulating expression of the gene.
  • the insert sequence integrates into a gene or regulatory region of a gene, thereby upregulating expression of the gene. In some embodiments, the insert sequence integrates into the genome and replaces a gene. In some embodiments, the insert sequence is stably integrated into the genome. In some embodiments, the insert sequence is retrotransposed into the genome. In some embodiments, the insert sequence is integrated into the genome by cleavage of a DNA strand of a target site by an endonuclease encoded by the mRNA. In some embodiments, the insert sequence is integrated into the genome via target-primed reverse transcription (TPRT). In some embodiments, the insert sequence is integrated into the genome via reverse splicing of the mRNA into a DNA target site of the genome.
  • TPRT target-primed reverse transcription
  • the cell is an immune cell.
  • the immune cell is a T cell or a B cell.
  • the immune cell is a myeloid cell.
  • the immune cell is selected from a group consisting of a monocyte, a macrophage, a dendritic cell, a dendritic precursor cell, and a macrophage precursor cell.
  • the mRNA is a self-integrating mRNA.
  • the method comprises introducing into the cell the mRNA.
  • the method comprises introducing into the cell the vector encoding the mRNA.
  • the method comprises introducing the mRNA or the vector encoding the mRNA into a cell ex vivo. In some embodiments, the method further comprises administering the cell to a human subject. In some embodiments, the method comprises administering the mRNA or the vector encoding the mRNA to a human subject. In some embodiments, an immune response is not elicited in the human subject. In some embodiments, the mRNA or the vector is substantially non-immunogenic. [00248] In some embodiments, the vector is a plasmid or a viral vector. In some embodiments, the vector comprises a non-LTR retrotransposon. In some embodiments, the vector comprises a human L1 element.
  • the vector comprises a L1 retrotransposon ORF1 gene. In some embodiments, the vector comprises a L1 retrotransposon ORF2 gene. In some embodiments, the vector comprises a L1 retrotransposon. In some embodiments, provided herein is an mRNA comprising sequences encoding human LINE 1 retrotransposition elements, and a payload comprising a nucleic acid sequence which can be retrotransposed and integrated into a genome of a cell comprising the mRNA.
  • an mRNA that can be delivered into a living cell, e.g., a human cell, wherein, the mRNA comprises sequences encoding human LINE 1 retrotransposition elements, and a payload comprising a nucleic acid sequence which can be retrotransposed and integrated into the genome of the cell.
  • the sequences encoding human LINE 1 retrotransposition elements comprise a L1 retrotransposon ORF1 sequence or a fragment thereof.
  • the sequences encoding human LINE 1 retrotransposition elements comprise a L1 retrotransposon ORF2 sequence or a fragment thereof.
  • the sequences encoding human LINE 1 retrotransposition elements comprise a L1 retrotransposon ORF1 sequence or a fragment thereof and a L1 retrotransposon ORF2 sequence or a fragment thereof, and a nucleic acid “payload” sequence which is a heterologous sequence which is integrated into the genome of cell by retrotransposition.
  • the mRNA is at least about 1, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, or 3 kilobases.
  • the mRNA is a most about 2.5, 2.6, 2.7, 2.8, 2.9, 3, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8, 3.9, 4, 4.1, 4.2, 4.3, 4.4, 4.5, 4.6, 4.7, 4.8, 4.9 or 5 kilobases.
  • the mRNA is at least about 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8, 5.9 or 6 kilobases.
  • the mRNA is at least about 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9 or 7 kilobases.
  • the mRNA is at least about 7.1, 7.2, 7.3, 7.4, 7.5, 7.6, 7.7, 7.8, 7.9 or 8 kilobases. In some embodiments, the mRNA is at least about 8.1, 8.2, 8.3, 8.4, 8.5, 8.6, 8.7, 8.8, 8.9 or 9 kilobases. In some embodiments, the mRNA is at least about 9.1, 9.2, 9.3, 9.4, 9.5, 9.6, 9.7, 9.8, 9.9 or 10 kilobases. [00250] In some embodiments, the mRNA comprises a sequence that inhibits or prevents degradation of the mRNA.
  • the sequence that inhibits or prevents degradation of the mRNA inhibits or prevents degradation of the mRNA by an exonuclease or an RNAse. In some embodiments, the sequence that inhibits or prevents degradation of the mRNA is a G quadruplex, pseudoknot or triplex sequence. In some embodiments, the sequence the sequence that inhibits or prevents degradation of the mRNA is an exoribonuclease-resistant RNA structure from a flavivirus RNA or an ENE element from KSV. In some embodiments, the sequence that inhibits or prevents degradation of the mRNA inhibits or prevents degradation of the mRNA by a deadenylase.
  • the sequence that inhibits or prevents degradation of the mRNA comprises non-adenosine nucleotides within or at a terminus of a poly A tail of the mRNA. In some embodiments, the sequence that inhibits or prevents degradation of the mRNA increases stability of the mRNA.
  • the exogenous sequence comprises a sequence encoding an exogenous polypeptide. In some embodiments, the sequence encoding an exogenous polypeptide is not in frame with a sequence encoding an endonuclease and/or a reverse transcriptase.
  • the sequence encoding an exogenous polypeptide is not in frame with a sequence encoding an endonuclease and/or a reverse transcriptase. In some embodiments, the exogenous sequence does not comprise introns. In some embodiments, the exogenous sequence comprises a sequence encoding an exogenous polypeptide selected from the group consisting of an enzyme, a receptor, a transport protein, a structural protein, a hormone, an antibody, a contractile protein and a storage protein. In some embodiments, the exogenous sequence comprises a sequence encoding an exogenous polypeptide selected from the group consisting of a chimeric antigen receptor (CAR), a ligand, an antibody, a receptor, and an enzyme.
  • CAR chimeric antigen receptor
  • the exogenous sequence comprises a regulatory sequence.
  • the regulatory sequence comprises a cis-acting regulatory sequence.
  • the regulatory sequence comprises a cis-acting regulatory sequence selected from the group consisting of an enhancer, a silencer, a promoter or a response element.
  • the regulatory sequence comprises a trans-acting regulatory sequence.
  • the regulatory sequence comprises a trans-acting regulatory sequence that encodes a transcription factor. [00251]
  • integration of the insert sequence does not adversely affect cell health.
  • the endonuclease, the reverse transcriptase or both are capable of site-specific integration of the insert sequence.
  • the retrotransposon system used herein is further engineered for precise site-specific integration.
  • the retrotransposon system used herein is paired with a CRISPR-Cas system to increase specificity.
  • the ORF polypeptide-binding sequence e.g., TTTTTA may be engineered site-specifically into a genomic sequence of a cell.
  • the mRNA comprises a sequence encoding an additional nuclease domain or a nuclease domain that is not derived from ORF2.
  • the mRNA comprises a sequence encoding a megaTAL nuclease domain, a TALEN domain, a Cas9 domain, a zinc finger binding domain from an R2 retroelement, or a DNA binding domain that binds to repetitive sequences such as a Rep78 from AAV.
  • the endonuclease comprises a mutation that reduces activity of the endonuclease compared to the endonuclease without the mutation.
  • the endonuclease is an ORF2p endonuclease and the mutation is S228P.
  • the mRNA comprises a sequence encoding a domain that increases fidelity and/or processivity of the reverse transcriptase.
  • the reverse transcriptase is a reverse transcriptase from a retroelement other than ORF2 or reverse transcriptase that has higher fidelity and/or processivity compared to a reverse transcriptase of ORF2p.
  • the reverse transcriptase is a group II intron reverse transcriptase.
  • the group II intron reverse transcriptase is a group IIA intron reverse transcriptase, a group IIB intron reverse transcriptase, or a group IIC intron reverse transcriptase.
  • the group II intron reverse transcriptase is TGIRT-II or TGIRT-III.
  • the mRNA comprises a sequence comprising an Alu element and/or a ribosome binding aptamer.
  • the mRNA comprises a sequence encoding a polypeptide comprising a DNA binding domain.
  • the 3' UTR sequence is derived from a viral 3' UTR or a beta-globin 3' UTR.
  • composition comprising a recombinant mRNA or vector encoding an mRNA, wherein the mRNA comprises a human LINE-1 transposon sequence comprising a human LINE-1 transposon 5’ UTR sequence, a sequence encoding ORF1p downstream of the human LINE-1 transposon 5’ UTR sequence, an inter-ORF linker sequence downstream of the sequence encoding ORF1p, a sequence encoding ORF2p downstream of the inter-ORF linker sequence, and a 3’ UTR sequence derived from a human LINE-1 transposon downstream of the sequence encoding ORF2p; wherein the 3’ UTR sequence comprises an insert sequence, wherein the insert sequence is a reverse complement of a sequence encoding an exogenous polypeptide or a reverse complement of a sequence encoding an exogenous regulatory element.
  • the insert sequence integrates into the genome of a cell when introduced into the cell. In some embodiments, the insert sequence integrates into a gene associated a condition or disease, thereby disrupting the gene or downregulating expression of the gene. In some embodiments, the insert sequence integrates into a gene, thereby upregulating expression of the gene. In some embodiments, the recombinant mRNA or vector encoding the mRNA is isolated or purified.
  • composition comprising a nucleic acid comprising a nucleotide sequence encoding (a) a long interspersed nuclear element (LINE) polypeptide, wherein the LINE polypeptide includes human ORF1p and human ORF2p; and (b) an insert sequence, wherein the insert sequence is a reverse complement of a sequence encoding an exogenous polypeptide or a reverse complement of a sequence encoding an exogenous regulatory element, wherein the composition is substantially non-immunogenic.
  • integration of the insert sequence does not adversely affect cell health.
  • the composition comprises human ORF1p and human ORF2p proteins.
  • the composition comprises a ribonucleoprotein (RNP) comprising human ORF1p and human ORF2p complexed to the nucleic acid.
  • the nucleic acid is mRNA.
  • a composition comprising a cell comprising a composition described herein.
  • the cell is an immune cell.
  • the immune cell is a T cell or a B cell.
  • the immune cell is a myeloid cell.
  • the immune cell is selected from a group consisting of a monocyte, a macrophage, a dendritic cell, a dendritic precursor cell, and a macrophage precursor cell.
  • the insert sequence is a reverse complement of a sequence encoding an exogenous polypeptide and the exogenous polypeptide is a chimeric antigen receptor (CAR).
  • CAR chimeric antigen receptor
  • a pharmaceutical composition comprising a composition described herein, and a pharmaceutically acceptable excipient.
  • the pharmaceutical composition is for use in gene therapy.
  • the pharmaceutical composition is for use in the manufacture of a medicament for treating a disease or condition.
  • the pharmaceutical composition is for use in treating a disease or condition.
  • a method of treating a disease in a subject comprising administering a pharmaceutical composition described herein to a subject with a disease or condition.
  • the method increases an amount or activity of a protein or functional RNA in the subject.
  • the subject has a deficient amount or activity of a protein or functional RNA.
  • the deficient amount or activity of a protein or functional RNA is associated with or causes the disease or condition.
  • the method further comprising administering an agent that inhibits human silencing hub (HUSH) complex, an agent that inhibits FAM208A, or an agent that inhibits TRIM28.
  • the agent that inhibits human silencing hub (HUSH) complex is an agent that inhibits Periphilin, TASOR and/or MPP8.
  • the agent that inhibits human silencing hub (HUSH) complex inhibits assembly of the HUSH complex. In some embodiments, the agent inhibits the Fanconi anemia complex. In some embodiments, the agent inhibits FANCD2-FANC1 heterodimer monoubiquitylation. In some embodiments, the agent inhibits FANCD2-FANC1 heterodimer formation. In some embodiments the agent inhibits the Fanconi Anemia (FA) core complex.
  • FA core complex is a component of the Fanconi anemia DNA damage repair pathway, e.g., in chemotherapy induced DNA inter- strand crosslinks.
  • the FA core complex comprises two central dimers of the FANCB and FA-associated protein of 100 kDa (FAAP100) subunits, flanked by two copies of the RING finger subunit, FANCL. These two heterotrimers act as a scaffold to assemble the remaining five subunits, resulting in an extended asymmetric structure. Destabilization of the scaffold would disrupt the entire complex, resulting in a non- functional FA pathway.
  • agents that can inhibit the FA core complex include Bortezomib and curcumin analogs EF24 and 4H-TTD.
  • Yet another object of the present invention is to provide a method for gene therapy of animals through administration of transposon-based vectors comprising tissue specific promoters and a gene of interest to facilitate tissue specific incorporation and expression of a gene of interest to produce a desired protein, peptide or nucleic acid.
  • Another object of the present invention is to provide a method for gene therapy of animals through administration of transposon-based vectors comprising cell specific promoters and a gene of interest to facilitate cell specific incorporation and expression of a gene of interest to produce a desired protein, peptide or nucleic acid.
  • Still another object of the present invention is to provide a method for gene therapy of animals through administration of transposon-based vectors comprising cell specific promoters and a gene of interest to facilitate cell specific incorporation and expression of a gene of interest to produce a desired protein, peptide or nucleic acid, wherein the desired protein, peptide or nucleic acid has a desired biological effect in the animal.
  • transposon-based vectors comprising cell specific promoters and a gene of interest to facilitate cell specific incorporation and expression of a gene of interest to produce a desired protein, peptide or nucleic acid, wherein the desired protein, peptide or nucleic acid has a desired biological effect in the animal.
  • methods and compositions for delivery inside a cell for example a myeloid cell and stable incorporation of one or more nucleic acids, comprising nucleic acid sequences encoding one or more proteins, wherein the stable incorporation may be via non-viral mechanisms.
  • the delivery of a nucleic acid composition into a myeloid cell is via a non-viral mechanism.
  • the delivery of the nucleic acids may further bypass plasmid mediated delivery.
  • a "plasmid,” as used herein, refers to a non-viral expression vector, e.g., a nucleic acid molecule that encodes for genes and/or regulatory elements necessary for the expression of genes.
  • a viral vector is capable of directing expression of a protein or proteins encoded by one or more genes carried by the vector when it is present in the appropriate environment.
  • viral vectors include, but are not limited to retroviral, adenoviral, lentiviral and adeno-associated viral vectors.
  • a composition inside a cell such as in a myeloid cell, the composition comprising one or more nucleic acid sequences encoding one or more proteins, wherein the one or more nucleic acid sequences is an RNA.
  • the RNA is mRNA.
  • one or more mRNA comprising one or more nucleic acid sequences are delivered.
  • the one or more mRNA may comprise at least one modified nucleotide.
  • nucleotide refers to a base-sugar-phosphate combination.
  • a nucleotide may comprise a synthetic nucleotide.
  • a nucleotide may comprise a synthetic nucleotide analog.
  • Nucleotides may be monomeric units of a nucleic acid sequence (e.g. deoxyribonucleic acid (DNA) and ribonucleic acid (RNA)).
  • nucleotide may include ribonucleoside triphosphates adenosine triphosphate (ATP), uridine triphosphate (UTP), cytosine triphosphate (CTP), guanosine triphosphate (GTP) and deoxyribonucleoside triphosphates such as dATP, dCTP, dITP, dUTP, dGTP, or derivatives thereof.
  • ribonucleoside triphosphates adenosine triphosphate (ATP), uridine triphosphate (UTP), cytosine triphosphate (CTP), guanosine triphosphate (GTP)
  • deoxyribonucleoside triphosphates such as dATP, dCTP, dITP, dUTP, dGTP, or derivatives thereof.
  • Such derivatives may include, for example, [aS]dATP, 7-deaza-dGTP and 7-deaza-dATP, and nucleotide derivatives that
  • nucleotide as used herein may refer to dideoxyribonucleoside triphosphates (ddNTPs) and their derivatives.
  • ddNTPs dideoxyribonucleoside triphosphates
  • Illustrative examples of dideoxyribonucleoside triphosphates may include, but are not limited to, ddATP, ddCTP, ddGTP, ddITP, and ddTTP.
  • a nucleotide may be unlabeled or detectably labeled by well-known techniques. Labeling may also be carried out with quantum dots. Detectable labels may include, for example, radioactive isotopes, fluorescent labels, chemiluminescent labels, bioluminescent labels and enzyme labels.
  • Fluorescent labels of nucleotides may include but are not limited fluorescein, 5- carboxyfluorescein (FAM), 2'7'-dimethoxy-4'5-dichloro-6-carboxyfluorescein (JOE), rhodamine, 6- carboxyrhodamine (R6G), N,N,NcN'-tetramethy1-6-carboxyrhodamine (TAMRA), 6-carboxy-X-rhodamine (ROX), 4-(4'dimethylaminophenylazo) benzoic acid (DABCYL), Cascade Blue, Oregon Green, Texas Red, Cyanine and 5-(2'-aminoethyl)aminonaphthalene-l-sulfonic acid (EDANS).
  • FAM 5- carboxyfluorescein
  • JE 2'7'-dimethoxy-4'5-dichloro-6-carboxyfluorescein
  • rhodamine 6- carboxyrh
  • fluorescently labeled nucleotides may include [R6G]dUTP, [TAMRA]dUTP, [R110]dCTP, [R6G]dCTP, [TAMRA]dCTP, [JOE]ddATP, [R6G]ddATP, [FAM]ddCTP, [R110]ddCTP, [TAN1RA]ddGTP, [ROX]ddTTP, [dR6G]ddATP, [dR110]ddCTP, [dTAMRA]ddGTP, and [dROX]ddTTP available from Perkin Elmer, Foster City, Calif.
  • Nucleotides may also be labeled or marked by chemical modification.
  • a chemically-modified single nucleotide can be biotin-dNTP.
  • biotinylated dNTPs can include, biotin-dATP (e.g., bio-N6-ddATP, biotin-14-dATP), biotin-dCTP (e.g., biotin-11-cICTP, biotin-14- dCTP), and biotin-dUTP (e.g. biotin-11-dUTP, biotin-1.6-dUTP, biotin-20-dUTP).
  • polynucleotide oligonucleotide
  • nucleic acid refers to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides, or analogs thereof, either in single-, double-, or multi-stranded form.
  • a polynucleotide may be exogenous or endogenous to a cell.
  • a polynucleotide may exist in a cell-free environment.
  • a polynucleotide may be a gene or fragment thereof.
  • a polynucleotide may be DNA.
  • a polynucleotide may be RNA.
  • a polynucleotide may have any three-dimensional structure, and may perform any function, known or unknown.
  • a polynucleotide may comprise one or more analogs (e.g. altered backbone, sugar, or nucleobase). If present, modifications to the nucleotide structure may be imparted before or after assembly of the polymer.
  • modified nucleotides or analogs include: pseudouridine, 5-bromouracil, 5- methylcytosine, peptide nucleic acid, xeno nucleic acid, morpholinos, locked nucleic acids, glycol nucleic acids, threose nucleic acids, dideoxynucleotides, cordycepin, 7-deaza-GTP, florophores (e.g.
  • thiol containing nucleotides thiol containing nucleotides, biotin linked nucleotides, fluorescent base analogs, CpG islands, methyl-7-guanosine, methylated nucleotides, inosine, thiouridine, pseudourdine, dihydrouridine, queuosine, and wyosine.
  • Non-limiting examples of polynucleotides include coding or non- coding regions of a gene or gene fragment, loci (locus) defined from linkage analysis, exons, introns, messenger RNA (mRNA), transfer RNA (tRNA), ribosomal RNA (rRNA), short interfering RNA (siRNA), short-hairpin RNA (shRNA), micro-RNA (miRNA), ribozymes, eDNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, cell-free polynucleotides including cell-free DNA (cfDNA) and cell-free RNA (cfRNA), nucleic acid probes, and primers.
  • loci locus
  • locus defined from linkage analysis, exons, introns, messenger RNA (mRNA), transfer RNA (tRNA), ribosomal RNA (rRNA), short interfer
  • the sequence of nucleotides may be interrupted by non- nucleotide components.
  • the nucleic acid composition may comprise one or more mRNA, comprising at least one mRNA encoding a transmembrane receptor implicated in an immune response function (e.g. a phagocytic receptor or synthetic chimeric antigen receptor) into human macrophage or dendritic cell or a suitable myeloid cell or a myeloid precursor cell.
  • the nucleic acid composition comprises one or more mRNA, and one or more lipids for delivery of the nucleic acid into a cell of hematopoietic origin, such as a myeloid cell or a myeloid cell precursor cell.
  • the one or more lipids may form a liposomal complex.
  • the composition described herein may be used for delivery inside a cell.
  • a cell may originate from any organism having one or more cells. Some non-limiting examples include: a prokaryotic cell, eukaryotic cell, a bacterial cell, an archaeal cell, a cell of a single-cell eukaryotic organism, a protozoa cell, a cell from a plant (e.g.
  • algal cells from plant crops, fruits, vegetables, grains, soy bean, corn, maize, wheat, seeds, tomatoes, rice, cassava, sugarcane, pumpkin, hay, potatoes, cotton, cannabis, tobacco, flowering plants, conifers, gymnosperms, ferns, clubmosses, hornworts, liverworts, mosses), an algal cell, (e.g., Botryococcus braunii, Chlamydomonas reinhardtii, Nannochloropsis gaditana, Chlorella pyrenoidosa, Sargassum patens C. Agardh, and the like), seaweeds (e.g.
  • a fungal cell e.g., a yeast cell, a cell from a mushroom
  • an animal cell e.g. fruit fly, cnidarian, echinoderm, nematode, etc.
  • a cell from a vertebrate animal e.g., fish, amphibian, reptile, bird, mammal
  • a cell from a mammal e.g., a pig, a cow, a goat, a sheep, a rodent, a rat, a mouse, a non-human primate, a human, etc.
  • a cell may not be originating from a natural organism (e.g.
  • a cell may be a synthetically made, sometimes termed an artificial cell).
  • the cell referred to herein is a mammalian cell.
  • the cell is a human cell.
  • the methods and compositions described herein relates to incorporating a genetic material in a cell, more specifically a human cell, wherein the human cell can be any human cell.
  • a human cell may be of any origin, for example, a somatic cell, a neuron, a fibroblast, a muscle cell, an epithelial cell, a cardiac cell, or a hematopoietic cell.
  • the methods and compositions described herein can also be applicable to and useful for incorporating exogenous nucleic acid in hard-to-transfect human cell.
  • the methods are simple and universally applicable once a suitable exogenous nucleic acid construct has been designed and developed.
  • the methods and compositions described herein are applicable to incorporate an exogenous nucleic acid in a cell ex vivo.
  • the compositions may be applicable for systemic administration in an organism, where the nucleic acid material in the composition may be taken up by a cell in vivo, whereupon it is incorporated in cell in vivo.
  • the methods and compositions described herein may be directed to incorporating an exogenous nucleic acid in a human hematopoietic cell, for example, a human cell of hematopoietic origin, such as a human myeloid cell or a myeloid cell precursor.
  • a cell as may refer to any cell that is a basic structural, functional and/or biological unit of a living organism.
  • a cell as may refer to any cell that is a basic structural, functional and/or biological unit of a living organism.
  • the one or more nucleic acids comprise at least one nucleic acid sequence encoding a transmembrane receptor protein having a role in immune response.
  • the methods and compositions are directed to using a retrotransposable element for incorporating one or more nucleic acid sequences into a myeloid cell.
  • the nucleic acid composition may comprise one or more nucleic sequences, such as a gene, where the gene is a transgene.
  • the term "gene,” as used herein, refers to a nucleic acid (e.g., DNA such as genomic DNA and cDNA) and its corresponding nucleotide sequence that is involved in encoding an RNA transcript.
  • genomic DNA includes intervening, non-coding regions as well as regulatory regions and may include 5' and 3' ends.
  • the term encompasses the transcribed sequences, including 5' and 3' untranslated regions (5'-UTR and 3'-UTR), exons and introns.
  • the transcribed region will contain "open reading frames” that encode polypeptides.
  • a "gene” comprises only the coding sequences (e.g., an "open reading frame” or "coding region") necessary for encoding a polypeptide.
  • genes do not encode a polypeptide, for example, ribosomal RNA genes (rRNA) and transfer RNA (tRNA) genes.
  • the term "gene” includes not only the transcribed sequences, but in addition, also includes non-transcribed regions including upstream and downstream regulatory regions, enhancers and promoters.
  • a gene may refer to an "endogenous gene” or a native gene in its natural location in the genome of an organism.
  • a gene may refer to an "exogenous gene” or a non-native gene.
  • a non-native gene may refer to a gene not normally found in the host organism, but which is introduced into the host organism by gene transfer.
  • a non-native gene may also refer to a gene not in its natural location in the genome of an organism.
  • a non-native gene may also refer to a naturally occurring nucleic acid or polypeptide sequence that comprises mutations, insertions and/or deletions (e.g., non-native sequence).
  • the term "transgene” refers to any nucleic acid molecule that is introduced into a cell, that may be intermittently termed herein as a recipient cell. The resultant cell after receiving a transgene may be referred to a transgenic cell.
  • a transgene may include a gene that is partly or entirely heterologous (i.e., foreign) to the transgenic organism or cell, or may represent a gene homologous to an endogenous gene of the organism or cell.
  • transgenes include any polynucleotide, such as a gene that encodes a polypeptide or protein, a polynucleotide that is transcribed into an inhibitory polynucleotide, or a polynucleotide that is not transcribed (e.g., lacks an expression control element, such as a promoter that drives transcription).
  • Transcripts and encoded polypeptides may be collectively referred to as "gene product.” If the polynucleotide is derived from genomic DNA, expression may include splicing of the mRNA in a eukaryotic cell.
  • Up-regulated refers to an increased expression level of a polynucleotide (e.g., RNA such as mRNA) and/or polypeptide sequence relative to its expression level in a wild-type state while “down-regulated” refers to a decreased expression level of a polynucleotide (e.g., RNA such as mRNA) and/or polypeptide sequence relative to its expression in a wild-type state.
  • RNA e.g., RNA such as mRNA
  • Expression of a transfected gene may occur transiently or stably in a cell. During “transient expression” the transfected gene is not transferred to the daughter cell during cell division. Since its expression is restricted to the transfected cell, expression of the gene is lost over time.
  • transfected gene in contrast, stable expression of a transfected gene may occur when the gene is co-transfected with another gene that confers a selection advantage to the transfected cell.
  • a selection advantage may be a resistance towards a certain toxin that is presented to the cell.
  • the application envisages the use of codon-optimized sequences.
  • An example of a codon optimized sequence may be a sequence optimized for expression in a eukaryote, e.g., humans (i.e. being optimized for expression in humans), or for another eukaryote, animal or mammal. Codon optimization for a host species other than human, or for codon optimization for specific organs is known.
  • the coding sequence encoding a protein may be codon optimized for expression in particular cells, such as eukaryotic cells.
  • the eukaryotic cells may be those of or derived from a particular organism, such as a plant or a mammal, including but not limited to human, or non-human eukaryote or animal or mammal as herein discussed, e.g., mouse, rat, rabbit, dog, livestock, or non-human mammal or primate.
  • Codon optimization refers to a process of modifying a nucleic acid sequence for enhanced expression in the host cells of interest by replacing at least one codon (e.g., about or more than about 1, 2, 3, 4, 5, 10, 15, 20, 25, 50, or more codons) of the native sequence with codons that are more frequently or most frequently used in the genes of that host cell while maintaining the native amino acid sequence.
  • codons e.g., about or more than about 1, 2, 3, 4, 5, 10, 15, 20, 25, 50, or more codons
  • Codon bias differs in codon usage between organisms
  • mRNA messenger RNA
  • tRNA transfer RNA
  • the predominance of selected tRNAs in a cell may generally reflect the codons used most frequently in peptide synthesis. Accordingly, genes may be tailored for optimal gene expression in a given organism based on codon optimization. Codon usage tables are readily available, for example, at the "Codon Usage Database” available at www.kazusa.orjp/codon/ and these tables may be adapted in a number of ways. Computer algorithms for codon optimizing a particular sequence for expression in a particular host cell are also available, such as Gene Forge (Aptagen; Jacobus, PA), are also available. [00271]
  • a "multicistronic transcript” as used herein refers to an mRNA molecule that contains more than one protein coding region, or cistron.
  • a mRNA comprising two coding regions is denoted a "bicistronic transcript.”
  • the "5′-proximal" coding region or cistron is the coding region whose translation initiation codon (usually AUG) is closest to the 5′ end of a multicistronic mRNA molecule.
  • a "5′-distal” coding region or cistron is one whose translation initiation codon (usually AUG) is not the closest initiation codon to the 5′ end of the mRNA.
  • promoter refers to a polynucleotide sequence capable of driving transcription of a coding sequence in a cell.
  • promoters used in the polynucleotide constructs of the disclosure include cis-acting transcriptional control elements and regulatory sequences that are involved in regulating or modulating the timing and/or rate of transcription of a gene.
  • a promoter may be a cis-acting transcriptional control element, including an enhancer, a promoter, a transcription terminator, an origin of replication, a chromosomal integration sequence, 5' and 3' untranslated regions, or an intronic sequence, which are involved in transcriptional regulation. These cis-acting sequences typically interact with proteins or other biomolecules to carry out (turn on/off, regulate, modulate, etc.) gene transcription.
  • a "constitutive promoter” is one that is capable of initiating transcription in nearly all tissue types, whereas a "tissue-specific promoter" initiates transcription only in one or a few particular tissue types.
  • inducible promoter is one that initiates transcription only under particular environmental conditions, developmental conditions, or drug or chemical conditions.
  • exemplary inducible promoter may be a doxycycline or a tetracycline inducible promoter.
  • Tetracycline regulated promoters may be both tetracycline inducible or tetracycline repressible, called the tet-on and tet-off systems.
  • tet regulated systems rely on two components, i.e., a tetracycline-controlled regulator (also referred to as transactivator) (tTA or rtTA) and a tTA/rtTA-dependent promoter that controls expression of a downstream cDNA, in a tetracycline- dependent manner.
  • tTA is a fusion protein containing the repressor of the Tn10 tetracycline-resistance operon of Escherichia coli and a carboxyl-terminal portion of protein 16 of herpes simplex virus (VP16).
  • the tTA-dependent promoter consists of a minimal RNA polymerase II promoter fused to tet operator (tetO) sequences (an array of seven cognate operator sequences). This fusion converts the tet repressor into a strong transcriptional activator in eukaryotic cells.
  • tetO tet operator
  • tTA binds to the tetO sequences, allowing transcriptional activation of the tTA-dependent promoter.
  • tTA cannot interact with its target and transcription does not occur.
  • tet-OFF The tet system that uses tTA is termed tet-OFF, because tetracycline or doxycycline allows transcriptional down-regulation.
  • rtTA a mutant form of tTA, termed rtTA, has been isolated using random mutagenesis.
  • rtTA is not functional in the absence of doxycycline but requires the presence of the ligand for transactivation.
  • exon refers to a nucleic acid sequence found in genomic DNA that is bioinformatically predicted and/or experimentally confirmed to contribute contiguous sequence to a mature mRNA transcript.
  • RNA e.g. pre-mRNA
  • splice acceptor site refers to a sequence present in genomic DNA that is bioinformatically predicted and/or experimentally confirmed to be the acceptor site during splicing of pre- mRNA, which may include identified and unidentified natural and artificially derived or derivable splice acceptor sites.
  • IRES internal ribosome entry site
  • mRNA messenger RNA
  • IRESs are commonly located in the 5' UTR of positive-stranded RNA viruses with uncapped genomes.
  • Another means to express 2 proteins from a single mRNA molecule is by insertion of a 2A peptide(-like) sequence in between their coding sequence.
  • 2A peptide(-like) sequences mediate self-processing of primary translation products by a process variously referred to as “ribosome skipping", “stop-go” translation and “stop carry-on” translation.
  • 2A peptide(-like) sequences are present in various groups of positive- and double-stranded RNA viruses including Picornaviridae, Flaviviridae, Tetraviridae, Dicistroviridae, Reoviridae and Totiviridae.
  • the term "2A peptide” refers to a class of 18–22 amino-acid (AA)-long viral oligopeptides that mediate "cleavage" of polypeptides during translation in eukaryotic cells.
  • the designation "2A” refers to a specific region of the viral genome and different viral 2As have generally been named after the virus they were derived from.
  • the first discovered 2A was F2A (foot-and-mouth disease virus), after which E2A (equine rhinitis A virus), P2A (porcine teschovirus-12A), and T2A (thosea asigna virus 2A) were also identified.
  • E2A equine rhinitis A virus
  • P2A porcine teschovirus-12A
  • T2A thosea asigna virus 2A
  • 2A peptide(-like) sequences mediate self-processing of primary translation products by a process variously referred to as “ribosome skipping", “stop-go” translation and “stop carry-on” translation.
  • 2A peptide(-like) sequences are present in various groups of positive- and double-stranded RNA viruses including Picornaviridae, Flaviviridae, Tetraviridae, Dicistroviridae, Reoviridae and Totiviridae.
  • the term "operably linked” refers to a functional relationship between two or more segments, such as nucleic acid segments or polypeptide segments.
  • termination sequence refers to a nucleic acid sequence which is recognized by the polymerase of a host cell and results in the termination of transcription.
  • the termination sequence is a sequence of DNA that, at the 3′ end of a natural or synthetic gene, provides for termination of mRNA transcription or both mRNA transcription and ribosomal translation of an upstream open reading frame.
  • Prokaryotic termination sequences commonly comprise a GC-rich region that has a two-fold symmetry followed by an AT-rich sequence.
  • a commonly used termination sequence is the T7 termination sequence.
  • termination sequences are known in the art and may be employed in the nucleic acid constructs of the present invention, including the TINT3, TL13, TL2, TR1, TR2, and T6S termination signals derived from the bacteriophage lambda, and termination signals derived from bacterial genes, such as the trp gene of E. coli.
  • the terms "polyadenylation sequence” (also referred to as a "poly A site” or "poly A sequence”) refers to a DNA sequence which directs both the termination and polyadenylation of the nascent RNA transcript. Efficient polyadenylation of the recombinant transcript is desirable, as transcripts lacking a poly A tail are typically unstable and rapidly degraded.
  • the poly A signal utilized in an expression vector may be "heterologous” or "endogenous".
  • An endogenous poly A signal is one that is found naturally at the 3′ end of the coding region of a given gene in the genome.
  • a heterologous poly A signal is one which is isolated from one gene and placed 3′ of another gene, e.g., coding sequence for a protein.
  • a commonly used heterologous poly A signal is the SV40 poly A signal.
  • the SV40 poly A signal is contained on a 237 bp BamHI/BclI restriction fragment and directs both termination and polyadenylation; numerous vectors contain the SV40 poly A signal.
  • Another commonly used heterologous poly A signal is derived from the bovine growth hormone (BGH) gene; the BGH poly A signal is also available on a number of commercially available vectors.
  • the poly A signal from the Herpes simplex virus thymidine kinase (HSV tk) gene is also used as a poly A signal on a number of commercial expression vectors.
  • the polyadenylation signal facilitates the transportation of the RNA from within the cell nucleus into the cytosol as well as increases cellular half-life of such an RNA.
  • the polyadenylation signal is present at the 3’-end of an mRNA.
  • complement refers to a sequence that is complementary to and hybridizable to the given sequence.
  • a sequence hybridized with a given nucleic acid is referred to as the "complement” or “reverse-complement” of the given molecule if its sequence of bases over a given region is capable of complementarily binding those of its binding partner, such that, for example, A-T, A-U, G-C, and G-U base pairs are formed.
  • a first sequence that is hybridizable to a second sequence is specifically or selectively hybridizable to the second sequence, such that hybridization to the second sequence or set of second sequences is preferred (e.g. thermodynamically more stable under a given set of conditions, such as stringent conditions commonly used in the art) to hybridization with non-target sequences during a hybridization reaction.
  • hybridizable sequences share a degree of sequence complementarity over all or a portion of their respective lengths, such as between 25%-100% complementarity, including at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, and 100% sequence complementarity.
  • Sequence identity such as for the purpose of assessing percent complementarity, may be measured by any suitable alignment algorithm, including but not limited to the Needleman-Wunsch algorithm (see e.g.
  • the EMBOSS Needle aligner available at www.ebi.ac.uk/Tools/psa/embossneedle/nucleotide.html
  • the BLAST algorithm see e.g. the BLAST alignment tool available at blast.ncbi.nlm.nih.gov/Blast.cgi, optionally with default settings
  • the Smith-Waterman algorithm see e.g. the EMBOSS Water aligner available at www.ebi.ac.ukaools/psa/emboss_water/nucleotide.html, optionally with default settings.
  • Optimal alignment can be assessed using any suitable parameters of a chosen algorithm, including default parameters.
  • Complementarity may be perfect or substantial/sufficient. Perfect complementarity between two nucleic acids may mean that the two nucleic acids may form a duplex in which every base in the duplex is bonded to a complementary base by Watson-Crick pairing. Substantial or sufficient complementary may mean that, a sequence in one strand is not completely and/or perfectly complementary to a sequence in an opposing strand, but that sufficient bonding occurs between bases on the two strands to form a stable hybrid complex in set of hybridization conditions (e.g., salt concentration and temperature). Such conditions may be predicted by using the sequences and standard mathematical calculations to predict the melting temperature (Tm) of hybridized strands, or by empirical determination of Tm by using routine methods.
  • Tm melting temperature
  • Transposons as used herein are segments within the chromosome that can translocate within the genome, also known as "jumping gene”. There are two different classes of transposons: class 1, or retrotransposons, that mobilize via an RNA intermediate and a “copy-and-paste” mechanism, and class II, or DNA transposons, that mobilize via excision integration, or a "cut-and-paste” mechanism (Ivics Nat Methods 2009). Bacterial, lower eukaryotic (e.g. yeast) and invertebrate transposons appear to be largely species specific, and cannot be used for efficient transposition of DNA in vertebrate cells.
  • Sleeping Beauty (Ivics Cell 1997), was the first active transposon that was artificially reconstructed by sequence shuffling of inactive TEs from fish. This made it possible to successfully achieve DNA integration by transposition into vertebrate cells, including human cells. Sleeping Beauty is a class II DNA transposon belonging to the Tcl/mariner family of transposons (Ni Genomics Proteomics 2008). In the meantime, additional functional transposons have been identified or reconstructed from different species, including Drosophila, frog and even human genomes, that all have been shown to allow DNA transposition into vertebrate and also human host cell genomes. Each of these transposons have advantages and disadvantages that are related to transposition efficiency, stability of expression, genetic payload capacity etc.
  • Heterologous includes molecules such as DNA and RNA which may not naturally be found in the cell into which it is inserted.
  • heterologous DNA when mouse or bacterial DNA is inserted into the genome of a human cell, such DNA is referred to herein as heterologous DNA.
  • homologous denotes molecules such as DNA and RNA that are found naturally in the cell into which it is inserted.
  • the insertion of mouse DNA into the genome of a mouse cell constitutes insertion of homologous DNA into that cell.
  • homologous DNA may be inserted at sites other than where it is naturally found, thereby creating a genetic alteration (a mutation) in the inserted site.
  • a "transposase” is an enzyme that is capable of forming a functional complex with a transposon end-containing composition (e.g., transposons, transposon ends), and catalyze insertion or transposition of the transposon end-containing composition into double stranded DNA which is incubated with an in vitro transposon reaction.
  • transposon end means a double-stranded DNA that contains the nucleotide sequences (the “transposon end sequences”) necessary to form the complex with the transposase or integrase enzyme that is functional in an in vitro transposition reaction.
  • a transposon end forms a complex or a synaptic complex or a transposon complex or a transposon composition with a transposase or integrase that recognizes and binds to the transposon end, and which complex is capable of inserting or transposing the transposon end into target DNA with which it is incubated in an in vitro transposition reaction.
  • a transposon end exhibits two complementary sequences consisting of a transferred transposon end sequence or transferred strand and a non-transferred transposon end sequence, or non-transferred strand
  • one transposon end that forms a complex with a hyperactive Tn5 transposase that is active in an in vitro transposition reaction comprises a transferred strand that exhibits a transferred transposon end sequence as follows: 5' AGATGTGTATAAGAGACAG 3', and a non-transferred strand that exhibits a "non-transferred transposon end sequence" as follows: (5' CTGTCTCTTATACACATCT 3 '.
  • the 3'-end of a transferred strand is joined or transferred to target DNA in an in vitro transposition reaction.
  • the non-transferred strand which exhibits a transposon end sequence that is complementary to the transferred transposon end sequence, is not joined or transferred to the target DNA in an in vitro transposition reaction.
  • the transferred strand and non-transferred strand are covalently joined.
  • the transferred and non-transferred strand sequences are provided on a single oligonucleotide, e.g., in a hairpin configuration.
  • cleavage domain refers to a nucleic acid sequence that is susceptible to cleavage by an agent, e.g., an enzyme.
  • a "restriction site domain” means a tag domain that exhibits a sequence for the purpose of facilitating cleavage using a restriction endonuclease.
  • the restriction site domain is used to generate di-tagged linear ssDNA fragments.
  • the restriction site domain is used to generate a compatible double-stranded 5'-end in the tag domain so that this end can be ligated to another DNA molecule using a template-dependent DNA ligase.
  • the restriction site domain in the tag exhibits the sequence of a restriction site that is present only rarely, if at all, in the target DNA (e.g., a restriction site for a rare-cutting restriction endonuclease such as NotI or AscI).
  • the term "recombinant nucleic acid molecule” refers to a recombinant DNA molecule or a recombinant RNA molecule.
  • a recombinant nucleic acid molecule is any nucleic acid molecule containing joined nucleic acid molecules from different original sources and not naturally attached together.
  • Recombinant RNA molecules include RNA molecules transcribed from recombinant DNA molecules.
  • a recombinant nucleic acid may be synthesized in the laboratory.
  • a recombinant nucleic acid can be prepared by using recombinant DNA technology by using enzymatic modification of DNA, such as enzymatic restriction digestion, ligation, and DNA cloning.
  • a recombinant DNA may be transcribed in vitro, to generate a messenger RNA (mRNA), the recombinant mRNA may be isolated, purified and used to transfect a cell.
  • mRNA messenger RNA
  • a recombinant nucleic acid may encode a protein or a polypeptide.
  • a recombinant nucleic acid under suitable conditions, can be incorporated into a living cell, and can be expressed inside the living cell.
  • expression of a nucleic acid usually refers to transcription and/or translation of the nucleic acid.
  • the product of a nucleic acid expression is usually a protein but can also be an mRNA. Detection of an mRNA encoded by a recombinant nucleic acid in a cell that has incorporated the recombinant nucleic acid, is considered positive proof that the nucleic acid is "expressed" in the cell.
  • Transformation is the process of uptake of foreign nucleic acid by a bacterial cell. This process is adapted for propagation of plasmid DNA, protein production, and other applications. Transformation introduces recombinant plasmid DNA into competent bacterial cells that take up extracellular DNA from the environment. Some bacterial species are naturally competent under certain environmental conditions, but competence is artificially induced in a laboratory setting. Transfection is the forced introduction of small molecules such as DNA, RNA, or antibodies into eukaryotic cells. Just to make life confusing, ‘transfection’ also refers to the introduction of bacteriophage into bacterial cells.
  • a "stem-loop" sequence refers to a nucleic acid sequence (e.g., RNA sequence) with sufficient self-complementarity to hybridize and form a stem and the regions of non-complementarity that bulges into a loop.
  • the stem may comprise mismatches or bulges.
  • vector refers to a nucleic acid molecule capable of transporting or mediating expression of a heterologous nucleic acid.
  • a "vector sequence” as used herein, refers to a sequence of nucleic acid comprising at least one origin of replication and at least one selectable marker gene.
  • Vectors capable of directing the expression of genes and/or nucleic acid sequence to which they are operatively linked are referred to herein as "expression vectors”.
  • a plasmid is a species of the genus encompassed by the term "vector.”
  • expression vectors of utility are often in the form of "plasmids” which refer to circular double stranded DNA molecules which, in their vector form are not bound to the chromosome, and typically comprise entities for stable or transient expression of the encoded DNA.
  • expression vectors that can be used in the methods as disclosed herein include, but are not limited to plasmids, episomes, bacterial artificial chromosomes, yeast artificial chromosomes, bacteriophages or viral vectors, and such vectors can integrate into the host's genome or replicate autonomously in the cell.
  • a vector can be a DNA or RNA vector.
  • Other forms of expression vectors known by those skilled in the art which serve the equivalent functions can also be used, for example, self-replicating extrachromosomal vectors or vectors capable of integrating into a host genome.
  • Exemplary vectors are those capable of autonomous replication and/or expression of nucleic acids to which they are linked.
  • a safe harbor locus is a region within the genome where additional exogenous or heterologous nucleic acid sequence can be inserted, and the host genome is able to accommodate the inserted genetic material.
  • Exemplary safe harbor sites include but are not limited to: AAVS1 site, GGTA1 site, CMAH site, B4GALNT2 site, B2M site, ROSA26 site, COLA1 site, and TIGRE site.
  • the heterologous nucleic acid described in this disclosure may be integrated at one or more sites in the genome of the cell, wherein the one or more locations is selected from the group consisting of: AAVS1 site, GGTA1 site, CMAH site, B4GALNT2 site, B2M site, ROSA26 site, COLA1 site, and TIGRE site.
  • the nucleic acid cargo comprising the transgene may be delivered to a R2D locus.
  • the nucleic acid cargo comprising the transgene may be delivered to the genome in an intergenic or intragenic region.
  • the nucleic acid cargo comprising the transgene is integrated into the genome 5' or 3' within 0.1 kb, 0.25 kb, 0.5 kb, 0.75, kb, 1 kb, 2 kb, 3 kb, 4 kb, 5 kb, 7.5 kb, 10 kb, 15 kb, 20 kb, 25 kb, 50, 75 kb, or 100 kb of an endogenous active gene.
  • the nucleic acid cargo comprising the transgene is integrated into the genome 5' or 3' within 0.1 kb, 0.25 kb, 0.5 kb, 0.75, kb, 1 kb, 2 kb, 3 kb, 4 kb, 5 kb, 7.5 kb, 10 kb, 15 kb, 20 kb, 25 kb, 50, 75 kb, or 100 kb of an endogenous promoter or enhancer.
  • the nucleic acid cargo comprising the transgene is 50-50,000 base pairs, e.g., between 50-40,000 bp, between 500-30,000 bp between 500- 20,000 bp, between 100-15,000 bp, between 500-10,000 bp, between 50-10,000 bp, between 50-5,000 bp. In some embodiments the nucleic acid cargo comprising the transgene is less than 1,000, 1,300, 1500, 2,000, 3,000, 4,000, 5,000, or 7,500 nucleotides in length.
  • L1 and Non-L1 Retrotransposon Systems [00293] Retrotransposons can contain transposable elements that are active participants in reorganizing their resident genomes.
  • retrotransposons can refer to DNA sequences that are transcribed into RNA and translated into protein and have the ability to reverse-transcribe themselves back into DNA. Approximately 45% of the human genome is comprised of sequences that result from transposition events. Retrotransposition occasionally generates target site deletions or adds non-retrotransposon DNA to the genome by processes termed 5′- and 3′-transduction. Recombination between non-homologous retrotransposons causes deletions, duplications or rearrangements of gene sequence. Ongoing retrotransposition can generate novel splice sites, polyadenylation signals and promoters, and so builds new transcription modules.
  • retrotransposons may be grouped into two classes, the retrovirus-like LTR retrotransposons, and the non-LTR elements such as human L1 elements, Neurospora TAD elements (Kinsey, 1990, Genetics 126:317-326), I factors from Drosophila (Bucheton et al., 1984, Cell 38:153-163), and R2Bm from Bombyx mori (Luan et al., 1993, Cell 72: 595-605). These two types of retrotransposons are structurally different and also retrotranspose using radically different mechanisms. Exemplary, non- limiting examples of LINE-encoded polypeptides are found in GenBank Accession Nos.
  • LINE-1 or L1- elements are autonomous as they encode all of the machinery alone to complete this reverse transcription and integration process;
  • L1 elements are abundant in the human genome, such that these elements may be considered as a naturalized element of the genome;
  • L1 retrotransposon retrotransposes its own mRNA with high degree of specificity, compared to other mRNAs floating around in the cells.
  • the L1 expresses a 6-kb bicistronic RNA that encodes the 40 kDa Open Reading Frame-1 RNA- binding protein (ORF1p) of essential but uncertain function, and a 150 kDa ORF2 protein with endonuclease and reverse transcriptase (RT) activities.
  • L1 retrotransposition is a complex process involving transcription of the L1, transport of its RNA to the cytoplasm, translation of the bicistronic RNA, formation of a ribonucleoprotein (RNP) particle, its re-import to the nucleus and target-primed reverse transcription at the integration site.
  • RNP ribonucleoprotein
  • L1 RNA forms an RNP in cis with the proteins that are translated from the transcript.
  • L1 integrates into genomic DNA by target-site primer reverse transcription (TPRT) by ORF2p cleavage at the 5’-TTTT-3’ where a poly A sequence of L1 RNA anneals and primes reverse transcriptase (RT) activity to make L1 cDNA.
  • TPRT target-site primer reverse transcription
  • ORF2p ORF2p cleavage at the 5’-TTTT-3’ where a poly A sequence of L1 RNA anneals and primes reverse transcriptase (RT) activity to make L1 cDNA.
  • TPRT target-site primer reverse transcription
  • RT reverse transcriptase
  • Other mobile elements of the genome can "hijack" the L1 ORF for retrotransposition.
  • Alu elements are such mobile DNA elements that belong to the class of short interspersed elements (SINEs) that are non-autonomous retrotransposons and acquire trans-factors to integrate.
  • Alu elements and SINE-1 elements can associate with the L1 ribonucleoproteins in trans to be also retrotransposed by ORF1p and ORF2p.
  • the Alu element ends with a long A-run, often referred to as the A-tail, and it also has a smaller A-rich region (indicated by AA) separating the two halves of a diverged dimer structure.
  • Alu elements are likely to have the internal components of an RNA polymerase III promoter (such as, commonly designated as an A box and a B box promoters), but they do not encode a terminator for RNA polymerase III.
  • a typical Alu transcript encompasses the entire Alu, including the A-tail, and has a 3' region that is unique for each locus.
  • the Alu RNA folds into separate structures for each monomer unit.
  • the RNA has been shown to bind the 7SL RNA SRP9 and 14 heterodimer, as well as poly A-binding protein (PABP).
  • PABP poly A-binding protein
  • the poly A tail of Alu primes with T rich (TTTT) region of the genome and attracts ORF2p to bind to the primed region and cleaves at the T rich region via its endonuclease activity.
  • the T-rich region primes reverse transcription by ORF2p on the 3' A-tail region of the Alu element. This creates a cDNA copy of the body of the Alu element. A nick occurs by an unknown mechanism on the second strand and second-strand synthesis is primed. The new Alu element is then flanked by short direct repeats that are duplicates of the DNA sequence between the first and second nicks. Alu elements are extremely prevalent within RNA molecules, owing to their preference for gene-rich regions.
  • a full-length Alu ( ⁇ 300 bp) is derived from the signal recognition particle RNA 7SL and consists of two similar monomers with an A-rich linker in-between, A- and B- boxes present in the 5′ monomer, and a poly-A tail lacking the preceding polyadenylation signal resulting in an elongated tail (up to 100 bp in length).
  • Alus can be transcribed by RNA polymerase III using the internal promoters within the A- and B-boxes; however, Alus contain no ORFs and therefore do not encode for protein products.
  • Other non-L1 transposons include SVAs and HERV-Ks.
  • a full-length SVA (SINE-VNTR-Alu) element ( ⁇ 2–3 kb) is a composite unit that contains a CCCTCT repeat, two Alu-like sequences, a VNTR, a SINE-R region with env (envelope) gene, the 3′ LTR of HERV-K10, and a polyadenylation signal followed by a poly-A tail. It is most likely that SVAs are transcribed by RNA polymerase II, although it is unknown whether SVA elements carry an internal promoter.
  • a full-length HERV-K element ( ⁇ 9–10 kb) is comprised of ancient remnants of endogenous retroviral sequences and includes two flanking LTR regions surrounding three retroviral ORFs: (1) gag encoding the structural proteins of a retroviral capsid; (2) pol-pro encoding the enzymes: protease, RT, and integrase; and (3) env encoding proteins allowing for horizontal transfer.
  • the LTR of HERV-K contains an internal, bidirectional promoter that appears to be under the transcriptional control of RNA polymerase II.
  • L1 retrotransposition and RNA binding can take place at or near poly-A tail.
  • the 3’-UTR plays a role in the recognition of stringent-type LINE RNA of ORF1 protein (ORF1p).
  • Stringent-type LINEs can contain a stem-loop structure located at the end of the 3′UTR.
  • Branched molecules consisting of junctions between transposon 3′-end cDNA and the target DNA, as well as specific positioning of L1 RNA within ORF2 protein (ORF2p), were detected during initial stages of L1 retrotransposition in vitro.
  • Secondary or tertiary RNA structure shared by L1 and Alu are likely to be responsible for recognition by and binding of ORF2, possibly along with a poly-A tail.
  • the stem-loop structure located downstream of the poly-A sequence correlates with cleavage intensity.
  • Non-homologous end-joining repair proteins such as XRCC1, Ku70 and DNA-PK, have been implicated in resolution of the L1 integrate at the time of insertion.
  • the cell has evolved a number of proteins that stand against unrestricted retrotransposition, including the APOBEC3 family of cytosine deaminases, adenosine deaminase ADAR1, chromatin-remodeling factors and members of the piRNA pathway for post-transcription gene silencing that functions in the male germ line.
  • compositions comprising nucleic acid constructs and methods involved for stable expression of encoded protein
  • a recombinant nucleic acid encoding one or more proteins for expression in a cell, such as a myeloid cell.
  • the recombinant nucleic acid is designed for stable expression of the one or more proteins or polypeptides encoded by the recombinant nucleic acid.
  • the stable expression is achieved by incorporation of recombinant nucleic acid within the genome of the cell.
  • compositions and methods described herein can be utilized to design products in which the recombinant nucleic acid may comprise one or more sequences that do not translate as a protein or a polypeptide component, but may encode an oligonucleotide that can be a regulatory nucleic acid, such as an inhibitor oligonucleotide product, such as an activator oligonucleotide.
  • a composition comprising a synthetic nucleic acid, comprising a nucleic acid sequence encoding a gene of interest and one or more retrotransposable elements to stably incorporate a non-endogenous nucleic acid into a cell.
  • the cell is a hematopoietic cell. In some embodiments, the cell is a myeloid cell. In some embodiments, the cell is a precursor cell. In some embodiments, the cell is undifferentiated. In some embodiments, the cell has further differentiation potential. In some embodiments, the cell is not a stem cell.
  • A. LINE/Alu Retrotransposon Construct [00305] In some embodiments, the present disclosure may utilize a retrotransposable system to stably incorporate into the genome and express a non-endogenous nucleic acid, where the non-endogenous nucleic acid comprises retrotransposable elements within the nucleic acid sequence.
  • the present disclosure may utilize a cell’s endogenous retrotransposable system (e.g., proteins and enzymes), to stably express a non-endogenous nucleic acid in the cell.
  • the present disclosure may utilize a cell’s endogenous retrotransposable system (e.g., proteins and enzymes, such as a LINE1 retrotransposition system), but may further express one or more components of the retrotransposable system to stably express a non-endogenous nucleic acid in the cell.
  • a synthetic nucleic acid is provided herein, the synthetic nucleic acid encoding a transgene, and encoding one or more components for retrotransposition.
  • the synthetic nucleic acid described herein is interchangeably termed as a nucleic acid construct, transgene or the exogenous nucleic acid.
  • a method of integrating a nucleic acid sequence into a genome of a cell comprising introducing a recombinant mRNA or a vector encoding an mRNA into the cell, wherein the mRNA comprises: an insert sequence, wherein the insert sequence comprises an exogenous sequence, or a sequence that is a reverse complement of the exogenous sequence; a 5’ UTR sequence and a 3’ UTR sequence downstream of the 5’ UTR sequence; wherein the 5’ UTR sequence or the 3’ UTR sequence comprises a binding site for a human ORF protein, and wherein the insert sequence is integrated into the genome of the cell.
  • the 5’ UTR sequence or the 3’ UTR sequence comprises a binding site for human ORF2p.
  • a method for integrating a nucleic acid sequence into the genome of an immune cell comprising introducing a recombinant mRNA or a vector encoding an mRNA, wherein the mRNA comprises an insert sequence, wherein the insert sequence comprises (i) an exogenous sequence or (ii) a sequence that is a reverse complement of the exogenous sequence; 5’ UTR sequence and a 3’ UTR sequence downstream of the 5’ UTR sequence, wherein the 5’ UTR sequence or the 3’ UTR sequence comprises an endonuclease binding site and/or a reverse transcriptase binding site, and wherein the transgene sequence is integrated into the genome of the immune cell.
  • a method for integrating a nucleic acid sequence into the genome of a cell comprising introducing a recombinant mRNA or a vector encoding an mRNA, wherein the mRNA comprises an insert sequence, wherein the insert sequence comprises (i) an exogenous sequence or (ii) a sequence that is a reverse complement of the exogenous sequence; a 5’ UTR sequence, a sequence of a human retrotransposon downstream of the 5’ UTR sequence, and a 3’ UTR sequence downstream of the sequence of a human retrotransposon; wherein the 5’ UTR sequence or the 3’ UTR sequence comprises an endonuclease binding site and/or a reverse transcriptase binding site, and wherein the sequence of a human retrotransposon encodes for two proteins that are translated from a single RNA containing two ORFs, and wherein the insert sequence is integrated into the genome of the cell.
  • the 5’ UTR sequence or the 3’ UTR sequence comprises an ORF2p binding site.
  • the ORF2p binding site is a poly A sequence in the 3' UTR sequence.
  • the mRNA comprises a sequence of a human retrotransposon.
  • the sequence of a human retrotransposon is downstream of the 5’ UTR sequence.
  • the sequence of a human retrotransposon is upstream of the 3’ UTR sequence.
  • the sequence of a human retrotransposon encodes for two proteins that are translated from a single RNA containing two ORFs.
  • the two ORFs are non- overlapping ORFs. In some embodiments, the two ORFs are ORF1 and ORF2. In some embodiments, the ORF1 encodes ORF1p and ORF2 encodes ORF2p. [00314] In some embodiments, the sequence of a human retrotransposon comprises a sequence of a non- LTR retrotransposon. In some embodiments, the sequence of a human retrotransposon encodes comprises a LINE-1 retrotransposon. In some embodiments, the LINE-1 retrotransposon is a human LINE-1 retrotransposon.
  • the sequence of a human retrotransposon comprises a sequence encoding an endonuclease and/or a reverse transcriptase.
  • the endonuclease and/or a reverse transcriptase is ORF2p.
  • the reverse transcriptase is a group II intron reverse transcriptase domain.
  • the endonuclease and/or a reverse transcriptase is a minke whale endonuclease and/or a reverse transcriptase.
  • the sequence of a human retrotransposon comprises a sequence encoding ORF2p.
  • the insert sequence is integrated into the genome at a poly T site using specificity of an endonuclease domain of the ORF2p.
  • the sequence of a human retrotransposon comprises a sequence encoding ORF1p
  • the mRNA does not comprise a sequence encoding ORF1p
  • the mRNA comprises a replacement of the sequence encoding ORF1p with a 5' UTR sequence from the complement gene.
  • the mRNA comprises a first mRNA molecule encoding ORF1p, and a second mRNA molecule encoding an endonuclease and/or a reverse transcriptase.
  • the mRNA is an mRNA molecule comprising a first sequence encoding ORF1p, and a second sequence encoding an endonuclease and/or a reverse transcriptase.
  • the first sequence encoding ORF1p and the second sequence encoding an endonuclease and/or a reverse transcriptase are separated by a linker sequence.
  • the linker sequence comprises an internal ribosome entry sequence (IRES).
  • the IRES is an IRES from CVB3 or EV71.
  • the linker sequence encodes a self-cleaving peptide sequence.
  • the linker sequence encodes a T2A, a E2A or a P2A sequence
  • the sequence of a human retrotransposon comprises a sequence that encodes ORF1p fused to an additional protein sequence and/or a sequence that encodes ORF2p fused to an additional protein sequence.
  • the ORF1p and/or the ORF2p is fused to a nuclear retention sequence.
  • the nuclear retention sequence is an Alu sequence.
  • the ORF1p and/or the ORF2p is fused to an MS2 coat protein.
  • the 5’ UTR sequence or the 3’ UTR sequence comprises at least one, two, three or more MS2 hairpin sequences. In some embodiments, the 5’ UTR sequence or the 3’ UTR sequence comprises a sequence that promotes or enhances interaction of a poly A tail of the mRNA with the endonuclease and/or a reverse transcriptase. In some embodiments, the 5’ UTR sequence or the 3’ UTR sequence comprises a sequence that promotes or enhances interaction of a poly-A-binding protein (PABP) with the endonuclease and/or a reverse transcriptase.
  • PABP poly-A-binding protein
  • the 5’ UTR sequence or the 3’ UTR sequence comprises a sequence that increases specificity of the endonuclease and/or a reverse transcriptase to the mRNA relative to another mRNA expressed by the cell.
  • the 5’ UTR sequence or the 3’ UTR sequence comprises an Alu element sequence.
  • the first sequence encoding ORF1p and the second sequence encoding an endonuclease and/or a reverse transcriptase have the same promoter.
  • the insert sequence has a promoter that is different from the promoter of the first sequence encoding ORF1p.
  • the insert sequence has a promoter that is different from the promoter of the second sequence encoding an endonuclease and/or a reverse transcriptase.
  • the first sequence encoding ORF1p and/or the second sequence encoding an endonuclease and/or a reverse transcriptase have a promoter or transcription initiation site selected from the group consisting of an inducible promoter, a CMV promoter or transcription initiation site, a T7 promoter or transcription initiation site, an EF1a promoter or transcription initiation site and combinations thereof.
  • the insert sequence has a promoter or transcription initiation site selected from the group consisting of an inducible promoter, a CMV promoter or transcription initiation site, a T7 promoter or transcription initiation site, an EF1a promoter or transcription initiation site and combinations thereof.
  • the first sequence encoding ORF1p and the second sequence encoding an endonuclease and/or a reverse transcriptase are codon optimized for expression in a human cell.
  • the mRNA comprises a WPRE element.
  • the mRNA comprises a selection marker.
  • the mRNA comprises a sequence encoding an affinity tag.
  • the affinity tag is linked to the sequence encoding an endonuclease and/or a reverse transcriptase.
  • the 3' UTR comprises a poly A sequence or wherein a poly A sequence is added to the mRNA in vitro.
  • the poly A sequence is downstream of a sequence encoding an endonuclease and/or a reverse transcriptase.
  • the insert sequence is upstream of the poly A sequence.
  • the 3' UTR sequence comprises the insert sequence.
  • the insert sequence comprises a sequence that is a reverse complement of the sequence encoding the exogenous polypeptide.
  • the insert sequence comprises a polyadenylation site. In some embodiments, the insert sequence comprises an SV40 polyadenylation site. In some embodiments, the insert sequence comprises a polyadenylation site upstream of the sequence that is a reverse complement of the sequence encoding the exogenous polypeptide. In some embodiments, the insert sequence is integrated into the genome at a locus that is not a ribosomal locus. In some embodiments, the insert sequence integrates into a gene or regulatory region of a gene, thereby disrupting the gene or downregulating expression of the gene. In some embodiments, the insert sequence integrates into a gene or regulatory region of a gene, thereby upregulating expression of the gene.
  • the insert sequence integrates into the genome and replaces a gene. In some embodiments, the insert sequence is stably integrated into the genome. In some embodiments, the insert sequence is retrotransposed into the genome. In some embodiments, the insert sequence is integrated into the genome by cleavage of a DNA strand of a target site by an endonuclease encoded by the mRNA. In some embodiments, the insert sequence is integrated into the genome via target-primed reverse transcription (TPRT). In some embodiments, the insert sequence is integrated into the genome via reverse splicing of the mRNA into a DNA target site of the genome. [00323] In some embodiments, the cell is an immune cell.
  • the immune cell is a T cell or a B cell. In some embodiments, the immune cell is a myeloid cell. In some embodiments, the immune cell is selected from a group consisting of a monocyte, a macrophage, a dendritic cell, a dendritic precursor cell, and a macrophage precursor cell.
  • the mRNA is a self-integrating mRNA. In some embodiments, the method comprises introducing into the cell the mRNA. In some embodiments, the method comprises introducing into the cell the vector encoding the mRNA. In some embodiments, the method comprises introducing the mRNA or the vector encoding the mRNA into a cell ex vivo.
  • the method further comprises administering the cell to a human subject. In some embodiments, the method comprises administering the mRNA or the vector encoding the mRNA to a human subject. In some embodiments, an immune response is not elicited in the human subject. In some embodiments, the mRNA or the vector is substantially non-immunogenic.
  • the vector is a plasmid or a viral vector. In some embodiments, the vector comprises a non-LTR retrotransposon. In some embodiments, the vector comprises a human L1 element. In some embodiments, the vector comprises a L1 retrotransposon ORF1 gene. In some embodiments, the vector comprises a L1 retrotransposon ORF2 gene.
  • the vector comprises a L1 retrotransposon.
  • the mRNA is at least about 1, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, or 3 kilobases.
  • the mRNA is a most about 2.5, 2.6, 2.7, 2.8, 2.9, 3, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8, 3.9, 4, 4.1, 4.2, 4.3, 4.4, 4.5, 4.6, 4.7, 4.8, 4.9 or 5 kilobases.
  • the mRNA comprises a payload that is at least about 1, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, or 3 kilobases.
  • the mRNA is a most about 2.5, 2.6, 2.7, 2.8, 2.9, 3, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8, 3.9, 4, 4.1, 4.2, 4.3, 4.4, 4.5, 4.6, 4.7, 4.8, 4.9 or 5 kilobases.
  • the mRNA is at least about 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8, 5.9 or 6 kilobases. In some embodiments, the mRNA is at least about 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9 or 7 kilobases. In some embodiments, the mRNA is at least about 7.1, 7.2, 7.3, 7.4, 7.5, 7.6, 7.7, 7.8, 7.9 or 8 kilobases. In some embodiments, the mRNA is at least about 8.1, 8.2, 8.3, 8.4, 8.5, 8.6, 8.7, 8.8, 8.9 or 9 kilobases.
  • the mRNA is at least about 9.1, 9.2, 9.3, 9.4, 9.5, 9.6, 9.7, 9.8, 9.9 or 10 kilobases. In some embodiments, the mRNA is at least about 10.1, 10.2, 10.3, 10.4, 10.5, 10.6, 10.7, 10.8, 10.9 or 11 kilobases. In some embodiments, the mRNA is at least about 11.1, 11.2, 11.3, 11.4, 11.5, 11.6, 11.7, 11.8, 11.9 or 12 kilobases. In some embodiments, the mRNA comprises a payload of about 6.8 kB, e.g., a sequence encoding a ABCA4 gene product.
  • the mRNA comprises a payload of about 6.7 kB, e.g., a sequence encoding a MY07A gene product. In some embodiments, the mRNA comprises a payload of about 7.5 kB, e.g., a sequence encoding a CEP290 gene product. In some embodiments, the mRNA comprises a payload of about 10.1 kB, e.g., a sequence encoding a CDH23 gene product. In some embodiments, the mRNA comprises a payload of about 9.4 kB, e.g., a sequence encoding a EYS gene product.
  • the mRNA comprises a payload of about 15.6 kB, e.g., a sequence encoding a USH2a gene product. In some embodiments, the mRNA comprises a payload of about 12.5 kB, e.g., a sequence encoding a ALMS1 gene product. In some embodiments, the mRNA comprises a payload of about 4.6 kB, e.g., a sequence encoding a GDE gene product. In some embodiments, the mRNA comprises a payload of about 6 kB, e.g., a sequence encoding the OTOF gene product.
  • the mRNA comprises a payload of about 7.1 kB, e.g., a sequence encoding a F8 gene product.
  • lentiviral and adeno-associated viral (AAV) gene delivery method are not expected to deliver a nucleic acid cargo of greater than 4 kB.
  • lentiviral delivery entails risk of insertional mutagenesis and other toxicities.
  • AAV mediated delivery entails unresolved liver and CNS toxicity.
  • the mRNA comprises a sequence that inhibits or prevents degradation of the mRNA.
  • the sequence that inhibits or prevents degradation of the mRNA inhibits or prevents degradation of the mRNA by an exonuclease or an RNAse.
  • the sequence that inhibits or prevents degradation of the mRNA is a G quadruplex, pseudoknot or triplex sequence.
  • the sequence the sequence that inhibits or prevents degradation of the mRNA is an exoribonuclease-resistant RNA structure from a flavivirus RNA or an ENE element from KSV. In some embodiments, the sequence that inhibits or prevents degradation of the mRNA inhibits or prevents degradation of the mRNA by a deadenylase. In some embodiments, the sequence that inhibits or prevents degradation of the mRNA comprises non-adenosine nucleotides within or at a terminus of a poly A tail of the mRNA. In some embodiments, the sequence that inhibits or prevents degradation of the mRNA increases stability of the mRNA.
  • the exogenous sequence comprises a sequence encoding an exogenous polypeptide. In some embodiments, the sequence encoding an exogenous polypeptide is not in frame with a sequence encoding an endonuclease and/or a reverse transcriptase. In some embodiments, the sequence encoding an exogenous polypeptide is not in frame with a sequence encoding an endonuclease and/or a reverse transcriptase. In some embodiments, the exogenous sequence does not comprise introns.
  • the exogenous sequence comprises a sequence encoding an exogenous polypeptide selected from the group consisting of an enzyme, a receptor, a transport protein, a structural protein, a hormone, an antibody, a contractile protein and a storage protein.
  • the exogenous sequence comprises a sequence encoding an exogenous polypeptide selected from the group consisting of a chimeric antigen receptor (CAR), a ligand, an antibody, a receptor, and an enzyme.
  • the exogenous sequence comprises a regulatory sequence.
  • the regulatory sequence comprises a cis-acting regulatory sequence.
  • the regulatory sequence comprises a cis-acting regulatory sequence selected from the group consisting of an enhancer, a silencer, a promoter or a response element. In some embodiments, the regulatory sequence comprises a trans-acting regulatory sequence. In some embodiments, the regulatory sequence comprises a trans-acting regulatory sequence that encodes a transcription factor. [00330] In some embodiments, integration of the insert sequence does not adversely affect cell health. In some embodiments, the endonuclease, the reverse transcriptase or both are capable of site-specific integration of the insert sequence. [00331] In some embodiments, the mRNA comprises a sequence encoding an additional nuclease domain or a nuclease domain that is not derived from ORF2.
  • the mRNA comprises a sequence encoding a megaTAL nuclease domain, a TALEN domain, a Cas9 domain, a zinc finger binding domain from an R2 retroelement, or a DNA binding domain that binds to repetitive sequences such as a Rep78 from AAV.
  • the endonuclease comprises a mutation that reduces activity of the endonuclease compared to the endonuclease without the mutation.
  • the endonuclease is an ORF2p endonuclease and the mutation is S228P.
  • the mRNA comprises a sequence encoding a domain that increases fidelity and/or processivity of the reverse transcriptase.
  • the reverse transcriptase is a reverse transcriptase from a retroelement other than ORF2 or reverse transcriptase that has higher fidelity and/or processivity compared to a reverse transcriptase of ORF2p.
  • the reverse transcriptase is a group II intron reverse transcriptase.
  • the group II intron reverse transcriptase is a group IIA intron reverse transcriptase, a group IIB intron reverse transcriptase, or a group IIC intron reverse transcriptase.
  • the group II intron reverse transcriptase is TGIRT-II or TGIRT-III.
  • the mRNA comprises a sequence comprising an Alu element and/or a ribosome binding aptamer.
  • the mRNA comprises a sequence encoding a polypeptide comprising a DNA binding domain.
  • the 3' UTR sequence is derived from a viral 3' UTR or a beta-globin 3' UTR.
  • composition comprising a recombinant mRNA or vector encoding an mRNA, wherein the mRNA comprises a human LINE-1 transposon sequence comprising a human LINE-1 transposon 5’ UTR sequence, a sequence encoding ORF1p downstream of the human LINE-1 transposon 5’ UTR sequence, an inter-ORF linker sequence downstream of the sequence encoding ORF1p, a sequence encoding ORF2p downstream of the inter-ORF linker sequence, and a 3’ UTR sequence derived from a human LINE-1 transposon downstream of the sequence encoding ORF2p; wherein the 3’ UTR sequence comprises an insert sequence, wherein the insert sequence is a reverse complement of a sequence encoding an exogenous polypeptide or a reverse complement of a sequence encoding an exogenous regulatory element.
  • the insert sequence integrates into the genome of a cell when introduced into the cell. In some embodiments, the insert sequence integrates into a gene associated a condition or disease, thereby disrupting the gene or downregulating expression of the gene. In some embodiments, the insert sequence integrates into a gene, thereby upregulating expression of the gene. In some embodiments, the recombinant mRNA or vector encoding the mRNA is isolated or purified.
  • composition comprising a nucleic acid comprising a nucleotide sequence encoding (a) a long interspersed nuclear element (LINE) polypeptide, wherein the LINE polypeptide includes human ORF1p and human ORF2p; and (b) an insert sequence, wherein the insert sequence is a reverse complement of a sequence encoding an exogenous polypeptide or a reverse complement of a sequence encoding an exogenous regulatory element, wherein the composition is substantially non-immunogenic.
  • the composition comprises human ORF1p and human ORF2p proteins.
  • the composition comprises a ribonucleoprotein (RNP) comprising human ORF1p and human ORF2p complexed to the nucleic acid.
  • the nucleic acid is mRNA.
  • a composition comprising a cell comprising a composition described herein.
  • the cell is an immune cell.
  • the immune cell is a T cell or a B cell.
  • the immune cell is a myeloid cell.
  • the immune cell is selected from a group consisting of a monocyte, a macrophage, a dendritic cell, a dendritic precursor cell, and a macrophage precursor cell.
  • the insert sequence is a reverse complement of a sequence encoding an exogenous polypeptide and the exogenous polypeptide is a chimeric antigen receptor (CAR).
  • CAR chimeric antigen receptor
  • a pharmaceutical composition comprising a composition described herein, and a pharmaceutically acceptable excipient.
  • the pharmaceutical composition is for use in gene therapy.
  • the pharmaceutical composition is for use in the manufacture of a medicament for treating a disease or condition.
  • the pharmaceutical composition is for use in treating a disease or condition.
  • a method of treating a disease in a subject comprising administering a pharmaceutical composition described herein to a subject with a disease or condition.
  • the method increases an amount or activity of a protein or functional RNA in the subject.
  • the subject has a deficient amount or activity of a protein or functional RNA.
  • the deficient amount or activity of a protein or functional RNA is associated with or causes the disease or condition.
  • the method further comprising administering an agent that inhibits human silencing hub (HUSH) complex, an agent that inhibits FAM208A, or an agent that inhibits TRIM28.
  • the agent that inhibits human silencing hub (HUSH) complex is an agent that inhibits Periphilin, TASOR and/or MPP8.
  • the agent that inhibits human silencing hub (HUSH) complex inhibits assembly of the HUSH complex.
  • the agent inhibits the Fanconi anemia complex.
  • the agent inhibits FANCD2-FANC1 heterodimer monoubiquitylation.
  • the agent inhibits FANCD2-FANC1 heterodimer formation.
  • the agent inhibits the Fanconi Anemia (FA) core complex.
  • FA core complex is a component of the Fanconi anemia DNA damage repair pathway, e.g., in chemotherapy induced DNA inter-strand crosslinks.
  • the FA core complex comprises two central dimers of the FANCB and FA-associated protein of 100 kDa (FAAP100) subunits, flanked by two copies of the RING finger subunit, FANCL. These two heterotrimers act as a scaffold to assemble the remaining five subunits, resulting in an extended asymmetric structure. Destabilization of the scaffold would disrupt the entire complex, resulting in a non-functional FA pathway.
  • agents that can inhibit the FA core complex include Bortezomib and curcumin analogs EF24 and 4H-TTD.
  • the sequences to be inserted may be placed under the control of tissue- specific elements, such that the entire inserted DNA is only functional in those cells in which the tissue- specific element is active.
  • a heterologous nucleic acid or gene of interest e.g., a transgene, a regulatory sequence, for example, a sequence for an inhibitory nucleic acid, an siRNA, a miRNA
  • the heterologous nucleic acid is termed insert for the purpose of the description in this document, where the insert is the nucleic acid sequence that will be reverse transcribed and inserted into the genome of the cell by the intended design of the constructs described herein.
  • the heterologous nucleic acid is also termed the cargo, or cargo sequence for the purpose of the description in this document.
  • the cargo can comprise the sequence of the heterologous nucleic acid that that is inserted in the genome.
  • the cell may be a cell mammalian cell.
  • the mammalian cell may be of epithelial, mesothelial or endothelial origin.
  • the cell may be a stem cell.
  • the cell may be a precursor cell.
  • the cell may be a cell that is terminally differentiated.
  • the cell may be a muscle cell, a cardiac cell, an epithelial cell, a hematopoietic cell, a mucous cell, an epidermal cell, a squamous cell, a cartilage cell, a bone cell, or any cell of mammalian origin.
  • the cell is of hematopoietic lineage.
  • he cell is of myeloid lineage, or a phagocytic cell, for example a monocyte, macrophage, a dendritic cell or a myeloid precursor cell.
  • the nucleic acid encoding the transgene is an mRNA.
  • the retrotransposable elements may be derived from a non-LTR retrotransposon.
  • a method of integrating a nucleic acid sequence into a genome of a cell comprising introducing a recombinant mRNA or a vector encoding an mRNA into the cell, wherein the mRNA comprises an insert sequence and wherein the insert sequence is integrated into the genome of the cell.
  • the insert sequence comprises (i) an exogenous sequence, or (ii) a sequence that is a reverse complement of the exogenous sequence; a 5’ UTR sequence and a 3’ UTR sequence downstream of the 5’ UTR sequence; wherein the 5’ UTR sequence or the 3’ UTR sequence comprises a binding site for a human ORF protein.
  • the ORF protein is a human LINE 1 ORF2 protein.
  • the ORF protein is a non-human ORF protein.
  • the ORF protein is a chimeric protein, a recombinant protein or an engineered protein.
  • a method for integrating a nucleic acid sequence into the genome of an immune cell comprising introducing a recombinant mRNA or a vector encoding an mRNA, wherein the mRNA comprises, (a) an insert sequence, wherein the insert sequence comprises (i) an exogenous sequence or (ii) a sequence that is a reverse complement of the exogenous sequence; (b) 5’ UTR sequence and a 3’ UTR sequence downstream of the 5’ UTR sequence, wherein the 5’ UTR sequence or the 3’ UTR sequence comprises an endonuclease binding site and a reverse transcriptase binding site, and wherein the transgene sequence is integrated into the genome of the immune cell.
  • the structural elements that mediate RNA integration or transposition may be encoded in a synthetic construct and are relied upon to deliver a heterologous gene of interest to the cell.
  • the synthetic construct may comprise a nucleic acid encoding the heterologous gene of interest and the structural elements that cause integration or retrotransposition of a heterologous gene of interest into the genome.
  • the structural elements that cause integration or retrotransposition may include a 5’ L1 RNA region, and a 3’-L1 region, the latter comprising a poly A 3’ region for priming.
  • the 5’ L1 RNA region may comprise one or more stem loop regions.
  • the L1- 3’ region may comprise one or more stem loop regions.
  • the 5’- and 3’ L1 regions are constructed as flanking the nucleic acid sequence encoding the heterologous gene of interest (the transgene).
  • the structural elements may include a region from an L1 or an Alu RNA comprising the hairpin loop structure that includes the A-Box and the B-Box elements that are ribosomal binding sites
  • the synthetic nucleic acid may comprise a L1-Ta promoter. [00347] There may be two types of LINE RNA recognition by ORF2p – the stringent and the relaxed.
  • the stringent type RT recognizes its own 3′UTR tail, and in the relaxed type RT does not require any specific recognition except for the poly-A tail. Division into the stringent and the relaxed type came from the observation that some LINE/SINE pairs share the same 3′-end.
  • the experimental studies showed that a 3′UTR stem-loop promotes retrotransposition.
  • the 5’-UTR of the LINE retrotransposition sequences have been shown to contain three conserved stem loop regions.
  • the transgene, or transcript of interest may be flanked by transposable elements from a L1 or an Alu sequence at the 5’ and the 3’ end.
  • the 5’ region of a retrotransposon comprises an Alu sequence.
  • the 3’ region of a retrotransposon comprises an Alu sequence.
  • the 5’ region of a retrotransposon comprises an L1 sequence.
  • the 3’ region of a retrotransposon comprises an L1 sequence.
  • the transgene or transcript of interest is flanked by an SVA transposon sequence.
  • the transcript of interest may comprise an L1 or an Alu sequence, encoding the binding regions for ORF2p and the 3’- poly A priming regions.
  • the heterologous nucleic acid encoding the transgene of interest may be flanked by an L1 or an Alu sequence, encoding the binding regions for ORF1p and the 3’- poly A priming regions.
  • the 3’-region may comprise one or more stem loop structures.
  • the transcript of interest is structured for cis integration or retrotransposition.
  • the transcript of interest is structured for trans integration or retrotransposition.
  • the retrotransposon is a human retrotransposon.
  • the sequence of a human retrotransposon can comprise a sequence encoding an endonuclease and/or a reverse transcriptase.
  • the sequence of a human retrotransposon can encode for two proteins that are translated from a single RNA containing two non-overlapping ORFs.
  • the two ORFs are ORF1 and ORF2.
  • a method for stably integrating a heterologous nucleic acid encoding a transgene into the genome of a cell, such as a myeloid cell comprising introducing to the cell a nucleic acid encoding: the transgene; one or more 5’nucleic acid sequences flanking the region encoding the transgene, comprising a 5’ region of a retrotransposon; and one or more 3’ nucleic acid sequence flanking the region encoding the transgene, comprising a 3’ region of a retrotransposon, wherein the 3’ region of the retrotransposon comprises a genomic DNA priming sequence and a LINE transposase binding sequence, having the respective endonuclease and reverse transcripta
  • a method for integrating a nucleic acid sequence into the genome of a cell comprising introducing a recombinant mRNA or a vector encoding an mRNA, wherein the mRNA comprises an insert sequence, wherein the insert sequence comprises (i) an exogenous sequence or (ii) a sequence that is a reverse complement of the exogenous sequence; (b) a 5’ UTR sequence, a sequence of a human retrotransposon downstream of the 5’ UTR sequence, and a 3’ UTR sequence downstream of the sequence of a human retrotransposon; wherein the 5’ UTR sequence or the 3’ UTR sequence comprises an endonuclease binding site and a reverse transcriptase binding site, and wherein the sequence of a human retrotransposon encodes for two proteins that are translated from a single RNA containing two ORFs, and wherein the insert sequence is integrated into the genome of the cell.
  • the method comprising using a single nucleic acid molecule for delivering and integrating the insert sequence into the genome of a cell.
  • the single nucleic acid molecule may be a plasmid vector.
  • the single nucleic acid may be DNA or an RNA molecule.
  • the single nucleic acid may be an mRNA.
  • the method comprises introducing into a cell one or more polynucleotides comprising the human retrotransposon and a heterologous nucleic acid sequence.
  • the one or more polynucleotides comprises (i) a first nucleic acid molecule encoding an ORF1p; (ii) a second nucleic acid molecule encoding an ORF2p and a sequence encoding a cargo.
  • the first nucleic acid and the second nucleic acid are mRNA.
  • the first nucleic acid and the second nucleic acid are DNA, e.g., encoded in separate plasmid vectors.
  • a self-integrating polynucleotide that comprises a sequence which is inserted into the genome of a cell, and insert is stably integrated into the genome by the self-integrating naked polynucleotide.
  • the polynucleotide is an RNA.
  • the polynucleotide is an mRNA.
  • the polynucleotide is an mRNA that has modifications.
  • the modifications ensure protection against RNases in the intracellular milieu.
  • the modifications include substituted modified nucleotides, e.g., 5-methylcytidine, pseudouridine or 2-thiouridine.
  • a single polynucleotide is used for delivery and genomic integration of the insert (or cargo) nucleic acid.
  • the single polynucleotide is bicistronic.
  • the single polynucleotide is tricistronic.
  • the single polynucleotide is multi-cistronic.
  • a two or more polynucleotide molecules are used for delivery and genomic integration of the insert (or cargo) nucleic acid.
  • a retrotransposable genetic element may be generated, the retrotransposable genetic element comprising (i) a heterologous nucleic acid encoding a transgene or a non-coding sequence to be inserted into the genome of a cell (the insert); (ii) a nucleic sequence encoding one or more retrotransposon ORF- encoding sequences; (iii) one or more UTR regions of the ORF-coding sequences, such that the heterologous nucleic acid encoding a transgene or a non-coding sequence to be inserted is comprised within the UTR sequences; wherein the 3’ region of the retrotransposon ORF- encoding sequences comprises a genomic DNA priming sequence.
  • the retrotransposable genetic element may be introduced into a cell for stably integrating the transgene into the genomic DNA.
  • the retrotransposable genetic element comprises (a) a retrotransposon protein coding sequence, and a 3’ UTR; and (b) a sequence comprising a heterologous nucleic acid that is to be inserted (e.g., integrated) within the genome of a cell.
  • the retrotransposon protein coding sequence, and the 3’ UTR may be a complete and sufficient unit for delivering the heterologous nucleic acid sequence within the genome of the cell, and comprise the retrotransposable elements, such as an endonuclease, a reverse transcriptase, a sequence in the 3’ UTR for binding to and priming the genomic DNA at the region cleaved by the endonuclease to start reverse transcribing and incorporating the heterologous nucleic acid.
  • the coding sequence of the insert is in forward orientation with respect to the coding sequence of the one or more ORFs.
  • the coding sequence of the insert is in reverse orientation with respect to the coding sequence of the one or more ORFs.
  • the coding sequence of the insert and the coding sequence of the one or more ORFs may comprise distinct regulatory elements, including 5’ UTR, 3’ UTR, promoter, enhancer, etc.
  • the 3’ UTR or the 5’-UTR of the insert may comprise the coding sequence of the one or more ORFs, and likewise, the coding sequence of the insert may be situated within in the 3’ UTR of the coding sequence of the one or more ORFs.
  • a retrotransposable genetic element may be generated, the retrotransposable genetic element comprising: (a) an insert sequence, comprising (i) an exogenous sequence, a sequence that is a reverse complement of the exogenous sequence; a 5’ UTR sequence and a 3’ UTR sequence downstream of the 5’ UTR sequence; wherein the 5’ UTR sequence or the 3’ UTR sequence comprises a binding site for a human ORF protein.
  • the retrotransposon may comprise a SINE or LINE element.
  • the retrotransposon comprises a SINE or LINE stem loop structure, such as an Alu element.
  • the retrotransposon is a LINE-1 (L1) retrotransposon.
  • the retrotransposon is human LINE-1.
  • Human LINE-1 sequences are abundant in the human genome. There are approximately 13,224 total human L1s, of which 480 are active, which make up about 3.6%. Therefore, human L1 proteins are well tolerated and non-immunogenic in humans. Moreover, a tight regulation of random transposition in human ensures that random transposase activity will not be triggered by introduction of the L1 system as described herein.
  • the retrotransposable constructs designed herein may comprise targeted and specific incorporation of the insert sequence.
  • the retrotransposable genetic element may comprise designs intended to overcome the silencing machinery actively prevalent in human cells, while being careful that random integration resulting in genomic instability is not initiated.
  • the retrotransposable constructs may comprise a sequence encoding a human LINE-1 ORF1 protein; and a human LINE-1 ORF2 protein.
  • the construct comprises a nucleic acid sequence encoding an ORF1p protein with at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to MGKKQNRKTGNSKTQSASPPPKERSSSPATEQSWMENDFDELREEGFRRSNYSELREDIQTKGK EVENFEKNLEECITRITNTEKCLKELMELKTKARELREECRSLRSRCDQLEERVSAMEDEMNEM KREGKFREKRIKRNEQSLQEIWDYVKRPNLRLIGVPESDVENGTKLENTLQDIIQENFPNLARQA NVQIQEIQRTPQRYSSRRATPRHIIVRF
  • the construct comprises a nucleic acid sequence with at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to atgggcaagaagcaaaatcgcaagacggggaattccaagacacaatccgctagcccaccacctaaagagcgttctagctccccctgctactgagcagtc ctggatggaaaacgacttccgggaagagggatttaggcgatccaactattcagaactccgcgaagatatccagacaaaggggaaggaggaggaagtcgagaatttttttt
  • the construct comprises a nucleic acid sequence encoding an ORF2p protein with at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to MTGSNSHITILTLNINGLNSAIKRHRLASWIKSQDPSVCCIQETHLTCRDTHRLKIKGWRKIYQAN GKQKKAGVAILVSDKTDFKPTKIKRDKEGHYIMVKGSIQQEELTILNIYAPNTGAPRFIKQVLSDL QRDLDSHTLIMGDFNTPLSTLDRSTRQKVNKDTQELNSALHQADLIDIYRTLHPKSTEYTFFSAP HHTYSKIDHIVGSK
  • the construct comprises a nucleic acid sequence with at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to atgaccggctctaactcacatatcaccatccttacacttaacattaacggcctcaactcagctatcaagcgccatcggctggccagctggatcaaatcaca ggatccaagcgtttgtgcatccaagagacccacctgacctgtagagatactcaccgcctcaagatcaagggatggcgaaagatttatcaggcgaacgg taagcagaagaa
  • the construct comprises a nucleic acid sequence encoding an ORF2p protein with at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to MVIGTYISIITLNVNGLNAPTKRHRLAEWIQKQDPYICCLQETHFRPRDTYRLKVRGWKKIFHAN GNQKKAGVAILISDKIDFKIKNVTRDKEGHYIMIQGSIQEEDITIINIYAPNIGAPQYIRQLLTAIKE EIDSNTIIVGDFNTSLTPMDRSSKMKINKETEALNDTIDQIDLIDIYRTFHPKTADYTFFSSAHGTFS RIDHIL
  • the construct comprises a nucleic acid sequence with at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to atggtcataggaacatacatatcgataattaccttaaacgtgaatggattaaatgccccaaccaaaaagacatagactggctgaatggatacaaaaacaag acccatatatatgctgtctacaagagacccacttcagacctagggacacatacagactgaaagtgaggggatggaaaagatattccatgcaaatggaa atcaaaagaaagctggggacag
  • the construct comprises a nucleic acid sequence encoding a nuclear localization sequence with at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to PAAKRVKLD.
  • the nuclear localization sequence is fused to the ORF2p sequence.
  • the construct comprises a nucleic acid sequence encoding a flag tag having the sequence DYKDDDDK.
  • the flag tag is fused to the ORF2p sequence. In some embodiments, the flag tag is fused to the nuclear localization sequence.
  • the construct comprises a nucleic acid sequence encoding an MS2 coat protein with at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to ASNFTQFVLVDNGGTGDVTVAPSNFANGIAEWISSNSRSQAYKVTCSVRQSSAQNRKYTIKVEV PKGAWRSYLNMELTIPIFATNSDCELIVKAMQGLLKDGNPIPSAIAANSGIYAMASNFTQFVLVD NGGTGDVTVAPSNFANGIAEWISSNSRSQAYKVTCSVRQSSAQNRKYTIKVEVPKGAWRSYLN MELTIPIFATNSDCELIVKAMQ
  • the MS2 coat protein sequence is fused to the ORF2p sequence.
  • the transgene may comprise a flanking sequence which comprises an Alu ORF2p recognition sequence.
  • additional elements may be introduced into the mRNA.
  • the additional elements may be an IRES element or a T2A element.
  • the mRNA transcript comprises one, two, three or more stop codons at the 3’-end.
  • the one, two, three or more stop codons are designed to be in tandem.
  • the one, two, three or more stop codons are designed to be in all three reading frames.
  • the one, two, three or more stop codons may be designed to be both in multiple reading frames and in tandem.
  • one or more target specific nucleotides may be added at the priming end of the L1 or the Alu RNA priming region.
  • the 5’ UTR sequence or the 3’ UTR sequence in addition to be able to bind the ORF protein may also be capable of binding to one or more endogenous proteins that regulate gene retrotransposition and/or stable integration.
  • the flanking sequence is capable of binding to a PABP protein.
  • the 5’ region flanking the transcript may comprise a strong promoter.
  • the promoter is a CMV promoter.
  • an additional nucleic encoding L1 ORF2p is introduced into the cell.
  • the sequence encoding L1 ORF1 is omitted, and only L1-ORF2 is included.
  • the nucleic acid encoding the transgene with the flanking elements is mRNA.
  • the endogenous L1-ORF1p function may be suppressed or inhibited.
  • the nucleic acid encoding the transgene with the retrotransposition flanking elements comprise one or more nucleic acid modifications.
  • the nucleic acid encoding the transgene with the retrotransposition flanking elements comprises one or more nucleic acid modifications in the transgene.
  • the modifications comprise codon optimization of the transgene sequence.
  • the codon optimization is for more efficient recognition by the human translational machinery, leading to more efficient expression in a human cell.
  • the one or more nucleic acid modification is performed in the 5’-flanking sequence or the 3’- flanking sequence including one or more stem-loop regions.
  • the nucleic acid encoding the transgene with the retrotransposition flanking elements comprise one, two, three, four, five, six, seven eight, nine, ten or more nucleic acid modifications.
  • the retrotransposed transgene is stably expressed for the life of the cell.
  • the cell is a myeloid cell.
  • the myeloid cell is a monocyte precursor cell.
  • the myeloid cell is an immature monocyte.
  • the monocyte is an undifferentiated monocyte.
  • the myeloid cell is a CD14+ cell. In some embodiments, the myeloid cell does not express CD16 marker.
  • the myeloid cell is capable of remaining functionally active for a desired period of greater than 3 days, greater than 4 days, greater than 5 days, greater than 6 days, greater than 7 days, greater than 8 days, greater than 9 days, greater than 10 days, greater than 11 days, greater than 12 days, greater than 13 days, greater than 14 days or more under suitable conditions.
  • a suitable condition may denote an in vitro condition, or an in vivo condition or a combination of both.
  • the retrotransposed transgene may be stably expressed in the cell for about 2 days, about 3 days, about 4 days, about 5 days, about 6 days, about 7 days, about 8 days, about 9 days or about 10 days.
  • the retrotransposed transgene is stably expressed in the cell for more than 10 days. In some embodiments, the retrotransposed transgene is stably expressed in the cell for more than 2 weeks. In some embodiments, the retrotransposed transgene is stably expressed in the cell for about 1 month. [00378] In some embodiments, the retrotransposed transgene may be modified for stable expression. In some embodiments, the retrotransposed transgene may be modified for resistant to in vivo silencing. [00379] In some embodiments, the expression of the retrotransposed transgene may be controlled by a strong promoter. In some embodiments, the expression of the retrotransposed transgene may be controlled by a moderately strong promoter.
  • the expression of the retrotransposed transgene may be controlled by a strong promoter that can be regulated in an in vivo environment.
  • the promoter is a CMV promoter.
  • the promoter is a L1-Ta promoter.
  • the ORF1p may be overexpressed.
  • the ORF2 may be overexpressed.
  • the ORF1p or ORF2p or both are overexpressed.
  • ORF1p is at least 1.1 fold, 1.5 fold, 2 fold, 3 fold, 4 fold, 5 fold, 6 fold, 7 fold, 8 fold, 9 fold, 10 fold, 12 fold, 14 fold, 16 fold, 18 fold, 20 fold, 30 fold, 40 fold, 50 fold, 60 fold, 70 fold, 80 fold, 90 fold, or at least 100 fold higher than a cell not overexpressing and ORF1.
  • ORF2p upon overexpression of an ORF2 sequence, is at least 1.1 fold, 1.5 fold, 2 fold, 3 fold, 4 fold, 5 fold, 6 fold, 7 fold, 8 fold, 9 fold, 10 fold, 12 fold, 14 fold, 16 fold, 18 fold, 20 fold, 30 fold, 40 fold, 50 fold, 60 fold, 70 fold, 80 fold, 90 fold, or at least 100 fold higher than a cell not overexpressing and ORF2p.
  • Retrotransposition fidelity and target specificity [00382]
  • the LINE-1 elements can bind to their own mRNA poly A tail to initiate retrotransposition.
  • LINE-1 elements preferably retrotranspose their own mRNA over random mRNAs (Dewannieux et al., 2013, 3,000-fold higher LINE-1 retrotransposition as compared to random mRNAs).
  • LINE-1 elements can also integrate non-specific poly-A sequences within a genome.
  • retrotransposition compositions and methods of using the same with increased retrotransposition specificity may be used for highly specific and efficient reverse transcription and subsequently, integration into genome of a target cell, e.g., a myeloid cell.
  • a retrotransposition composition provided herein comprises a retrotransposition cassette that comprises one or more additional components that increases integration or retrotransposing specificity.
  • the retrotransposon cassette may encode one or more additional elements that allows for high affinity RNA-protein interaction to out compete non-specific binding between poly-A sequences and ORF2.
  • Another exemplary measure for enhancing integration or retrotransposition efficiency is external manipulation of the cells.
  • the endonuclease function of the retrotransposition machinery delivered in a cell may likely be subject to inhibition by the cell’s transposition silencing machinery, such as DNA repair pathways.
  • small molecules can be used to modulate or inhibit DNA repair pathways in the cells prior to introducing the nucleic acid.
  • cell sorting and/or synchronization can be used prior to introducing the nucleic acid, such as by electroporation, as cell cycle synchronized cell populations were shown to increase gene transfer to the cells.
  • Cell sorting may be utilized to synchronize or homogenize the cell types and increase uniform transfer and expression of the exogenous nucleic acid. Uniformity may be achieved sorting stem cells from non-stem cells.
  • Another exemplary measure for enhancing integration or retrotransposition efficiency is to enhance biochemical activity. For example, this may be achieved by increasing reverse-transcriptase processivity or DNA cleavage (endonuclease) activity.
  • Another exemplary measure for enhancing integration or retrotransposition efficiency is to subvert endogenous silencing mechanisms. For example, this may be achieved by replacing entire LINE-1 sequence with a different organisms’ LINE-1.
  • Another exemplary measure for enhancing integration or retrotransposition efficiency is to enhance translation and ribosome binding. For example, this may be achieved by increasing expression of LINE-1 proteins, increasing LINE protein binding LINE-1 mRNA, or increasing LINE-1 complex binding to ribosomes.
  • Another exemplary measure for enhancing integration or retrotransposition efficiency is to increase nuclear import or retention. For example, this may be achieved by fusing the LINE- 1 sequence to a nuclear retention signal sequence.
  • Another exemplary measure for enhancing integration or retrotransposition efficiency is to enhance sequence-specific insertion.
  • the method encompasses enhancing the retrotransposon for increasing specificity and robustness of expression of the cargo by modifying the UTR sequence of the LINE-1 ORFs.
  • the 5’UTR upstream of ORF1 or ORF2 encoding sequence may be further modified to comprise a sequence that is complementary to the sequence of a target region within the genome that helps in homologous recombination at the specific site where the ORF nuclease can act and the retrotransposition can take place.
  • the sequence that can bind to a target sequence by homology is between 2-15 nucleotides long.
  • the sequence having homology to a genomic target that is included in the 5’UTR of an ORF1 mRNA may be about 3 nucleotides, about 4 nucleotides, about 5 nucleotides, about 6 nucleotides, about 7 nucleotides, about 8 nucleotides, about 9 nucleotides or about 10 nucleotides long. In some embodiments, the sequence having homology to a genomic target is about 12 or about 15 nucleotides long.
  • the sequence having homology to a genomic target is at least about 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105, 110, 115, 1120 or 125 nucleotides in length.
  • the sequence having homology to a genomic target comprises about 2-5, about 2-6, about 2-8 or about 2-10, or about 2-12 contiguous nucleotides that share complementarity with the respective target region within the genome.
  • the sequence having homology to a genomic target is at least about or about 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105, 110, 115, 1120 or 125 contiguous nucleotides that share complementarity with the respective target region within the genome.
  • an ORF2 is associated with or fused to an additional protein domain that comprises RNA binding activity.
  • the retrotransposon cassette comprises a cognate RNA sequence that comprises affinity with the additional protein domain associated with or fused to the ORF2.
  • the ORF2 is associated with or fused to a MS2-MCP coat protein.
  • the retrotransposon cassette further comprises a MS2 hairpin RNA sequence in the 3’ or 5’ UTR sequence that interacts with the MS2-MCP coat protein.
  • the ORF2 is associated with or fused to a PP7 coat protein.
  • the retrotransposon cassette further comprises a PP7 hairpin RNA sequence in the 3’ or 5’ UTR sequence that interacts with the MS2-MCP coat protein.
  • the one or more additional elements increases retrotransposition specificity by at least 1.5 fold, at least 2 fold, at least 3 fold, at least 4 fold, at least 5 fold, at least 10 fold, at least 20 fold, at least 30 fold, at least 50 fold, at least 100 fold, at least 200 fold, at least 300 fold, at least 500 fold, at least 1000 fold, at least 1500 fold, at least 2000 fold, at least 3000 fold, at least 5000 fold or more as compared to a retrotransposon cassette without the one or more additional elements.
  • the DNA endonuclease domain appears to have specificity for a series of purines 3’ of the target site followed by a series of pyrimidines (Py) n ⁇ (Pu) n .
  • An exemplary sequence may be (Adenosine) n ⁇ (Thymidine) n .
  • a CRISPR-Cas guide RNA system is combined with the LINE- retrotransposon system used here to increase the precision of site directed retrotransposition.
  • the system incorporates a prime editing guide RNA (pegRNA) to incorporate one or more ORF-binding sequence into a specific genomic locus.
  • the pegRNA incorporates the sequence that binds human ORF, e.g. TTTTTA in a site-specific manner.
  • the CRISPR-Cas system comprises a Cas9 enzyme. In some embodiments the CRISPR-Cas comprises a Cfp1 enzyme. In some embodiments, the Cas9 is a dCas9, paired with a nickase system. [00390] Consequently, provided herein is a method and compositions for stable incorporation of a transgene into the genome of a myeloid cell, such as a monocyte or macrophage, wherein the method comprises incorporating the transgene using a non-LTR retrotransposon system, wherein the retrotransposition occurs at a specific genomic locus with a target specificity, high precision and fidelity.
  • the method comprises administration to the cell a composition comprising a system having at least one transgene, flanked with one or more retrotransposable elements, and one or more nucleic acids encoding one or more proteins for increasing the transposition specificity, and/or further comprising modifying one or more genes associated with the retrotransposition.
  • the nucleic acid comprising the transgene, situated in 3’ UTR region of the retrotransposable elements is often referred to as a retrotransposition cassette.
  • the retrotransposition cassette comprises the nucleic acid encoding the transgene and flanking Alu transposable elements.
  • the retrotransposable elements comprise a sequence for binding the retrotransposons, for example, L1-transposons, such as L1-ORF proteins, ORF1p and ORF2p.
  • ORF proteins are known to bind to their own mRNA sequence for retrotransposition. Therefore, the retrotransposition cassette comprises the nucleic acid encoding the transgene; a flanking L1-ORF2p binding sequence, and/or a L1-ORF1p binding sequence, comprising a sequence encoding a L1-ORF1p encoding sequence and a L1-ORF2p encoding sequence outside the transgene sequence.
  • the L1-ORF1 and L1-ORF2 are interspersed by a spacer region, also termed as an ORF1- ORF2 inter-region.
  • the L1-ORF1 and L1-ORF2 coding sequences are in an opposite orientation with respect to the coding region of the transgene.
  • the retrotransposition cassette can comprise a poly A region downstream of the L1- ORF2-coding sequence and the transgene sequence is placed downstream of the poly A sequence.
  • the L1- ORF2 comprises a nucleic acid sequence that encodes an endonuclease (EN) and a reverse transcriptase (RT) followed by the poly A sequence.
  • the L1-ORF2 sequence in the retrotransposition cassette described herein is a complete (intact) sequence, that is, encodes the full length native (WT) L1-ORF2 sequence.
  • the L1-ORF2 sequence in the retrotransposition cassette described herein comprises a partial or modified sequence.
  • the system described herein can comprise a promoter for expressing the L1-ORF1p and L1- ORF2p.
  • the transgene expression is driven by a separate promoter.
  • the transgene and the ORFs are in tandem orientation. In some embodiments, the transgene and the ORFs are in opposite orientation.
  • the method comprises incorporating one or more elements in addition to the retrotransposon cassette.
  • the one or more additional elements comprise a nucleic acid sequence encoding one or more domains of a heterologous protein.
  • the heterologous protein may be a sequence specific nucleic acid binding protein, for example, a sequence specific DNA binding protein domain (DBD).
  • the heterologous protein is a nuclease or a fragment thereof.
  • the additional elements comprise a nucleic acid sequence encoding one or more nuclease domains or fragments thereof from a heterologous protein.
  • the heterologous nuclease domain has reduced nuclease activity.
  • the heterologous nuclease domain is rendered inactive.
  • the ORF2 nuclease is rendered inactive; whereas one or more nuclease domains from the heterologous protein is configured to render specificity to the retrotransposition.
  • one or more nuclease domains or fragments thereof from the heterologous protein targets a specific desired polynucleotide within the genome where retrotransposition and incorporation of the polynucleotide of interest is to be incorporated.
  • the one or more nuclease domains from the heterologous protein comprise a mega-TAL nuclease domain, TALENs, or a zinc finger nuclease domain, for example, a mega-TAL, a TALE, or a zinc finger domain fused to or associated with a nuclease domain, e.g., a FokI nuclease domain.
  • the one or more nuclease domains from the heterologous protein comprise a CRISPR-Cas protein domain loaded with a specific guide nucleic acid, e.g., a guide RNA (gRNA) for a specific target locus.
  • gRNA guide RNA
  • the CRISPR-Cas protein is a Cas9, a Cas12a, a Cas12b, a Cas13, a CasX, or a CasY protein domain.
  • the one or more nuclease domains from the heterologous protein has target specificity.
  • the additional nuclease domain may be incorporated into the ORF2 domain.
  • the additional nuclease may be fused with the ORF2p domain.
  • the additional nuclease domain may be fused to an ORF2p, wherein the ORF2p includes a mutation in the ORF2p endonuclease domain.
  • the mutation inactivates the ORF2p endonuclease domain.
  • the mutation is a point mutation.
  • the mutation is a deletion.
  • the mutation is an insertion.
  • the mutation abrogates the ORF2 endonuclease (nickase) activity.
  • a mutation inactivates the DNA target recognition of ORF2p endonuclease.
  • the mutation covers a region associated with ORF2p nuclease-DNA recognition.
  • a mutation reduces the DNA target recognition of ORF2p endonuclease.
  • the ORF2p endonuclease domain mutation is in the N-terminal region of the protein. In some embodiments, the ORF2p endonuclease domain mutation is in a conserved region of the protein. In some embodiments, the ORF2p endonuclease domain mutation is in the conserved N-terminal region of the protein. In some embodiments, the mutation comprises the N14 amino acid within L1 endonuclease domain. In some embodiments, the mutation comprises 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more consecutive amino acids including the N14 amino acid within L1 endonuclease domain.
  • the mutation comprises the comprises the E43 amino acid within L1 endonuclease. In some embodiments, the mutation comprises 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more consecutive amino acids including the E43 amino acid within L1 endonuclease domain. In some embodiments, the mutation comprises 2 or more amino acids in the L1 endonuclease domain including N14, or E43 or a combination thereof. In some embodiments, the mutation comprises D145 of the L1 endonuclease domain. In some embodiments, the mutation may be D145A. In some embodiments, the may be a comprise D205 of the L1 endonuclease domain. In some embodiments, the mutation may be D205G.
  • the mutation may comprise H230 of L1 endonuclease domain. In some embodiments, the may be a comprise S228 of the L1 endonuclease domain. In some embodiments, the mutation may be S228P. [00395] In some embodiments, a mutation reduces the DNA target recognition of ORF2p endonuclease by at least 50%. In some embodiments, a mutation reduces the DNA target recognition of ORF2p endonuclease by at least 60%. In some embodiments, a mutation reduces the DNA target recognition of ORF2p endonuclease by at least 70%. In some embodiments, a mutation reduces the DNA target recognition of ORF2p endonuclease 80%.
  • a mutation reduces the DNA target recognition of ORF2p endonuclease 90%. In some embodiments, a mutation reduces the DNA target recognition of ORF2p by 95%. In some embodiments, a mutation reduces the DNA target recognition of ORF2p by 100%. [00396] In some embodiments, the mutation is a deletion. In some embodiments, the deletion is complete, i.e., 100% of the L1 endonuclease domain is deleted. In some embodiments, the deletion is partial.
  • the about 98%, about 95%, about 94%, about 93%, about 92% about 91%, about 90%, about 85%, about 80%, about 75%, about 70%, about 65%, about 60%, or about 50% of the ORF2 endonuclease domain is deleted.
  • an additional nuclease domain is inserted into the ORF2 protein sequence.
  • ORF2 endonuclease domain is deleted, and is replaced with an endonuclease domain from a heterologous protein.
  • the ORF2 endonuclease is partially deleted and replaced with an endonuclease domain from a heterologous protein.
  • the endonuclease domain from a heterologous protein may be a mega-TAL nuclease domain.
  • the endonuclease domain from a heterologous protein may be a TALENs.
  • the endonuclease domain from a heterologous protein may be a Cas9 loaded with a specific gRNA for a locus.
  • the endonuclease is an endonuclease that has (i) a specific target on the genome and (ii) it creates a 5’-P and a 3’-OH terminus at the cleavage site.
  • the additional endonuclease domain from a heterologous protein is an endonuclease domain from a related retrotransposon.
  • the endonuclease domain from a heterologous protein may comprise a bacterial endonuclease engineered for targeting a specific site.
  • the endonuclease domain from a heterologous protein may comprise a domain of a homing endonuclease or a fragment thereof.
  • the endonuclease is a homing endonuclease.
  • the homing endonuclease is an engineered LAGLIDADG homing endonucleases (LHEs) or a fragment thereof.
  • additional endonucleases may be a restriction endonuclease, Cre, Cas TAL or fragments thereof.
  • the endonuclease may comprise a Group II intron encoded protein (ribozyme) or a fragment thereof.
  • the engineered L1-ORF2p can generate much reduced off-target effects when expressed in a cell than using a native, non- engineered L1-ORF2p. In some embodiments, the engineered L1-ORF2p generates no off-target effect. [00402] In some embodiments, the engineered or modified L1-ORF2p targets a recognition site that is other than the usual (Py)n ⁇ (Pu)n site. In some embodiments, engineered L1-ORF2p targets a recognition site that comprises the (Py)n ⁇ (Pu)n site, for example, TTTT/AA site, such as a hybrid target site.
  • the engineered L1-ORF2p targets a recognition site having at least one nucleotide in addition to the conventional L1-ORF2 (Py)n ⁇ (Pu)n site, for example TTTT/AAG, or TTTT/AAC, or TTTT/AAT, TTTT/AAA, GTTTT/AA, CTTTT/AA, ATTTT/AA, or TTTTT/AA.
  • the engineered L1-ORF2p targets a recognition site that is in addition to the conventional L1-ORF2p (Py)n ⁇ (Pu)n site.
  • the engineered L1-ORF2p targets a recognition site that is other than to the conventional L1-ORF2p (Py)n ⁇ (Pu)n site. In some embodiments, the engineered L1-ORF2p targets a recognition site that is 4, 5, 6, 7, 8, 9, 10 or more nucleotides long. In some embodiments, the engineered or modified L1-ORF2p recognition site may be 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more nucleotides. [00403] The engineered L1-ORF2p can be engineered to retain its ability to bind to its own mRNA after translation and reverse transcribe with high efficiency.
  • the engineered L1-ORF2p has enhanced efficiency of reverse transcription compared to a native (WT) L1-ORF2p.
  • the system comprising a retrotransposable element further comprises a gene modification that reduces non-specific retrotransposition.
  • the gene modification may comprise a sequence encoding the L1-ORF2p.
  • the modification may comprise mutation of one or more amino acids that are essential for binding to a protein that helps ORF2p binding to the target genomic DNA.
  • a protein that helps ORF2p binding to the target genomic DNA may be part of the chromatin-ORF interactome.
  • the modification may comprise one or more amino acids that are essential for binding to a protein that helps ORF2p DNA endonuclease activity. In some embodiments, the modification may comprise one or more amino acids that are essential for binding to a protein that helps ORF2p RT activity. In some embodiments, the modification may comprise at a protein binding site on ORF2p such that the association of a protein with ORF2p is altered, wherein binding of the protein to ORF2p is required for binding to chromatin. In some embodiments, the modification may comprise at a protein binding site on ORF2p such that the association of the protein with ORF2p is more stringent and/or specific than in absence of the modification.
  • the binding of ORF2p to the target DNA has increased specificity.
  • the modification may reduce binding of ORF2 to one or more proteins that are part of the ORF2p chromatin interactome.
  • the gene modification may be in the PIP domain of ORF2p.
  • the gene modification may be in one or more genes encoding a protein that binds to an ORF2p and helps in the recognition, binding, endonuclease or RT activity of ORF2p.
  • the gene modification may be in one or more genes encoding PCNA, PARP1, PABP, MCM, TOP1, RPA, PURA, PURB, RUVBL2, NAP1, ZCCHC3, UPF1 or MOV10 proteins at an ORF2p interacting site for each protein or at a site that affects the protein’s interaction with ORF2p or the interaction of ORF2p with target DNA.
  • the modification may be on an ORF2p binding domain of PCNA at an ORF2p interacting site or at a site that affects the protein’s interaction with ORF2p or the interaction of ORF2p with target DNA.
  • the modification may be on an ORF2p binding domain of TOP1.
  • the modification may be on an ORF2p binding domain of RPA. In some embodiments, the modification may be on an ORF2p binding domain of PARP1 at an ORF2p interacting site or at a site that affects the protein’s interaction with ORF2p or the interaction of ORF2p with target DNA. In some embodiments, the modification may be on an ORF2p binding domain of PABP (e.g., PABPC1) at an ORF2p interacting site or at a site that affects the protein’s interaction with ORF2p or the interaction of ORF2p with target DNA. In some embodiments, the gene modification may be on an MCM gene.
  • PABP e.g., PABPC1
  • the gene modification may be on a gene encoding MCM3 protein at an ORF2p interacting site or at a site that affects the protein’s interaction with ORF2p or the interaction of ORF2p with target DNA. In some embodiments, the gene modification may be on a gene encoding MCM5 protein at an ORF2p interacting site or at a site that affects the protein’s interaction with ORF2p or the interaction of ORF2p with target DNA. In some embodiments, the gene modification may be on a gene encoding MCM6 protein at an ORF2p interacting site or at a site that affects the protein’s interaction with ORF2p or the interaction of ORF2p with target DNA.
  • the gene modification may be on a gene encoding MEPCE protein at an ORF2p interacting site or at a site that affects the protein’s interaction with ORF2p or the interaction of ORF2p with target DNA. In some embodiments, the gene modification may be on a gene encoding on a gene encoding RUVBL1 or RUVBL2 protein at an ORF2p interacting site or at a site that affects the protein’s interaction with ORF2p or the interaction of ORF2p with target DNA.
  • the gene modification may be on a gene encoding on a gene encoding TROVE protein at an ORF2p interacting site or at a site that affects the protein’s interaction with ORF2p or the interaction of ORF2p with target DNA.
  • the retrotransposition system disclosed herein comprises one or more elements that increase the fidelity of reverse transcription.
  • the L1-ORF2 RT domain is modified.
  • the modification includes one or more of: increasing fidelity, increasing processivity, increasing DNA-RNA substrate affinity; or inactivating RNase H activity.
  • the modification comprises introducing one or more mutations in the RT domain of the L1-ORF2, such that the fidelity of the RT is increased.
  • the mutation comprises a point mutation.
  • the mutation comprises alteration, such as substitution of one, two three, four, five, six or more amino acids in the L1-ORF2p RT domain.
  • the mutation comprises deletion of one or more amino acids, for example, one, two, three, four, five, six, seven, eight, nine, ten or more amino acids in the L1-ORF2p RT domain.
  • the mutation may comprise an in-del mutation.
  • the mutation may comprise a frame- shift mutation.
  • the modification may comprise inclusion of an additional RT domain or fragment thereof from a second protein.
  • the second protein is a viral reverse transcriptase.
  • the second protein is a non-viral reverse transcriptase.
  • the second protein is a retrotransposable element.
  • the second protein is a non-LTR retrotransposable element.
  • the second protein is a group II intron protein.
  • the group II intron is as TGIRTII.
  • the second protein is a Cas nickase, wherein the retrotransposable system further comprises introducing a guide RNA.
  • the second protein is a Cas9 endonuclease, wherein the retrotransposable system further comprises introducing a guide RNA.
  • the second protein or fragment thereof is fused to the N-terminus of the L1-ORF2 RT domain or the modified L1-ORF2 RT domain.
  • the second protein or fragment thereof is fused to the C-terminus of the L1-ORF2 RT domain or the modified L1-ORF2 RT domain.
  • the additional RT domain or fragment thereof from the second protein is incorporated in the retrotransposition system in addition to the full-length WT L1-ORF2p RT domain.
  • the additional RT domain or fragment thereof from the second protein is incorporated in presence of a modified (engineered) L1-ORF2p RT domain or a fragment thereof, where the modification (or engineering) may comprise a mutation for enhancement of the L1-ORF2p RT processivity, stability and/or fidelity of the modified L1-ORF2p RT compared to the native or WT ORF2p.
  • the reverse transcriptase domain could be replaced with other more highly processive and high-fidelity RT domains from other retroelements or group II introns, such as TGIRTII.
  • the modification may comprise a fusion with an additional RT domain or fragment thereof from a second protein.
  • the second protein may comprise a retroelement.
  • the additional RT domain or fragment thereof from a second protein is configured to increase the fidelity of reverse transcription of the fused L1-ORF2p RT domain.
  • the nucleic acid encoding the additional RT domain or fragment thereof is fused to a native or WT L1-ORF2 encoding sequence.
  • the nucleic acid encoding the additional RT domain or fragment thereof from a second protein is fused to a modified L1-ORF2 encoding sequence.
  • the modification comprises introducing one or more mutations in the RT domain of the L1-ORF2 or fragment thereof, such that the fidelity of the fused RT is increased.
  • the mutation in the RT domain of the L1-ORF2 or fragment thereof comprises a point mutation.
  • the mutation comprises alteration, such as substitution of one, two three, four, five, six or more amino acids in the L1-ORF2p RT domain.
  • the mutation comprises deletion of one or more amino acids, for example, one, two, three, four, five, six, seven, eight, nine, ten or more amino acids in the L1- ORF2p RT domain.
  • the mutation may comprise an in-del mutation.
  • the mutation may comprise a frame-shift mutation.
  • the modified L1-ORF2p RT domain has increased processivity than the WT L1- ORF2p RT domain.
  • the modified L1-ORF2p RT domain has at least 10% higher processivity and/or fidelity over the WT L1- ORF2p RT domain.
  • the modified L1-ORF2p RT domain has at least 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 110%, 120%, 150%, 200%, 300%, 400%, 500%, 1000% or higher processivity and/or fidelity over the WT L1- ORF2p RT domain.
  • the modified RT can process greater than 6kb nucleic acid stretch. In some embodiments, the modified RT can process greater than 7kb nucleic acid stretch. In some embodiments, the modified RT can process greater than 8kb nucleic acid stretch. In some embodiments, the modified RT can process greater than 9kb nucleic acid stretch. In some embodiments, the modified RT can process greater than 10kb nucleic acid stretch.
  • Group II introns and ribozymes [00416] Group II enzymes are mobile ribozymes that self-splice precursor RNAs, yielding excised intron lariat RNAs. The introns encode a reverse transcriptase.
  • the reverse transcriptase may stabilize the RNA for forward and reverse splicing, and later in converting the integrated intron RNA to DNA.
  • Group II RNAs are characterized by a conserved secondary structure spanning 400-800 nucleotides.
  • the secondary structure is formed by six domains DI-VI, and is organized in a structure resembling a wheel, where the domains radiate from a central point.
  • the domains interact to form a conserved tertiary structure that brings together distant sequences to form an active site.
  • the active site binds the splice sites and branch point residue nucleotide and in association of Mg2+ cations, activate catalysis of splicing.
  • the DV domain is within the active site, which has the conserved catalytic AGC and an AY bulge and both these regions bind Mg2+ ions necessary for the catalysis.
  • DI is the largest domain with upper and lower halves separated by kappa and zeta motifs.
  • the lower half contains the ⁇ ’ motif, which is associated with an active site.
  • the upper half contains sequence elements that bind to the 5’ and 3’ exons at the active sites.
  • DIV encodes the intron-encoded protein (IEP) with subdomain IVa near the 5’- end containing the high affinity binding site for IEP.
  • Group II introns have conserved 5’- and 3’- end sequences, GUGYG and AY respectively.
  • Group II RNA introns can be utilized to retrotranspose a sequence of interest into DNA via target primed reverse transcription. This process of transposition by Group II RNA introns is often referred to as retrohoming. Group II introns recognize DNA target sites by base pairing of the intron RNA to the DNA target sequence, they can be modified to retarget a specific sequence carried within the intron to a desired DNA site. [00419] In some embodiments, the method and compositions for retrotransposition described herein may comprise a Group II intron sequence, a modified Group II intron sequence or a fragment thereof. Exemplary Group II IEPs (maturase) include but are not limited to bacterial, fungal, yeast IEPs, that are functional in human cells.
  • the nucleic acid construct comprises an RNA.
  • the nucleic acid construct is an RNA.
  • the nucleic acid construct is an mRNA.
  • the mRNA comprises a sequence of a heterologous gene or portion thereof, wherein the heterologous gene or portion thereof encodes a polypeptide or protein.
  • the mRNA comprises a sequence encoding a fusion protein. In some embodiments, the mRNA comprises a sequence encoding a recombinant protein. In some embodiments, the mRNA comprises a sequence encoding a synthetic protein. In some embodiments, the nucleic acid comprises one or more sequences, wherein the one or more sequences encode on or more heterologous proteins, one or more recombinant proteins, or one or more synthetic proteins or a combination thereof. In some embodiments, the nucleic acid comprises one or more sequences, wherein the one or more sequences encode on or more heterologous proteins comprising a synthetic protein or a recombinant protein.
  • the synthetic or recombinant protein is a recombinant fusion protein.
  • C. Retrotransposon systems comprising an site directed editing and/or integrase [00421]
  • a CRISPR-Cas guide RNA system is combined with the LINE-retrotransposon system used here to increase the precision of site directed retrotransposition; for example, the system incorporates a prime editing guide RNA (pegRNA) to incorporate one or more ORF-binding sequence into a specific genomic locus.
  • pegRNA prime editing guide RNA
  • the pegRNA incorporates the sequence that binds human ORF, e.g. TTTTTA in a site- specific manner.
  • the CRISPR-Cas system comprises a Cas9 enzyme.
  • the CRISPR-Cas comprises a Cfp1 enzyme.
  • the Cas9 is a dCas9, paired with a nickase system.
  • the retrotransposon systems described herein comprise (i) a LINE1 retrotransposon element, and (ii) an integrase system or parts thereof. Some integrase systems are capable of site-specific integration – of double stranded DNA.
  • a recombinant hybrid system wherein the integrase or a fragment thereof incorporated within a recombinant ORF protein, or delivered separately as a separate nucleic acid (e.g. mRNA) encoding an integrase or fragment thereof that recognizes a specific genomic site; and couples with the LINE 1 reverse transcription and insertion of a cargo sequence within the genome of a cell or an organism at the precise location led by the specificity of the integrase. This could be achieved in a few alternative ways.
  • mRNA nucleic acid
  • the cargo sequence comprises an attachment site that is recognized and utilized by the integrase to draw the cargo to the landing site within the genome, also recognized by the same integrase.
  • the integrase is capable of a single strand cut.
  • the integrase DNA recognition site i.e., the genomic landing sequence, can be 10 nucleotides long, e.g., 12, 14, 16, 18, 20, 22, 24, 26, 28, 30 or more nucleotides long, thereby conferring greater specificity than any other system.
  • the integrase may be truncated or otherwise mutated to allow the ORF to reverse transcribe and integrate the cargo sequence at the integrase specified genomic site.
  • the ORF protein may also be mutated at the RNA recognition site to allow the integrase recognize the genomic integration sequence preferentially recognized by the integrase (also termed the “genomic landing sequence or site”.
  • the integrase is encoded by a separate polynucleotide, and may be driven by a CRISPR Cas system and a guide RNA to a site that can be nicked and an integrase landing sequence further comprising an ORF binding site comprising the 4 nucleotides may be introduced, thereafter the integrase draws in the cargo sequence that comprises the attachment sequence to the landing sequence, followed by the LINE1 activity leading to genomic integration at the site specified by the integrase system.
  • the nucleic acid construct is developed for expressing in a eukaryotic cell. In some embodiments, the nucleic acid construct is developed for expressing in a human cell. In some embodiments, the nucleic acid construct is developed for expressing in a hematopoietic cell. In some embodiments, the nucleic acid construct is developed for expressing in a myeloid cell. In some embodiments, the myeloid cell is a human cell. II.
  • nucleic acid constructs for methods of enhancement of expression of encoded protein
  • the recombinant nucleic acid is modified for enhanced expression of the protein encoded by a sequence of the nucleic acid.
  • Enhanced expression of the protein encoded therein can be a function of the nucleic acid stability, translation efficiency and the stability of the translated protein.
  • a number of modifications are contemplated herein for incorporation in the design of the nucleic acid construct that can confer nucleic acid stability, such as stability of the messenger RNA encoding the exogenous or heterologous protein, which may be a synthetic recombinant protein or a fragment thereof.
  • the nucleic acid is mRNA, comprising one or more sequences, wherein the one or more sequences encode one or more heterologous proteins comprising a synthetic or a recombinant fusion protein.
  • one or more modifications are made in the mRNA comprising a sequence encoding a recombinant or fusion protein to increase the mRNA half-life.
  • a proper 5’- cap structure is important in the synthesis of functional messenger RNA.
  • the 5’- cap comprises a guanosine triphosphate arranged as GpppG at the 5’terminus of the nucleic acid.
  • the mRNA comprises a 5’ 7-methylguanosine cap, m7-GpppG.
  • a 5’ 7-methylguanosine cap increases mRNA translational efficiency and prevents degradation of mRNA 5’- 3’exonucleases.
  • the mRNA comprises "anti-reverse" cap analog (ARCA, m 7,3'- O GpppG). Translational efficiency, however, can be markedly increased by usage of the ARCA.
  • the guanosine cap is a Cap 0 structure.
  • the guanosine cap is a Cap 1 structure.
  • the mRNA cap In addition to its essential role of cap-dependent initiation of protein synthesis, the mRNA cap also functions as a protective group from 5′ to 3′ exonuclease cleavage and a unique identifier for recruiting protein factors for pre-mRNA splicing, polyadenylation and nuclear export. It acts as the anchor for the recruitment of initiation factors that initiate protein synthesis and the 5′ to 3′ looping of mRNA during translation.
  • RNA triphosphatase RNA triphosphatase
  • GTase RNA guanylyltransferase
  • guanine-N7 methyltransferase guanine-N7 MTase
  • Each of these enzyme activities carries out an essential step in the conversion of the 5′ triphosphate of nascent RNA to the Cap 0 structure.
  • RNA TPase removes the ⁇ -phosphate from the 5′ triphosphate to generate 5′ diphosphate RNA.
  • GTase transfers a GMP group from GTP to the 5′ diphosphate via a lysine- GMP covalent intermediate.
  • the guanine-N7 MTase then adds a methyl group to the N7 amine of the guanine cap to form the cap 0 structure.
  • m7G-specific 2′O methyltransferase (2′O MTase) methylates the +1 ribonucleotide at the 2′O position of the ribose to generate the cap 1 structure.
  • the nuclear RNA capping enzyme interacts with the polymerase subunit of RNA polymerase II complex at phosphorylated Ser5 of the C-terminal heptad repeats.
  • RNA guanine-N7 methyltransferase also interacts with the RNA polymerase II phosphorylated heptad repeats.
  • the cap is a G- quadruplex cap.
  • the mRNA is synthesized by in vitro transcription (IVT).
  • IVT in vitro transcription
  • mRNA synthesis and capping may be performed in one step. Capping may occur in the same reaction mixture as IVT.
  • mRNA synthesis and capping may be performed in separate steps. mRNA thus formed by IVT is purified and then capped.
  • the nucleic acid construct e.g., the mRNA construct
  • comprises one or more sequences encoding a protein or a polypeptide of interest can be designed to comprise elements that protect, prevent, inhibit or reduce degradation of the mRNA by endogenous 5’-3’ exoribonucleases, for example, Xrn1.
  • Xrn1 is a cellular enzyme in the normal RNA decay pathways that degrades 5′ monophosphorylated RNAs.
  • some viral RNA structural elements are found to be particularly resistant to such RNases, for example, the Xrn1-resistant structure in flavivirus sfRNAs, called the ‘xrRNA’.
  • the mosquito-borne flaviviruses (MBFV) genomes contain discrete RNA structures in their 3′-untranslated region (UTR) that block the progression of Xrn1. These RNA elements are sufficient to block Xrn1 without the use of accessory proteins.
  • xrRNAs halt the enzyme at a defined location such that the viral RNA located downstream of the xrRNAs is protected from degradation.
  • the xrRNAs from Zika virus or Murray Valley encephalitis virus for example, comprise three-way junction and multiple pseudoknot interactions that create an unusual and complex fold that requires a set of nucleotides conserved across the MBFVs structure.
  • the xrRNAs halt the enzyme at a defined location such that the viral RNA located downstream of the xrRNAs is protected from degradation.
  • the 5’-end of the RNA passes through a ring-like structure of the fold and is believed to remain protected from the Xrn1-like exonuclease.
  • the nucleic acid construct comprising the one or more sequences that encode a protein of interest may comprise one or more xrRNA structures incorporated therein.
  • the xrRNA is a stretch of nucleotides having the conserved regions of the 3’ UTR of one or more viral xrRNA sequences.
  • 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more xrRNA elements are incorporated within the nucleic acid construct. In some embodiments, 2 or more xrRNA elements are incorporated in tandem within the nucleic acid construct. In some embodiments, the xrRNA comprise one or more regions comprising conserved sequences or fragments thereof or modifications thereof. In some embodiments, the xrRNA is placed at the 3’UTR of a retrotransposon element. In some embodiments, the xrRNA is placed at upstream of the sequences encoding the one or more proteins or polypeptides.
  • the xrRNA is placed in the 3’UTR of a retrotransposon element, such as an ORF2 sequence, and upstream of the sequences encoding the one or more proteins or polypeptides.
  • the xrRNA structure comprises a MBFV xrRNA sequence, or a sequence that is at least 90% identical thereof.
  • the xrRNA structure comprises a tick-borne flaviviruses (TBFVs) xrRNA sequence, or a sequence that is at least 90% identical thereof.
  • the xrRNA structure comprises a tick-borne flaviviruses (TBFVs) xrRNA sequence, or a sequence that is at least 90% identical thereof.
  • the xrRNA structure comprises a tick-borne flaviviruses (TBFVs) xrRNA sequence, or a sequence that is at least 90% identical thereof.
  • TVFVs tick-borne flaviviruses
  • the xrRNA structure comprises a xrRNA sequence from a member of no known arthropod vector flaviviruses (NKVFVs), or a sequence that is at least 90% identical thereof.
  • the xrRNA structure comprises a xrRNA sequence from a member of insect-specific flaviviruses (ISFVs), or a sequence that is at least 90% identical thereof.
  • the xrRNA structure comprises a Zikavirus xrRNA sequence, or a sequence that is at least 90% identical thereof.
  • a pseudoknot is a RNA structure that is minimally composed of two helical segments connected by single-stranded regions or loops. Although several distinct folding topologies of pseudoknots exist.
  • Poly A tail modifications [00434] The poly A structure in the 3’UTR of an mRNA is an important regulator of mRNA half-life. Deadenylation of the 3’ end of the poly A tail is the first step of the intracellular mRNA degradation.
  • the length of the poly A tail of the mRNA construct is taken into critical consideration and designed for maximizing the expression of the protein encoded by the mRNA coding region, and the mRNA stability.
  • the nucleic acid construct comprises one or more poly A sequences.
  • the poly A sequence at the 3’UTR of the sequences encoding the one or more proteins or polypeptides comprise 20-200 adenosine nucleobases.
  • the poly A sequence comprises 30-200 adenosine nucleobases.
  • the poly A sequence comprises 50-200 adenosine nucleobases.
  • the poly A sequence comprises 80-200 adenosine nucleobases.
  • the mRNA segment comprising the sequences that encode one or more proteins or polypeptides comprises a 3’-UTR having a poly-A tail comprising about 180 adenosine nucleobases, or about 140 adenosine nucleobases, or about 120 adenosine nucleobases.
  • the poly A tail comprises about 122 adenosine nucleobases.
  • the poly A sequence comprises 50 adenosine nucleobases.
  • the poly A sequence comprises 30 adenosine nucleobases.
  • the adenosine nucleobases in the poly A tail are placed in tandem, with or without intervening non-adenosine bases.
  • one or more non- adenosine nucleobases are incorporated in the poly A tail, which confer further resistance to certain exonucleases.
  • the stretch of adenosines in poly A tail of the construct comprises one or more non-adenosine (A) nucleobase.
  • the non-A nucleobase is present at -3, -2, -1, and/or +1 position at the poly A 3’-terminal region.
  • the non-A bases comprise a guanosine (G) or a cytosine (C) or an uracil base (U).
  • the non-A base is a G.
  • the non-A base more than one, in tandem, for example, GG.
  • the modification at the 3’ end of the poly A tail with one or more non-A base is directed at disrupting the A base stacking at the poly A tail.
  • the poly A base stacking promotes deadenylation by various deadenylating enzymes, and therefore 3’ end of poly A tail ending in -AAAG, -AAAGA, or -AAAGGA are effective in conferring stability against deadenylation.
  • a GC sequence intervening a poly A sequence is shown to effectively show down 3’-5’ exonuclease mediated decay.
  • a modification contemplated herein comprises an intervening non-A residue, or a non-A residue duplex intervening a poly A stretch at the 3’end.
  • a triplex structure is introduced in the 3’ UTR which effectively stalls or slows down exonuclease activity involving the 3’ end.
  • the mRNA with the modifications described above has an extended half- life and demonstrates stable expression over a longer period than the unmodified mRNA.
  • the mRNA stably expresses for greater than 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days 9 days or 10 days or more, and the mRNA or its protein product is detectable in vivo. In some embodiments, the mRNA is detected up to 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 11 days, 12 days, 13 days, 14 days or 15 days in vivo.
  • a protein product of the mRNA is detected up to 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 11 days, 12 days, 13 days, 14 days, 15 days, 16 days, 17 days, 18 days, 20 days, 25 days or 30 days in vivo.
  • CircRNA and tectoRNA [00438] Circular RNA is useful in the design and production of stable form of RNA used as a messenger RNA to direct synthesis protein chains, such as long, multiply repeating protein chains. There are few methods to make circular RNA (circRNA).
  • RNA ends include protein-mediated ligation of RNA ends using RNA ligase and using a split self-splicing intron, such that if the two halves of the intron are located and the ends of a transcribed mRNA, the intron will splice itself out and leave a ligated product (FIG. 3A).
  • Another technique relies on the ability of T4 DNA ligase to act as an RNA ligase when the RNA ends to be ligated are held together by an oligonucleotide. Both these techniques suffer from inefficiency and require a large amount of enzyme.
  • a third technique uses the cyclization or circularization activity of group I introns where most of the intron sequences that carry out the reaction must remain a part of the circle.
  • Group I introns share a complex set of secondary and tertiary structures containing a series of conserved RNA stem loops which form the catalytic core. Many of these introns are self-splicing in vitro and can splice and form two ligated exons as RNA with no accessory protein factors.
  • the products created by the group I autocatalytic reaction are (1) an upstream exon ligated at the 5' splice site to the 3' splice site of a downstream exon and (2) a linear intron that can undergo further reversible auto-catalysis to form a circular intron.
  • the presence of such a large highly structured nucleic acid sequence severely limits the types of RNA sequences that can be made circular by that technique.
  • the catalytic activity of the intron may remain and interfere with structure and function of the circular RNA.
  • RNA sequences that fold a three-dimensional structure to form a stable binding interaction that is independent of sequence.
  • tectoRNA molecular units, defined as RNA molecules capable of self-assembly. The use of such type of tertiary interactions allows one to control and modulate the assembly process by manipulating cation concentration (e.g.
  • RNA molecules Mg 2+ ), and/or suitable temperature and employing modularly designed ‘selector’ RNA molecules.
  • a basic modular unit was designed that comprises a 4-way junction with an interacting module on each helical arm.
  • the interacting module is a GAAA loop or a specific GAAA loop receptor.
  • Each tectoRNA can interact with two other tectoRNAs via the formation of four loop–receptor interactions, two with each partner molecule.
  • the tectoRNA structures are suitably selected, and integrated in the RNA comprising the exon and intron to form a circRNA.
  • the integration is done by well- known molecular biology techniques such as ligation.
  • the tectoRNA forms a stable structure at high temperatures.
  • the tectoRNA structure do not compete with internal RNA sequences, thereby creating high efficiency circularization and splicing.
  • the circRNA can comprise a coding sequence described in any of the preceding sections.
  • it can comprise a sequence encoding fusion protein comprising a tethering or a receptor molecule.
  • the receptor can be a phagocytic receptor fusion protein.
  • the intron is a self-splicing intron.
  • the terminal regions having the tertiary structures are about 30 nucleotides to about 100 nucleotides long.
  • the tertiary structure motif is about 45 nucleotides, about 50 nucleotides, about 55 nucleotides, about 60 nucleotides, about 65 nucleotides, about 70 nucleotides or about 75 nucleotides long.
  • the tertiary motifs are formed at high temperatures. In some embodiments, the tertiary motifs are stable.
  • the nucleic acid construct having the one or more modifications as described herein and comprising one or more sequences encoding one or more proteins or polypeptides is stable when administered in vivo.
  • the nucleic acid is an mRNA.
  • the mRNA comprising one or more sequences encoding one or more proteins or polypeptides is stable in vivo for more than 2 days, for more than 3 days, more than 4 days, more than 5 days, more than 6 days, more than 7 days, more than 8 days, more than 9 days, more than 10 days, more than 11 days, more than 12 days, more than 13 days, more than 14 days, more than 15 days, more than 16 days, more than 17 days, more than 18 days, more than 19 days, or more than 20 days.
  • the protein encoded by the sequences in the mRNA can be detected in vivo at greater than 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 11 days, 12 days, 13 days, 14 days, 15 days, 16 days, 17 days, 18 days, 19 days, or 20 days. In some embodiments, the protein encoded by the sequences in the mRNA can be detected in vivo for about 7 days after the mRNA is administered. In some embodiments, the protein encoded by the sequences in the mRNA can be detected in vivo for about 14 days after the mRNA is administered.
  • the protein encoded by the sequences in the mRNA can be detected in vivo for about 21 days after the mRNA is administered. In some embodiments, the protein encoded by the sequences in the mRNA can be detected in vivo for about 30 days after the mRNA is administered. In some embodiments, the protein encoded by the sequences in the mRNA can be detected in vivo for more than about 30 days after the mRNA is administered. [00446] In some aspects, enhancing nucleic acid uptake or incorporation within the cell is contemplated for enhancing expression of the retrotransposition. One of the methods include obtaining a homogenous population of cells to initiate incorporation of the nucleic acid, e.g.
  • cell cycle synchronization may be sought.
  • Cell cycle synchronization may be accomplished by sorting cells for a certain common phenotype.
  • the cell population may be subjected to a treatment with a reagent that can stall cell cycle progression of all cells at a certain stage.
  • reagents can be found in commercial databases, such as www.tocris.com/cell-biology/cell-cycle-inhibitors, or www.scbt.com/browse/chemicals-Other- Chemicals-cell-cycle-arresting-compounds.
  • itraconazole or nocodazole inhibits cell cycle at G1 phase, or reagents that arrest cell cycle at G0/G1 phase, for example, 5-[(4-Ethylphenyl)methylene]- 2-thioxo-4-thiazolidinone (compound 10058-F4) (Tocris Bioscience); or a G2M cell cycle blocker, such as AZD 5438 (chemical name, 4-[2-Methyl-1-(1-methylethyl)-1H-imidazol-5-yl]-N-[4- (methylsulfonyl)phenyl]-2-pyrimidinamine) which blocks cell cycle at G2M, G1 or S phases, to name a few.
  • AZD 5438 chemical name, 4-[2-Methyl-1-(1-methylethyl)-1H-imidazol-5-yl]-N-[4- (methylsulfonyl)phenyl]-2-pyrimidinamine
  • Cyclosporin, hydroxyurea, thymidine are well known reagents that can cause cell cycle arrests. Some reagents may irreversibly alter a cell state or may be toxic for the cells. Serum deprivation of cells for about 2-16 hours prior to electroporation or transfection, depending on the cell type, may also be an easy and reversible strategy for cell synchronization. [00447] In some embodiments, retrotransposition efficiency may be increased by encouraging generation of DNA double stranded breaks to a cell that has been transfected with or electroporated with the retrotransposition constructs as described herein and/or modulating the DNA repair machinery.
  • Method of introducing double stranded breaks in a cell include subjecting the cell to controlled ionizing radiation of about 0.1 Gy or less for a short period.
  • efficiency of LINE-1 mediated retrotransposition may be increased by treating the cell with small molecule inhibitors of DNA repair proteins to increase the window for the reverse transcriptase to act.
  • Exemplary small molecule inhibitors of DNA repair proteins may be Benzamide (CAS 55-21-0), Olaparib (Lynparza) (CAS 763113-22-0), Rucaparib (Clovis -AG014699, PF-01367338 Pfizer), Niraparib (MK- 827 Tesaro) CAS 1038915-60- 4); Veliparib (ABT-888 Abbvie) (CAS 912444-00-9); Camptothecin (CPT) (CAS 7689-03-4); Irinotecan (CAS 100286-90-6); Topotecan (Hycamtin® GlaxoSmithKline) (CAS 123948-87-8); NSC 19630 (CAS 72835-26-8); NSC 617145 (CAS 203115-63-3); ML216 (CAS 1430213-30-1); 6-hydroxyDL- dopa (CAS 21373-30-8); D- 103; D-G23; DIDS (CAS 67483-13-0); B02 (CAS 1290541-46-6
  • the transgene or noncoding sequence that is the heterologous nucleic acid sequence to be inserted within the genome of a cell is delivered as an mRNA.
  • the mRNA may comprise greater than about 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1200, 1300, 1400, 1500, 1600, 1700, 1800, 1900, 2000, 3000, 4000, 5000, 6000, 7000, 8000, 9000, 10,000 bases.
  • the mRNA may be more than 10,000 bases long.
  • the mRNA may be about 11,000 bases long.
  • the mRNA may be about 12,000 bases long.
  • the mRNA comprises a transgene sequence that encodes a fusion protein.
  • the nucleic acid is delivered as a plasmid.
  • the nucleic acid is delivered in the cell by transfection.
  • the nucleic acid is delivered in the cell by electroporation.
  • the transfection or electroporation is repeated more than once to enhance incorporation of the nucleic acid into the cell.
  • Contemplated herein are retrotransposon mediated stable integration of a recombinant nucleic acid encoding a phagocytic or tethering receptor (PR) fusion protein (CFP).
  • PR phagocytic or tethering receptor
  • the CFPs comprise: a PR subunit comprising: a transmembrane domain, and an intracellular domain comprising an intracellular signaling domain; and an extracellular domain comprising an antigen binding domain specific to an antigen of a target cell; wherein the transmembrane domain and the extracellular domain are operatively linked.
  • the nucleic acid comprises a sequence encoding a chimeric fusion protein (CFP), the CFP comprising an extracellular domain comprising a CD5 binding domain, and a transmembrane domain operatively linked to the extracellular domain.
  • CFP chimeric fusion protein
  • the CD5 binding domain is a CD5 binding protein, such as an antigen binding fragment of an antibody, a Fab fragment, an scFv domain or an sdAb domain.
  • the CD5 binding domain comprises an scFv comprising (i) a variable heavy chain (VH) sequence with at least 90% sequence identity to EIQLVQSGGGLVKPGGSVRISCAASGYTFTNYGMNWVRQAPGKGLEWMGWINTHTGEPTYAD SFKGRFTFSLDDSKNTAYLQINSLRAEDTAVYFCTRRGYDWYFDVWGQGTTVTVTV; and (ii) a variable light chain (VL) sequence with at least 90% sequence identity to DIQMTQSPSSLSASVGDRVTITCRASQDINSYLSWFQQKPGKAPKTLIYRANRLESGVPSRFSGSG SGTDYTLTISSLQYEDFGIYYCQQYDESPWTFGGGTKLEIK.
  • VH variable heavy chain
  • VL variable light chain
  • the CFP further comprises an intracellular domain, wherein the intracellular domain comprises one or more intracellular signaling domains, and wherein a wild-type protein comprising the intracellular domain does not comprise the extracellular domain.
  • the one or more intracellular signaling domains comprises a phagocytic signaling domain.
  • the phagocytosis signaling domain comprises an intracellular signaling domain derived from a receptor other than Megf10, MerTk, Fc ⁇ R, and Bai1.
  • the phagocytosis signaling domain comprises an intracellular signaling domain derived from Fc ⁇ R, Fc ⁇ R or Fc ⁇ R.
  • the phagocytosis signaling domain comprises an intracellular signaling domain with at least 90% sequence identity to LYCRRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPP.
  • the one or more intracellular signaling domains further comprises a proinflammatory signaling domain.
  • the proinflammatory signaling domain comprises a PI3-kinase (PI3K) recruitment domain.
  • the proinflammatory signaling domain comprises a sequence with at least 90% sequence identity to YEDMRGILYAAPQLRSIRGQPGPNHEEDADSYENM.
  • the proinflammatory signaling domain is derived from an intracellular signaling domain of CD40.
  • the proinflammatory signaling domain comprises a sequence with at least 90% sequence identity to KVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ.
  • the transmembrane domain comprises a CD8 transmembrane domain.
  • the transmembrane domain comprises a sequence with at least 90% sequence identity to IYIWAPLAGTCGVLLLSLVIT.
  • the extracellular domain further comprises a hinge domain derived from CD8, wherein the hinge domain is operatively linked to the transmembrane domain and the CD5 binding domain.
  • the extracellular domain comprises a sequence with at least 90% sequence identity to ALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLD.
  • the CFP comprises an extracellular domain comprising a scFv that specifically binds CD5, and a hinge domain derived from CD8; a hinge domain derived from CD28 or at least a portion of an extracellular domain from CD68; a CD8 transmembrane domain, a CD28 transmembrane domain or a CD68 transmembrane domain; and an intracellular domain comprising at least two intracellular signaling domains, wherein the at least two intracellular signaling domains comprise: a first intracellular signaling domain derived from Fc ⁇ R or Fc ⁇ R, and a second intracellular signaling domain comprising a PI3K recruitment domain, or derived from CD40.
  • the recombinant polynucleic acid is an mRNA or circRNA.
  • the nucleic acid is delivered into a myeloid cell.
  • the nucleic acid is delivered into a CD14+ cell, a CD14+CD16- cell, an M0 macrophage, an M2 macrophage, an M1 macrophage or a mosaic myeloid cell/macrophage.
  • the fusion protein comprises a sequence with at least 90% sequence identity to EIQLVQSGGGLVKPGGSVRISCAASGYTFTNYGMNWVRQAPGKGLEWMGWINTHTGEPTYAD SFKGRFTFSLDDSKNTAYLQINSLRAEDTAVYFCTRRGYDWYFDVWGQGTTVTVSSGGGGSGG GGSGGGGSDIQMTQSPSSLSASVGDRVTITCRASQDINSYLSWFQQKPGKAPKTLIYRANRLESG VPSRFSGSGSGTDYTLTISSLQYEDFGIYYCQQYDESPWTFGGGTKLEIKSGGGGSGALSNSIMYF SHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDIYIWAPLAGTCGV LLLSLVITLYCRRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQGSGSYEDMRGI LYAAPQLRSIRGQPG
  • the fusion protein comprises a sequence with at least 90% sequence identity to EIQLVQSGGGLVKPGGSVRISCAASGYTFTNYGMNWVRQAPGKGLEWMGWINTHTGEPTYAD SFKGRFTFSLDDSKNTAYLQINSLRAEDTAVYFCTRRGYDWYFDVWGQGTTVTVSSGGGGSGG GGSGGGGSDIQMTQSPSSLSASVGDRVTITCRASQDINSYLSWFQQKPGKAPKTLIYRANRLESG VPSRFSGSGSGTDYTLTISSLQYEDFGIYYCQQYDESPWTFGGGTKLEIKSGGGGSGALSNSIMYF SHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDIYIWAPLAGTCGV LLLSLVITLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQKKVAKKPTNKAP HPKQEPQEINFPDDLPG
  • the fusion protein is a transmembrane protein, an intracellular protein or an intracellular protein.
  • the fusion protein is directed to enhancing the function of an immune cell, e.g., a myeloid cell, selected from monocyte, macrophages dendritic cells or precursors thereof.
  • the fusion protein augments a cellular function of an immune cell, such as phagocytosis.
  • the disclosure is not limited by the transgenes that can be expressed using the methods and compositions described.
  • the transgenes indicated in this section are exemplary.
  • Provided herein are exemplary transgene candidates, for stable integration into the genome of a phagocytic cell.
  • the transgene is a recombinant nucleic acid encoding a phagocytic receptor (PR) fusion protein (CFP).
  • the recombinant nucleic acid has a PR subunit comprising: (i) a transmembrane domain, and (ii) an intracellular domain comprising a phagocytic receptor intracellular signaling domain; and an extracellular antigen binding domain specific to an antigen of a target cell; wherein the transmembrane domain and the extracellular antigen binding domain are operatively linked such that antigen binding to the target by the extracellular antigen binding domain of the fused receptor activated in the intracellular signaling domain of the phagocytic receptor.
  • the recombinant nucleic acid encodes a chimeric antigen receptor.
  • the chimeric antigen receptor is a chimeric antigen receptor (phagocytosis) (CAR-P).
  • the fusion protein is a recombinant protein for locking anti-phagocytic signals.
  • the fusion protein is a phagocytosis enhancing chimeric protein.
  • the chimeric protein has intracellular domains comprising active phagocytosis signal transduction domains.
  • the chimeric protein enhances the phagocytic potential by enhancing the inflammatory potential of the phagocytic cell in which it expresses.
  • the transgene is designed to express a chimeric protein which is activated by contact with an antigen in a target cell, whereupon the phagocytic cell phagocytoses the target cell and kills the target cell.
  • the terms "spacer” or "linker” as used in reference to a fusion protein refers to a peptide sequence that joins the protein domains of a fusion protein. Generally, a spacer has no specific biological activity other than to join or to preserve some minimum distance or other spatial relationship between the proteins or RNA sequences. However, in some embodiments, the constituent amino acids of a spacer can be selected to influence some property of the molecule such as the folding, net charge, or hydrophobicity of the molecule.
  • Suitable linkers for use in an embodiment of the present disclosure are well known to those of skill in the art and include, but are not limited to, straight or branched-chain carbon linkers, heterocyclic carbon linkers, or peptide linkers.
  • the linker is used to separate two antigenic peptides by a distance sufficient to ensure that, in some embodiments, each antigenic peptide properly folds.
  • Exemplary peptide linker sequences adopt a flexible extended conformation and do not exhibit a propensity for developing an ordered secondary structure.
  • Typical amino acids in flexible protein regions include Gly, Asn and Ser. Virtually any permutation of amino acid sequences containing Gly, Asn and Ser would be expected to satisfy the above criteria for a linker sequence.
  • the PSP subunit comprises a transmembrane (TM) domain of a phagocytic receptor.
  • the PSP subunit comprises an ICD domain of a phagocytic receptor.
  • the ICD encoded by the recombinant nucleic acid comprises a domain selected from the group consisting of lectin, dectin 1, mannose receptor (CD206), scavenger receptor A1 (SRA1), MARCO, CD36, CD163, MSR1, SCARA3, COLEC12, SCARA5, SCARB1, SCARB2, CD68, OLR1, SCARF1, SCARF2, CXCL16, STAB1, STAB2, SRCRB4D, SSC5D, CD205, CD207, CD209, RAGE, CD14, CD64, F4/80, CCR2, CX3CR1, CSF1R, Tie2, HuCRIg(L), and CD169 receptor.
  • lectin dectin 1, mannose receptor (CD206), scavenger receptor A1 (SRA1), MARCO, CD36, CD163, MSR1, SCARA3, COLEC12, SCARA5, SCARB1, SCARB2, CD68, OLR1, SCARF1, SCARF2, CX
  • the ICD comprises the signaling domain derived from any one or more of: lectin, dectin 1, mannose receptor (CD206), scavenger receptor A1 (SRA1), MARCO (Macrophage Receptor with Collagenous Structure, aliases: SRA6, SCARA2), CD36 (Thrombospondin receptor, aliases: Scavenger Receptor class B, member 3), CD163 (Scavenger receptor, cysteine rich- type 1), MSR1, SCARA3, COLEC12 (aliases: Scavenger Receptor With C-Type Lectin, SCARA4, or Collectin 12), SCARA5, SCARB1, SCARB2, CD68 (SCARD, microsialin), OLR1 (Oxidized Low Density Lipoprotein Receptor 1, LOX1, or C-Type Lectin Domain Family 8 Member A), SCARF1, SCARF2, SRCRB4D, SSC5D, and CD169 (aliases,
  • the recombinant nucleic acid encodes, for example, an intracellular domain of human MARCO.
  • the PSR subunit comprises an intracellular domain having a 44 amino acid ICD of human MARCO having an amino acid sequence: MRNKKILKEDELLSETQQAAFHQIAMEPFEINVPKPKRRNGVNF.
  • the PSR subunit comprises a variant which is at least 70%, 75%, 80%, 85%, 90% or 95% identical to the intracellular domain of MARCO.
  • the PSR phagocytic scavenger receptor
  • the recombinant nucleic acid encodes an intracellular domain of human SRA1.
  • the PSR subunit comprises an intracellular domain having a 50 amino acid ICD of human SRA1 having an amino acid sequence: MEQWDHFHNQQEDTDSCSESVKFDARSMTA LLPPNPKNSPSLQEKLKSFK.
  • the PSR subunit comprises a variant which is at least 70%, 75%, 80%, 85%, 90% or 95% identical to the intracellular domain of human SRA1.
  • the intracellular region of SRA has a phosphorylation site.
  • the PSR comprises a transmembrane region of human SRA1.
  • the recombinant nucleic acid comprises an intracellular domain of CD36.
  • the recombinant nucleic acid comprises a TM domain of CD36.
  • Naturally occurring full length CD36 has two TM domains and two short intracellular domains, and an extracellular domain of CD36 binds to oxidized LDL.
  • Both of the intracellular domains contain pairs of cysteines that are fatty acid acylated. It lacks known signaling domains (e.g. kinase, phosphatase, g-protein binding, or scaffolding domains).
  • N-terminal cytoplasmic domain is extremely short (5–7 amino acid residues) and is closely associated with the internal leaflet of the plasma membrane.
  • the carboxy-terminal domain contains 13 amino acids, containing a CXCX5K motif homologous to a region in the intracellular domain of CD4 and CD8 that is known to interact with signaling molecules.
  • the intracellular domain of CD36 is capable of assembling a signaling complex that activates lyn kinases, MAP kinases and Focal Adhesion Kinases (FAK), and inactivation of src homology 2-containing phosphotyrosine phosphatase (SHP-2).
  • FAM Focal Adhesion Kinases
  • SHP-2 phosphotyrosine phosphatase
  • GEFs guanine nucleotide exchange factors
  • the recombinant nucleic acid encodes for example, an intracellular domain of human SCARA3.
  • the PSR subunit comprises a variant which is at least 70%, 75%, 80%, 85%, 90% or 95% identical to the intracellular domain of human SCARA3.
  • the PSR comprises the TM domain of SCARA3.
  • the TM domains are about 20-30 amino acids long.
  • Scavenger receptors may occur as homo or hetero dimers.
  • MARCO for example occurs as a homo trimer.
  • the TM domain or the ICD domain of the PSP is not derived from FcR, Megf10, Bai1 or MerTK.
  • the ICD of the PSR does not comprise a CD3 zeta intracellular domain.
  • the intracellular domain and transmembrane domains are derived from FcR beta.
  • the recombinant nucleic acid encodes a chimeric antigenic receptor for enhanced phagocytosis (CAR-P), which is a phagocytic scavenger receptor (PSR) fusion protein (CFP) comprising: (a) an extracellular domain comprising an extracellular antigen binding domain specific to an antigen of a target cell, (b) a transmembrane domain, and (c) a recombinant PSR intracellular signaling domain, wherein the recombinant PSR intracellular signaling domain comprises a first portion derived from a phagocytic and a second portion derived from non-phagocytic receptor.
  • CAR-P chimeric antigenic receptor for enhanced phagocytosis
  • PSR phagocytic scavenger receptor
  • CFP fusion protein
  • the second portion is not a PI3K recruitment domain. In some embodiments, the second portion is a PI3K recruitment domain.
  • the second portion derived from non-phagocytic receptor may comprise an intracellular signaling domain that enhances phagocytosis, and/or inflammatory potential of the engineered phagocytic cells expressing the recombinant nucleic acid. In some embodiments, the second portion derived from non- phagocytic receptor comprises more than one intracellular domain (ICD). In some embodiments, the second portion derived from non-phagocytic receptor comprises a second ICD.
  • the second portion derived from non-phagocytic receptor comprises a second and a third ICD. In some embodiments, the second portion derived from non-phagocytic receptor comprises a second, a third and a fourth ICD, wherein the second portion is encoded by the recombinant nucleic acid.
  • the respective second portions comprising a second, or third or fourth ICD derived from non-phagocytic receptor are described as follows.
  • the recombinant nucleic acid encodes a second intracellular domain in addition to the phagocytic ICD, which confers capability of potent pro-inflammatory immune activation, such as when macrophages engage in fighting infection.
  • the second intracellular domain (second ICD) is fused to the cytoplasmic terminus of the first phagocytic ICD.
  • the second intracellular domain provides a second signal is necessary to trigger inflammasomes and pro-inflammatory signals.
  • NLRs Nod-like receptors
  • TME tumor microenvironment
  • Influence of IL-10, glucocorticoid hormones, apoptotic cells, and immune complexes can interfere with innate immune cell function.
  • Immune cells including phagocytic cells settle into a tolerogenic phenotype.
  • this phenotype commonly known as the M2 phenotype is distinct from the M1 phenotype, where the macrophages are potent and capable of killing pathogens.
  • Macrophages exposed to LPS or IFN- gamma can polarize towards an M1 phenotype, whereas macrophages exposed to IL-4 or IL- 13 will polarize towards an M2 phenotype.
  • LPS or IFN-gamma can interact with Toll-like receptor 4 (TLR4) on the surface of macrophages inducing the Trif and MyD88 pathways, inducing the activation of transcription factors IRF3, AP-1, and NFKB and thus activating TNFs genes, interferon genes, CXCL10, NOS2, IL-12, etc., which are necessary in a pro-inflammatory Ml macrophage response.
  • TLR4 and IL-13 bind to IL-4R, activation the Jak/Stat6 pathway, which regulates the expression of CCL17, ARG1, IRF4, IL-10, SOCS3, etc., which are genes associated with an anti-inflammatory response (M2 response).
  • the recombinant nucleic acid encodes one or more additional intracellular domains, comprising a cytoplasmic domain for inflammatory response.
  • expression of the recombinant nucleic acid encoding the phagocytic receptor (PR) fusion protein (CFP) comprising the cytoplasmic domain for inflammatory response in the engineered macrophages confers potent pro- inflammatory response similar to the M1 phenotype.
  • the cytoplasmic domain for inflammatory response can be the signal transducing domains or regions of TLR3, 4, 9, MYD88, TRIF, RIG-1, MDA5, CD40, IFN receptor, NLRP- 1 – 14, NOD1, NOD2, Pyrin, AIM2, NLRC4, CD40.
  • the expression of the recombinant nucleic acid encoding the phagocytic scavenger receptor (PSR) fusion protein (CFP) comprises a pro-inflammatory cytoplasmic domain for activation of IL-1 signaling cascade.
  • the cytoplasmic portion of the chimeric receptor (for example, phagocytic receptor (PR) fusion protein (CFP)) comprises a cytoplasmic domain from a toll-like receptor, such as the intracellular signaling domains of toll-like receptor 3 (TLR3), toll-like receptor 4 (TLR4), toll-like receptor 7 (TLR7), toll-like receptor 8 (TLR8), toll-like receptor 9 (TLR9).
  • the cytoplasmic portion of the chimeric receptor comprises a suitable region from interleukin-1 receptor-associated kinase 1 (IRAK1).
  • IRAK1 interleukin-1 receptor-associated kinase 1
  • the cytoplasmic portion of the chimeric receptor comprises a suitable region from differentiation primary response protein (MYD88). In some embodiments, the cytoplasmic portion of the chimeric receptor comprises a suitable region from myelin and lymphocyte protein (MAL). In some embodiments, the cytoplasmic portion of the chimeric receptor comprises a suitable region from retinoic acid inducible gene (RIG-1). [00479] In some embodiments, the transmembrane domain of the PSR comprises the transmembrane domain of any one of MYD88, TLR3, TLR4, TLR7, TLR8, TLR9, MAL, IRAK1, proteins.
  • the recombinant PSR intracellular signaling domain comprises a first portion derived from a phagocytic and a second portion derived from non-phagocytic receptor wherein the second portion derived from non-phagocytic receptor comprises a phosphorylation site.
  • the phosphorylation site comprises amino acid sequences suitable for an autophosphorylation site.
  • the phosphorylation site comprises amino acid sequences suitable phosphorylation by Src family kinases.
  • the phosphorylation site comprises amino acid sequences, which upon phosphorylation are capable of binding to SH2 domains in a kinase.
  • a receptor tyrosine kinase domain is fused at the cytoplasmic end of the CFP in addition to the first cytoplasmic portion.
  • the phosphorylation is a tyrosine phosphorylation.
  • the second intracellular domain is an Immune receptor Tyrosine Activation Motif (ITAM).
  • ITAM motif is present in mammalian ⁇ and ⁇ immunoglobulin proteins, TCR ⁇ receptors, FCR ⁇ receptors subunits, CD3 chains receptors and NFAT activation molecule.
  • the CFP intracellular domain comprises one ITAM motif.
  • the CFP intracellular domain comprises more than one ITAM motifs. In some embodiments, the CFP intracellular domain comprises two or more ITAM motifs. In some embodiments, the CFP intracellular domain comprises three or more ITAM motifs. In some embodiments, the CFP intracellular domain comprises four or more ITAM motifs. In some embodiments, the CFP intracellular domain comprises five or more ITAM motifs. In some embodiments, the CFP intracellular domain comprises six or more ITAM motifs. In some embodiments, the CFP intracellular domain comprises seven or more ITAM motifs. In some embodiments, the CFP intracellular domain comprises eight or more ITAM motifs. In some embodiments, the CFP intracellular domain comprises nine or more ITAM motifs.
  • the CFP intracellular domain comprises ten or more ITAM motifs.
  • one or more domains in the first phagocytic ICD comprises a mutation.
  • one or more domains in the second ICD comprises a mutation to enhance a kinase binding domain, to generate a phosphorylation site, to generate an SH2 docking site or a combination thereof.
  • Co-expression of an Inflammatory Gene [00485]
  • the recombinant nucleic acid comprises a coding sequence for a pro-inflammatory gene, which is co-expressed with the CFP in the engineered cell.
  • the pro- inflammatory gene is a cytokine.
  • the recombinant nucleic acid encoding the proinflammatory gene can be monocistronic, wherein the two coding sequences for (a) the PSP and (b) the proinflammatory gene are post-transcriptionally or post-translationally cleaved for independent expression.
  • the two coding sequences comprise a self-cleavage domain, encoding a P2A sequence, for example.
  • the two coding regions are separated by an IRES site.
  • the two coding sequences are encoded by a bicistronic genetic element.
  • the coding regions for (a) the PSP and (b) the proinflammatory gene can be unidirectional, where each is under a separate regulatory control. In some embodiments, the coding regions for both are bidirectional and drive in opposite directions. Each coding sequence is under a separate regulatory control.
  • Co-expression of the proinflammatory gene is designed to confer strong inflammatory stimulation of the macrophage and activate the surrounding tissue for inflammation.
  • Integrin activation domains [00491] Cell-cell and cell-substratum adhesion is mediated by the binding of integrin extracellular domains to diverse protein ligands; however, cellular control of these adhesive interactions and their translation into dynamic cellular responses, such as cell spreading or migration, requires the integrin cytoplasmic tails. These short tails bind to intracellular ligands that connect the receptors to signaling pathways and cytoskeletal networks (Calderwood DA, 2004, Integrin Activation, Journal of Cell Science 117, 657-666). Integrins are heterodimeric adhesion receptors formed by the non-covalent association of ⁇ and ⁇ subunits.
  • Each subunit is a type I transmembrane glycoprotein that has relatively large extracellular domains and, with the exception of the ⁇ 4 subunit, a short cytoplasmic tail.
  • Individual integrin family members have the ability to recognize multiple ligands. Integrins can bind to a large number of extracellular matrix proteins (bone matrix proteins, collagens, fibronectins, fibrinogen, laminins, thrombospondins, vitronectin, and von Willebrand factor), reflecting the primary function of integrins in cell adhesion to extracellular matrices. Many "counter-receptors" are ligands, reflecting the role of integrins in mediating cell-cell interactions. Integrins undergo conformational changes to increase ligand affinity.
  • the Integrin ⁇ 2 subfamily consists of four different integrin receptors, ⁇ M ⁇ 2 (CD11b/CD18, Mac- 1, CR3, Mo-1), ⁇ L ⁇ 2 (CD11a/CD18, LFA-1), ⁇ X ⁇ 2 (CD11c/CD18), and ⁇ D ⁇ 2 (CD11d/CD18).
  • ⁇ M ⁇ 2 CD11b/CD18, Mac- 1, CR3, Mo-1
  • ⁇ L ⁇ 2 CD11a/CD18, LFA-1
  • ⁇ X ⁇ 2 CD11c/CD18
  • ⁇ D ⁇ 2 CD11d/CD18
  • the ⁇ subunits of all ⁇ 2 integrins contain an inserted region of ⁇ 200 amino acids, termed the I or A domain.
  • I domains mediate protein-protein interactions, and in integrins, they are integrally involved in the binding of protein ligands. Although the I domains dominate the ligand binding functions of their integrins, other regions of the ⁇ subunits do influence ligand recognition. As examples, in ⁇ M ⁇ 2 a mAb (OKM1) recognizing an epitope outside the I domain but in the ⁇ M subunit inhibits ligand binding; and the EF-hand regions in ⁇ L ⁇ 2 and ⁇ 2 ⁇ 1 , integrins with I domains in their ⁇ subunits, contribute to ligand recognition.
  • ⁇ M ⁇ 2 a mAb (OKM1) recognizing an epitope outside the I domain but in the ⁇ M subunit inhibits ligand binding; and the EF-hand regions in ⁇ L ⁇ 2 and ⁇ 2 ⁇ 1 , integrins with I domains in their ⁇ subunits, contribute to ligand recognition.
  • the ⁇ M subunit, and perhaps other ⁇ subunits, contains a lectin-like domain, which is involved in engagement of non-protein ligands, and occupancy may modulate the function of the I domain.
  • integrins lack enzymatic activity
  • signaling is instead induced by the assembly of signaling complexes on the cytoplasmic face of the plasma membrane. Formation of these complexes is achieved in two ways; first, by receptor clustering, which increases the avidity of molecular interactions thereby increasing the on-rate of binding of effector molecules, and second, by induction of conformational changes in receptors that creates or exposes effector binding sites.
  • integrins have the ability to bind fibronectin, laminins, collagens, tenascin, vitronectin and thrombospondin. Clusters of integrin/ECM interactions form focal adhesions, concentrating cytoskeletal components and signaling molecules within the cell.
  • the cytoplasmic tail of integrins serve as a binding site for ⁇ -actinin and talin which then recruit vinculin, a protein involved in anchoring F-actin to the membrane.
  • Talin is activated by kinases such as protein kinase C (PKC ⁇ ).
  • PKC ⁇ protein kinase C
  • Leucocytes express L-selectin, activated platelets express P- selectin, and activated endothelial cells express E- and P-selectin.
  • P-selectin-mediated adhesion enables chemokine- or platelet-activating factor-triggered activation of ⁇ 2 integrins, which stabilizes adhesion. It also facilitates release of chemokines from adherent leucocytes.
  • the cytoplasmic domain of P-selectin glycoprotein ligand 1 formed a constitutive complex with Nef-associated factor 1.
  • Src kinases After binding of P- selectin, Src kinases phosphorylated Nef-associated factor 1, which recruit the phosphoinositide-3-OH kinase p85-p110 ⁇ heterodimer and result in activation of leukocyte integrins. E-selectin ligands transduce signals that also affect ⁇ 2 integrin function. Selectins trigger activation of Src family kinases. SFKs activated by selectin engagement phosphorylate the immunoreceptor tyrosine-based activation motifs (ITAMs) in the cytoplasmic domains of DAP12 and FcR ⁇ . In some respects, CD44 is sufficient to transduce signals from E-selectin.
  • ITAMs immunoreceptor tyrosine-based activation motifs
  • CD44 triggers the inside-out signaling of integrins.
  • a final common step in integrin activation is binding of talin to the cytoplasmic tail of the ⁇ subunit.
  • Kindlins another group of cytoplasmic adaptors, bind to a different region of integrin ⁇ tails.
  • Kindlins increase the clustering of talin-activated integrins.
  • Kindlins are responsive to selectin signaling, however, kindlins are found mostly in hematopoietic cells, such as neutrophils.
  • Selectin signaling as well as signaling upon integrin activation by chemokines components have shared components, including SFKs, Syk, and SLP-76.
  • the intracellular domain of the recombinant PSR fusion protein comprises an integrin activation domain.
  • the integrin activation domain comprises an intracellular domain of a selectin, for example, a P-selectin, L-selectin or E-selectin.
  • the intracellular domain of the recombinant PSR fusion protein comprises an integrin activation domain of laminin.
  • the intracellular domain of the recombinant PSR fusion protein comprises an integrin activation domain for activation of Talin.
  • the intracellular domain of the recombinant PSR fusion protein comprises an integrin activation domain fused to the cytoplasmic end of the phagocytic receptor ICD domain.
  • Chimeric Receptor for Enhancing Antigen Cross presentation [00500]
  • the recombinant nucleic acid encodes a domain capable of enabling cross presentation of antigens.
  • MHC class I molecules present self- or pathogen-derived antigens that are synthesized within the cell, whereas exogenous antigens derived via endocytic uptake are loaded onto MHC class II molecules for presentation to CD4+ T cells.
  • Hsp90 heat shock protein 90
  • SREC-1 scavenger receptor expressed by endothelial cells
  • SREC-1 has no significant homology to other types of scavenger receptors but has unique domain structures. It contains 10 repeats of EGF-like cysteine- rich motifs in the extracellular domain.
  • the structure of SREC-I was shown to be similar to that of a transmembrane protein with 16 EGF-like repeats encoded by the Caenorhabditis elegans gene ced-I, which functions as a cell surface phagocytic receptor that recognizes apoptotic cells.
  • Cross presentation of cancer antigens through the Class-I MHC pathway results in enhanced CD8+ T cell response, which is associated with cytotoxicity and therefore beneficial in tumor regression.
  • the intracellular domain of the CFP comprises a SREC1 intracellular domain.
  • the intracellular domain of the CFP comprises a SRECII intracellular domain.
  • the PSR subunit comprises: an intracellular domain comprising a PSR intracellular signaling domain from SREC1 or SRECII.
  • the PSR subunit comprises: (i) a transmembrane domain, and (ii) an intracellular domain comprising a PSR intracellular signaling domain from SREC1 or SRECII.
  • the PSR subunit comprises: (i) a transmembrane domain, (ii) an intracellular domain comprising a PSR intracellular signaling domain, and (iii) an extracellular domain from SREC1 or SRECII.
  • the TM encoded by the recombinant nucleic acid comprises a domain of a scavenger receptor (SR).
  • the TM can be the TM domain of or derived from any one or more of: lectin, dectin 1, mannose receptor (CD206), SRA1, MARCO, CD36, CD163, MSR1, SCARA3, COLEC12, SCARA5, SCARB1, SCARB2, CD68, OLR1, SCARF1, SCARF2, SRCRB4D, SSC5D, and CD169.
  • the TM domains are about 20-30 amino acids long.
  • TM domains of SRs are about 20-30 amino acids long.
  • the TM domain or the ICD domain of the PSP is not derived from Megf10, Bai1 or MerTK.
  • the ICD of the PSR does not comprise a CD3 zeta intracellular domain.
  • the TM is derived from the same phagocytic receptor as the ICD.
  • the TM region is derived from a plasma membrane protein.
  • the TM can be selected from an Fc receptor (FcR).
  • FcR Fc receptor
  • nucleic acid sequence encoding domains from specific FcRs are used for cell-specific expression of a recombinant construct.
  • an FCR-alpha region comprising the TM domain may be used for macrophage specific expression of the construct.
  • FcR ⁇ recombinant protein expresses in mast cells.
  • the CFP comprises the TM of an FCR beta (FcR ⁇ ).
  • the CFP comprises both theFcR ⁇ T M and ICD domains.
  • the TM domain is derived from CD8.
  • the TM is derived from CD2.
  • the TM is derived from FCR alpha.
  • Extracellular domain of a CFP fusion protein comprises an antigen binding domain that binds to one or more target antigens on a target cell.
  • the target binding domain is specific for the target.
  • the extracellular domain can include an antibody or an antigen-binding domain selected from intrabodies, peptibodies, nanobodies, single domain antibodies. SMIPs, and multispecific antibodies.
  • the extracellular domain includes a Fab binding domain.
  • the extracellular domain includes a scFv.
  • the chimeric antigen receptor comprises an extracellular antigen binding domain is derived from the group consisting of an antigen-binding fragment (Fab), a single-chain variable fragment (scFv), a nanobody, a VH domain, a VL domain, a single domain antibody (sdAb), a VNAR domain, and a VHH domain, a bispecific antibody, a diabody, or a functional fragment of any thereof.
  • Fab antigen-binding fragment
  • scFv single-chain variable fragment
  • nanobody a VH domain, a VL domain, a single domain antibody (sdAb), a VNAR domain, and a VHH domain, a bispecific antibody, a diabody, or a functional fragment of any thereof.
  • the antigen-binding fragment Fab
  • a single-chain variable fragment scFv
  • a nanobody a VH domain, a VL domain, a single domain antibody (sdAb), a VNAR domain, and a VHH domain, a bispecific antibody, a diabody, or a functional fragment of any thereof specifically bind to one or more antigens.
  • the antigens are cancer antigens
  • the target cell is a target cancer cell.
  • the antigen for a target cancer cell is selected from the group consisting of CD3, CD4, CD5, CD7, CD19, CCR2, CCR4, CD30, CD37, TCRB1/2, TCR ⁇ ⁇ , TCR ⁇ ⁇ .
  • cancer antigen targets can be selected from cancer antigens known to one of skill in the art. Depending on the cancer and the cell type involved cancer antigens are mutated native proteins. The antigen binding domains are screened for specificity towards mutated/cancer antigens and not the native antigens.
  • the cancer antigen for a target cancer cell can be one or more of the mutated/cancer antigens: MUC16, CCAT2, CTAG1A, CTAG1B, MAGE A1, MAGEA2, MAGEA3, MAGE A4, MAGEA6, PRAME, PCA3, MAGE C1, MAGEC2, MAGED2, AFP, MAGEA8, MAGE9, MAGEA11, MAGEA12, IL13RA2, PLAC1, SDCCAG8, LSP1, CT45A1, CT45A2, CT45A3, CT45A5, CT45A6, CT45A8, CT45A10, CT47A1, CT47A2, CT47A3, CT47A4, CT47A5, CT47A6, CT47A8, CT47A9, CT47A10, CT47A11, CT47A12, CT47B1, SAGE1, and CT55.
  • the mutated/cancer antigens MUC16, CCAT2, CTAG1A, CTAG1B, MAGE A1, MAGEA2, MAGEA3, MAGE A4, MAGEA
  • the cancer antigen for a target cancer cell can be one or more of the mutated/cancer antigens: CD2, CD3, CD4, CD5, CD7, CD8, CD20, CD30, CD45, CD56, where the cancer is a T cell lymphoma.
  • the cancer antigen for a target cancer cell can be one or more of the mutated/cancer antigens: IDH1, ATRX, PRL3, or ETBR, where the cancer is a glioblastoma.
  • the cancer antigen for a target cancer cell can be one or more of the mutated/cancer antigens: CA125, beta-hCG, urinary gonadotropin fragment, AFP, CEA, SCC, inhibin or extradiol, where the cancer is ovarian cancer.
  • the cancer antigen for a target cancer cell may be HER2.
  • the cancer antigen for a target cancer cell may be EGFR Variant III.
  • the cancer antigen for a target cancer cell may be CD19.
  • the SR subunit region comprises an extracellular domain (ECD) of the scavenger receptor.
  • ECD of the scavenger receptor comprises an ECD domain of the SR comprising the ICD and the TM domains.
  • the SR-ECD contributes to the binding of the phagocyte to the target cell, and in turn is activated, and activates the phagocytosis of the target cell.
  • the PSR domain optionally comprises the ECD domain or portion thereof of the respective scavenger receptor the ICD and TM domains of which is incorporated in the PSR.
  • the ECD encoded by the recombinant nucleic acid comprises a domain selected from the group consisting of lectin, dectin 1, mannose receptor (CD206), scavenger receptor A1 (SRA1), MARCO, CD36, CD163, MSR1, SCARA3, COLEC12, SCARA5, SCARB1, SCARB2, CD68, OLR1, SCARF1, SCARF2, CXCL16, STAB1, STAB2, SRCRB4D, SSC5D, CD205, CD207, CD209, RAGE, CD14, CD64, F4/80, CCR2, CX3CR1, CSF1R, Tie2, HuCRIg(L), and CD169 receptor.
  • lectin dectin 1, mannose receptor (CD206), scavenger receptor A1 (SRA1), MARCO, CD36, CD163, MSR1, SCARA3, COLEC12, SCARA5, SCARB1, SCARB2, CD68, OLR1, SCARF1, SCARF2, CX
  • the extracellular domains of most macrophage scavenger receptors contain scavenger receptors with a broad binding specificity that may be used to discriminate between self and non-self in the nonspecific antibody-independent recognition of foreign substances.
  • the type I and II class A scavenger receptors (SR-AI1 and SR-AII) are trimeric membrane glycoproteins with a small NH2-terminal intracellular domain, and an extracellular portion containing a short spacer domain, an a-helical coiled-coil domain, and a triple-helical collagenous domain.
  • the type I receptor additionally contains a cysteine-rich COOH-terminal (SRCR) domain.
  • the SR ECD is designed to bind to pro-apoptotic cells.
  • the scavenger receptor ECD comprises a binding domain for a cell surface molecule of a cancer cell or an infected cell.
  • the extracellular domain of the PR subunit is linked by a linker to a target cell binding domain, such as an antibody or part thereof, specific for a cancer antigen.
  • the extracellular antigen binding domain comprises one antigen binding domain.
  • the extracellular antigen binding domain comprises more than one binding domain.
  • the binding domain is an scFv.
  • the binding domain is an single domain antibody (sdAb).
  • the binding domain is fused to the recombinant PR at the extracellular domain.
  • the binding domain (e.g., scFv) and the extracellular domain of the PR are linked via a linker.
  • the ECD antigen binding domain can bind to an intracellular antigen.
  • the intracellular antigen is a cancer antigen.
  • the extracellular antigen binding domain binds to the target ligand with an affinity of less than 1000 nM. In some embodiments, the extracellular antigen binding domain binds to the target ligand with an affinity of less than 500 nM. In some embodiments, the extracellular antigen binding domain binds to the target ligand with an affinity of less than 450 nM. In some embodiments, the extracellular antigen binding domain binds to the target ligand with an affinity of less than 400 nM.
  • the extracellular antigen binding domain binds to the target ligand with an affinity of less than 350 nM. In some embodiments, the extracellular antigen binding domain binds to the target ligand with an affinity of less than 250 nM. In some embodiments, the extracellular antigen binding domain binds to the target ligand with an affinity of less than 200 nM. In some embodiments, the extracellular antigen binding domain binds to the target ligand with an affinity of less than 100 nM. In some embodiments, the extracellular antigen binding domain binds to the target ligand with an affinity ranging between than 200 nM to 1000 nM.
  • the extracellular antigen binding domain binds to the target ligand with an affinity ranging between than 300 nM to 1.5 mM. In some embodiments, the antigen binding domain binds to the target ligand with an affinity > 200 nM, > 300 nM or >500 nM.
  • Peptide Linker [00535] In some embodiments, the extracellular antigen binding domains, scFvs are linked to the TM domain or other extracellular domains by a linker. In some embodiments, where there are more than one scfv at the extracellular antigen binding domain the more than scfvs are linked with each other by linkers. [00536] In some embodiments, the linkers are flexible.
  • the linkers comprise a hinge region.
  • Linkers are usually short peptide sequences.
  • the linkers are stretches of Glycine and one or more Serine residues.
  • Other amino acids preferred for short peptide linkers include but are not limited to threonine (Thr), serine (Ser), proline (Pro), glycine (Gly), aspartic acid (Asp), lysine (Lys), glutamine (Gln), asparagine (Asn), and alanine (Ala) arginine (Arg), phenylalanine (Phe), glutamic acid (Glu).
  • Thr threonine
  • Ser proline
  • Gly aspartic acid
  • Als lysine
  • glutamine Gln
  • Asparagine Asparagine
  • Glu alanine
  • Arg arginine
  • Phe phenylalanine
  • glutamic acid Glu
  • Pro is a unique amino acid with a cyclic side chain which causes a very restricted conformation.
  • Pro-rich sequences are used as interdomain linkers, including the linker between the lipoyl and E3 binding domain in pyruvate dehydrogenase (GA 2 PA 3 PAKQEA 3 PAPA 2 KAEAPA 3 PA 2 KA).
  • the empirical linkers may be flexible linkers, rigid linkers, and cleavable linkers. Sequences such as (G4S)x (where x is multiple copies of the moiety, designated as 1, 2, 3, 4, and so on) comprise a flexible linker sequence.
  • linker comprises at least 2, or at least 3 amino acids.
  • linker comprises 4 amino acids.
  • the linker comprises 5 amino acids.
  • the linker comprises 6 amino acids.
  • the linker comprises 7 amino acids.
  • the linker comprises 8 amino acids.
  • the linker comprises 9 amino acids.
  • the linker comprises 8 amino acids. In some embodiments, the linker comprises 10 amino acids. In some embodiments, the linker comprises 11 amino acids. In some embodiments, the linker comprises 12 amino acids. In some embodiments, the linker comprises 13 amino acids. In some embodiments, the linker comprises 14 amino acids. In some embodiments, the linker comprises 15 amino acids. In some embodiments, the linker comprises 16 amino acids. In some embodiments, the linker comprises 17 amino acids. In some embodiments, the linker comprises 18 amino acids. In some embodiments, the linker comprises 19 amino acids. In some embodiments, the linker comprises 20 amino acids.
  • any suitable ECD, TM or ICD domain can be cloned interchangeably in the suitable portion of any one of the CARP receptors described in the disclosure to obtain a protein with enhanced phagocytosis compared to an endogenous receptor.
  • Characteristics of the Fusion Proteins [00539]
  • the CFP can structurally incorporate into the cell membrane of the cell in which it is expressed.
  • Specific leader sequences in the nucleic acid construct, such as the signal peptide can be used to direct plasma membrane expression of the encoded protein.
  • the transmembrane domain encoded by the construct can incorporate the expressed protein in the plasma membrane of the cell.
  • the transmembrane domain comprises a TM domain of an FcRalpha receptor, which dimerizes with endogenous FcR-gamma receptors in the macrophages, ensuring macrophage specific expression.
  • the CFP can render the cell that expresses it as potently phagocytic.
  • the recombinant nucleic acid encoding the CFP is expressed in a cell, the cell can exhibit an increased phagocytosis of a target cell having the antigen of a target cell, compared to a cell not expressing the recombinant nucleic acid.
  • the cell When the recombinant nucleic acid is expressed in a cell, the cell can exhibit an increased phagocytosis of a target cell having the antigen of a target cell, compared to a cell not expressing the recombinant nucleic acid.
  • the recombinant nucleic acid when expressed in a cell the cell exhibits at least 2-fold increased phagocytosis of a target cell having the antigen of a target cell, compared to a cell not expressing the recombinant nucleic acid.
  • the recombinant nucleic acid when expressed in a cell the cell exhibits at least 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, 20-fold 30-fold or at least 5-fold increased phagocytosis of a target cell having the antigen of a target cell, compared to a cell not expressing the recombinant nucleic acid.
  • expression of SIRP- ⁇ ICD enhances phagocytosis of the cell expressing it by 1.1 fold or more, 1.2 fold or more, 1.3 fold or more, q.4 fold or more, 1.5 fold or more, by 1.6 fold or more, 1.7 fold or more, 1.8 fold or more, 1.9 fold or more, 2 fold or more, 3 fold or more, 4 fold or more, 5 fold or more, 8 fold or more, 10 fold or more, 15 fold or more, 20 fold or more, 30 fold or more, 40 fold or more, 50 fold or more, 60 fold or more, 70 fold or more 80 fold or more, 90 fold or more, 100 fold or more, compared to a cell not expressing SIRP- ⁇ ICD.
  • the cells co-expressing SIRP- ⁇ ICD and a CFP encoding a phagocytic receptor as described herein exhibits an augmented phagocytosis compared to a cell that does not express either of the proteins.
  • co-expressing SIRP- ⁇ ICD and a CFP encoding a phagocytic receptor as described herein exhibits more than 2-fold, more than 3-fold, more than 4-fold, more than 5- fold, more than 6-fold, more than 7-fold, more than 8-fold, more than 9-fold, more than 10-fold, more than 20-fold, more than 30-fold, more than 40-fold, more than 50-fold, more than 60-fold, more than 70-fold, more than 80-fold, more than 90-fold, more than 100-fold, or more than 150-fold or more than 200-fold increase in phagocytic potential (measured in fold change of phagocytic index) compared to a cell that does not express either the SIRP- ⁇ ICD or the CFP encoding a phagocytic receptor.
  • expression of the any one of a CFP expressing a CD47 blocking extracellular domain of SIRP ⁇ and an intracellular domain of a phagocytic receptor augments phagocytic activity of a cell expressing it by at least 1.5 fold or more, 1.6 fold or more, 1.7 fold or more, 1.8 fold or more, 1.9 fold or more, 2 fold or more, 3 fold or more, 4 fold or more, 5 fold or more, 8 fold or more, 10 fold or more, 15 fold or more, 20 fold or more, 30 fold or more, 40 fold or more, 50 fold or more, 60 fold or more, 70 fold or more 80 fold or more, 90 fold or more, 100 fold or more, compared to a cell not expressing the CFP, or compared to a cell expressing SIRP- ⁇ ICD.
  • the enhancement in phagocytosis of target cells by a cell expressing either SIRP- ⁇ ICD is highly increased compared to a phagocytic cell not expressing SIRP- ⁇ ICD.
  • the enhancement in phagocytosis of target cells by a cell expressing a CFP comprising a CD47 blocking extracellular domain of SIRP ⁇ and an intracellular domain of a phagocytic receptor is highly increased compared to a control phagocytic cell not expressing the fusion protein or a control phagocytic cell expressing the SIRP- ⁇ ICD.
  • the cell when the recombinant nucleic acid described herein is expressed in a cell, the cell exhibits an increased cytokine production.
  • the cytokine can comprise any one of: IL-1, IL-6, IL- 12, IL-23, TNF, CXCL9, CXCL10, CXCL11, IL-18, IL-23, IL-27 and interferons.
  • the recombinant nucleic acid described herein when the recombinant nucleic acid described herein is expressed in a cell, the cell exhibits an increased cell migration.
  • the recombinant nucleic acid described herein when the recombinant nucleic acid described herein is expressed in a cell, the cell exhibits an increased immune activity.
  • the cell when the recombinant nucleic acid is expressed in a cell, the cell exhibits an increased expression of MHC II. In some embodiments, when the recombinant nucleic acid is expressed in a cell, the cell exhibits an increased expression of CD80. In some embodiments, when the recombinant nucleic acid is expressed in a cell, the cell exhibits an increased expression of CD86. In some embodiments, when the recombinant nucleic acid is expressed in a cell, the cell exhibits an increased iNOS production.
  • the cell when the recombinant nucleic acid is expressed in a cell, the cell exhibits decreased trogocytosis of a target cell expressing the antigen of a target cell compared to a cell not expressing the recombinant nucleic acid.
  • the chimeric receptors may be glycosylated, pegylated, and/or otherwise post- translationally modified.
  • glycosylation, pegylation, and/or other posttranslational modifications may occur in vivo or in vitro and/or may be performed using chemical techniques.
  • any glycosylation, pegylation and/or other posttranslational modifications may be N-linked or O-linked.
  • any one of the chimeric receptors may be enzymatically or functionally active such that, when the extracellular domain is bound by a ligand, a signal is transduced to polarize a macrophage.
  • the chimeric fusion protein comprises an extracellular domain (ECD) targeted to bind to CD5 (CD5 binding domain), for example, comprising a heavy chain variable region (VH) having an amino acid sequence as set forth in SEQ ID NO: 1.
  • the chimeric CFP comprises a CD5 binding heavy chain variable domain comprising an amino acid sequence that has at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% sequence identity to SEQ ID NO: 1.
  • the extracellular domain (ECD) targeted to bind to CD5 comprises a light chain variable domain (V L ) having an amino acid sequence as set forth in SEQ ID NO: 2.
  • the chimeric CFP comprises a CD5 binding light chain variable domain comprising an amino acid sequence that has at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% sequence identity to SEQ ID NO: 2.
  • the CFP comprises an extracellular domain targeted to bind to HER2 (HER2 binding domain) having for example a heavy chain variable domain amino acid sequence as set forth in SEQ ID NO: 8 and a light chain variable domain amino acid sequence as set forth in SEQ ID NO: 9.
  • the CFP comprises a HER2 binding heavy chain variable domain comprising an amino acid sequence that has at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% sequence identity to SEQ ID NO: 8.
  • the CFP comprises a HER2 binding light chain variable domain comprising an amino acid sequence that has at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% sequence identity to SEQ ID NO: 9.
  • the CFP comprises a hinge connecting the ECD to the transmembrane (TM).
  • the hinge comprises the amino acid sequence of the hinge region of a CD8 receptor.
  • the CFP may comprise a hinge having the amino acid sequence set forth in SEQ ID NO: 7 (CD8 ⁇ chain hinge domain).
  • the PFP hinge region comprises an amino acid sequence that is at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% sequence identity to SEQ ID NO: 7.
  • the CFP comprises a CD8 transmembrane region, for example having an amino acid sequence set forth in SEQ ID NO: 6.
  • the CFP TM region comprises an amino acid sequence that is at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% sequence identity to SEQ ID NO: 6.
  • the CFP comprises an intracellular domain having an FcR domain.
  • the CFP comprises an FcR domain intracellular domain comprises an amino acid sequence set forth in SEQ ID NO: 3, or at least a sequence having 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% sequence identity to SEQ ID NO: 3.
  • the CFP comprises an intracellular domain having a PI3K recruitment domain.
  • the PI3K recruitment domain comprises an amino sequence set forth in SEQ ID NO: 4.
  • the PI3K recruitment domain comprises an amino acid sequence that has at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% sequence identity to SEQ ID NO: 4.
  • the CFP comprises an intracellular domain having a CD40 intracellular domain.
  • the CD40 ICD comprises an amino sequence set forth in SEQ ID NO: 5.
  • the CD40 ICD comprises an amino acid sequence that has at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% sequence identity to SEQ ID NO: 5.
  • the CD5 binding domain comprises an scFv comprising: (i) a variable heavy chain (VH) sequence of SEQ ID NO: 1 or with at least 90% sequence identity to SEQ ID NO: 1; and (ii) a variable light chain (VL) sequence of SEQ ID NO: 2 or with at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 2.
  • VH variable heavy chain
  • VL variable light chain
  • the CD5 binding domain comprises an scFv comprising SEQ ID NO: 33 or with at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 33.
  • the HER2 binding domain comprises an scFv comprising: (i) a variable heavy chain (VH) sequence of SEQ ID NO: 8 or with at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 8; and (ii) a variable light chain (VL) sequence of SEQ ID NO: 9 or with at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 9.
  • VH variable heavy chain
  • VL variable light chain
  • the CD5 binding domain comprises an scFv comprising SEQ ID NO: 32 or with at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 32.
  • the CFP further comprises an intracellular domain, wherein the intracellular domain comprises one or more intracellular signaling domains, and wherein a wild-type protein comprising the intracellular domain does not comprise the extracellular domain.
  • the extracellular domain further comprises a hinge domain derived from CD8, wherein the hinge domain is operatively linked to the transmembrane domain and the anti-CD5 binding domain.
  • the extracellular hinge domain comprises a sequence of SEQ ID NO: 7 or with at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 7.
  • the CFP comprises an extracellular domain fused to a transmembrane domain of SEQ ID NO: 30 or with at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 30.
  • the CFP comprises an extracellular domain fused to a transmembrane domain of SEQ ID NO: 31 or with at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 31.
  • the transmembrane domain comprises a CD8 transmembrane domain.
  • the transmembrane domain comprises a sequence of SEQ ID NO: 6 or 29 or with at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 6 or 29.
  • the transmembrane domain comprises a sequence of SEQ ID NO: 18 or with at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 18.
  • the transmembrane domain comprises a sequence of SEQ ID NO: 34 or with at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 34.
  • the transmembrane domain comprises a sequence of SEQ ID NO: 19 or with at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 19.
  • the CFP comprises one or more intracellular signaling domains that comprise a phagocytic signaling domain.
  • the phagocytosis signaling domain comprises an intracellular signaling domain derived from a receptor other than Megf10, MerTk, FcR ⁇ , and Bai1. In some embodiments, the phagocytosis signaling domain comprises an intracellular signaling domain derived from a receptor other than Megf10, MerTk, an FcR, and Bai1. In some embodiments, the phagocytosis signaling domain comprises an intracellular signaling domain derived from a receptor other than CD3 ⁇ . In some embodiments, the phagocytosis signaling domain comprises an intracellular signaling domain derived from FcR ⁇ , FcR ⁇ or FcR ⁇ .
  • the phagocytosis signaling domain comprises an intracellular signaling domain derived from CD3 ⁇ .
  • the CFP comprises an intracellular signaling domain of any one of SEQ ID NOs: 3, 20, 27 and 28 or with at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to any one of SEQ ID NOs: 3, 20, 27 and 28.
  • the one or more intracellular signaling domains further comprises a proinflammatory signaling domain.
  • the proinflammatory signaling domain comprises a PI3-kinase (PI3K) recruitment domain.
  • the proinflammatory signaling domain comprises a sequence of SEQ ID NO: 4 or with at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 4.
  • the proinflammatory signaling domain is derived from an intracellular signaling domain of CD40.
  • the proinflammatory signaling domain comprises a sequence of SEQ ID NO: 5 or with at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 5.
  • the CFP comprises an intracellular signaling domain of SEQ ID NO: 21 or with at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 21.
  • the CFP comprises an intracellular signaling domain of SEQ ID NO: 23 or with at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 23.
  • the CFP comprises a sequence of SEQ ID NO: 14 or with at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 14.
  • the CFP comprises a sequence of SEQ ID NO: 15 or with at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 15.
  • the CFP comprises a sequence of SEQ ID NO: 16 or with at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 16.
  • the CFP comprises a sequence of SEQ ID NO: 24 or with at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 24.
  • the CFP comprises a sequence of SEQ ID NO:25 or with at least 70%, 75%, 80%, 85%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 25.
  • the CFP comprises: (a) an extracellular domain comprising: (i) a scFv that specifically binds CD5, and (ii) a hinge domain derived from CD8; a hinge domain derived from CD28 or at least a portion of an extracellular domain from CD68; (b) a CD8 transmembrane domain, a CD28 transmembrane domain, a CD2 transmembrane domain or a CD68 transmembrane domain; and (c) an intracellular domain comprising at least two intracellular signaling domains, wherein the at least two intracellular signaling domains comprise: (i) a first intracellular signaling domain derived from FcR ⁇ , FcR ⁇ or FcR ⁇ , and (ii) a second intracellular signaling domain: (A) comprising a PI3K recruitment domain, or (B) derived from CD40.
  • an extracellular domain comprising: (i) a scFv that specifically binds CD5, and (ii) a hinge domain
  • the CFP comprises as an alternative (c) to the above: an intracellular domain comprising at least two intracellular signaling domains, wherein the at least two intracellular signaling domains comprise: (i) a first intracellular signaling domain derived from a phagocytic receptor intracellular domain, and (ii) a second intracellular signaling domain derived from a scavenger receptor phagocytic receptor intracellular domain comprising: (A) comprising a PI3K recruitment domain, or (B) derived from CD40.
  • Exemplary scavenger receptors from which an intracellular signaling domain may be derived may be found in Table 2.
  • the CFP comprises and intracellular signaling domain derived from an intracellular signaling domain of an innate immune receptor.
  • the recombinant polynucleic acid is an mRNA. In some embodiments, the recombinant polynucleic acid is a circRNA. In some embodiments, the recombinant polynucleic acid is a viral vector. In some embodiments, the recombinant polynucleic acid is delivered via a viral vector.
  • the myeloid cell is a CD14+ cell, a CD14+/CD16- cell, a CD14+/CD16+ cell, a CD14-/CD16+ cell, CD14-/CD16- cell, a dendritic cell, an M0 macrophage, an M2 macrophage, an M1 macrophage or a mosaic myeloid cell/macrophage/dendritic cell.
  • a method of treating cancer in a human subject in need thereof comprising administering a pharmaceutical composition to the human subject, the pharmaceutical composition comprising: (a) a myeloid cell comprising a recombinant polynucleic acid sequence, wherein the polynucleic acid sequence comprises a sequence encoding a chimeric fusion protein (CFP), the CFP comprising: (i) an extracellular domain comprising an anti-CD5 binding domain, and (ii) a transmembrane domain operatively linked to the extracellular domain; and (b) a pharmaceutically acceptable carrier; wherein the myeloid cell expresses the CFP.
  • a myeloid cell comprising a recombinant polynucleic acid sequence
  • the polynucleic acid sequence comprises a sequence encoding a chimeric fusion protein (CFP)
  • the CFP comprising: (i) an extracellular domain comprising an anti-CD5 binding domain, and (ii) a transmembrane domain operatively linked
  • the cancer upon binding of the CFP to CD5 expressed by a target cancer cell of the subject killing or phagocytosis activity of the myeloid cell is increased by greater than 20% compared to a myeloid cell not expressing the CFP. In some embodiments, growth of a tumor is inhibited in the human subject.
  • the cancer is a CD5+ cancer. In some embodiments, the cancer is leukemia, T cell lymphoma, or B cell lymphoma.
  • the CFP comprises one or more sequences shown in Table A and/or Table B below. Table A - Exemplary sequences of CFPs and domains thereof Table B - Linker sequences IV.
  • Noncoding exogenous sequence for delivery and incorporation into the genome of a cell may be delivered into the cell and designed to be incorporated in the genome of the cell.
  • the noncoding sequence as used herein, is a sequence that does not result in a translated protein product, but may have regulatory elements, such as transcribed products, such as inhibitory RNA.
  • such a sequence may be a miRNA sequence.
  • the sequence may be a sequence for siRNA generation.
  • the sequence may comprise an intronic sequence, or a binding site created such that one or more DNA binding proteins can dock on the site and influence the nature and behavior of the adjoining regions.
  • the sequence may be a transcription factor binding site.
  • the sequence may comprise an enhancer binding site.
  • the sequence may comprise a binding site for topoisomerase, gyrase, reverse transcriptase, polymerase, poly A binding protein, guanylyl cyclase, ligase, restriction enzymes, DNA methylase, HDAC enzymes, and many others.
  • the noncoding sequence may be directed to manipulating heterochromatin.
  • a noncoding insert sequence, as it may also be referred to here, may be a few nucleotides to 5 kB in length. V.
  • Plasmid design and recombinant nucleic acid design comprising an insert sequence [00572]
  • the nucleic acid construct comprising one or more sequences encoding one or more proteins or polypeptides is incorporated in a plasmid for transcription and generating an mRNA.
  • mRNA can be transcribed in an in vitro system using synthetic system of cell extracts. Alternatively, mRNA can be generated in a cell and harvested.
  • the cell can be a prokaryotic cell, such as a bacterial cell. In some embodiments, the cell is a eukaryotic cell. In some embodiments, the transcription occurs in a synthetic system.
  • Provided herein are exemplary plasmid design.
  • a plasmid is designed for expression of the mRNA molecule comprising a heterologous sequence of interest that encodes a protein or a polypeptide.
  • the plasmid comprises, inter alia, the sequences for genomic integration elements for integration of the heterologous sequence of interest that encodes a protein or a polypeptide; the sequence comprising the transgene or fragment thereof, operably linked to its separate promoter and regulatory elements that are required for its expression in the host following integration in the host genome, (such as, the subject who is administered the mRNA); one or more regulatory elements for transcription and generation of the mRNA including a promoter for expression of the mRNA, e.g.
  • a plasmid backbone can be an available vector, such as an in-house or commercially developed vector, that can be improved in various ways for best expression of the transcribed sequences, for example, (but not limited to), by introducing one or more desirable restriction digestion sites in the MCS (multiple cloning site), introducing a desired promoter for overall mRNA transcription, such as the T7 promoter, exchanging an existing sequence within the plasmid vector for one or more desired sequences, or introducing one or more desired segments, such as a selection marker sequence.
  • the plasmid comprises transcription regulatory elements, such as a promoter at the 5’ region, and a 3’-stabilizing element.
  • the promoter is chosen for enhanced mRNA transcription in the desired cell, such as an E coli bacterial cell.
  • the promoter for transcription of the plasmid is selected from a T7 promoter, a Sp6 promoter, pL (lambda) promoter, T3 promoter, trp promoter, araBad promoter, lac promoter or a Ptac promoter.
  • the promoter is a T7 promoter.
  • T7 or Sp6 promoters are constitutive promoters and are useful for high level transcription or in vitro transcription.
  • the 3’ stabilizing element is a sequence from BGH 3’ element, WPRE 3’ element, SV40 element, hGH element and other elements.
  • the 3’ element comprises the necessary poly A and transcription termination sequences.
  • Exemplary selection markers include antibiotic selection marker and/or expression detection marker.
  • Antibiotic selection markers include but are not limited to ampicillin resistance gene sequence (beta lactamase gene or fragment thereof) conferring resistance to ampicillin, for example G418 selection marker, tetracycline resistance gene sequence conferring resistance to tetracycline, kanamycin resistance gene sequence conferring resistance to kanamycin, erythromycin resistance gene sequence conferring resistance to erythromycin, chloramphenicol resistance gene sequence conferring resistance to chloramphenicol, neomycin resistant gene sequence conferring resistance to neomycin, and others.
  • Exemplary expression detection marker include FLAG, HA, GFP and others.
  • the plasmid is less than 20 kb in length. In some embodiments, the plasmid is less than 19 kb in length. In some embodiments, the plasmid is less than 20 kb in length. In some embodiments, the plasmid is less than 18 kb in length. In some embodiments, the plasmid is less than 20 kb in length. In some embodiments, the plasmid is less than 17 kb in length.
  • the plasmid is less than 20 kb in length. In some embodiments, the plasmid is less than 16 kb in length. In some embodiments, the plasmid is less than 15 kb in length. In some embodiments, the plasmid is less than 14 kb in length. In some embodiments, the plasmid is less than 13 kb in length. In some embodiments, the plasmid is less than 12 kb in length. In some embodiments, the plasmid is about 15 kb, about 14 kb, about 13 kb, about 12 kb or about 10 kb in length. [00579] In some embodiments, the codon is optimized for maximized transcription suitable for the transcription system. VI.
  • the recombinant nucleic comprises one or more regulatory elements within the noncoding regions that can be manipulated for desired expression profiles of the encoded proteins.
  • the noncoding region may comprise suitable enhancer.
  • the enhancer comprises a binding region for a regulator protein or peptide may be added to the cell or the system comprising the cell, for commencement of expression of the protein encoded under the influence of the enhancer.
  • a regulatory element may comprise a protein binding domain that remains bound with the cognate protein and continue to inhibit transcription and/or translation of recombinant protein until an extracellular signal is provided for the protein to decouple from the bound position to allow commencement of the protein synthesis.
  • Examples include but are not limited to Tetracycline-inducible (Tet-Inducible or Tet-on) and Tetracycline repressible (Tet-off) systems known to one of skill in the art.
  • Construct comprising metabolic switch In some embodiments, the 5’ and 3’ untranslated regions flanking the coding regions of the construct may be manipulated for regulation of expression of the recombinant protein encoded by the nucleic acid constructs described above.
  • the 3’UTR may comprise one or more elements that are inserted for stabilizing the mRNA.
  • AU- Rich Elements (ARE) sequences are inserted in the 3’ UTR that result in binding of RNA binding proteins that stabilize or destabilize the mRNA, allowing control of the mRNA half-life.
  • the 3’UTR may comprise a conserved region for RNA binding proteins (e.g. GAPDH) binding to mature mRNA strand preventing translation.
  • glycolysis results in the uncoupling of the RNA binding proteins (e.g. GAPDH) allowing for mRNA strand translation.
  • the principle of the metabolic switch is to trigger expression of target genes when a cell enters a certain metabolic state.
  • GAPDH is an RNA binding protein (RBP). It binds to ARE sequences in the 3’UTR, preventing translation of mRNA.
  • RBP RNA binding protein
  • GAPDH is required to convert glucose into ATP, coming off the mRNA allowing for translation of the protein to occur.
  • the environment in which the cell comprising the recombinant nucleic acid is present provides the metabolic switch to the gene expression.
  • hypoxic condition can trigger the metabolic switch inducing the disengaging of GAPDH from the mRNA.
  • the expression of the mRNA therefore can be induced only when the macrophage leaves the circulation and enters into a tumor environment, which is hypoxic. This allows for systemic administration of the nucleic acid or a cell comprising the nucleic acid, but ensures a local expression, specifically targeting the tumor environment.
  • the nucleic acid construct can be a split construct, for example, allowing a portion of the construct to be expressed under the control of a constitutive expression system whereas another portion of the nucleic acid is expressed under control of a metabolic switch, as described above.
  • the nucleic acid may be under bicistronic control.
  • the bicistronic vector comprises a first coding sequence under a first regulatory control, comprising the coding sequence of a target recognition moiety which may be under constitutive control; and a second coding sequence encoding an inflammatory gene expression which may be under the metabolic switch.
  • the bicistronic vector may be unidirectional. In some embodiments, the bicistronic vector may be bidirectional.
  • the ARE sequences comprise protein binding motifs for binding ARE sequence that bind to ADK, ALDH18A1, ALDH6A1, ALDOA, ASS1, CCBL2, CS, DUT, ENO1, FASN, FDPS, GOT2, HADHB, HK2, HSD17B10, MDH2, NME1, NQ01, PKM2, PPP1CC, SUCLG1, TP11, GAPDH, or LDH.
  • compositions and Immunotherapy comprising (i) the nucleic acid encoding the transgene is incorporated in a transpositioning or retrotranspositioning system comprising the transgene, the 5’- and 3’- flanking transposition or retrotranspositioning elements, the expression regulation elements, such as promoters, introns; and a nucleic acid encoding the transposase or retrotransposase, (ii) a nucleic acid delivery vehicle and a pharmaceutically acceptable salt or excipient.
  • the pharmaceutical composition comprises cells comprising the nucleic acid encoding the transgene that is stably integrated in the genome of the cell and a pharmaceutically acceptable excipient.
  • Nucleic acid constructs can be delivered with cationic lipids (Goddard, et al, Gene Therapy, 4:1231-1236, 1997; Gorman, et al, Gene Therapy 4:983-992, 1997; Chadwick, et al, Gene Therapy 4:937-942, 1997; Gokhale, et al, Gene Therapy 4:1289-1299, 1997; Gao, and Huang, Gene Therapy 2:710-722, 1995), using viral vectors (Monahan, et al, Gene Therapy 4:40-49, 1997; Onodera, et al, Blood 91:30-36, 1998), by uptake of "naked DNA", and the like.
  • nucleic acid comprising the transgene and the transposable elements is introduced or incorporated in the cell by known methods of nucleic acid transfer inside a cell, such as using lipofectamine, or calcium phosphate, or via physical means such as electroporation or nucleofection.
  • nucleic acid is encapsulated in liposomes or lipid nanoparticles.
  • LNPs are 100- 300 nm in diameter provide efficient means of mRNA delivery to various cell types, including macrophages.
  • the nucleic acid is transferred by other nanoparticles.
  • the vector for expression of the CFP is of a viral origin, namely a lentiviral vector or an adenoviral vector.
  • the nucleic acid encoding the recombinant nucleic acid is encoded by a lentiviral vector.
  • the lentiviral vector is prepared in-house and manufactured in large scale for the purpose. In some embodiments, commercially available lentiviral vectors are utilized, as is known to one of skill in the art.
  • the viral vector is an Adeno-Associated Virus (AAV) vector.
  • AAV Adeno-Associated Virus
  • the methods find use in a variety of applications in which it is desired to introduce an exogenous nucleic acid into a target cell and are particularly of interest where it is desired to express a protein encoded by an expression cassette in a target cell, where the target cell or cells are part of a multicellular organism.
  • the transposase system may be administered to the organism or host in a manner such that the targeting construct is able to enter the target cell(s), e.g., via an in vivo or ex vivo protocol. Such cells or organs are typically returned to a living body.
  • the transgene encoding a fusion protein related to immune function is stably integrated in a living cell of a subject ex vivo, following which the cell comprising the transgene is returned to the subject.
  • the CFP transgene phagocytic receptor fusion protein
  • an immune cell such as a myeloid cell, a phagocytic cell, a macrophage, a monocyte or a cell of dendritic cell lineage is contacted ex vivo with the recombinant nucleic acids for stable transfer of the transgene and re-introduced in the same subject for combating a disease of the subject.
  • the diseases contemplated comprises infectious diseases, cancer and autoimmune diseases.
  • the nucleic acid encoding the PSR subunit comprising fusion protein (CFP) described herein is used to generate engineered phagocytic cells for treating cancer.
  • Cancers include, but are not limited to T cell lymphoma, cutaneous lymphoma, B cell cancer (e.g., multiple myeloma, Waldenstrom's macroglobulinemia), the heavy chain diseases (such as, for example, alpha chain disease, gamma chain disease, and mu chain disease), benign monoclonal gammopathy, and immunocytic amyloidosis, melanomas, breast cancer, lung cancer, bronchus cancer, colorectal cancer, prostate cancer (e.g., metastatic, hormone refractory prostate cancer), pancreatic cancer, stomach cancer, ovarian cancer, urinary bladder cancer, brain or central nervous system cancer, peripheral nervous system cancer, esophageal cancer, cervical cancer, uterine or endometrial cancer
  • cancers include human sarcomas and carcinomas, e.g., fibrosarcoma, myxosarcoma, liposarcoma, chondrosarcoma, osteogenic sarcoma, chordoma, angiosarcoma, endotheliosarcoma, lymphangiosarcoma, lymphangioendotheliosarcoma, synovioma, mesothelioma, Ewing's tumor, leiomyosarcoma, rhabdomyosarcoma, colon carcinoma, colorectal cancer, pancreatic cancer, breast cancer, ovarian cancer, squamous cell carcinoma, basal cell carcinoma, adenocarcinoma, sweat gland carcinoma, sebaceous gland carcinoma, papillary carcinoma, papillary adenocarcinomas, cystadenocarcinoma, medullary carcinoma, bronchogenic carcinoma, renal cell carcinoma
  • human sarcomas and carcinomas e.g.,
  • the cancer is an epithelial cancer such as, but not limited to, bladder cancer, breast cancer, cervical cancer, colon cancer, gynecologic cancers, renal cancer, laryngeal cancer, lung cancer, oral cancer, head and neck cancer, ovarian cancer, pancreatic cancer, prostate cancer, or skin cancer.
  • the cancer is breast cancer, prostate cancer, lung cancer, or colon cancer.
  • the epithelial cancer is non-small-cell lung cancer, nonpapillary renal cell carcinoma, cervical carcinoma, ovarian carcinoma (e.g., serous ovarian carcinoma), or breast carcinoma.
  • the epithelial cancers can be characterized in various other ways including, but not limited to, serous, endometrioid, mucinous, clear cell, or undifferentiated.
  • the present disclosure is used in the treatment, diagnosis, and/or prognosis of lymphoma or its subtypes, including, but not limited to, mantle cell lymphoma. Lymphoproliferative disorders are also considered to be proliferative diseases.
  • cellular immunotherapy comprises providing the patient a medicament comprising live cells, which should be HLA matched for compatibility with the subject, and such that the cells do not lead to graft versus Host Disease, GVHD.
  • a subject arriving at the clinic for personalized medicine and immunotherapy as described above, is routinely HLA typed for determining the HLA antigens expressed by the subject.
  • Therapeutic advantages of mRNA driven delivery [00593]
  • the cell is within a living system, e.g., a host organism such as a human.
  • the nucleic acid sequence is an mRNA.
  • delivery via retrotransposon poses to be a highly lucrative mode.
  • mRNA driven delivery simplifies gene delivery.
  • retrotransposon mediated delivery itself encodes for the editing machinery, encodes for new genes to be delivered.
  • a single mRNA may be sufficient for gene delivery and editing.
  • mRNA delivery is advantageous in that it can ensure introduction of a nucleic acid cargo without size restraint.
  • Table 9 summarizes some of the advantages over the other existing methods of nucleic acid deliveries. Table 9. Advantages of retrotransposon mediated gene delivery [00597] Retrotransposons are advantageous for applications across multiple modalities. Gene manipulation using this method is easily attained both in vivo and ex vivo.
  • the application of retrotransposon may be in vivo, a piece of genetic material encoded in an mRNA can be directly introduced into a patient by systemic or local introduction.
  • cells can be taken out from a subject, and manipulated ex vivo and then introduced either to the same subject (autologous) or to another human (heterologous).
  • retrotransposons and the related methods described herein may be instrumental in gene therapy. With the advantage of capacity to introduce large payloads, large sections of DNA carrying a gene encoding an entire protein may be introduced in one shot without requiring multiple introductions and multiple editing events.
  • a gene that encodes a defective protein may be excised, the correct gene may be introduced in the correct site in one integration event using a retrotransposon mediated delivery.
  • CRISPR editing may be used to excise a gene from precise locus and retrotransposition may be used to replace the correct genes.
  • a preferred retrotransposon integration site may be introduced at the excision site.
  • retrotransposons and the related methods described herein may be instrumental in gene editing.
  • retrotransposons and the related methods described herein may be instrumental in transcriptional regulation.
  • retrotransposons and the related methods described herein may be instrumental in genome engineering.
  • composition for incorporating a heterologous nucleic acid sequence in the genome comprising one or more polynucleic acids further comprise (i) a sequence encoding an integrase or a fragment thereof for site directed integration of the insert sequence into the genome and (ii) a genome landing site sequence that operable by the integrase, wherein the genome landing sequence is greater than 4, 5, 6, 7, 8, 9, or 10 consecutive nucleotides long.
  • the integrase is a bacterial integrase.
  • the integrase is a serine integrase.
  • the composition comprises an ORF2 and an integrase or a fragment thereof, wherein the integrase and the ORF2 are on separate polynucleotides.
  • the integrase has a capability of integrating nucleic acid sequence into a genomic site that has a genomic landing sequence that is about 10 nucleotides long, about 20 nucleotides long, about 30 nucleotides long, about 40 nucleotides long.
  • the ORF2 and the integrase are on a single polynucleotide.
  • the ORF2 is modified to incorporate a fragment of an integrase protein that can recognize a genomic landing sequence of greater than 10 consecutive nucleotides long, and wherein the LINE retrotransposon system integrates the heterologous genomic insert into the genomic landing sequence recognized by the fragment of an integrase protein that has been incorporated into the genome.
  • the integrase is not integrated into the genome of the cell. In some embodiments, the integrase is a recombinant protein.
  • the ORF protein e.g., the ORF2 protein is a recombinant (e.g., chimeric) protein, which comprises at least a fragment of a bacterial serine integrase that is capable of recognizing a genomic landing sequence of an integrase, e.g., a bacterial integrase, e.g., a bacterial serine integrase, wherein the genome landing sequence that is operable by the integrase and is greater than 20 nucleotides long, or greater than 30 nucleotides long.
  • the one or more of the ORF protein sequence comprise a mutation.
  • the recombinant (e.g., chimeric) ORF protein comprises a deletion of the target recognition sequence.
  • the recombinant (e.g., chimeric) ORF protein comprises a fragment of the integrase, e.g., a bacterial integrase, e.g., a bacterial serine integrase, which comprises a catalytic domain or a fragment thereof, a site-specific genomic integration recognition domain.
  • a pharmaceutical composition wherein the insert sequence comprises an attachment site operable by the integrase.
  • the genomic landing site is inserted into the genome using a guide RNA and a Cas system.
  • the guide RNA, the CAS system and the genomic landing sequence are in a polynucleotide that is separate from the polynucleotide comprising the sequence encoding the LINE1-ORFs and the insert sequence.
  • a method for a site-specific integration of a heterologous genomic insert sequence into the genome of a mammalian cell comprising: (i) introducing into the cell (a) a polynucleotide comprising sequences encoding one or more human retrotransposon elements associated with the heterologous insert sequence, and (b) a polynucleotide comprising sequence encoding a guide RNA, an RNA guided integrase or a fragment thereof and a landing sequence operable by the integrase; (ii) verifying the integration of the heterologous insert sequence into the site of the genome.
  • a method for site-specific integration of a heterologous genomic insert using a LINE retrotransposon system wherein the LINE retrotransposon system is modified to incorporate a fragment of an integrase protein that can recognize a genomic landing sequence of greater than 10 consecutive nucleotides long, and wherein the LINE retrotransposon system integrates the heterologous genomic insert into the genomic landing sequence recognized by the fragment of the integrase protein that has been incorporated into the genome.
  • the integrase recognizes and contacts the genomic landing sequence, and the reverse transcriptase elements of the LINE (L1) retrotransposon system reverse transcribes and incorporates the insert sequence (e.g., the cargo sequence) at the specific site of the genome landing sequence.
  • the method comprises a step of incorporating into the genome the genomic landing sequence of greater than 10 consecutive nucleotides long.
  • the step of incorporating into the genome the genomic landing sequence is performed by an RNA-guided CRISPR-Cas system.
  • the RNA-guided CRISPR-Cas system has an editing function capable of incorporating a sequence of greater than 10 consecutive nucleotides long into a specific genome site.
  • a modified L1 retrotransposition system comprising a site specific integrase DNA recognition moiety; wherein the integrase DNA recognition moiety recognizes the genomic sequence for site-specific integration, and wherein the L1 retrotransposition system reverse transcribes and integrates the sequence comprising the heterologous insert into the genomic site at or near the site recognized by the integrase.
  • Existing systems incorporating an integrase, such as a serine integrase may comprise a DNA integration system, using for example a plasmid, a viral delivery system, each of which can be bypassed for the safer and sure mRNA system as used herein, and without the limitation of cargo size.
  • retrotransposons and the related methods described herein may be instrumental in developing cell therapy, for example chimeric antigen receptor (CAR)T cells, in NK cell therapy or in myeloid cell therapy.
  • retrotransposons and the related methods described herein may be instrumental in delivery of genes into neurons, which are difficult to access by existing technologies.
  • a method for targeted replacement of a genomic nucleic acid sequence of a cell comprising: (A) introducing to the cell a polynucleotide sequence encoding a first protein complex comprising a targeted excision machinery for excising from the genome of the cell a nucleic acid sequence comprising one or more mutations; and (B) a recombinant mRNA encoding a second protein complex, wherein the recombinant mRNA comprises: (i) a nucleic acid sequence comprising the excised nucleic acid sequence in (A) that does not contain the one or more mutations, and (ii) a sequence encoding an L1 retrotransposon ORF2 protein under the influence of an independent promoter.
  • the first protein complex may be an endonuclease complex independent of the second protein complex.
  • the first protein complex comprises a CRISPR-CAS system that uses sequence guided genomic DNA excision.
  • the methods described herein couples a CRISPR CAS system or any other gene editing system with a L1 transposon machinery (e.g., the second protein complex) that delivers a replacement gene with a payload capacity of greater than 4kb, or 5kb, or 6kb, or 7kb, or 8kb or 9 kb or 10 kb.
  • This coupling can be utilized in precisely excising a large fragment (a mutated gene causing a disease) from the genomic locus and integrating a large fragment of a gene or an entire gene that encodes a correct, non-mutated sequence.
  • a large number of genetic diseases may require delivery of gene delivery of large payloads, often exceeding the functional capacity of existing methods. Contemplated herein are methods and compositions disclosed herein that can be instrumental in further designing therapy for such diseases using retrotransposons. An exemplary list of genetic diseases include but are not limited to the ones listed in Table 10. Table 10. List of potential gene therapy applications
  • the method comprises: (A) excising from the genome of the cell a nucleic acid sequence comprising one or more mutations and (B) introducing into the cell a recombinant mRNA encoding: (i) a nucleic acid sequence comprising a wild type sequence relative to the sequence excised in (A) that does not contain the one or more mutation, (ii) a sequence encoding an L1 retrotransposon ORF2 protein under the influence of an independent promoter.
  • Step (A) further comprises introducing a short sequence comprising at least a plurality of adenylate residues at the excision site.
  • the nucleic acid sequence comprising a wild type sequence is operably linked with the ORF2 encoding sequence in a way such that the ORF2 reverse transcriptase integrates the sequence comprising the wild type non-mutated sequence into the genome.
  • the cell is a lymphocyte.
  • the cell is an epithelial cell.
  • the cell is a retinal pigmented epithelial cell (RPE).
  • RPE retinal pigmented epithelial cell
  • the cell is a neuron.
  • the cell is a myeloid cell.
  • the cell is a stem cell.
  • the cell is a cancer cell.
  • the gene is selected from a group consisting of ABCA4, MY07A, CEP290, CDH23, EYS, USH2a, GPR98, ALMS1, GDE, OTOF andF8.
  • the mRNA comprises a sequence for an inducible promoter.
  • the expression of the nucleic acid sequence comprising a non-mutated sequence is detectable at least 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34 or 35 days post infection.
  • the method comprises introducing into the cell a recombinant mRNA in vivo.
  • the method comprises introducing into the cell a recombinant mRNA ex vivo.
  • a method of treating a genetic disease in a subject in need thereof comprising: introducing into the subject a composition comprising a polycistronic mRNA encoding a gene or fragment thereof, operably linked to a sequence encoding an L1 retrotransposon; wherein the gene or the fragment thereof is at least 10.1 kb in length.
  • the method comprises directly introducing the mRNA systemically.
  • the method comprises directly introducing the mRNA locally.
  • the genetic disease is a retinal disease.
  • the disease is macular dystrophy.
  • the disease is Stargardt disease, also known as juvenile macular degeneration, or fundus flavimaculatus.
  • the disease causes progressive degeneration and damage of the macula.
  • the condition has a genetic basis due to mutation in the ATP-binding cassette (ABC) transporter gene, (ABCA4) gene, and arises from the deposition of lipofuscin-like substance in the retinal pigmented epithelium (RPE) with secondary photoreceptor cell death.
  • the method comprises direct delivery of the mRNA to the retina.
  • the method comprises treating a nonsyndromic autosomal recessive deafness (DFNB12) and deafness associated with retinitis pigmentosa and vestibular dysfunction (USH1D).
  • DFNB12 non-syndromic autosomal recessive deafness
  • USH1D retinitis pigmentosa and vestibular dysfunction
  • the method comprises introducing an mRNA comprising a copy of CDH23 or a fragment thereof operably linked to a sequence encoding an L1 retrotransposon.
  • DFNB12 non-syndromic deafness
  • USH1D Usher syndrome
  • Stable expression of an exogenous polypeptide may be accomplished in a variety of cell types (e.g.
  • the target cell is a post-mitotic cell, e.g., a mammalian cardiomyocyte, or an RPE cell.
  • the mobile genetic element comprises a human LINE 1 sequence.
  • the mobile genetic element is a human LINE1 sequence.
  • the mobile genetic element comprises a sequence encoding a human L1 ORFp1 protein.
  • the mobile genetic element comprises a sequence encoding a human L1-ORFp2 protein.
  • the mobile genetic element comprises a sequence encoding a human ORFp1 and human ORFp2 polypeptides.
  • a polynucleotide sequence is introduced in a target cell, the polynucleotide comprises of a sequence encoding a mobile genetic element, and an insert sequence.
  • the mobile genetic element comprises a polypeptide that post-translationally promotes a stable integration of an insert sequence into the genome of the target cell.
  • the mobile genetic element comprises a polypeptide further configured for site-specific integration of a given insert sequence into the genome of the target cell, for example but not limited to the embodiments as is described elsewhere in the specification.
  • the polynucleotide described herein is an mRNA.
  • the mRNA may be bicistronic or polycistronic.
  • the insert sequence and the sequence encoding the mobile genetic element can be in reverse orientation with respect to each other.
  • the mobile genetic element may integrate the insert sequence via target-primed reverse transcription (TPRT).
  • TPRT target-primed reverse transcription
  • the mobile genetic element comprises the human L1 retrotransposon, or fragments thereof.
  • the polynucleotide can be specifically targeted to a cell type.
  • the polynucleotide may be composed in a nanoparticle, wherein the nanoparticle comprises one or more targeting moieties known to one of skill in the art.
  • a method of stably integrating an insert sequence into genomic DNA of a target cell comprising contacting a composition to the target cell, the composition comprising a polynucleic acid, wherein the polynucleic acid comprises: an insert sequence, wherein the insert sequence comprises a sequence that is a reverse complement of a sequence encoding an exogenous polypeptide, and a mobile genetic element comprising a sequence encoding a polypeptide, wherein the polypeptide encoded by the sequence of the mobile genetic element promotes integration of the insert sequence into genomic DNA; stably integrating the insert sequence into the genomic DNA of the target cell; and expressing an exogenous polypeptide in the target cell, wherein the target cell is a human hepatocyte.
  • polynucleic acid is mRNA.
  • the mRNA is encapsulated in a nanoparticle for intracellular delivery.
  • the nanoparticle comprises a lipid.
  • the polynucleic acid is introduced into the hepatocyte by contacting a composition, comprising, for example, the polynucleic acid and a delivery vehicle (e.g., a nanoparticle comprises a lipid) to the hepatocyte such that it results in the successful uptake of the polynucleic acid by the hepatocyte.
  • the incorporation is via electroporation.
  • the polynucleic acid composition is electroporated in the hepatocyte.
  • the hepatocyte is electroporated under conditions suitable for expression of the polynucleic acid-encoded polypeptides and conducive to the viability of the hepatocyte.
  • the integration of the insert into the genome of the hepatocyte is verified after incorporation the polynucleic acid by methods known to one of skill in the art, e.g., by genome sequencing.
  • the expression of the polypeptide from integrated insert sequence is verified at a suitable interval following incorporation of the polynucleic acid in the hepatocyte, wherein the suitable interval is about 4, 6, 8, 10, 12, 24 or 48 hours.
  • the population of cells comprising the hepatocytes that have been subjected to the electroporation is cultured under conditions suitable for a hepatocyte for at least about 2 hours, about 3 hours, about 4 hours, about 5 hours, about 6 hours, about 8 hours, about 10 hours or about 24 hours.
  • the hepatocyte is cultured for about 48 hours, 72 hours, 96 hours or more under conditions suitable for a hepatocyte for growth.
  • the expression of a polypeptide encoded by the polynucleotide is verified after 48, 72, or 96 hours, or after 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days or more in culture.
  • at least 2% of the human hepatocytes express the exogenous polypeptide at day 10 after incorporating.
  • about 2%, or about 5%, or about 10% or more of the human hepatocytes in the population of cells subjected to the electroporation express the exogenous polypeptide at day 10 after incorporating.
  • a method of stably integrating an insert sequence into genomic DNA of a target cell comprising contacting a composition to the target cell, the composition comprising a polynucleic acid, wherein the polynucleic acid comprises: an insert sequence, wherein the insert sequence comprises a sequence that is a reverse complement of a sequence encoding an exogenous polypeptide, and a mobile genetic element comprising a sequence encoding a polypeptide, wherein the polypeptide encoded by the sequence of the mobile genetic element promotes integration of the insert sequence into genomic DNA; stably integrating the insert sequence into the genomic DNA of the target cell; and expressing an exogenous polypeptide in the target cell, wherein the target cell is a human cardiomyocyte.
  • polynucleic acid is mRNA.
  • the mRNA is encapsulated in a nanoparticle for intracellular delivery.
  • the nanoparticle comprises a lipid.
  • the polynucleic acid is introduced into the cardiomyocyte by contacting a composition, comprising, for example, the polynucleic acid and a delivery vehicle (e.g., a nanoparticle comprises a lipid) to the cardiomyocyte such that it results in the successful uptake of the polynucleic acid by the cardiomyocyte.
  • the incorporation is via electroporation.
  • the polynucleic acid composition is electroporated in the cardiomyocyte.
  • the cardiomyocyte is electroporated under conditions suitable for expression of the polynucleic acid-encoded polypeptides and conducive to the viability of the cardiomyocyte.
  • the integration of the insert into the genome of the cardiomyocyte is verified after incorporation the polynucleic acid by methods known to one of skill in the art, e.g., by genome sequencing.
  • the expression of the polypeptide from integrated insert sequence is verified at a suitable interval following incorporation of the polynucleic acid in the cardiomyocyte, wherein the suitable interval is about 4, 6, 8, 10, 12, 24 or 48 hours.
  • the population of cells comprising the cardiomyocytes that have been subjected to the electroporation is cultured under conditions suitable for a cardiomyocyte for at least about 2 hours, about 3 hours, about 4 hours, about 5 hours, about 6 hours, about 8 hours, about 10 hours or about 24 hours.
  • the cardiomyocyte is cultured for about 48 hours, 72 hours, 96 hours or more under conditions suitable for a cardiomyocyte for growth.
  • the expression of a polypeptide encoded by the polynucleotide is verified after 48, 72, or 96 hours, or after 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days or more in culture.
  • at least 2% of the human cardiomyocytes express the exogenous polypeptide at day 10 after incorporating.
  • about 2%, or about 5%, or about 10% or more of the human cardiomyocytes in the population of cells subjected to the electroporation express the exogenous polypeptide at day 10 after incorporating.
  • a method of stably integrating an insert sequence into genomic DNA of a target cell comprising contacting a composition to the target cell, the composition comprising a polynucleic acid, wherein the polynucleic acid comprises: an insert sequence, wherein the insert sequence comprises a sequence that is a reverse complement of a sequence encoding an exogenous polypeptide, and a mobile genetic element comprising a sequence encoding a polypeptide, wherein the polypeptide encoded by the sequence of the mobile genetic element promotes integration of the insert sequence into genomic DNA; stably integrating the insert sequence into the genomic DNA of the target cell; and expressing an exogenous polypeptide in the target cell, wherein the target cell is a human retinal pigment epithelial cell (RPE).
  • RPE retinal pigment epithelial cell
  • polynucleic acid is mRNA.
  • the mRNA is encapsulated in a nanoparticle for intracellular delivery.
  • the nanoparticle comprises a lipid.
  • the polynucleic acid is introduced into the RPE by contacting a composition, comprising, for example, the polynucleic acid and a delivery vehicle (e.g., a nanoparticle comprises a lipid) to the RPE such that it results in the successful uptake of the polynucleic acid by the RPE.
  • the incorporation is via electroporation.
  • the polynucleic acid composition is electroporated in the RPE.
  • the RPE is electroporated under conditions suitable for expression of the polynucleic acid-encoded polypeptides and conducive to the viability of the RPE.
  • the integration of the insert into the genome of the RPE is verified after incorporation the polynucleic acid by methods known to one of skill in the art, e.g., by genome sequencing.
  • the expression of the polypeptide from integrated insert sequence is verified at a suitable interval following incorporation of the polynucleic acid in the RPE, wherein the suitable interval is about 4, 6, 8, 10, 12, 24 or 48 hours.
  • the population of cells comprising the RPEs that have been subjected to the electroporation is cultured under conditions suitable for a RPE for at least about 2 hours, about 3 hours, about 4 hours, about 5 hours, about 6 hours, about 8 hours, about 10 hours or about 24 hours.
  • the RPE is cultured for about 48 hours, 72 hours, 96 hours or more under conditions suitable for a RPE for growth.
  • the expression of a polypeptide encoded by the polynucleotide is verified after 48, 72, or 96 hours, or after 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days or more in culture.
  • at least 2% of the human RPEs express the exogenous polypeptide at day 10 after incorporating.
  • about 2%, or about 5%, or about 10% or more of the human RPEs in the population of cells subjected to the electroporation express the exogenous polypeptide at day 10 after incorporating.
  • a method of stably integrating an insert sequence into genomic DNA of a target cell comprising contacting a composition to the target cell, the composition comprising a polynucleic acid, wherein the polynucleic acid comprises: an insert sequence, wherein the insert sequence comprises a sequence that is a reverse complement of a sequence encoding an exogenous polypeptide, and a mobile genetic element comprising a sequence encoding a polypeptide, wherein the polypeptide encoded by the sequence of the mobile genetic element promotes integration of the insert sequence into genomic DNA; stably integrating the insert sequence into the genomic DNA of the target cell; and expressing an exogenous polypeptide in the target cell, wherein the target cell is a human neuronal cell.
  • polynucleic acid is mRNA.
  • the mRNA is encapsulated in a nanoparticle for intracellular delivery.
  • the nanoparticle comprises a lipid.
  • the polynucleic acid is introduced into the neuronal cell by contacting a composition, comprising, for example, the polynucleic acid and a delivery vehicle (e.g., a nanoparticle comprises a lipid) to the neuronal cell such that it results in the successful uptake of the polynucleic acid by the neuronal cell.
  • the incorporation is via electroporation.
  • the polynucleic acid composition is electroporated in the neuronal cell.
  • the neuronal cell is electroporated under conditions suitable for expression of the polynucleic acid-encoded polypeptides and conducive to the viability of the neuronal cell.
  • the integration of the insert into the genome of the neuronal cell is verified after incorporation the polynucleic acid by methods known to one of skill in the art, e.g., by genome sequencing.
  • the expression of the polypeptide from integrated insert sequence is verified at a suitable interval following incorporation of the polynucleic acid in the neuronal cell, wherein the suitable interval is about 4, 6, 8, 10, 12, 24 or 48 hours.
  • the population of cells comprising the neuronal cells that have been subjected to the electroporation is cultured under conditions suitable for a neuronal cell for at least about 2 hours, about 3 hours, about 4 hours, about 5 hours, about 6 hours, about 8 hours, about 10 hours or about 24 hours.
  • the neuronal cell is cultured for about 48 hours, 72 hours, 96 hours or more under conditions suitable for a neuronal cell for growth.
  • the expression of a polypeptide encoded by the polynucleotide is verified after 48, 72, or 96 hours, or after 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days or more in culture.
  • at least 2% of the human neuronal cells express the exogenous polypeptide at day 10 after incorporating.
  • about 2%, or about 5%, or about 10% or more of the human neuronal cells in the population of cells subjected to the electroporation express the exogenous polypeptide at day 10 after incorporating.
  • Example 1 Exemplary retrotransposon designs constructs: [00640] Provided here are exemplary strategies of designing retrotransposon constructs for incorporating into the genome of a cell and expressing an exemplary transgene.
  • FIG.1B and FIG.1C illustrates various strategic designs for integrating an mRNA encoding transgene into the genome of a cell. GFP shown here in a box is an exemplary transgene.
  • the mRNA encoding the transgene (e.g., GFP) can be co-expressed with a nucleic acid sequence encoding an ORF2p protein, in either sense or antisense orientation; the respective coding sequences may be in a monocistronic or bicistronic construct shown under exemplary Cis- strategies (FIG.1B and FIG.1C).
  • CMV/T7 are promoters. [00641] On the other hand, the same could be directed to be expressed in a trans manner.
  • the trans- strategy can include a sequence encoding an ORF2p protein or both ORF1p and ORF2p proteins from a bicistronic sequence and an mRNA encoding a GFP in a sense or antisense direction in the 3’UTR of any gene.
  • the transgene is flanked by a retrotransposing sequence comprising transposase binding sequences, an A-box and B-box, and a poly A tail.
  • FIG. 2A illustrates three exemplary designs for expressing an exemplary transgene GFP by stably incorporating the sequence encoding GFP using the constructs.
  • the first construct comprises a sequence encoding GFP, flanked by L15’-UTR; and a poly A sequence at the 3’ UTR, in absence of any transposase binding elements.
  • the second and the third constructs comprise a sequence encoding GFP, a 3’UTR an A Box and a B-box, and a poly A sequence at the 3’ UTR.
  • the third construct comprises an additional sequence encoding ORF2p. Expected GFP expression levels at 72 hours are shown on the right side.
  • FIG. 2B illustrates three exemplary designs for expressing an exemplary transgene GFP in an mRNA that either encodes RFP or ORF2p by stably incorporating the sequence encoding GFP using the constructs.
  • the first construct comprises a sequence encoding RFP, and a poly A sequence at the 3’ UTR, in absence of any L1 elements.
  • the second and the third constructs comprise a 3’UTR comprising an A Box and a B-box, and a poly A sequence at the 3’ UTR.
  • the second construct comprises a sequence encoding RFP and the third construct comprises a sequence encoding ORF2p. Expected RFP and GFP expression levels at 72 hours are shown on the right side.
  • RNA–RNA binding interfaces are constructed by combining pairs of GNRA loop/loop–receptor interaction motifs, yielding high affinity, high specificity tertiary structures. (FIG.3B).
  • RNA monomers are designed that are capable of directional assembly in either the parallel (‘up–up’) or anti-parallel (‘up–down’) assembly modes. In anti-parallel assembly of interacting molecules, each incorporated monomer switches the directionality of the growing chain and thus compensates for its intrinsic bending, producing long, relatively straight multi-unit chains.
  • RNA folding program Mfold bioinfo.math.rpi.edu/ ⁇ zukerm/rna/mfold
  • RNA folding program Mfold bioinfo.math.rpi.edu/ ⁇ zukerm/rna/mfold
  • a fluorescence-based chip-flow piece testing method is utilized.
  • a library of potential variants of the structured RNA (chip piece) is synthesized as DNA templates and amplified to include sequencing adapters and regions for RNAP initiation.
  • Each DNA variant is transcribed in situ into RNA, enabling display of sequence-identified clusters of RNA on the surface of the sequencing chip.
  • the fluorescently-labeled tectoRNA binding partner, the "flow piece” is introduced to the sequencing chip flow cell at increasing concentrations, allowing quantification of bound fluorescence to each cluster of RNA after equilibration.
  • An mRNA is designed comprising ORF2 encoding sequence and a sequence encoding a gene of interest, to incorporate the gene of interest into the genome of a cell using ORF2.
  • the construct comprises an ORF2 that is further modified.
  • ORF2 protein initiates retrotransposition by binding to its own poly A sequence. However, because poly A is abundantly present in mRNAs, a non-specific binding and integration becomes a possibility.
  • a recombinant ORF2 is designed comprising an mRNA-binding domain of a heterologous protein, and the cognate mRNA sequence for the heterologous mRNA-binding domain is inserted near the poly A sequence in the 3’-UTR and the ORF2 poly A binding site.
  • a chimeric ORF2 is thereby generated as shown in (FIG. 4B), in which a high affinity RNA- binding domain of a heterologous protein encoding sequence is incorporated or fused to the ORF2 sequence and cognate RNA sequences corresponding to the high affinity RNA-binding protein is incorporated in the 3’UTR region of the mRNA, proximal to the poly A region.
  • the heterologous high affinity RNA-binding domain is derived from MCP coat protein MS2 (shown as M in the figure), is incorporated within the ORF2 sequence and the cognate sequence, the MS2 hairpin, is included in the 3’ UTR sequence of the mRNA (FIG.4B).
  • the MS2 binds to the cognate sequence, increasing the specificity of the chimeric ORF2 to its own mRNA for reverse transcribing and incorporating the respective sequence associated with the ORF2 mRNA in the mammalian cell genome (FIG. 4B).
  • attempts to increase specificity of integration of the transgene by the ORF2 within the genome of a target cell is undertaken.
  • Mega TAL encoding sequence fused to an ORF2 as shown in FIG. 4C (upper panel).
  • the ORF2 is mutated to remove its ability to recognize and bind to RNA sequence that has less specificity.
  • the fused protein is directed to the TAL binding sequence incorporated within the 3’UTR and perform endonuclease function.
  • the Mega TAL DNA binding sequence is targeted by the fusion protein.
  • other chimera FIG. 4C (middle panel)
  • fusion protein with a specific DNA binding domain FIG. 4C (lower panel) are designed.
  • plasmid vectors are generated for delivery and incorporation of a recombinant LINE-1 construct comprising an ORF2 transposon element operably linked to a transgene transposable into a mammalian cell, and regulatory elements for mRNA transcription and stabilization.
  • the mRNA can be transcribed in a bacterial host cell, which can be further processed and/or purified for introduction into a mammalian cell in vitro or administration in an organism, such as a mammal, a rodent, sheep, pig or a human.
  • Any suitable vector backbone is used for incorporating the recombinant nucleic acid sequence as insert and transcribing in a bacterial system for mRNA generation; or in vitro transcription system may be utilized to generate an mRNA comprising the recombinant nucleic acid sequence.
  • Several features are added to the plasmid. Upon successful scalable mRNA production, and purification, the mRNA may be introduced in a mammalian cell of interest, such as a myeloid cell.
  • Plasmids traditionally used in the field of study for retrotransposition lack designer genes, gene blocks, and Gibson assembly methods were used regularly to insert different features.
  • a new vector that takes features from the old vectors but has flexibility to insert new features can be beneficial both for the study and optimization of LINE-1 elements as a gene delivery system.
  • FIG. 5(I) which contains the natural LINE-1 sequence with the original 5’UTR, 3’UTR and interORF sequence with no restriction sites to swap out any of these features.
  • New optimized plasmid ⁇ Removed Dox inducible promoter, replaced with CMV or EIF1a or EF1a promoter ⁇ Added a T7 site to make mRNA ⁇ Codon optimized ORF1 and ORF2 ⁇ Added a WPRE element to stabilize mRNA ⁇ Added FLAG tag to ORF2 to help with protein detection ⁇ Decreased size from 18kb to 14kb ⁇ Added blunt restriction sites (dotted lines with blunt arrows) at each feature to facilitate insertions ⁇ Includes a G418 selection marker [00652] The plasmid is shown in FIG.5 (II). [00653] With Gibson a reverse split GFP is inserted for plasmid reporter gene as shown in FIG. 5 (III).
  • FIG.5 (IV) A complete reverse GFP for the mRNA reporter is inserted as in FIG.5 (IV).
  • a nuclear localization sequence NLS
  • IRES nuclear localization sequence
  • FIG. 5 (VII) An IRES or another termination/promoter sequence is inserted to increase expression of ORF2 (FIG. 5 (VII)).
  • MS2 hairpins are inserted in the 3’UTR and a MS2 coat protein sequence in the N terminus of the ORF2 protein (FIG.5 (VIII)).
  • a corresponding exemplary ORF2 with enhanced specificity and its mechanism of action is disclosed in the preceding example and in FIG. 4B.
  • an Alu element is inserted in the 3’UTR of the mRNA (FIG. 5 (IX)).
  • the ORF2’s RT domain is replaced with the Group II intron’s reverse transcriptase domain (FIG. 5 (X)).
  • the minke whale genome has the highest number and percentage of active LINE elements ( ⁇ 5,000 with 60% active compared to humans that have 480 with 3.6% active).
  • the two sequences are 67% identical and the whale sequence has the active endonuclease and reverse-transcriptase residues.
  • the respective minke whale domains can be used to replace native ORF2 endonuclease and/or RT domains or design a chimera domain.
  • Example 5 mRNA design synthetic mRNA generation [00655] mRNA can be strategically designed for synthetic production by oligosynthesis and or ligation of oligonucleotides. Additionally, such designs are useful for in vitro transcription (IVT) mediated mRNA generation.
  • the mRNA strategy can include the same variants as the plasmid strategy discussed in the previous example.
  • Example 6 Structural features for increased mRNA half-life
  • structural features are introduced in the mRNA comprising the retrotransposition elements and/or the transgene for increasing the mRNA half-life. The goal is to increase the duration of protein expression from the mRNA in primary monocytes from three days to at least 5 days with an ultimate goal of 10 days. [00657] As shown in FIG.
  • the mRNA comprising a sequence encoding the transgene when introduced into a CD14+ myeloid cell (monocyte), is translated and expresses a chimeric receptor (an ATAK construct) capable of binding to an antigen on a cancer cell.
  • a number of mRNA designs are generated by synthesizing various gene blocks comprising singly, or combinations of one or more of: (i) a G-quadruplex, (ii) a viral pseudoknot structure in the 5’ UTR; and/or (iii) one or (iv) more xrRNA loop structures in the 3’ UTR (v) a triplex RNA structure as shown in FIG.
  • constructs are individually prepared by an off-site vendor and tested in- house for determining stability of the mRNA, as measured by the expression of the chimeric receptor (An exemplary receptor and its function is depicted graphically in FIG. 7B (left). The process flow chart is shown on FIG.7B (right).
  • constructs are cloned into plasmids, with encoded or modified poly A tails. The mRNA was transcribed and purified. Meanwhile, frozen monocytes are thawed and harvested.
  • LINE-1 Retrotransposon plasmid mediated delivery of GFP gene [00659] In this test run, genomic integration of a GFP cargo and expression the GFP protein using a LINE-1 retrotransposon system was verified.
  • the LINE-1-GFP construct (LINE-1 plasmid GFP) is exemplified in FIG. 8A: A plasmid construct having a LINE-1 sequence encoding ORF1p (ORF1), a sequence encoding ORF2p (ORF2), and a CMV promoter driven split GFP gene situated in the 3’UTR of the LINE-1 in reverse orientation with respect to the ORFs.
  • the split GFP is designed to have an intronic sequence inserted in between a splice donor and acceptor sites, which ensures that the GFP is expressed only after integration and splicing mediated removal of the noncoding sequence in the middle of the coding sequence.
  • the cargo is 2.1 kb.
  • HEK293T cells were transfected with the plasmid using Fugene reagent, and plasmid positive cells were selected by puromycin.
  • the mRNA generated from a genome integrated GFP successfully translates and is measured by flow cytometry, as indicated as change in mean fluorescence intensity (MFI) (FIG.8B) and fraction of cells with GFP fluorescence intensity compared to mock transfected cells (FIG.8C).
  • Example 8 LINE-1 Retrotransposon plasmid mediated delivery of a chimeric receptor gene
  • a recombinant gene can be successfully expressed using the LINE-1 sequence in a cell.
  • HEK 293 cells were transfected with a plasmid having the LINE-1 elements, with a 3 kb cargo sequence encoding recombinant receptor protein CD5-intron-fcr-PI3K (ATAK) that is interrupted by an intron sequence in the CD5 binding domain.
  • ATAK recombinant receptor protein
  • the cargo is a chimeric receptor that has a CD5 binding extracellular domain, a FCR ⁇ transmembrane domain, and an intracellular domain having a PI3-kinase recruitment domain.
  • the schematic representation of the retrotransposon plasmid is shown in FIG. 9A.
  • the ATAK receptor cannot express unless it is integrated in the genome and the intron is spliced off.
  • the receptor expression is detected using labeled CD5 as bait for the CD5 binding extracellular domain.
  • Results shown in FIG. 9B and 9C show successful integration and expression of the receptor. 36.5% cells were ATAK (CD5 binder) positive (FIG.9C).
  • a LINE-1 construct (LINE-1plasmid-cd5_fcr-pi3k_t2a_GFPintron) with a longer 3.7 kb cargo sequence encoding a non-interrupted recombinant receptor protein CD5-intron- fcr-PI3K and an interrupted GFP sequence with a T2A sequence between receptor and the GFP sequences (FIG. 10A).
  • FIG. 10B Normalized against mock-transfected cells, there was a greater than 10-fold increase of the ATAK receptor and GFP double-positive cells was noted (FIG. 10B).
  • FIG.10C and FIG.10D Exemplary fluorescence identification of GFP and fluorescent tagged CD5 binding and gating quantitation for experimental runs are shown in FIG.10C and FIG.10D.
  • Example 9 mRNA encoding LINE-1 Retrotransposon for delivery of a cargo gene [00662]
  • capability of delivering and expressing a LINE-1 retrotransposable gene sequence as an mRNA was tested.
  • An mRNA encoding an ORF1 (ORF1-FLAG-mRNA), and an mRNA encoding ORF2 and GFP in the antisense direction with a CMV promoter sequence (ORF2-FLAG-GFPai) are designed as shown in FIG.11A.
  • the cargo size in this assay was 2.4 kb, and GFP is in antisense orientation with respect to ORF2 sequence.
  • the mRNAs were electroporated in 293T cells and the reporter genes expression was demonstrated as shown in FIG.11B.
  • This experimental set up demonstrated that no ORF1- readthrough is necessary for the expression of the ORF2p, and expression of ORF2p from a different mRNA molecule can allow higher expression of ORF2p and GFP. With these results, a successful delivery of the LINE-1 and cargo in the form of mRNA was achieved.
  • FIG.12B shows fluorescent microscopy image of GFP+ cells following retrotransposon mRNA electroporation.
  • a complete LINE-1 mRNA encoding both ORF1 and ORF2 and GFP transgene in antisense orientation in a single mRNA molecule was tested for delivery and genomic integration in a cell.
  • mRNA contains the bicistronic ORF1 and ORF2 sequence with a CMV-GFP sequence in the 3’UTR going from 3’-5’ (FIG. 13A).
  • the cargo size is 2.4 kb.
  • the inter-ORF region is manipulated as follows: (a) In one construct the inter-ORF region is replaced with an IRES from CVB3; (b) In another construct, the inter-ORF region is replaced with an IRES from EV71; (c) In three separate constructs, an E2A or P2A or T2A self-cleavage sequence is intercalated in the inter-ORF region. Result are as shown in FIG.16. Compared to the LINE-1 plasmid GFP (LINE-1 wild type plasmid) led to only modest changes in the GFP readout, especially with T2A sequence insertion. Insertion of EV71 IRES sequence improved GFP expression, while CVB3 IRES did not show any improvement. Example 12.
  • Retrotransposition in an immune cell To test retrotransposition in immune cells, LINE-1 plasmid and mRNA were tested with the CMV-GFP antisense reporter cargo by electroporating into Jurkat cells, which is a T cell lymphoma line (FIG. 17A-FIG. 17B). Mock set were electroporated with a plasmid with no GFP sequence. GFP expression in the transfected cells was assessed, representative data at 4 days post electroporation is shown in FIG.17B. Fold increase is reported relative to mock transfected cells. Both plasmid and mRNA delivery modes resulted in successful GFP expression.
  • THP-1 cells (a myeloid, monocytic cell line) were electroporated with a plasmid having LINE-1 sequences and a 3.7 kb cargo encoding a chimeric HER-2 binding receptor, and a split GFP (LINE- 1 plasmid Her2-Cd3z-T2A-GFPintron) (FIG. 18A).
  • the cargo is a chimeric receptor that comprises a HER2 binding extracellular domain, a CD3z transmembrane domain, and split GFP reporter.
  • the plasmid was successfully integrated into the genome and showed prolonged expression, as demonstrated in FIG. 18B. Representative expression at day 6 post transfection is shown in the figure.
  • LINE-1 mediated gene delivery can result in successful stable genomic integration in various cell types, including epithelial cell types (HEK-293T cells); T cells (e.g., Jurkat cells); and cells of myeloid lineage (e.g., THP-1 cells) and results in prolonged expression.
  • HEK-293T cells epithelial cell types
  • T cells e.g., Jurkat cells
  • myeloid lineage e.g., THP-1 cells
  • retrotransposition can result in integration of large genetic cargo, and, these can be delivered as a single nucleic acid construct.
  • Example 13 External methods for further enhancing efficiency of LINE-1 mediated retrotransposition of the cargo sequences [00671] In this section, methods for further enhancing the efficiency of retrotransposition of cargo sequences into the genome of cells are detailed.
  • Cell cycle synchronization by selection of cells in a population that are in a certain stage of cell cycle or G1 arrest by a suitable agent can lead to higher nucleic acid uptake efficiency, e.g., plasmid vector transfection efficiency or electroporation efficiency.
  • nucleic acid uptake efficiency e.g., plasmid vector transfection efficiency or electroporation efficiency.
  • cells are pre-sorted and each group is separately electroporated to ensure uniform electroporation. The efficiencies of electroporation are compared between these groups and a cell cycle stage that results in highest efficiency as determined by the expression of the GFP test plasmid or mRNA is selected (FIG.19).
  • cells are synchronized with or without sorting by treating the cells, with a cell cycle arrest reagent for a few hours prior to electroporation.
  • An exemplary list of cell cycle arrest reagents is provided in Table 1. The list is non-exhaustive, and is inclusive of reagents that can be proapoptotic, and hence careful selection suitable for the purpose and dose and time of incubation is optimized for use in the particular context. Table 1.
  • retrotransposition is enhanced by inducing DNA double stranded breaks (DSB) in a cell that expresses a retrotransposition machinery as described in any of the examples above by controlled irradiation, which create opportunities for the homologous recombination and priming for the reverse transcriptase (FIG. 20).
  • DSB DNA double stranded breaks
  • FIG. 20 cells transfected with LINE-1 plasmid GFP construct and subjected to an irradiation pulse. GFP expression is monitored. The intensity and time of irradiation is optimized for obtaining the maximum benefit, as indicated by higher GFP expression.
  • cells transfected with LINE-1 plasmid GFP were divided into experimental sets that are treated as follows (i) irradiation in order to induce DSB (as described above); (ii) treat cells in this set with a small molecule, such as SCR7, that blocks DNA ligase and therefore inhibits the DNA damage repair machinery. Preventing protective repair mechanism from inhibiting the progress of the retrotransposition is expected to enhance GFP expression: (iii) irradiate the cells then treat the cells with SCR7, combination of the two is expected to show a more robust effect. GFP expression is monitored over a period of 6 days, and the set that shows maximum GFP fluorescence over the longest period indicates a condition that is adopted in further studies.
  • Example 14 Enhancing efficiency of LINE-1 mediated retrotransposition of the cargo sequences by further modification of the construct [00676]
  • a LINE-1 plasmid-GFP is further modified to test for increased GFP expression as follows: (a) In one construct, the 5’UTR is replaced with an UTR of a complement gene; (b) In another construct, the 3’ UTR is replaced with the UTR sequence of B-globin gene for increased stability; (c) In another construct the inter-ORF region is replaced with an IRES from CVB3; (d) In another construct, the inter-ORF region is replaced with an IRES from EV71 (e) In three separate constructs, an E2A or P2A or T2A self-cleavage sequence is intercalated in the inter-ORF region as shown in a diagrammatic representation in FIG.21.
  • LINE-1 plasmid-GFP is further modified to test for increased GFP expression as follows: (a) the ORF2 encoding sequence is fused with a nuclear localization sequence (NLS) (graphically represented in FIG.15A second construct from top). (b) the ORF1 encoding sequence is fused with a nuclear localization sequence (NLS), graphically represented in FIG.
  • NLS nuclear localization sequence
  • HEK-293T cells were transfected with constructs (a)- (f) and the LINE- plasmid GFP construct in parallel. GFP expression is monitored after transfection into HEK293T cells. The set that shows maximum GFP fluorescence over the longest period is adopted.
  • III Modifying construct to increase LINE-1-protein-RNA complex binding to the ribosome.
  • an additional sequence is inserted in the 3’UTR of the LINE-1 construct to increase association of the LINE-1 protein RNA construct to the ribosomes, the sequence is an Alu element, or a ribosome binding aptamer (FIG.23).
  • a sequence containing MS2 binding loop structure is introduced into the 3’UTR of the LINE-1, and a sequence encoding MS2 RNA binding domain is fused to the RNA binding domain of the ORF2p-RT (graphically represented in FIG.4A and 4B, and FIG.24, construct SEQ ID NO: 15).
  • the fused protein will specifically attach to the MS2-binding structural motif in the 3’ UTR, and therefore any non-specific binding and retrotransposition is minimized (FIG.24).
  • GFP expression is monitored after transfection into HEK293T cells.
  • the ORF is fused with the protein binding sequences shown in left column of Table 3 below, combined with a cognate sequence inserted in the 3’UTR region of the ORF2 shown in the corresponding right column in the same row.
  • Table 3 Exemplary list of elements to enhance translation efficiency and stability of the LINE-1 proteins and increased expression of LINE-1 proteins.
  • the LINE-1 plasmid GFP is cut at the 3’end of the endonuclease coding sequence of ORF2, and a sequence encoding the DNA binding domain (DBD) of a heterologous zinc finger protein (ZFP) is inserted.
  • the endonuclease domain is fused with a CRISPR nuclease.
  • a variety of nucleases can be tested by modifying the LINE-1 plasmid GFP ORF by creating a fusion protein using DNA binding domains and cleavage domain as shown in a non-exhaustive list in Table 4,
  • two ORF-2 domains are encoded in one set to facilitate dimerization.
  • the construct that has higher GFP expression than the ORF2 endonuclease can be further selected.
  • the plasmid designs are graphically represented in FIG. 25. GFP expression is monitored after transfection of the plasmids into HEK293T cells, and the set that yielded best.
  • Table 4 Exemplary non-exhaustive list of additional DNA cleavage domains/enzymes that can be fused to or inserted in place of LINE-1 endonuclease.
  • the sequence encoding the human ORF2 in LINE-1plasmid GFP is excised and replaced with a sequence encoding MMLV or TGIRTII.
  • the ORF2 reverse transcriptase domain is fused with a DNA binding domain of a heterologous protein.
  • the reverse transcriptase domains and/or the DNA binding domains can be selected from a non-exhaustive list provided in Table 5A-Table 5B.
  • the constructs are graphically exemplified in FIG. 26. GFP expression is monitored after transfection into HEK293T cells.
  • Table 5A Selected non-exhaustive list of reverse transcriptase for replacing the LINE-1 RT for higher efficiency
  • Table 5B Selected non-exhaustive list of DNA-binding domains for fusing to a RT for higher efficiency
  • VII. Replacing human LINE-1 with LINE-1 from other organisms.
  • the sequence encoding human LINE-1 is replaced by a LINE-1 from a different organism.
  • the human LINE-1 construct is compared with a construct where the human LINE-1 is replaced by a minke whale LINE-1 sequence (FIG. 27). Using the same experimental framework, a number of ORFs are tested.
  • An exemplary non-exhaustive list is provided in Table 6 below.
  • the LINE-1 plasmid GFP ORF2 is fused with a domain of a MegaTAL nuclease, a CRISPR-CAS nuclease, a TALEN, R2 retroelement binding zinc finger binding domain, or a DNA binding domain that can bind to repetitive elements such as Rep78 AAV.
  • FIG. 28 exemplifies the deigns.
  • Table 7 provides a list of the different elements that can be fused to increase sequence specific retrotransposition.
  • GFP encoding payloads were constructed as follows: an antisense promoter sequence under doxycycline inducible control followed by antisense GFP gene split with an intron in the sense direction was placed downstream of the LINE-1 ORFs (FIG. 29). Splicing donor (SD) and splicing acceptor (SA) sequences are recognized and spliced out only when the mRNA is produced from the promoter in the top strand, therefore only the GFP gene integrated into genome from spliced mRNA generates fluorescent signal.
  • SD Splicing donor
  • SA splicing acceptor
  • the GFP expression was measured 35 days post doxycycline induction of the ORF expression using flow cytometry (green histogram) compared to a negative control plasmid (grey histogram).
  • the cargo size was 2.4 kb.
  • the cargo GFP gene in the previous construct was replaced with intron interrupted CD5-FcR- PI3K CAR-M sequence (Morrissey et al., 2018).
  • the CD5 binder expression was measured by flow cytometry using a Alexa647-conjugated CD5 protein such that retrotransposed cells are CD5-AF647 positive (red histogram) compared with a plasmid transfected negative control cell population (grey histogram) (FIG. 30). Successful expression of the 3.0 kb construct was demonstrated as shown in the figure. [00691]
  • the cargo gene length was extended by adding the intron-interrupted GFP gene after the T2A sequence downstream of the CD5-FcR-PI3K CAR-M sequence (FIG.31).
  • the CD5 binder expression was measured by flow cytometry using a Alexa647-conjugated CD5 protein.
  • the GFP expression is measured using flow cytometry (green histogram) compared to a negative control plasmid transfected cells (grey histogram).
  • the flow cytometry signal in the Q2 showed that 10.8% cells express both CAR-M and GFP proteins.
  • the payload size limit has not been reached with retrotransposon delivery and integration (Retro-T delivery) with a 3.9 kb payload.
  • the delivery mechanism described here was successful for expression of the first generation CART construct and GFP (separated by T2A site). In this example, different constructs were tested for retrotransposition efficiency of the insert sequence.
  • FIG. 33A shows gene delivery as mRNA results in successful integration. This data is the first to show that Retro T can be delivered as mRNA.
  • a trans strategy of using separate mRNAs encoding for ORF1 and ORF2 with antisense promoter and GFP cargo (ORF2-GFPai) in the 3’ UTR for gene delivery was explored, as exemplified graphically in FIG. 33B (top panel).
  • FIGs. 33B-33D demonstrate experimental results from multiple representative assays. Separate mRNAs that expression the LINE-1 proteins could reconstitute the RNA-protein complex required for retrotransposition.
  • the cis strategy uses a single bicistronic LINE-1 mRNA with the antisense promoter and GFP gene cargo in the 3’UTR.
  • FIG. 33D shows that introducing a single mRNA yields higher number of integrations per cell. Sorting of 293T GFP cells to enrich for retrotransposed cells for biochemical and integration assays. Cells are the same as in FIG.33B and show GFP expression 4 days post-sort in bottom panels.
  • the graph shows qPCR assay for genomic DNA integration from different LINE-1 plasmid transfected, LINE-1 mRNA (retro-mRNA), and ORF1 and ORF2-GFP mRNA electroporated cells.
  • Plasmid-transfected cells use a plasmid that does not contain and SV40 maintenance sequence. Integration per cell is calculated from determining copy numbers per samples through interpolation of a standard curve of plasmid and genomic DNA and normalizing for the two copies of RPS30 per 293T cell. Error bars denote standard deviation of three technical replicate measurements.
  • Example 16 Delivery to diverse cell types [00693] As shown in FIGs. 34-38, the mRNA constructs comprising a gene of interest, e.g.
  • a GFP protein can be efficiently expressed in diverse cell types, such as epithelial cells (e.g., HEK 293 cells), monocytic cells lines (e.g., THP-1 cells), lymphoblastic cell lines (e.g., K562 cells), and primary lymphocytes (T cells).
  • epithelial cells e.g., HEK 293 cells
  • monocytic cells lines e.g., THP-1 cells
  • lymphoblastic cell lines e.g., K562 cells
  • T cells primary lymphocytes
  • Activated primary T cells were also successfully transfected with mRNA with genomic integration and expression of GFP (FIG.36).
  • Primary T cells were isolated and expanded using IL7/IL15; and a 1 st Gen CAR construct was delivered on day 2 post activation. Cells sorted and frozen. GFP expression was detectable after a freeze-thaw cycle (FIG. 37A-B).
  • FIG. 38 shows a representative assay of GFP mRNA integration and expression in 293T cells, K562 cells, THP- 1 cells and Primary T cells.
  • Example 17. Modifying the retrotransposition system, exchanging for site-specificity of an integrase for genomic integration
  • large mRNA constructs are stably incorporated and expressed in non- dividing mammalian cell using the retrotransposon integration system into the genome of the cell with a high degree of location specificity using serine integrases. Retrotransposon constructs are designed as elaborated elsewhere in the disclosure.
  • an mRNA construct is designed to include Cas endonuclease fused with a serine integrase comprising a mutation in the catalytic domain that eliminates a possibility of double stranded polynucleotide integration by the integrase, and prime editing guide RNA (pegRNA) oligonucleotides directed to a specific genomic locus, e.g., a histone gene locus, an actin gene locus etc, depending on which the guide RNA is specifically designed.
  • pegRNA prime editing guide RNA
  • One or more T2A cleavage sites separate the coding sequence of the individual proteins, e.g. Cas9, and the serine integrase of the fragment thereof.
  • the pegRNAs are designed to insert a 41 bp AttB landing site.
  • a LINE 1 ORF2 binding site is incorporated that is located conveniently and in proximity (e.g., juxtaposed) for binding of an ORF2 protein in relation to the integrase binding site.
  • a second mRNA construct is designed to include a LINE1 mRNA fused with a cargo sequence that is greater than 5, 6, 7, 8, 9, 10 kilobases, and encoding a protein; a mutated endonuclease, and an AttP attachment site fused to the cargo sequence for the integrase to attract and bring the cargo sequence to the landing sequence.
  • the AttP attachment site is complementary to the AttB landing site.
  • the mRNA constructs are prepared through in vitro transcription and then purified. Each of resulting purified mRNA constructs are incorporated separately into lipid nanoparticles (LNP). Using electroporation, the two mRNA constructs are co-delivered using LNPs into cell. The Cas9 endonuclease fused to the pegRNAs is guided to insert the genomic landing sequence into the specific gene locus.
  • the AttB landing site acts like a beacon that attracts for the AttP attachment site, which by design is comprised within the cargo sequence that is associated with the LINE1 mRNA.
  • Enriching stably retrotransposed cells [00701] In an effort to increase the cell yield having stably integrated nucleic acid sequence a method of sorting and culturing was attempted, as described in this example. 293T cells were electroporated with LINE1-GFP mRNA produced by IVT and cultured in vitro for at least 3 days. Expression of GFP was determined periodically using flow cytometry, as shown in FIG.40. Genomic integration per genome was evaluated using quantitative PCR. Interpolations of nucleic acid encoding GFP in the genome per genome were evaluated using standard curves for GFP and a housekeeping gene (FAU).
  • FAU housekeeping gene
  • FIG.40 shows a sorting and enrichment culture of GFP positive cells.
  • FIG.40 shows a sorting and enrichment culture of GFP positive cells.
  • FIG.41C shows average number of GFP integrations per genome when gated at 10 ⁇ 3 units of GFP fluorescence intensity and at 10 ⁇ 4 units of GFP fluorescence intensity.
  • Integrated DNA encoded protein expression starts to be detectable at day 3 and peaks around day 6-7 (FIG.45).
  • genomic integration and expression of the LINE-1 GFP mRNA in K562 and THP-1 was quite low; integration was detected at about 0.067 – 0.155 per cell in K562 cells (FIG. 46).
  • THP-1 data not shown.
  • Higher LINE1-GFP mRNA concentrations (1500 and 2000 ng/ ⁇ l) caused cell death in these cells.
  • GFP mRNA expression in PD-0015 monocytes was detected at day 3 post electroporation, with detectable integration per cell. (FIG.47).
  • Steps were to be taken for more extensive DNase 1 treatment, and test mRNA batches were to be evaluated for residual plasmid before electroporation.
  • Accuracy in determination of integration levels in the genome could be improved by first enriching for integrated DNA sequence by PCR followed by paired end sequencing leading to mapping the integration sites within the genome.
  • Next generation sequencing is considered the gold standard in this respect, which involves gDNA extraction ⁇ shearing by sonication ⁇ DNA linkers ligated onto DNA ends ⁇ nested PCR (1: one primer for linker, second to integrated DNA, 2: Illumina sequencing adapters added) ⁇ paired-end sequencing.
  • Example 21 Example 21.
  • siRNAs (3 per target candidate) were made, electroporated in test cells along with LINE1-GFP mRNA and tested for alteration of the LINE- 1 GFP expression by flow cytometry and its genome integration by qPCR and a cocktail of the siRNA that help increase LINE-1 GFP integration and expression was selected for further titration. Results from the different siRNAs tested are shown in FIGs. 48-51. Knockdown of ADAR1, BRCA and RNASEL tested individually induced about 2-fold increase in integration of LINE1-GFP. ADAR2, RAD51 and APOEBEC3C each led to less than 1.5-fold increase, and let7 miRNA and TASOR each led to no increase.
  • LINE-1 GFP 2000 ng/ ⁇ L was electroporated with an siBRCA at 100, 200 and 300 ng/ ⁇ L in 293 cells, data shown at 4 days post electroporation.
  • the integration rate was approximately ⁇ 0.06 GFP copies per cell
  • siBRCA1_s459 100 ng/ ⁇ l increases integration by ⁇ 2- fold.
  • Data shown in FIG. 49 demonstrates that at day 6 post electroporation, each of siRNASEL and siADAR1 siRNAs separately increased integration about 2-fold.
  • siAPOBEC3C_s2617 increases GFP integration ⁇ 1.5-fold (FIG.50) at 6 days post electroporation. Table 11.
  • siRNA against ADAR, APOEBEC3C, BRCA and RNASEL were chosen for the siRNA cocktail.
  • concentration of the siRNAs for electroporation was titrated next. It was observed that LINE1-GFP mRNA at 1500 ng/ ⁇ L was slightly toxic (FIG.51).
  • FOG.51 the concentration of the siRNAs for electroporation was slightly toxic.
  • 75 ng/uL of each siRNA resulted in ⁇ 5-fold improvement of integration of GFP in 293T cells.
  • Efficiency of retrotransposition can be impacted by numerous variables, such as the level of retrotransposon gene integration and subsequent transcription and translation efficiency of an integrated gene.
  • variables such as LINE-1 mutations, mRNA sequence alterations/additions, and alterations in mRNA chemistry, are tested for their impact on increasing retrotransposition efficiency and expression of the construct in a cell.
  • mRNA modifications such as those that increase mRNA stability and protein expression
  • sequence modifications such as addition of nuclear localization sequences (NLSs) and introducing mutations in LINE-1 proteins to enhance localization and integration
  • methods to improve cargo expression and (4) bioinformatic analysis on various retroelements from different organisms.
  • the learnings from these experiments are adapted across a number of human cell types, including myeloid cells, T cells, hepatocytes, cardiomyocytes, neurons and retinal pigment epithelial cells, to determine the specificity and versatility of these approaches to different cell types.
  • test constructs include plasmid constructs and mRNA constructs comprising a sequence encoding GFP along with a promoter and a poly A sequence that is inserted in reverse orientation relative to the ORF1/2 genes in the retrotransposon complex as described elsewhere in the specification.
  • test constructs include constructs that contain the GFP gene in an antisense orientation interrupted by an intron in sense orientation.
  • test constructs include constructs without an intron.
  • Retrotransposition conditions can include reagents to enhance integration, with the GFP-retrotransposon delivered to the cells in vitro via electroporation and/or a transfection reagent. Electroporation conditions optimized for each specific cell type are used. Efficiency of integration is determined by flow cytometry, for example using gates set up based on SSC and FSC. GFP is measured in negative control and positive control to set gates for flow cytometry. An exemplary negative control used will be set at ⁇ 0.1% GFP+. An exemplary positive control used will be set at >90% GFP+. GFP is measured in negative control and positive control to set gates for flow cytometry.
  • An exemplary negative control used will be set at ⁇ 0.1% GFP+.
  • An exemplary positive control used will be set at >90% GFP+.
  • An exemplary measurement indicative of successful integration is measurement of GFP expression, as determined by flow cytometry, in >2% of cells by day 10 post retrotransposition.
  • Another exemplary measurement indicative of successful integration is measurement of GFP expression, as determined by flow cytometry, in >10% of cells by day 10 post retrotransposition.
  • Additional assays such as PCR and next generation sequencing (NGS) are performed, for example, to confirm integration. Next generation sequencing can be performed on the transfected/electroporated cells.
  • Exemplary mRNA structures that may directly impact mRNA stability and translation efficiency to which modifications will be tested to increase stability and protein expression include the 5' CAP, the poly(A) tail, and the untranslated regions (UTRs).
  • CAP untranslated regions
  • enzymatic incorporation of the 5’CAP and use of CAP analogies, such as 7-methylguanosine will be tested. Enzymatic incorporation of the 5’CAP may be efficient than using CAP analogs.
  • variation of the poly(A) tail length will be also be tested to determine whether the poly(A) tail length impacts translation efficiency.
  • variation of the percent GC content of mRNA will be tested to determine whether the GC content impacts translation efficiency. High GC content may increase mRNA secondary structure stability.
  • Low GC content may reduce translatability of the mRNA. Sequence-specific mRNA variations can be tested to arrive at an optimum GC content. In another exemplary method, substituting certain codons with rare codons and inserting modified nucleotides will be undertaken in order to determine if it can affect translation efficiency. Other exemplary nucleotide modifications that will be tested to increase stability and protein expression include use of 5-methylcytidine (m5C) and pseudouridine ( ⁇ ) nucleotides.
  • An exemplary measurement indicative of successful integration is measurement of GFP expression, as determined by flow cytometry, in >2% of cells by day 10 post retrotransposition.
  • Another exemplary measurement indicative of successful integration is measurement of GFP expression, as determined by flow cytometry, in >10% of cells by day 10 post retrotransposition.
  • Different mRNA production processes will also be tested for increased transcription of full- length mRNAs.
  • Exemplary NLS sequence modifications will be tested, such as for enhanced localization and integration, include various NLS sequences, placement of the NLS sequences upstream or downstream of LINE-1 elements and the number of NLS sequences used.
  • GFP is measured in negative control and positive control to set gates for flow cytometry.
  • an exemplary negative control used will be set at ⁇ 0.1% GFP+.
  • an exemplary positive control used will be set at >90% GFP+.
  • An exemplary measurement indicative of successful cargo gene expression is measurement of increased GFP expression, as determined by flow cytometry, in >10% of cells by day 10 post retrotransposition.
  • Exemplary sequence modifications that encode mutations in LINE-1 proteins that will be tested, such as for enhanced localization and integration include K3R of ORF1 protein and Y1180A of ORF2.
  • GFP is measured in negative control and positive control to set gates for flow cytometry.
  • an exemplary negative control used will be set at ⁇ 0.1% GFP+.
  • an exemplary positive control used will be set at >90% GFP+.
  • An exemplary measurement indicative of successful cargo gene expression is measurement of increased GFP expression, as determined by flow cytometry, in >10% of cells by day 10 post retrotransposition.
  • Example 21 Effect of introducing a nuclear localization signal in retrotransposition by human LINE1 constructs [00713]
  • several constructs were generated and tested in which a nuclear localization signal was inserted in different locations as described below, and retrotransposition activity was tested in HEK293T cells.
  • mRNA constructs containing one or more various NLSs and different numbers of total NLSs comprising the retrotransposon sequences described herein were electroporated in the 293T cells, and the number of insertions of a test gene in the genome of a cell was investigated.
  • NLSs were individually tested at the following positions in LINE1-GFP mRNA as summarized in FIG.53: (i) ORF1-N, in which an NLS was inserted at the N-terminal end of the sequence encoding ORF1 of a LINE1-GFP construct (FIG.54A); (ii) ORF1-C, in which an NLS was inserted at the C-terminal end of the sequence encoding ORF1 of a LINE1-GFP construct (FIG.55A), (iii) ORF2-N, in which an NLS was inserted at the N-terminal end of the sequence encoding ORF2 of a LINE1-GFP construct (FIG.
  • ORF2-N in which an SV40 NLS and a linker was inserted at the N-terminal end of the sequence encoding ORF2 of a LINE1-GFP construct
  • ORF2-C in which an NLS was inserted at the C-terminal end of the sequence encoding ORF2 of a LINE1-GFP construct
  • retrotransposition using the LINE GFP NLS constructs was measured in number of GFP insertions per cell (genome).
  • Table 12A [00715] As shown in FIGs 54B-54C and FIGs 55B-55C, NLS insertions at N-terminal and C-terminal of ORF1 sequence abolishes retrotransposition activity of the LINE-1 constructs. On the other hand, each of the constructs shown in FIGs.56A-58C showed some improvement in retrotransposition, with insertion of the NLS in either ORF2 N or C terminal. [00716] Table 12B details sequences relevant to the constructs in tests described for FIGs 56-56C. Table 12B [00717] With insertion of an NLS at the N terminal end of ORF2 sequence, about 2-fold increase in number of insertions per cell. (FIGs.56B, and 56C).
  • Table 12C details sequences relevant to the constructs in tests described for FIGs 57-57C.
  • Table 12C [00719]
  • insertion of the NLS at the ORF2 C terminus increases the retrotransposition by about 5 fold (FIG.58B-58C).
  • Table 12D details sequences relevant to the constructs in tests described for FIGs 58A-58C.
  • LINE-1-GFPai plasmid Screen for efficient LINE1 system for retrotransposition of various human cells.
  • a phylogenetic screen is undertaken across a large number of organisms using bioinformatics followed by laboratory testing, for selecting one or more hyperactive retrotransposon element that can efficiently move within human genome.
  • Over 10 million LINE-1 sequences from 503 different genomes were identified (Ivancevic et al., 2016), including ORF1 and ORF2 proteins with novel domain variations.
  • the ‘hyperactive’LINE-1 species were shown to display retrotransposition activity superior to that of human, rat and mouse. These elements will be cloned into LINE-1-GFPai plasmid and screened in HEK293T cells.
  • Test mRNA constructs comprising a sequence encoding GFP along with a promoter and a poly A sequence, inserted in reverse orientation relative to the ORF1/2 genes in the retrotransposon complex as described elsewhere in the specification are used for electroporating the cells.
  • Efficiency of integration is determined by flow cytometry and PCR.
  • GFP is measured in negative control and positive control to set gates for flow cytometry.
  • an exemplary negative control used will be set at ⁇ 0.1% GFP+.
  • an exemplary positive control used will be set at >90% GFP+. Integration will be tested using PCR.
  • An exemplary measurement indicative of successful integration is measurement of GFP expression, as determined by flow cytometry, in >10% of cells by day 10 post retrotransposition. Example 24.
  • An exemplary measurement indicative of successful cargo gene expression is measurement of increased GFP expression, as determined by flow cytometry, in >10% of cells by day 10 post retrotransposition.
  • Example 25 Adapting efficiency-optimized retrotransposon system for in vivo cargo gene delivery [00726]
  • the retrotransposon mRNA will be engineered for in vivo delivery using liver-targeting LNPs to detect an intracellular or secreted protein, in mice.
  • Cell-type specific miRNA targets in the 3’ UTR of the cargo gene mRNA will be applied to target it for degradation in undesirable cell types. LNPs will be tested for efficient delivery in vivo.
  • mice will be administered the LNP encapsulated mRNA constructs that comprise a sequence encoding GFP along with a promoter and a poly A sequence flanking the GFP encoding sequence.
  • the GFP gene is inserted in reverse orientation relative to the ORF1/2 genes in the retrotransposon complex as described elsewhere in the specification. Protein expression will be examined by imaging and test mice will be sacrificed and tissues harvested for histological analysis and PCR at determined time points. [00727] Cell-specific targeting is achieved following systemic administration of the LNP encapsulated mRNA wherein the LNPs comprise surface modification to display antibodies or ligands that recognize cognate counterparts in the target cell.
  • Retrotransposon fusion constructs are generated in which a targeting moiety is incorporated to ensure increase in targeting specificity of the ORF2p.
  • One method is to retarget LINE1 elements with cargo to specifically integrate into one of the genomic safe harbor (GHS) sites with a high and sustainable transcriptional activity.
  • GHS genomic safe harbor
  • AAVS1, CCR5 and ROSA26 are some of the GHS sites.
  • specific LINE1 elements are selected after suitable screen for identifying an efficient LINE1 element that readily transposes in human.
  • the selected LINE1 can be one that integrates into one of the GHS loci.
  • Another method is that the retrotransposon ORF2 is engineered bearing fusion of ORF2 with Cas9 and its mutants.
  • Cpf1 zinc finger element
  • TAL effector Zinc effector
  • Cas6-8 ‘cascade’ restriction endonuclease
  • the addition of homology arms of different length around the mRNA cargo will also be tested.
  • An exemplary construct is designed, comprising sequences encoding: ORF1; RT and dCas9; the cargo gene in antisense orientation, and a guide RNA to target site for priming RT activity.
  • exemplary constructs are designed and tested in which the ORF2p lacks an EN (deleted), and is fused with a Cas 9 or its mutants, a Cas 12a (Cpf1), a Cas6-8 ‘cascade’, a Meganuclease, a Zinc-finger nuclease, a TALEN, or a restriction endonuclease, which directs the specificity and introduces the nicks on the genomic DNA.
  • Exemplary constructs are designed and tested in which the ORF2p comprises a mutant EN that has reduced or altered activity, and is fused with a Cas 9 or its mutants, a Cas 12a (Cpf1), a Cas6-8 ‘cascade’, a Meganuclease, a Zinc-finger nuclease, a TALEN, or a restriction endonuclease, which directs the specificity and introduces the nicks on the genomic DNA.
  • constructs are designed and tested in which retrotransposon plasmids will be engineered that encode a fusion of ORF2 protein with Cas9 and Cas9 mutants.
  • mRNA containing ORF1 and mRNA encoding RT and dCas9 and the cargo gene in antisense orientation, and pegRNA will be delivered to target sites for priming RT activity.
  • the use of two sgRNA, each fused to a dCas9 nickase, may be evaluated to determine if introducing nicks upstream and downstream of targeted locations improves site-specific integration and orientation of gene cargo. If modified LINE-1 RT fusion protein can bind its own mRNA and transport to nucleus, pegRNA could target genomic region and prime RT activity (via dCas9 nickase activity) so the LINE-1 RT can reverse transcribe mRNA gene cargo for integration into genomic DNA.
  • Efficiency of integration will be determined by flow cytometry.
  • GFP is measured in negative control and positive control to set gates for flow cytometry.
  • an exemplary negative control used will be set at ⁇ 0.1% GFP+.
  • an exemplary positive control used will be set at >90% GFP+.
  • Integration will be confirmed by PCR.
  • the sites of genomic integration are analyzed using NGS. Any construct with preferential integration in the specific genome location is subjected to several cycles of directed evolution to improve its efficiency and/or integration precision.
  • An exemplary measurement indicative of successful gene integration and expression is 90% of cargo gene integrations detected in a specific genome location and GFP expression, as determined by flow cytometry, in >2% of cells by day 10 post retrotransposition.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Biotechnology (AREA)
  • Zoology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Engineering & Computer Science (AREA)
  • Biomedical Technology (AREA)
  • Wood Science & Technology (AREA)
  • Molecular Biology (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Plant Pathology (AREA)
  • Microbiology (AREA)
  • Physics & Mathematics (AREA)
  • Medicinal Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Mycology (AREA)
  • Epidemiology (AREA)
  • Immunology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Communicable Diseases (AREA)
  • Oncology (AREA)
  • Toxicology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Cell Biology (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Immobilizing And Processing Of Enzymes And Microorganisms (AREA)
  • Macromonomer-Based Addition Polymer (AREA)
PCT/US2022/028831 2021-05-11 2022-05-11 Methods and compositions for genomic integration Ceased WO2022241029A1 (en)

Priority Applications (12)

Application Number Priority Date Filing Date Title
CA3218780A CA3218780A1 (en) 2021-05-11 2022-05-11 Methods and compositions for genomic integration
GB2318472.4A GB2623653A (en) 2021-05-11 2022-05-11 Methods and compositions for genomic integration
JP2023570260A JP2024518100A (ja) 2021-05-11 2022-05-11 ゲノム組込みのための方法および組成物
MX2023013381A MX2023013381A (es) 2021-05-11 2022-05-11 Metodos y composiciones para la integracion genomica.
IL308445A IL308445A (en) 2021-05-11 2022-05-11 Methods and compositions for genomic integration
KR1020237042556A KR20240037192A (ko) 2021-05-11 2022-05-11 게놈 통합을 위한 방법 및 조성물
AU2022272235A AU2022272235A1 (en) 2021-05-11 2022-05-11 Methods and compositions for genomic integration
CN202280049196.6A CN117836009A (zh) 2021-05-11 2022-05-11 用于基因组整合的方法和组合物
BR112023023642A BR112023023642A2 (pt) 2021-05-11 2022-05-11 Métodos e composições para integração genômica
EP22808288.9A EP4337268A4 (en) 2021-05-11 2022-05-11 Methods and compositions for genomic integration
US18/157,052 US12319925B2 (en) 2021-05-11 2023-01-19 Methods and compositions for genomic integration
US19/187,426 US20250250584A1 (en) 2021-05-11 2025-04-23 Methods and compositions for genomic integration

Applications Claiming Priority (6)

Application Number Priority Date Filing Date Title
US202163187117P 2021-05-11 2021-05-11
US63/187,117 2021-05-11
US202163254791P 2021-10-12 2021-10-12
US63/254,791 2021-10-12
US202163274907P 2021-11-02 2021-11-02
US63/274,907 2021-11-02

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US18/157,052 Continuation US12319925B2 (en) 2021-05-11 2023-01-19 Methods and compositions for genomic integration

Publications (1)

Publication Number Publication Date
WO2022241029A1 true WO2022241029A1 (en) 2022-11-17

Family

ID=84029812

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2022/028831 Ceased WO2022241029A1 (en) 2021-05-11 2022-05-11 Methods and compositions for genomic integration

Country Status (11)

Country Link
US (2) US12319925B2 (https=)
EP (1) EP4337268A4 (https=)
JP (1) JP2024518100A (https=)
KR (1) KR20240037192A (https=)
AU (1) AU2022272235A1 (https=)
BR (1) BR112023023642A2 (https=)
CA (1) CA3218780A1 (https=)
GB (1) GB2623653A (https=)
IL (1) IL308445A (https=)
MX (1) MX2023013381A (https=)
WO (1) WO2022241029A1 (https=)

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2023182948A1 (en) * 2022-03-21 2023-09-28 Bio Adventure Co., Ltd. Internal ribosome entry site (ires), plasmid vector and circular mrna for enhancing protein expression
WO2024193739A1 (en) * 2023-03-23 2024-09-26 Ostravska Univerzita Method for producing proteins in host cells
US12319925B2 (en) 2021-05-11 2025-06-03 Myeloid Therapeutics, Inc. Methods and compositions for genomic integration
WO2025217194A1 (en) * 2024-04-09 2025-10-16 Typewriter Therapeutics, Inc. Repeat dosing of retrotransposons

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP7831937B2 (ja) 2019-09-03 2026-03-17 クリエイト・メディシンズ,インコーポレーテッド ゲノム組込みのための方法および組成物
WO2025229499A1 (en) * 2024-04-29 2025-11-06 Averna Therapeutics Ltd Compositions and methods for modulating t cells

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2004072290A1 (en) * 2003-02-07 2004-08-26 The Administrators Of The Tulane Educational Fund Mammalian retrotransposable elements
WO2009056321A1 (en) * 2007-10-31 2009-05-07 BUNDESREPUBLIK DEUTSCHLAND,letztvertreten durch den Präsidenten des Paul-Ehrlich-Instituts Controlled activation of non-ltr retrotransposons in mammals
WO2020131862A1 (en) * 2018-12-17 2020-06-25 The Broad Institute, Inc. Crispr-associated transposase systems and methods of use thereof
WO2021046243A2 (en) * 2019-09-03 2021-03-11 Myeloid Therapeutics, Inc. Methods and compositions for genomic integration

Family Cites Families (228)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4522811A (en) 1982-07-08 1985-06-11 Syntex (U.S.A.) Inc. Serial injection of muramyldipeptides and liposomes enhances the anti-infective activity of muramyldipeptides
US4470461A (en) 1982-09-30 1984-09-11 Phillips Petroleum Company Organic nitro compounds as cosurfactants in enhanced oil recovery processes
GB8601597D0 (en) 1986-01-23 1986-02-26 Wilson R H Nucleotide sequences
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
GB8809129D0 (en) 1988-04-18 1988-05-18 Celltech Ltd Recombinant dna methods vectors and host cells
EP0368684B2 (en) 1988-11-11 2004-09-29 Medical Research Council Cloning immunoglobulin variable domain sequences.
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
US5703055A (en) 1989-03-21 1997-12-30 Wisconsin Alumni Research Foundation Generation of antibodies through lipid mediated DNA delivery
DE3920358A1 (de) 1989-06-22 1991-01-17 Behringwerke Ag Bispezifische und oligospezifische, mono- und oligovalente antikoerperkonstrukte, ihre herstellung und verwendung
AU649066B2 (en) 1990-07-25 1994-05-12 Syngene, Inc. Circular extension for generating multiple nucleic acid complements
US5571894A (en) 1991-02-05 1996-11-05 Ciba-Geigy Corporation Recombinant antibodies specific for a growth factor receptor
GB9114948D0 (en) 1991-07-11 1991-08-28 Pfizer Ltd Process for preparing sertraline intermediates
FI941572L (fi) 1991-10-07 1994-05-27 Oncologix Inc Anti-erbB-2-monoklonaalisten vasta-aineiden yhdistelmä ja käyttömenetelmä
US5858784A (en) 1991-12-17 1999-01-12 The Regents Of The University Of California Expression of cloned genes in the lung by aerosol- and liposome-based delivery
US5633234A (en) 1993-01-22 1997-05-27 The Johns Hopkins University Lysosomal targeting of immunogens
WO1994025591A1 (en) 1993-04-29 1994-11-10 Unilever N.V. PRODUCTION OF ANTIBODIES OR (FUNCTIONALIZED) FRAGMENTS THEREOF DERIVED FROM HEAVY CHAIN IMMUNOGLOBULINS OF $i(CAMELIDAE)
US5773244A (en) 1993-05-19 1998-06-30 Regents Of The University Of California Methods of making circular RNA
FR2709309B1 (fr) 1993-08-25 1995-11-10 Centre Nat Rech Scient Compositions cellulaires, préparation et utilisations thérapeutiques.
US5631236A (en) 1993-08-26 1997-05-20 Baylor College Of Medicine Gene therapy for solid tumors, using a DNA sequence encoding HSV-Tk or VZV-Tk
US5641875A (en) 1993-09-30 1997-06-24 University Of Pennsylvania DNA encoding chimeric IgG Fc receptor
US5639642A (en) 1994-06-16 1997-06-17 Novo Nordisk A/S Synthetic leader peptide sequences
US6300090B1 (en) 1994-07-29 2001-10-09 The Rockefeller University Methods of use of viral vectors to deliver antigen to dendritic cells
US5641870A (en) 1995-04-20 1997-06-24 Genentech, Inc. Low pH hydrophobic interaction chromatography for antibody purification
US5869046A (en) 1995-04-14 1999-02-09 Genentech, Inc. Altered polypeptides with increased half-life
US5766903A (en) 1995-08-23 1998-06-16 University Technology Corporation Circular RNA and uses thereof
US20030121063A1 (en) 1995-11-16 2003-06-26 The Trustees Of The University Of Pennsylvania Compositions and methods of use of mammalian retrotransposons
US6150160A (en) 1995-11-16 2000-11-21 The John Hopkins University Compositions and methods of use of mammalian retrotransposons
US6734014B1 (en) 1996-02-08 2004-05-11 The United States Of America As Represented By The Department Of Health And Human Services Methods and compositions for transforming dendritic cells and activating T cells
EP1056834A2 (en) 1998-02-20 2000-12-06 The Rockefeller University Apoptotic cell-mediated antigen presentation to dendritic cells
US6210931B1 (en) 1998-11-30 2001-04-03 The United States Of America As Represented By The Secretary Of Agriculture Ribozyme-mediated synthesis of circular RNA
US6576463B1 (en) 1999-01-15 2003-06-10 The Regents Of The University Of California Hybrid vectors for gene therapy
AU1100201A (en) 1999-10-28 2001-05-08 Board Of Trustees Of The Leland Stanford Junior University Methods of in vivo gene transfer using a sleeping beauty transposon system
AU2001257362A1 (en) 2000-04-28 2001-11-12 University Of Pittsburgh Of The Commonwealth System Of Higher Education The use of tolerogenic dendritic cells for enhancing tolerogenicity in a host and methods for making the same
US7176243B2 (en) 2000-06-02 2007-02-13 The General Hospital Corporation CaR receptor as a mediator of migratory cell chemotaxis and/or chemokinesis
AU2001297703B2 (en) 2000-11-07 2006-10-19 City Of Hope CD19-specific redirected immune cells
US8709412B2 (en) 2001-06-29 2014-04-29 The Board Of Trustees Of The Leland Stanford Junior University Modulation of TIM receptor activity in combination with cytoreductive therapy
US20060183226A1 (en) 2002-01-31 2006-08-17 Haruhiko Fujiwara Methods for retrotransposing long interspersed elements (lines)
CA2476452A1 (en) 2002-02-15 2003-08-28 Zycos Inc. Electroporation methods for introducing bioactive agents into cells
US20080254027A1 (en) 2002-03-01 2008-10-16 Bernett Matthew J Optimized CD5 antibodies and methods of using the same
AU2003233734C1 (en) 2002-06-05 2011-01-20 Her Majesty The Queen In Right Of Canada, As Represented By The Minister Of Agriculture And Agri-Food Retrons for gene targeting
EP1509244B1 (en) 2002-06-06 2011-07-27 Immunicum AB New method and composition for producing a cellular allogeneic vaccine
US20060239962A1 (en) 2002-12-04 2006-10-26 Banchereau Jacques F Rapid one-step generation of antigen loaded dendritic cell vaccine from precursors
US8007805B2 (en) 2003-08-08 2011-08-30 Paladin Labs, Inc. Chimeric antigens for breaking host tolerance to foreign antigens
US8198020B2 (en) 2003-08-22 2012-06-12 Potentia Pharmaceuticals, Inc. Compositions and methods for enhancing phagocytosis or phagocyte activity
US7709625B2 (en) 2004-06-10 2010-05-04 The Board Of Regents Of The University Of Texas Methods and compositions for bone marrow stem cell-derived macrophage delivery of genes for gene therapy
CN105168250B (zh) 2004-10-25 2019-02-05 塞勒兰特治疗公司 增殖骨髓细胞群体的方法及其应用
GB2421948A (en) * 2004-12-30 2006-07-12 Ist Superiore Sanita Retrotransposon inhibition to treat cancer
US20060188891A1 (en) 2005-02-23 2006-08-24 Bickmore William D Jr Methods and apparatus for controlling DNA amplification
US20060257359A1 (en) 2005-02-28 2006-11-16 Cedric Francois Modifying macrophage phenotype for treatment of disease
US20090191202A1 (en) 2005-09-29 2009-07-30 Jamieson Catriona Helen M Methods for manipulating phagocytosis mediated by CD47
US7926300B2 (en) 2005-11-18 2011-04-19 Cree, Inc. Adaptive adjustment of light output of solid state lighting panels
EP2004237A1 (en) 2006-04-03 2008-12-24 Keele University Targeted therapy
JP2009535065A (ja) 2006-05-04 2009-10-01 アブマクシス・インコーポレイテツド 組換えタンパク質の高レベルを産生する安定した哺乳動物細胞系を作製するための方法
EP2046347A2 (en) 2006-07-20 2009-04-15 Gourmetceuticals, LLC Phosphorylated glucomannan polysaccharide for receptor mediated activation and maturation of monocyte-derived dendritic cells
US7833789B2 (en) 2006-08-01 2010-11-16 Fondazione Centro San Raffaele Del Monte Tabor Monocyte cell
CN1951499A (zh) 2006-10-09 2007-04-25 中国农业大学 一种细胞免疫疫苗及其制备方法
US10155038B2 (en) 2007-02-02 2018-12-18 Yale University Cells prepared by transient transfection and methods of use thereof
EP2160461B1 (en) 2007-07-04 2012-08-08 Max-Delbrück-Centrum für Molekulare Medizin (MDC) Hyperactive variants of the transposase protein of the transposon system sleeping beauty
AU2009205665B2 (en) 2008-01-15 2013-12-05 The Board Of Trustees Of The Leland Stanford Junior University Methods for manipulating phagocytosis mediated by CD47
WO2010010119A1 (en) 2008-07-22 2010-01-28 Ablynx Nv Amino acid sequences directed against multitarget scavenger receptors and polypeptides
MX2011000970A (es) 2008-08-29 2011-03-15 Symphogen As Anticuerpos anti-cd5.
EP2331680B1 (en) 2008-09-22 2017-05-03 Baylor College Of Medicine Methods and compositions for generating an immune response by inducing cd40 and pattern recognition receptor adapters
US9080211B2 (en) 2008-10-24 2015-07-14 Epicentre Technologies Corporation Transposon end compositions and methods for modifying nucleic acids
EP2248903A1 (en) * 2009-04-29 2010-11-10 Universitat Autònoma De Barcelona Methods and reagents for efficient and targeted gene transfer to monocytes and macrophages
US9101674B2 (en) 2010-03-29 2015-08-11 Vib Vzw Targeting and in vivo imaging of tumor-associated macrophages
AU2011239569B2 (en) 2010-04-16 2014-07-24 Baylor College Of Medicine Method for treating solid tumors
WO2012005763A1 (en) 2010-07-06 2012-01-12 The Scripps Research Institute Use of myeloid-like progenitor cell populations to treat tumors
ES2754394T3 (es) 2010-09-08 2020-04-17 Chemotherapeutisches Forschungsinstitut Georg Speyer Haus Receptores de antígenos quiméricos con una región bisagra optimizada
WO2012043651A1 (ja) 2010-09-30 2012-04-05 国立大学法人 熊本大学 ミエロイド系血液細胞の製造方法
US9206479B2 (en) 2011-02-09 2015-12-08 University Of Rochester Methods and compositions related to Staufen 1 binding sites formed by duplexing Alu elements
EP3792359A1 (en) 2011-03-30 2021-03-17 Transine Therapeutics Limited Functional nucleic acid molecule and use thereof
PL3586861T3 (pl) 2011-06-08 2022-05-23 Translate Bio, Inc. Kompozycje nanocząstek lipidowych i sposoby dostarczania mrna
JP6153526B2 (ja) 2011-09-06 2017-06-28 エージェンシー フォー サイエンス,テクノロジー アンド リサーチ ポリペプチドワクチン
WO2013051718A1 (ja) 2011-10-07 2013-04-11 国立大学法人三重大学 キメラ抗原受容体
US9149519B2 (en) 2012-01-17 2015-10-06 New York University Chimeric human immunodeficiency virus type 1 (HIV-1) with enhanced dendritic cell and macrophage tropism comprising the simian immunodeficiency virus (SIV) minimal Vpx packaging domain
KR102338833B1 (ko) 2012-02-06 2021-12-13 인히브릭스, 인크. Cd47 항체 및 그 사용 방법
US20140140989A1 (en) 2012-02-06 2014-05-22 Inhibrx Llc Non-Platelet Depleting and Non-Red Blood Cell Depleting CD47 Antibodies and Methods of Use Thereof
JP6850528B2 (ja) 2012-02-13 2021-03-31 シアトル チルドレンズ ホスピタル ドゥーイング ビジネス アズ シアトル チルドレンズ リサーチ インスティテュート 二重特異性キメラ抗原受容体およびその治療的使用
WO2013123088A1 (en) 2012-02-14 2013-08-22 Loma Linda University Agents and method for treating inflammation-related conditions and diseases
EP2639313A1 (en) 2012-03-14 2013-09-18 Rheinische Friedrich-Wilhelms-Universität Bonn High-resolution transcriptome of human macrophages
KR102437522B1 (ko) 2012-05-25 2022-08-26 셀렉티스 면역요법을 위한 동종이형 및 면역억제제 저항성인 t 세포의 조작 방법
CN103483452B (zh) 2012-06-12 2021-08-13 上海细胞治疗集团有限公司 双信号独立的嵌合抗原受体及其用途
ES2528892T3 (es) 2012-07-30 2015-02-13 Nbe-Therapeutics Llc Identificación mediada por trasposición de proteínas de unión o funcionales específicas
US20140037606A1 (en) 2012-08-06 2014-02-06 Eyal Amiel Cell-based, anti-cancer vaccines
AU2013327136A1 (en) 2012-10-02 2015-04-16 Memorial Sloan-Kettering Cancer Center Compositions and methods for immunotherapy
MX2015007446A (es) 2012-12-12 2015-12-07 Vasculox Inc Anticuerpos terapeuticos para cd47.
US9221908B2 (en) 2012-12-12 2015-12-29 Vasculox, Inc. Therapeutic CD47 antibodies
CN105101997B (zh) 2013-02-06 2018-11-09 印希彼有限合伙公司 不减少血小板和不减少血红细胞的cd47抗体及其使用方法
WO2014121840A1 (en) 2013-02-07 2014-08-14 Medizinische Hochschule Hannover Induced dendritic cells and uses thereof
PT2961831T (pt) 2013-02-26 2020-10-12 Memorial Sloan Kettering Cancer Center Composições e métodos para imunoterapêutica
WO2014134412A1 (en) 2013-03-01 2014-09-04 Regents Of The University Of Minnesota Talen-based gene correction
WO2014153114A1 (en) 2013-03-14 2014-09-25 Fred Hutchinson Cancer Research Center Compositions and methods to modify cells for therapeutic objectives
EP2970426B1 (en) 2013-03-15 2019-08-28 Michael C. Milone Targeting cytotoxic cells with chimeric receptors for adoptive immunotherapy
MX389160B (es) 2013-10-31 2025-03-20 Hutchinson Fred Cancer Res Células no t efectoras y madre/progenitoras hematopoyéticas modificadas y usos de estas.
LT3424955T (lt) 2013-12-25 2025-06-25 Daiichi Sankyo Company, Limited Anti-trop2 antikūno ir vaisto konjugato gamybos būdas
EP3656864A1 (en) 2014-02-14 2020-05-27 Board of Regents, The University of Texas System Chimeric antigen receptors and methods of making
AU2015229448B2 (en) 2014-03-11 2020-09-03 The Board Of Trustees Of The Leland Stanford Junior University Anti SIRP-alpha antibodies and Bi-specific Macrophage Enhancing antibodies
WO2015164627A1 (en) 2014-04-23 2015-10-29 Discovery Genomics, Inc. Chimeric antigen receptors specific to avb6 integrin and methods of use thereof to treat cancer
CN104004095B (zh) 2014-06-04 2016-11-23 博生吉医药科技(苏州)有限公司 一种cd7纳米抗体、其编码序列及应用
US10407683B2 (en) 2014-07-16 2019-09-10 Modernatx, Inc. Circular polynucleotides
TWI750110B (zh) 2014-07-21 2021-12-21 瑞士商諾華公司 使用人類化抗-bcma嵌合抗原受體治療癌症
JP2017522893A (ja) 2014-07-31 2017-08-17 セレクティスCellectis Ror1特異的多重鎖キメラ抗原受容体
ES2791248T3 (es) 2014-08-19 2020-11-03 Novartis Ag Receptor antigénico quimérico (CAR) anti-CD123 para su uso en el tratamiento del cáncer
WO2016033331A1 (en) 2014-08-28 2016-03-03 Bioatla, Llc Conditionally active chimeric antigen receptors for modified t-cells
WO2016030501A1 (en) * 2014-08-28 2016-03-03 Centre National De La Recherche Scientifique - Cnrs - Synthetic alu-retrotransposon vectors for gene therapy
US20180133252A9 (en) 2014-09-09 2018-05-17 Unum Therapeutics Inc. Chimeric receptors and uses thereof in immune therapy
ES2946697T3 (es) 2014-09-10 2023-07-24 Miltenyi Biotec Bv & Co Kg Una población celular para su uso en el tratamiento de cáncer
CA2961950A1 (en) 2014-09-28 2016-03-31 The Regents Of The University Of California Modulation of stimulatory and non-stimulatory myeloid cells
JP2017531430A (ja) 2014-10-07 2017-10-26 セレクティスCellectis Carによって誘導される免疫細胞の活性を調節するための方法
MA41538A (fr) 2014-10-17 2017-12-26 Baylor College Medicine Cellules immunitaires bipartites et tripartites de signalisation
JP7523203B2 (ja) 2014-10-31 2024-07-26 マサチューセッツ インスティテュート オブ テクノロジー 生体分子の免疫細胞への送達
CA2967379A1 (en) 2014-11-18 2016-05-26 Janssen Pharmaceutica Nv Cd47 antibodies, methods, and uses
WO2016106184A1 (en) 2014-12-22 2016-06-30 AgBiome, Inc. Methods for making a synthetic gene
US11161907B2 (en) 2015-02-02 2021-11-02 Novartis Ag Car-expressing cells against multiple tumor antigens and uses thereof
CN113713091A (zh) 2015-02-06 2021-11-30 新加坡国立大学 工程免疫细胞及其用途和生产方法
WO2016130845A1 (en) 2015-02-11 2016-08-18 Loma Linda University A method for utilizing engineered dendritic cells to induce gut-homing regulatory t cells and treat gut inflammation
US20170151281A1 (en) 2015-02-19 2017-06-01 Batu Biologics, Inc. Chimeric antigen receptor dendritic cell (car-dc) for treatment of cancer
WO2016138034A1 (en) 2015-02-24 2016-09-01 The Regents Of The University Of California Binding-triggered transcriptional switches and methods of use thereof
JP7237449B2 (ja) 2015-02-27 2023-03-13 アイセル・ジーン・セラピューティクス・エルエルシー 血液系腫瘍を標的としたキメラ抗体受容体(CARs)の構成およびその使用方法
WO2016149254A1 (en) 2015-03-17 2016-09-22 Chimera Bioengineering, Inc. Smart car devices, de car polypeptides, side cars and uses thereof
US10214591B1 (en) * 2015-04-03 2019-02-26 Alienor Farma Monoclonal antibody to human line-1 ORF2 protein and method for early detection of transforming cells in pre-neoplastic tissues of a human subject
EP3286225B1 (en) 2015-04-23 2020-07-01 Baylor College of Medicine Cd5 chimeric antigen receptor for adoptive t cell therapy
CA2994935A1 (en) 2015-05-18 2016-11-24 Ab Initio Biotherapeutics, Inc. Sirp polypeptide compositions and methods of use
US10434153B1 (en) 2015-05-20 2019-10-08 Kim Leslie O'Neill Use of car and bite technology coupled with an scFv from an antibody against human thymidine kinase 1 to specifically target tumors
EP3302558A4 (en) 2015-06-01 2019-01-16 The Rockefeller University ANTI-TUMOR MEDIUM AND METHOD OF USE
GB201509413D0 (en) 2015-06-01 2015-07-15 Ucl Business Plc Fusion protein
CA3012607A1 (en) 2015-06-18 2016-12-22 The Broad Institute Inc. Crispr enzymes and systems
US20190008897A1 (en) 2015-07-22 2019-01-10 University Of Washington Compositions and methods for producing pro-inflammatory macrophages
RU2766690C2 (ru) 2015-07-28 2022-03-15 Дзе Трастиз Оф Дзе Юниверсити Оф Пенсильвания Модифицированные моноциты/макрофаги, экспрессирующие химерные антигенные рецепторы, и их применения
GB2592821B (en) 2015-07-31 2022-01-12 Univ Minnesota Modified cells and methods of therapy
EP3328377A4 (en) 2015-07-31 2019-03-13 Tarveda Therapeutics, Inc. COMPOSITIONS AND METHODS FOR IMMUNE ONCOLOGY THERAPIES
WO2017027422A1 (en) 2015-08-07 2017-02-16 Alexo Therapeutics Inc. Constructs having a sirp-alpha domain or variant thereof
US11352439B2 (en) 2015-08-13 2022-06-07 Kim Leslie O'Neill Macrophage CAR (MOTO-CAR) in immunotherapy
CN108243607A (zh) 2015-09-09 2018-07-03 西雅图儿童医院(Dba西雅图儿童研究所) 用于免疫疗法的巨噬细胞的遗传工程
EP3350335B1 (en) 2015-09-16 2019-11-27 T-CURX GmbH Improved transposon system for gene delivery
EP4706680A3 (en) 2015-09-22 2026-03-25 Julius-Maximilians-Universität Würzburg A method for high level and stable gene transfer in lymphocytes
CN105154473B (zh) 2015-09-30 2019-03-01 上海细胞治疗研究院 一种高效安全的转座子整合系统及其用途
KR20180054600A (ko) 2015-10-13 2018-05-24 브라이엄 영 유니버시티 면역치료에서의 대식세포 키메라 항원 수용체(moto-car)
CA3004738A1 (en) 2015-11-09 2017-05-18 Aperisys, Inc. Modified immune cells and uses thereof
US10946042B2 (en) 2015-12-01 2021-03-16 The Trustees Of The University Of Pennsylvania Compositions and methods for selective phagocytosis of human cancer cells
EP3202783A1 (en) 2016-02-02 2017-08-09 Ecole Polytechnique Fédérale de Lausanne (EPFL) Engineered antigen presenting cells and uses thereof
WO2017133175A1 (en) 2016-02-04 2017-08-10 Nanjing Legend Biotech Co., Ltd. Engineered mammalian cells for cancer therapy
US12220451B2 (en) 2016-02-04 2025-02-11 Duke University Cell-based vaccine compositions and methods of use
GB201602473D0 (en) 2016-02-11 2016-03-30 Horizon Discovery Ltd Replicative transposon system
US9820350B2 (en) 2016-02-19 2017-11-14 Cooper Technologies Company Configurable lighting system
US10617749B1 (en) 2016-02-24 2020-04-14 Duke University Composition of matter and methods for alteration of dendritic cell metabolism to augment cancer vaccine efficacy
US20170275665A1 (en) 2016-02-24 2017-09-28 Board Of Regents, The University Of Texas System Direct crispr spacer acquisition from rna by a reverse-transcriptase-cas1 fusion protein
US20200063157A9 (en) 2016-02-26 2020-02-27 Poseida Therapeutics, Inc. Transposon system and methods of use
EP3219803A1 (en) 2016-03-15 2017-09-20 Max-Delbrück-Centrum für Molekulare Medizin Enhanced sleeping beauty transposons, kits and methods of transposition
US20180186855A1 (en) 2016-03-23 2018-07-05 Alector Llc Chimeric receptors and methods of use thereof
WO2017172981A2 (en) 2016-03-29 2017-10-05 University Of Southern California Chimeric antigen receptors targeting cancer
US11649284B2 (en) 2016-04-18 2023-05-16 Baylor College Of Medicine Cancer gene therapy targeting CD47
US10875919B2 (en) 2016-04-26 2020-12-29 Alector Llc Chimeric receptors and methods of use thereof
US11390658B2 (en) 2016-06-06 2022-07-19 St. Jude Children's Research Hospital Anti-CD7 chimeric antigen receptor and method of use thereof
WO2017214553A1 (en) 2016-06-09 2017-12-14 The General Hospital Corporation Modulating the cellular stress response
CA3028158A1 (en) 2016-06-17 2017-12-21 The Broad Institute, Inc. Type vi crispr orthologs and systems
CN107523545A (zh) 2016-06-20 2017-12-29 上海细胞治疗研究院 一种高效稳定表达抗体的杀伤性细胞及其用途
EP3504244A4 (en) 2016-08-26 2020-08-19 Agency for Science, Technology and Research MACROPHAGE-STIMULATING PROTEIN RECEPTOR ANTIBODIES (OR OF NANTAIS ORIGINAL RON-RECEPTOR) AND THEIR USES
JOP20190009A1 (ar) 2016-09-21 2019-01-27 Alx Oncology Inc أجسام مضادة ضد بروتين ألفا منظم للإشارات وطرق استخدامها
EP4089116A1 (en) 2016-09-27 2022-11-16 Cero Therapeutics, Inc. Chimeric engulfment receptor molecules
WO2018064626A1 (en) 2016-09-30 2018-04-05 Baylor College Of Medicine Adaptive chimeric antigen receptor t-cell design
WO2018071058A1 (en) 2016-10-15 2018-04-19 Baylor College Of Medicine Platform for enhanced targeted cell delivery
WO2018073394A1 (en) 2016-10-19 2018-04-26 Cellectis Cell death inducing chimeric antigen receptors
EP3529276A4 (en) 2016-10-21 2020-06-17 Arch Oncology, Inc. CD47 THERAPEUTIC ANTIBODIES
SG11201903693QA (en) 2016-11-01 2019-05-30 Genmab Bv Polypeptide variants and uses thereof
KR102709829B1 (ko) 2016-11-11 2024-09-24 바이오 래드 래버러토리스 인코오포레이티드 핵산 샘플을 프로세싱하는 방법
CA3049961A1 (en) 2016-12-09 2018-06-14 The Broad Institute, Inc. Crispr effector system based diagnostics
CN118027200A (zh) 2016-12-09 2024-05-14 艾利妥 抗SIRPα抗体及其使用方法
WO2018140831A2 (en) 2017-01-27 2018-08-02 Silverback Therapeutics, Inc. Tumor targeting conjugates and methods of use thereof
AU2018235756B2 (en) 2017-03-13 2024-08-08 Poseida Therapeutics, Inc. Compositions and methods for selective elimination and replacement of hematopoietic stem cells
CN111108220B (zh) 2017-03-15 2024-11-19 博德研究所 用于病毒检测的基于crispr效应系统的诊断
WO2018191490A1 (en) 2017-04-13 2018-10-18 The Trustees Of The University Of Pennsylvania Use of gene editing to generate universal tcr re-directed t cells for adoptive immunotherapy
US10415017B2 (en) 2017-05-17 2019-09-17 Thunder Biotech, Inc. Transgenic macrophages, chimeric antigen receptors, and associated methods
JP2020525537A (ja) 2017-06-12 2020-08-27 エモリー ユニバーシティー T細胞抗原標的キメラ抗原受容体(car)、及び細胞療法での使用
TWI828625B (zh) 2017-06-25 2024-01-11 美商西雅圖免疫公司 引導及導航控制蛋白質以及彼之製造及使用方法
WO2019010551A1 (pt) 2017-07-10 2019-01-17 Instituto De Biologia Molecular Do Paraná - Ibmp Plataforma genética para superexpressão heteróloga associada à seleção de células altamente produtoras de proteínas
WO2019023347A1 (en) 2017-07-26 2019-01-31 Forty Seven, Inc. ANTI-SIRP-ALPHA ANTIBODIES AND ASSOCIATED METHODS
CN109306340B (zh) 2017-07-27 2023-06-06 上海细胞治疗研究院 一种高效扩增全t细胞的人工抗原递呈细胞及其用途
CN109337872B (zh) 2017-07-27 2023-06-23 上海细胞治疗研究院 高效扩增car-t细胞的人工抗原递呈细胞及其用途
WO2019032624A1 (en) 2017-08-08 2019-02-14 Pionyr Immunotherapeutics, Inc. COMPOSITIONS AND METHODS FOR DEACTIVATING TREM1-EXPRESSING MESHLOID CELLS
WO2019050948A1 (en) 2017-09-05 2019-03-14 Regeneron Pharmaceuticals, Inc. ADMINISTRATION OF A GENE EDITION SYSTEM HAVING ONLY ONE RETROVIRAL PARTICLE AND METHODS OF GENERATING AND USING
AU2018329741B2 (en) 2017-09-08 2025-02-20 Poseida Therapeutics, Inc. Compositions and methods for chimeric ligand receptor (CLR)-mediated conditional gene expression
CN111479921B (zh) 2017-09-18 2024-08-02 埃克苏马生物技术公司 用于以基因方式修饰且扩增淋巴细胞以及调节其活性的方法及组合物
EP3688032B1 (en) 2017-09-26 2025-11-05 Cero Therapeutics Holdings, Inc. Chimeric engulfment receptor molecules and methods of use
US12467050B2 (en) 2017-10-02 2025-11-11 Georgia Tech Research Corporation Methods and compositions for engineering synthetic bioswitches for remote control of biological activity
US11352611B2 (en) 2017-10-03 2022-06-07 Board Of Regents, The University Of Texas System Non-LTR-retroelement reverse transcriptase and uses thereof
GB201717974D0 (en) 2017-10-31 2017-12-13 Univ Court Of The Univ Of Aberdeen Modified receptors
WO2019090175A1 (en) 2017-11-02 2019-05-09 Arbor Biotechnologies, Inc. Novel crispr-associated transposon systems and components
CN109971716B (zh) 2017-12-28 2023-08-01 上海细胞治疗研究院 自分泌cd47抗体的egfr特异性car-t细胞及其用途
US11572557B2 (en) 2018-01-29 2023-02-07 The Board Of Trustees Of The Leland Stanford Junior University Photoreversible acylation reagents
KR20200120917A (ko) 2018-02-02 2020-10-22 더 트러스티스 오브 더 유니버시티 오브 펜실바니아 키메라 항원 수용체를 발현하는 변형된 단핵구/대식세포/수지상 세포 및 단백질 응집체와 연관이 있는 질환 및 장애에서의 용도
AU2019226526B2 (en) 2018-03-02 2025-12-04 Generation Bio Co. Identifying and characterizing genomic safe harbors (GSH) in humans and murine genomes, and viral and non-viral vector compositions for targeted integration at an identified GSH loci
GB2572005A (en) 2018-03-16 2019-09-18 Univ Court Univ Of Edinburgh Macrophage-based therapy
US20210015865A1 (en) 2018-03-28 2021-01-21 Cero Therapeutics, Inc. Chimeric engulfment receptors and uses thereof for neurodegenerative diseases
JP7444781B2 (ja) 2018-03-28 2024-03-06 セロ・セラピューティクス・インコーポレイテッド 細胞免疫療法組成物およびその使用
WO2019191334A1 (en) 2018-03-28 2019-10-03 Cero Therapeutics, Inc. Chimeric tim4 receptors and uses thereof
SG11202009626QA (en) 2018-04-20 2020-10-29 Medizinische Hochschule Hannover Chimeric antigen receptor and car-t cells that bind a herpes virus antigen
CA3098865A1 (en) 2018-05-02 2019-11-07 The Trustees Of The University Of Pennsylvania Compositions and methods of phospholipase a2 receptor chimeric autoantibody receptor t cells
SG11202011240YA (en) 2018-06-26 2020-12-30 Broad Inst Inc Crispr/cas and transposase based amplification compositions, systems and methods
US20210222163A1 (en) 2018-07-11 2021-07-22 X Gen Us Co. Transposome enabled dna/rna-sequencing (ted rna-seq)
JP2021530212A (ja) 2018-07-13 2021-11-11 ザ リージェンツ オブ ザ ユニバーシティ オブ カリフォルニアThe Regents Of The University Of California レトロトランスポゾンベースの送達媒体及びその使用方法
CN113286880A (zh) * 2018-08-28 2021-08-20 旗舰先锋创新Vi有限责任公司 调控基因组的方法和组合物
EP3628309A1 (en) 2018-09-28 2020-04-01 Universität Heidelberg Method of making oral dosage forms
EP3876977A1 (en) 2018-11-06 2021-09-15 The Regents Of The University Of California Chimeric antigen receptors for phagocytosis
GB201818110D0 (en) 2018-11-06 2018-12-19 Macrophox Ltd Monocytes for cancer targeting
WO2020132327A1 (en) 2018-12-19 2020-06-25 The Trustees Of The University Of Pennsylvania Use of cd2/5/7 knock-out anti-cd2/5/7 chimeric antigen receptor t cells against t cell lymphomas and leukemias
CA3117950A1 (en) 2018-12-19 2020-06-25 Amgen Inc. Apparatus for resolving imaging problems caused by the meniscus
US20220133790A1 (en) * 2019-01-16 2022-05-05 Beam Therapeutics Inc. Modified immune cells having enhanced anti-neoplasia activity and immunosuppression resistance
CA3135531A1 (en) 2019-04-30 2020-11-05 Daniel Getts Engineered chimeric fusion protein compositions and methods of use thereof
US20220001031A1 (en) 2019-04-30 2022-01-06 Myeloid Therapeutics, Inc. Engineered chimeric fusion protein compositions and methods of use thereof
US11013764B2 (en) 2019-04-30 2021-05-25 Myeloid Therapeutics, Inc. Engineered phagocytic receptor compositions and methods of use thereof
US20220378824A1 (en) 2019-04-30 2022-12-01 Myeloid Therapeutics, Inc. Engineered chimeric fusion protein compositions and methods of use thereof
MX2021015411A (es) 2019-06-11 2022-04-18 Myeloid Therapeutics Inc Composiciones acopladoras especificas de macrofagos y metodos de uso de las mismas.
JP2022536951A (ja) 2019-06-19 2022-08-22 フラッグシップ パイオニアリング イノベーションズ シックス,エルエルシー 環状ポリリボヌクレオチドを投与する方法
WO2021016075A1 (en) 2019-07-19 2021-01-28 Flagship Pioneering Innovations Vi, Llc Recombinase compositions and methods of use
US20230040216A1 (en) 2019-11-19 2023-02-09 The Broad Institute, Inc. Retrotransposons and use thereof
BR112022011339A2 (pt) 2019-12-11 2022-10-04 Myeloid Therapeutics Inc Composições de células terapêuticas e métodos para fabricação e usos das mesmas
US10980836B1 (en) 2019-12-11 2021-04-20 Myeloid Therapeutics, Inc. Therapeutic cell compositions and methods of manufacturing and use thereof
JP2023516692A (ja) 2020-03-04 2023-04-20 フラッグシップ パイオニアリング イノベーションズ シックス,エルエルシー ゲノムを調節するための方法及び組成物
IL296024A (en) 2020-03-04 2022-10-01 Flagship Pioneering Innovations Vi Llc Methods and compositions for modulating a genome
CA3174483A1 (en) 2020-03-04 2021-09-10 Flagship Pioneering Innovations Vi, Llc Improved methods and compositions for modulating a genome
AU2021232069A1 (en) 2020-03-05 2022-11-03 Flagship Pioneering Innovations Vi, Llc Host defense suppressing methods and compositions for modulating a genome
CN115867294A (zh) 2020-06-04 2023-03-28 凯瑞斯马治疗公司 嵌合抗原受体的新型构建体
CA3187138A1 (en) 2020-06-26 2021-12-30 Carisma Therapeutics Inc. Mrna transfection of immune cells
WO2022036265A1 (en) 2020-08-14 2022-02-17 Cero Therapeutics, Inc. Chimeric tim receptors and uses thereof
AU2021350024A1 (en) 2020-09-24 2023-05-04 Flagship Pioneering Innovations V, Inc. Compositions and methods for inhibiting gene expression
CA3197423A1 (en) 2020-11-04 2022-05-12 Daniel Getts Engineered chimeric fusion protein compositions and methods of use thereof
AU2022272235A1 (en) 2021-05-11 2023-12-21 Create Medicines, Inc. Methods and compositions for genomic integration

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2004072290A1 (en) * 2003-02-07 2004-08-26 The Administrators Of The Tulane Educational Fund Mammalian retrotransposable elements
WO2009056321A1 (en) * 2007-10-31 2009-05-07 BUNDESREPUBLIK DEUTSCHLAND,letztvertreten durch den Präsidenten des Paul-Ehrlich-Instituts Controlled activation of non-ltr retrotransposons in mammals
WO2020131862A1 (en) * 2018-12-17 2020-06-25 The Broad Institute, Inc. Crispr-associated transposase systems and methods of use thereof
WO2021046243A2 (en) * 2019-09-03 2021-03-11 Myeloid Therapeutics, Inc. Methods and compositions for genomic integration

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See also references of EP4337268A4 *

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12319925B2 (en) 2021-05-11 2025-06-03 Myeloid Therapeutics, Inc. Methods and compositions for genomic integration
WO2023182948A1 (en) * 2022-03-21 2023-09-28 Bio Adventure Co., Ltd. Internal ribosome entry site (ires), plasmid vector and circular mrna for enhancing protein expression
WO2024193739A1 (en) * 2023-03-23 2024-09-26 Ostravska Univerzita Method for producing proteins in host cells
WO2025217194A1 (en) * 2024-04-09 2025-10-16 Typewriter Therapeutics, Inc. Repeat dosing of retrotransposons

Also Published As

Publication number Publication date
IL308445A (en) 2024-01-01
US20230141052A1 (en) 2023-05-11
AU2022272235A1 (en) 2023-12-21
US20250250584A1 (en) 2025-08-07
EP4337268A1 (en) 2024-03-20
GB202318472D0 (en) 2024-01-17
CA3218780A1 (en) 2022-11-17
EP4337268A4 (en) 2025-06-04
MX2023013381A (es) 2024-02-08
BR112023023642A2 (pt) 2024-01-30
JP2024518100A (ja) 2024-04-24
KR20240037192A (ko) 2024-03-21
US12319925B2 (en) 2025-06-03
GB2623653A (en) 2024-04-24

Similar Documents

Publication Publication Date Title
JP7831937B2 (ja) ゲノム組込みのための方法および組成物
US12319925B2 (en) Methods and compositions for genomic integration
US20220257794A1 (en) Circular rnas for cellular therapy
JP2021534798A (ja) ゲノムを調節するための方法及び組成物
CN113661242A (zh) 包含经修饰的环状多核糖核苷酸的组合物及其用途
CA3077086A1 (en) Systems, methods, and compositions for targeted nucleic acid editing
US20140056868A1 (en) Supercoiled MiniVectors as a Tool for DNA Repair, Alteration and Replacement
CN105899657A (zh) 用于改变基因产物表达的crispr-cas系统和方法、结构信息以及诱导型模块化cas酶
WO2023023515A1 (en) Persistent allogeneic modified immune cells and methods of use thereof
CN114096674A (zh) 环状多核糖核苷酸的给药方法
US20240325533A1 (en) Modified immune cells and methods of using the same
JP2023542976A (ja) カーゴヌクレオチド配列を転位させるための系および方法
KR20240139088A (ko) 킬로베이스 규모의 rna 가이드 게놈 리콤비니어링
KR20240049834A (ko) 킬로베이스 규모의 rna 유도 게놈 리콤비니어링
WO2022256578A2 (en) Circular guide rnas for crispr/cas editing systems
WO2025128722A2 (en) Methods and compositions for genomic integration
CN117836009A (zh) 用于基因组整合的方法和组合物
WO2025193592A2 (en) Enhanced nuclear delivery of dna and compositions for use in practicing the same
JP2025536570A (ja) 核標的dna送達及びその実践に使用するための組成物
EP4720287A1 (en) Crispr-related methods and compositions targeting ptpn2 expression
CA3250716A1 (en) Endonuclease CAS based on a ModRNA and base editor and their uses
HK40060122A (en) Methods and compositions for modulating a genome

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22808288

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 308445

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: MX/A/2023/013381

Country of ref document: MX

Ref document number: 3218780

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 2023570260

Country of ref document: JP

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112023023642

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 202318472

Country of ref document: GB

Kind code of ref document: A

Free format text: PCT FILING DATE = 20220511

WWE Wipo information: entry into national phase

Ref document number: 2318472.4

Country of ref document: GB

WWE Wipo information: entry into national phase

Ref document number: 202317082871

Country of ref document: IN

WWE Wipo information: entry into national phase

Ref document number: 2022272235

Country of ref document: AU

Ref document number: AU2022272235

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 2022808288

Country of ref document: EP

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2022808288

Country of ref document: EP

Effective date: 20231211

ENP Entry into the national phase

Ref document number: 2022272235

Country of ref document: AU

Date of ref document: 20220511

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 11202308630W

Country of ref document: SG

WWE Wipo information: entry into national phase

Ref document number: 202280049196.6

Country of ref document: CN

ENP Entry into the national phase

Ref document number: 112023023642

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20231110

WWP Wipo information: published in national office

Ref document number: 2318472.4

Country of ref document: GB