WO2013169886A1 - Anti-pcsk9 antibodies and use thereof - Google Patents

Anti-pcsk9 antibodies and use thereof Download PDF

Info

Publication number
WO2013169886A1
WO2013169886A1 PCT/US2013/040112 US2013040112W WO2013169886A1 WO 2013169886 A1 WO2013169886 A1 WO 2013169886A1 US 2013040112 W US2013040112 W US 2013040112W WO 2013169886 A1 WO2013169886 A1 WO 2013169886A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
sequence
antibody
nucleic acid
nucleic acids
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2013/040112
Other languages
English (en)
French (fr)
Other versions
WO2013169886A9 (en
Inventor
Andrew Lawrence Feldhaus
Leon F. Garcia-Martinez
Benjamin H. Dutzar
Ethan Wayne OJALA
Brian Robert KOVACEVICH
Katie Olson
Pei Fan
Jens Billgren
Erica Ann STEWART
Corinne C. Akatsuka
Patricia Dianne Mcneill
Danielle Marie MITCHELL
Dan Scott ALLISON
John A. Latham
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Alderbio Holdings LLC
Original Assignee
Alderbio Holdings LLC
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to NZ702304A priority Critical patent/NZ702304A/en
Priority to KR1020147034039A priority patent/KR102137291B1/ko
Priority to MX2014013612A priority patent/MX2014013612A/es
Priority to CN201380036215.2A priority patent/CN104583237B/zh
Priority to EP13787331.1A priority patent/EP2844673A4/en
Priority to CA2872777A priority patent/CA2872777A1/en
Priority to EP19218830.8A priority patent/EP3753950A2/en
Priority to AU2013259562A priority patent/AU2013259562B2/en
Application filed by Alderbio Holdings LLC filed Critical Alderbio Holdings LLC
Priority to SG11201407099WA priority patent/SG11201407099WA/en
Priority to JP2015511658A priority patent/JP6386996B2/ja
Publication of WO2013169886A1 publication Critical patent/WO2013169886A1/en
Publication of WO2013169886A9 publication Critical patent/WO2013169886A9/en
Priority to IL235436A priority patent/IL235436A0/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/40Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against enzymes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/04Anorexiants; Antiobesity agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/06Antihyperlipidemics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/10Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/12Antihypertensives
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/573Immunoassay; Biospecific binding assay; Materials therefor for enzymes or isoenzymes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/90Enzymes; Proenzymes
    • G01N2333/914Hydrolases (3)
    • G01N2333/948Hydrolases (3) acting on peptide bonds (3.4)
    • G01N2333/95Proteinases, i.e. endopeptidases (3.4.21-3.4.99)
    • G01N2333/964Proteinases, i.e. endopeptidases (3.4.21-3.4.99) derived from animal tissue
    • G01N2333/96425Proteinases, i.e. endopeptidases (3.4.21-3.4.99) derived from animal tissue from mammals
    • G01N2333/96427Proteinases, i.e. endopeptidases (3.4.21-3.4.99) derived from animal tissue from mammals in general
    • G01N2333/9643Proteinases, i.e. endopeptidases (3.4.21-3.4.99) derived from animal tissue from mammals in general with EC number
    • G01N2333/96433Serine endopeptidases (3.4.21)

Definitions

  • This invention pertains to novel antibodies and antibody fragments that specifically bind to human Proprotein Convertase Subtilisin-like/Kexin type 9 (hereinafter "PCSK9") and compositions containing.
  • PCSK9 Proprotein Convertase Subtilisin-like/Kexin type 9
  • the invention relates to nucleic acids encoding said antibodies and antibody fragments and the use thereof to express said antibodies and antibody fragments in desired host cells. Also, the invention relates to therapeutic and diagnostic use of these antibodies and antibody fragments.
  • the invention provides rabbit antibodies and humanized and chimeric antibodies derived therefrom specific to PCSK9 as well as antibody fragments specific to PCSK9 which include e.g., Fab', F(ab') 2 , Fv, scFv fragments, SMIPs (small molecule immunopharmaceuticals), camelbodies, nanobodies, monovalent antibodies such as MetMab like antibodies, and IgNAR.
  • the invention provides nucleic acids and host cells containing that encode for and result in the expression of the subject anti-PCSK9 antibodies, i.e., rabbit antibodies and antibody fragments and modified forms thereof including by way of example humanized and chimeric antibodies derived therefrom as well as antibody fragments which include e.g., Fab', F(ab') 2 , Fv, scFv fragments, SMIPs (small molecule immunopharmaceuticals), camelbodies, nanobodies, monovalent antibodies such as MetMab like antibodies, and IgNAR.
  • the subject anti-PCSK9 antibodies i.e., rabbit antibodies and antibody fragments and modified forms thereof including by way of example humanized and chimeric antibodies derived therefrom as well as antibody fragments which include e.g., Fab', F(ab') 2 , Fv, scFv fragments, SMIPs (small molecule immunopharmaceuticals), camelbodies, nanobodies, monovalent antibodies such as MetMab like
  • the invention relates to expression systems for the manufacture of the inventive anti-PCSK9 antibodies, including yeast, fungi, mammalian, and other cells useful for the manufacture of antibodies and antibody fragments.
  • the invention relates to novel antibodies and antibody fragments that specifically bind to human PCSK9 which compete with and/or specifically bind to the same or overlapping epitope(s) on PCSK9 as any of the anti-PC SK9 antibodies and antibody fragments exemplified herein.
  • the invention further pertains to the in vivo use of the subject anti-PCSK9 antibodies and antibody fragments alone or in association with other active agents or drugs, for blocking, inhibiting or neutralizing PCSK9.
  • the invention further pertains to the in vivo use of the subject anti-PCSK9 antibodies and antibody fragments alone or in association with other active agents or drugs, for blocking or inhibiting the interaction of PCSK9 with LDLR.
  • the invention also specifically relates to methods for treating or preventing disorders of cholesterol or lipid homeostasis and disorders associated therewith including by way of example hypercholesterolemia, hyperlipidemia, hypertriglyceridaemia, sitosterolemia, atherosclerosis, arteriosclerosis, coronary heart disease, metabolic syndrome, acute coronary syndrome, xanthoma, hypertension, angina, obesity, diabetes and vascular inflammation, by the administration of the subject anti-PC SK9 antibodies and antibody fragments, wherein the subject antibodies and antibody fragments may be used alone or in association with other active agents.
  • the invention further specifically relates to methods of preventing or treating diseases and disorders associated with PCSK9, e.g., diseases associated with increased or decreased levels of PCSK9 and/or mutations in the PCSK9 gene that affect PCSK9 protein expression, primary sequence and/or function by administering said antibodies or fragments thereof alone or in combination with other active agents.
  • diseases and disorders associated with PCSK9 e.g., diseases associated with increased or decreased levels of PCSK9 and/or mutations in the PCSK9 gene that affect PCSK9 protein expression, primary sequence and/or function by administering said antibodies or fragments thereof alone or in combination with other active agents.
  • the present invention further provides methods for improving blood cholesterol markers associated with increased risk of heart disease using the subject antibodies and antibody fragments alone or in association with other active agents.
  • These markers include, but are not limited to, high total cholesterol, high LDL, high total cholesterol to HDL ratio and high LDL-C to HDL ratio.
  • the present invention further provides methods for treating or preventing any of the following conditions or complications associated therewith such as hypercholesterolemia, heart disease, metabolic syndrome, diabetes, coronary heart disease, stroke, cardiovascular diseases, Alzheimer's disease and generally dyslipidemias, which can be manifested, for example, by an elevated total serum cholesterol, elevated LDL, elevated triglycerides, elevated VLDL, and/or low HDL.
  • primary and secondary dyslipidemias that can be treated using an antibody or antibody fragment according to the invention, either alone, or in combination with one or more other agents include the metabolic syndrome, diabetes mellitus, familial combined hyperlipidemia, familial hypertriglyceridemia, familial hypercholesterolemias, including heterozygous hypercholesterolemia, homozygous hypercholesterolemia, familial defective apop lipoprotein B-100; polygenic hypercholesterolemia; remnant removal disease, hepatic lipase deficiency; dyslipidemia secondary to any of the following: dietary indiscretion, hypothyroidism, drugs including estrogen and progestin therapy, beta-blockers, and thiazide diuretics; nephrotic syndrome, chronic renal failure, Cushing's syndrome, primary biliary cirrhosis, glycogen storage diseases, hepatoma, cholestasis, acromegaly, insulinoma, isolated growth hormone deficiency, and alcohol-induced hyper
  • antibody or antibody fragment according to the invention can also be useful in preventing or treating atherosclerotic diseases, such as, for example, coronary heart disease, coronary artery disease, peripheral arterial disease, stroke (ischaemic and hemorrhagic), angina pectoris, or cerebrovascular disease and acute coronary syndrome, myocardial infarction.
  • atherosclerotic diseases such as, for example, coronary heart disease, coronary artery disease, peripheral arterial disease, stroke (ischaemic and hemorrhagic), angina pectoris, or cerebrovascular disease and acute coronary syndrome, myocardial infarction.
  • the antibody or antibody fragment according to the invention is useful in reducing the risk of: nonfatal heart attacks, fatal and non- fatal strokes, certain types of heart surgery, hospitalization for heart failure, chest pain in patients with heart disease, and/or cardiovascular events because of established heart disease such as prior heart attack, prior heart surgery, and/or chest pain with evidence of clogged arteries.
  • the invention also particularly relates to the use of the subject anti-PCSK9 antibodies and antibody fragments in any of the aforementioned therapeutic indications or conditions in combination with other drugs that are typically used to treat such disorders, wherein the antibody and other drug or agent may be co-administered or separately administered.
  • Non limiting examples of drugs that may be co-administered with the subject antibodies or antibody fragments or used in the same therapeutic regimen include by way of example statins, ACE inhibitors, Angiotensin II receptor blockers (ARBs), Antiarrhythmics, Antiplatelet Drugs, aspirin, beta blockers, amiodarone, digoxin, aspirin, anti-clotting agents, digoxin, diuretics, heart failure drugs, vasodilators, blood thinners, other anti-cholesterol drugs such as holestyramine (Questran), gemfibrozil (Lopid, Gemcor), Omacor, and pantethine, other anti-hypertensives, antidiabetigenic drugs such as Alpha-glucosidase inhibitors, Biguanides, Dipeptidyl peptidase-4 inhibitors, Insulin therapies, Meglitinides, Sulfonylurea, and Thiazolidinediones, and other drugs used to treat conditions wherein the treated individual may have
  • compositions containing the subject anti-PCSK9 antibodies or antibody fragments especially compositions are suitable for in vivo administration, e.g., subcutaneous, intravenous, intradermal, intranasal, rectal, vaginal, intrathecal, oral, and other administrable dosage forms.
  • compositions containing the subject anti-PCSK9 antibodies or antibody fragments especially compositions suitable for in vivo administration, e.g., subcutaneous, intravenous, intradermal, intranasal, rectal, vaginal, intrathecal, oral, and other administrable dosage forms which contain another active agent such as statins, ACE inhibitors, Angiotensin II receptor blockers (ARBs), Antiarrhythmics, Antiplatelet Drugs, aspirin, beta blockers, amiodarone, digoxin, aspirin, anti-clotting agents, digoxin, diuretics, heart failure drugs, vasodilators, blood thinners, other anti- cholesterol drugs such as holestyramine (Questran), gemfibrozil (Lopid, Gemcor), Omacor, and pantethine, other anti-hypertensives, antidiabetigenic drugs such as Alpha-glucosidase inhibitors, Biguanides, Dipeptidyl peptida
  • the invention further relates to storage stable forms containing the subject anti- PCSK9 antibodies or antibody fragments, e.g., lyophilisates, suspensions, and buffered or temperature stable compositions.
  • the invention also pertains to methods of using the subject antibodies and antibody fragments that specifically bind to PCSK9 in screening assays to detect and monitor the levels of PCSK9 in serum samples, potentially for the diagnosis of diseases and disorders associated with PCSK9 or identifying individuals wherein the administration of the subject antibodies and antibody fragments that specifically bind to PCSK9 may have a therapeutic or prophylactic effect or for monitoring the effects of a treatment designed to modulate or neutralize PCSK9 or block cholesterol synthesis, e.g., a treatment involving administration of one of the subject anti-PCSK9 antibodies or antibody fragments.
  • PCSK9 Proprotein convertase subtilisin kexin type 9
  • LDLR low density lipoprotein receptor
  • PCSK9 has been shown to directly interact with the LDLR protein, be endocytosed along with the LDLR, and co-immunofluoresce with the LDLR throughout the endosomal pathway (Lagace et al, 116(11) J. Clin. Invest. 2995-3005 (2006)).
  • PCSK9 interacts with the LDLR via the EGF domain and the complex is internalized. In the endosome, the lower pH results in an increased affinity between PCSK9 and LDLR and the complex is targeted for degradation in the lysosome (Horton et al, April Supp., J. Lipid Res. S172-177 (2009), Sci. 928-33 (2003)).
  • mice lacking PCSK9 or in which PCSK9 mRNA has been lowered by antisense oligonucleotide inhibitors have higher levels of hepatic LDLR protein and a greater ability to clear circulating LDL-C; Rashid et al, 2005 PNAS 102:5374-5379; and Graham et al, 2007 J. Lipid Res. 48(4):763-767.
  • ADH autosomal dominant hypercholesterolemia
  • LDL low density lipoprotein
  • PCSK9 is a prohormone-proprotein convertase in the subtilisin (S8) family of serine proteases (Seidah et al, 100(3) Proc. Nat ⁇ Acad. Sci. 928-33 (2003)). Humans have nine prohormone-proprotein convertases that can be divided between the S8A and S8B subfamilies (Rawlings et al, 34 Nucleic Acids Research D270-72 (2006)). Furin, PC1/PC3, PC2, PACE4, PC4, PC5/PC6 and PC7/PC8/LPC/SPC7 are classified in subfamily S8B.
  • the pro-domain first acts as a chaperone and is required for proper folding of the catalytic domain (Ikemura et al., 262 J. Biol. Chem. 7859-64 (1987)). Once the catalytic domain is folded, autocatalysis occurs between the pro-domain and catalytic domain. Following this initial cleavage reaction, the pro-domain remains bound to the catalytic domain where it then acts as an inhibitor of catalytic activity (Fu et al., 275 J. Biol. Chem. 16871-78 (2000)). When conditions are correct, maturation proceeds with a second autocatalytic event at a site within the pro-domain (Anderson et al., 16 Nature 1508-18 (1997)). After this second cleavage event occurs the pro-domain and catalytic domain dissociate, giving rise to an active protease.
  • PCSK9 has not been isolated without its inhibitory pro- domain, and measurements of PCSK9's catalytic activity have been variable (Naureckiene et al, 420(1) Archives of Biochem. & Biophysics 55-67 (2003); Seidah et al, 100(3) Proc. Nat'l Acad. Sci. 928-33 (2003)).
  • PCSK9 plays a role in the regulation of LDL; that the expression or upregulation of PCSK9 is associated with increased plasma levels of LDL cholesterol, that the corresponding inhibition or lack of expression of PCSK9 is associated with reduced LDL cholesterol plasma levels; and that decreased levels of LDL cholesterol are associated with sequence variations in PCSK9 have been found to confer protection against coronary heart disease; Cohen, 2006 N. Engl. J. Med. 354: 1264-1272.
  • the present invention provides novel antibodies and antibody fragments that specifically bind PCSK9, as well as antibodies that compete with such antibodies or antibody fragments, or which specifically bind to the same or overlapping epitope, or antibodies which contain any or all of the CDRs of the novel antibodies and antibody fragments exemplified herein.
  • These antibodies and antibody fragments may be used to block, inhibit or neutralize the in vivo effects of serum PCSK9 in vivo, and in some embodiments specifically inhibit or block the PCSK9/ LDLR binding interaction and thereby inhibit or neutralize one or all of the biological effects associated with this binding interaction.
  • the invention provides novel antibodies and antibody fragments that specifically bind to human PCSK9 and compositions containing. More particularly, the invention provides rabbit anti-PCSK9 antibodies and antibody fragments as well as humanized and chimeric antibodies and antibody fragments derived therefrom such as Fab, Fab', F(ab') 2 , Fv, scFv fragments, SMIPs (small molecule immunopharmaceuticals), camelbodies, nanobodies, monovalent antibodies such as MetMab like antibodies, and IgNAR.
  • rabbit anti-PCSK9 antibodies and antibody fragments as well as humanized and chimeric antibodies and antibody fragments derived therefrom such as Fab, Fab', F(ab') 2 , Fv, scFv fragments, SMIPs (small molecule immunopharmaceuticals), camelbodies, nanobodies, monovalent antibodies such as MetMab like antibodies, and IgNAR.
  • the invention further describes the use of the subject anti-PCSK9 antibodies and antibody fragments for treating any subject wherein blocking, inhibiting or neutralizing the in vivo effect of PCSK9 or blocking or inhibiting the interaction of PCSK9 and LDLR is therapeutically desirable, wherein the subject anti-PCSK9 antibodies or antibody fragments may be used alone or in association with other active agents or drugs.
  • the invention also describes methods for treating or preventing disorders of cholesterol or lipid homeostasis and disorders which may be associated therewith including by way of example hypercholesterolemia, hyperlipidemia, hypertriglyceridaemia, sitosterolemia, atherosclerosis, arteriosclerosis, coronary heart disease, metabolic syndrome, acute coronary syndrome, vascular inflammation, diabetes, obesity, angina, hypertension and xanthoma by the administration of the subject anti-PC SK9 antibodies and antibody fragments that specifically bind to PCSK9, wherein the subject antibodies and antibody fragments may be used alone or in association with other active agents.
  • the invention further provides methods of preventing or treating diseases and disorders associated with PCSK9, e.g., diseases associated with increased or decreased levels of PCSK9 and/or mutations in the PCSK9 gene that affect PCSK9 protein expression, primary sequence and/or function by administering said antibodies or fragments thereof alone or in combination with other active agents.
  • diseases and disorders associated with PCSK9 e.g., diseases associated with increased or decreased levels of PCSK9 and/or mutations in the PCSK9 gene that affect PCSK9 protein expression, primary sequence and/or function by administering said antibodies or fragments thereof alone or in combination with other active agents.
  • the invention broadly encompasses the use of the subject anti-PCSK9 antibodies and fragments in treating any subject having a condition or at risk of developing a condition wherein modulation of lipid or cholesterol levels is clinically desirable or where the subject has a condition that is often associated with high lipids or cholesterol.
  • the present invention provides methods for treating or preventing disorders of cholesterol or lipid homeostasis and disorders and complications associated therewith, e.g., hypercholesterolemia, hyperlipidemia, hypertriglyceridaemia, sitosterolemia, atherosclerosis, arteriosclerosis, coronary heart disease, metabolic syndrome, acute coronary syndrome, vascular inflammation, xanthoma, hypertension, angina and related conditions by administration of the subject anti-PC SK9 antibodies and antibody fragments alone or in association with other active agents.
  • disorders of cholesterol or lipid homeostasis and disorders and complications associated therewith e.g., hypercholesterolemia, hyperlipidemia, hypertriglyceridaemia, sitosterolemia, atherosclerosis, arteriosclerosis, coronary heart disease, metabolic syndrome, acute coronary syndrome, vascular inflammation, xanthoma, hypertension, angina and related conditions.
  • the present invention further provides methods for improving blood cholesterol markers associated with increased risk of heart disease using the subject antibodies and antibody fragments alone or in association with other active agents.
  • These markers include, but are not limited to, high total cholesterol, high LDL, high total cholesterol to HDL ratio and high LDL-C to HDL ratio.
  • the invention also particularly relates to the use of the subject anti-PCSK9 antibodies and antibody fragments in any of the aforementioned therapeutic indications or conditions in combination with other drugs that are typically used to treat such disorders, wherein the antibody and other drug or agent may be co-administered or separately administered.
  • drugs include that may be co-administered with the subject anti-PC SK9 antibodies or antibody fragments or in the same therapeutic regimen include by way of example statins, ACE inhibitors, Angiotensin II receptor blockers (ARBs), Antiarrhythmics, Antiplatelet Drugs, aspirin, beta blockers, amiodarone, digoxin, aspirin, anti-clotting agents, digoxin, diuretics, heart failure drugs, vasodilators, blood thinners, other anti-cholesterol drugs such as holestyramine (Questran), gemfibrozil (Lopid, Gemcor), Omacor, and pantethine, other anti-hypertensives, antidiabetigenic drugs such as Alpha-glucosidase inhibitors, Biguanides, Dipeptidyl peptidase-4 inhibitors, Insulin therapies, Meglitinides, Sulfonylurea, and Thiazolidinediones, and other drugs used to treat conditions wherein the treated individual
  • compositions containing the subject anti-PCSK9 antibodies or antibody fragments especially compositions are suitable for in vivo administration, e.g., subcutaneous, intravenous, intradermal, intranasal, intrathecal, vaginal, rectal, and other injectable or topical administrable dosage forms.
  • the present invention further provides methods for treating or preventing any of the following conditions or complications associated therewith such as hypercholesterolemia, heart disease, metabolic syndrome, diabetes, coronary heart disease, stroke, cardiovascular diseases, Alzheimer's disease and generally dyslipidemias, which can be manifested, for example, by an elevated total serum cholesterol, elevated LDL, elevated triglycerides, elevated VLDL, and/or low HDL.
  • primary and secondary dyslipidemias that can be treated using an antibody or antibody fragment according to the invention, either alone, or in combination with one or more other agents include the metabolic syndrome, diabetes mellitus, familial combined hyperlipidemia, familial hypertriglyceridemia, familial hypercholesterolemias, including heterozygous hypercholesterolemia, homozygous hypercholesterolemia, familial defective apop lipoprotein B-100; polygenic hypercholesterolemia; remnant removal disease, hepatic lipase deficiency; dyslipidemia secondary to any of the following: dietary indiscretion, hypothyroidism, drugs including estrogen and progestin therapy, beta-blockers, and thiazide diuretics; nephrotic syndrome, chronic renal failure, Cushing's syndrome, primary biliary cirrhosis, glycogen storage diseases, hepatoma, cholestasis, acromegaly, insulinoma, isolated growth hormone deficiency, and alcohol-induced hyper
  • the present invention further provides methods for use of the subject anti-PCSK9 antibody or antibody fragment in preventing or treating atherosclerotic diseases, such as, for example, coronary heart disease, coronary artery disease, peripheral arterial disease, stroke (ischaemic and hemorrhagic), angina pectoris, or cerebrovascular disease and acute coronary syndrome, myocardial infarction; in reducing the risk of: nonfatal heart attacks, fatal and non-fatal strokes, certain types of heart surgery, hospitalization for heart failure, chest pain in patients with heart disease, and/or cardiovascular events because of established heart disease such as prior heart attack, prior heart surgery, and/or chest pain with evidence of clogged arteries; and to reduce the risk of recurrent cardiovascular events.
  • atherosclerotic diseases such as, for example, coronary heart disease, coronary artery disease, peripheral arterial disease, stroke (ischaemic and hemorrhagic), angina pectoris, or cerebrovascular disease and acute coronary syndrome, myocardial infarction
  • compositions containing at least one of the subject anti-PCSK9 antibodies or antibody fragments especially compositions which are suitable for in vivo administration, e.g., subcutaneous, intravenous, intradermal, intranasal, intrathecal, vaginal, rectal, oral and other injectable or topical dosage forms which optionally may contain another active agent such as statins, ACE inhibitors, Angiotensin II receptor blockers (ARBs), Antiarrhythmics, Antiplatelet Drugs, aspirin, beta blockers, amiodarone, digoxin, aspirin, anti-clotting agents, digoxin, diuretics, heart failure drugs, vasodilators, blood thinners, other anti-cholesterol drugs such as holestyramine (Questran), gemfibrozil (Lopid, Gemcor), Omacor, and pantethine, other antihypertensives, antidiabetigenic drugs such as Alpha-glucosidase inhibitors, Big
  • the invention further relates to storage stable forms containing the subject anti-PCSK9 antibodies or antibody fragments, e.g., lyophilisates, suspensions, and buffered or temperature stable compositions containing.
  • the invention also provides methods of using the subject antibodies and antibody fragments that specifically bind to PCSK9 in screening assays to detect and monitor the levels of PCSK9 in serum samples, potentially for the diagnosis of diseases and disorders associated with PCSK9 or in identifying individuals wherein the administration of the subject antibodies and antibody fragments that specifically bind to PCSK9 may have a therapeutic or prophylactic effect or for monitoring the effects of a treatment designed to modulate or neutralize PCSK9 or block cholesterol synthesis, e.g., a treatment involving administration of one of the subject or other anti-PC SK9 antibodies or antibody fragments.
  • the invention provides specific anti-PCSK9 antibodies and fragments thereof and diagnostic or pharmaceutical compositions containing having particular epitopic specificity for PCSK9, and preferably antibodies or fragments thereof having high affinity or avidity and/or other desired functional properties.
  • the invention relates to any therapeutic or diagnostic use of the antibodies described herein, or antibodies competing therewith or possessing the same or overlapping epitopic specificity, preferably antibodies or antibody fragments comprising one or all of the CDRs of one of the exemplified anti-PCSK9 antibodies or antibody fragments, or more preferably an antibody comprising one or more variable or CDR sequences which possess at least 80, 90, or 95, 96, 97, 98, 99 or 100% identity to any of the VH, VL and CDR polypeptides described herein, and to polynucleotides encoding these antibodies and antibody fragments and host cells containing.
  • a preferred embodiment of the invention is directed to chimeric or humanized antibodies and fragments thereof (such as Fab or Fv or monovalent fragments) capable of binding to PCSK9, and preferably which inhibit, block or neutralize the biological activities of PCSK9 or which block or inhibit the binding of PCSK9 to LDLR.
  • chimeric or humanized antibodies and fragments thereof such as Fab or Fv or monovalent fragments
  • the invention comprises an isolated antibody or antibody fragment that competes for binding to PCSK9 or binds with the same or an overlapping epitope on PCSK9 as an antibody or antibody fragment according to the invention.
  • the invention comprises a method for treating or preventing a condition associated with elevated serum cholesterol levels in a patient, comprising administering to a patient in need thereof an effective amount of at least one anti-PCSK9 antibody or antibody fragment according to the invention.
  • the invention comprises a method of inhibiting binding of PCSK9 to LDLR in a subject in need thereof comprising administering an effective amount of at least one anti-PCSK9 antibody or antibody fragment according to the invention.
  • the invention comprises an anti-PCSK9 antibody or antibody fragment according to the invention that binds to PCSK9 with a KD that is less than 100 nM.
  • the invention comprises a method for treating or preventing a condition associated with elevated serum cholesterol levels in a subject, the method comprising administering to a subject in need thereof an effective amount of at least one anti-PCSK9 antibody or antibody fragment according to the invention simultaneously or sequentially with another active agent, e.g., one that reduces cholesterol levels or which elevates the availability of LDLR protein.
  • another active agent e.g., one that reduces cholesterol levels or which elevates the availability of LDLR protein.
  • the invention comprises a method of lowering serum cholesterol levels in a subject, the method comprising administering to a subject an effective amount of at least at least one anti-PC SK9 antibody or antibody fragment according to the invention.
  • the invention comprises a method of lowering serum cholesterol level in a subject, the method comprising administering to a subject an effective amount of at least one anti-PCSK9 antibody or antibody fragment according to the invention, simultaneously or sequentially with another agent that elevates the availability of LDLR protein or which reduces serum cholesterol.
  • the invention comprises a method of increasing LDLR protein level in a subject, the method comprising administering to a subject an effective amount of at least one anti-PCSK9 antibody or antibody fragment according to the invention.
  • the invention comprises a method of increasing LDLR protein levels in a subject, the method comprising administering to a subject an effective amount of at least one at least one anti-PCSK9 antibody or antibody fragment according to the invention simultaneously or sequentially with an agent that elevates the availability of LDLR protein or one which reduces serum cholesterol.
  • the invention further provides methods of preventing or treating diseases and disorders associated with PCSK9, e.g., diseases associated with increased or decreased levels of PCSK9 and/or mutations in the PCSK9 gene that affect PCSK9 protein expression, primary sequence and/or function by administering at least one at least one anti-PCSK9 antibody or antibody fragment according to the invention in combination with other agents.
  • diseases and disorders associated with PCSK9 e.g., diseases associated with increased or decreased levels of PCSK9 and/or mutations in the PCSK9 gene that affect PCSK9 protein expression, primary sequence and/or function
  • administering at least one at least one anti-PCSK9 antibody or antibody fragment according to the invention in combination with other agents.
  • the present invention provides methods for treating or preventing disorders of cholesterol or lipid homeostasis and disorders and complications associated therewith, e.g., hypercholesterolemia, hyperlipidemia, hypertriglyceridaemia, sitosterolemia, atherosclerosis, arteriosclerosis, coronary heart disease, metabolic syndrome, acute coronary syndrome, vascular inflammation, xanthoma and related conditions using the subject anti-PCSK9 antibodies and antibody fragments.
  • disorders of cholesterol or lipid homeostasis and disorders and complications associated therewith e.g., hypercholesterolemia, hyperlipidemia, hypertriglyceridaemia, sitosterolemia, atherosclerosis, arteriosclerosis, coronary heart disease, metabolic syndrome, acute coronary syndrome, vascular inflammation, xanthoma and related conditions using the subject anti-PCSK9 antibodies and antibody fragments.
  • the present invention provides methods for treating or preventing disorders of cholesterol or lipid homeostasis and disorders and complications associated therewith, e.g., hypercholesterolemia, hyperlipidemia, hypertriglyceridaemia, sitosterolemia, atherosclerosis, arteriosclerosis, coronary heart disease, metabolic syndrome, acute coronary syndrome, vascular inflammation, xanthoma and other conditions such as obesity, hypertension, diabetes, wherein the subject is treated with the subject anti-PCSK9 antibodies and antibody fragments, in combination with other drugs used to treat such disorders such as e.g., statins, ACE inhibitors, Angiotensin II receptor blockers (ARBs), Antiarrhythmics, Antiplatelet Drugs, aspirin, beta blockers, amiodarone, digoxin, aspirin, anti-clotting agents, digoxin, diuretics, heart failure drugs, vasodilators, blood thinners, other anti-cholesterol drugs such as holestyramine (Questran),
  • hypercholesterolemia
  • ACE inhibitors may be used in combination with the subject anti-PCSK9 antibodies and antibody fragments wherein the moieties may be jointly or separately administered by the same or different means of administration include by way of example: Capoten (captopril), Vasotec (enalapril), Prinivil, Zestril (lisinopril), Lotensin (benazepril), Monopril (fosinopril), Altace (ramipril), Accupril (quinapril), Aceon (perindopril), Mavik (trandolapril), Univasc (moexipril),
  • ARBs may be used in combination with the subject anti-PCSK9 antibodies and antibody fragments wherein the moieties may be jointly or separately administered by the same or different means of administration include by way of example: Cozaar (losartan), Diovan (valsartan), Avapro (irbesartan), Atacand (candesartan), and Micardis (telmisartan).
  • Antiarrhythmics may be used in combination with the subject anti-PCSK9 antibodies and antibody fragments include by way of example: Tambocor (fiecainide), Procanbid (procainamide), Cordarone (amiodarone), and Betapace (sotalol).
  • Anticlotting agents which may be used in combination with the subject anti- PCSK9 antibodies and antibody fragments wherein the moieties may be jointly or separately administered by the same or different means of administration include: Tissue plasminogen activator (TPA), Tenecteplase, Alteplase, Urokinase, Reteplase, and Streptokinase.
  • TPA Tissue plasminogen activator
  • Tenecteplase Tenecteplase
  • Alteplase Alteplase
  • Urokinase Urokinase
  • Reteplase Reteplase
  • Streptokinase Streptokinase
  • Beta-blockers may be used in combination with the subject anti-PCSK9 antibodies and antibody fragments wherein the moities may be jointly or separately administered by the same or different means of administration include by way of example: Sectral (acebutolol), Zebeta (bisoprolol), Brevibloc (esmolol), Inderal (propranolol), Tenormin (atenolol), Normodyne, Trandate (labetalol), Coreg (carvedilol), Lopressor, and Toprol-XL (metoprolol).
  • Calcium channel blockers which may be used in combination with the subject anti-PCSK9 antibodies and antibody fragments wherein the moities may be jointly or separately administered by the same or different means of administration include by way of example: Norvasc (amlodipine), Plendil (felodipine), Cardizem, Cardizem CD, Cardizem SR, Dilacor XR, Diltia XT, Tiazac (diltiazem), Calan, Calan SR, Covera-HS, Isoptin, Isoptin SR, Verelan, Verelan PM (verapamil), Adalat, Adalat CC, Procardia, Procardia XL (nifedipine), Cardene, Cardene SR (nicardipine), Sular (nisoldipine), Vascor (bepridil), and Caduet which is a combination of a statin cholesterol drug and amlodipine.
  • Norvasc amlodipine
  • Plendil felodipine
  • Diuretics which may be used in combination with the subject anti-PCSK9 antibodies and antibody fragments wherein the moities may be jointly or separately administered by the same or different means of administration include by way of example Lasix (furosemide), Bumex (bumetanide), Demadex (torsemide), Esidrix (hydrochlorothiazide), Zaroxolyn (metolazone), and Aldactone (spironolactone).
  • Heart failure drugs which may be used in combination with the subject anti- PCSK9 antibodies and antibody fragments wherein the moities may be jointly or separately administered by the same or different means of administration include by way of example Dobutrex (dobutamine), and Primacor (milrinone).
  • Vasodilators which may be used in combination with the subject anti-PCSK9 antibodies and antibody fragments wherein the moities may be jointly or separately administered by the same or different means of administration include by way of example Dilatrate-SR, Iso-Bid, Isonate, Isorbid, Isordil, Isotrate, Sorbitrate (isosorbide dinitrate), IMDUR (isorbide mononitrate), and BiDil (hydralazine with isosorbide dinitrate.
  • Dilatrate-SR Iso-Bid
  • Isonate Isorbid
  • Isordil Isotrate
  • Sorbitrate isosorbide dinitrate
  • IMDUR isorbide mononitrate
  • BiDil hydroalazine with isosorbide dinitrate.
  • Blood thinners which may be used in combination with the subject anti-PCSK9 antibodies and antibody fragments wherein the moities may be jointlyor separately administered by the same or different means of administration include by way of example Warfarin (Coumadin), Heparin, Lovenox, and Fragmin.
  • Warfarin Cosmetic
  • Heparin Heparin
  • Lovenox Lovenox
  • Fragmin Fragmin.
  • the present invention further provides methods for improving blood cholesterol markers associated with increased risk of heart disease using the subject antibodies and antibody fragments in association with any of the foregoing or other actives wherein the moities may be jointlyor separately administered by the same or different means of administration. These markers include, but are not limited to, high total cholesterol, high LDL-C, high total cholesterol to HDL ratio and high LDL-C to HDL ratio.
  • the invention comprises a pharmaceutical composition comprising an antibody protein or fragment according to the invention and another active, e.g., one of the actives above-identified, e.g., an agent that elevates the availability of LDLR protein levels or an agent which blocks or inhibits cholesterol synthesis.
  • the agent that blocks cholesterol synthesis comprises a statin.
  • the statin in some instances potentially may further elevate LDLR levels.
  • the statin is selected from the group consisting of atorvastatin, cerivastatin, fluvastatin, lovastatin, mevastatin, pitavastatin, pravastatin, rosuvastatin, simvastatin, and some combination thereof.
  • statin is further combined with niacin, an absorption inhibitor (ezetimibe), a lipid modifying agent, or a combination thereof.
  • the agent that elevates the availability of LDLR protein levels comprises a cytokine such as oncostatin M, or a hormone like estrogen, and/or a herbal moiety such as berberine.
  • the invention comprises a pharmaceutical composition comprising an antibody protein or fragment or variant thereof according to the invention and an agent that increases high density lipoprotein (HDL) and/or decreases triglyceride levels.
  • the agent that increases high density lipoprotein (HDL) and/or decreases triglyceride levels comprises a fibrate.
  • the fibrate is selected from the group consisting of bezafibrate, ciprofibrate, clofibrate, gemfibrozil, fenofibrate, and some combination thereof.
  • the invention comprises a pharmaceutical composition comprising an antibody protein or fragment according to the invention and a bile acid sequestering agent.
  • the bile sequestering agent is selected from the group consisting of cholestyramine, colesevelam, colestipol, and some combination thereof.
  • the invention comprises a pharmaceutical composition comprising an antibody or antibody fragment according to the invention and an agent that decreases cholesterol absorption in the intestine.
  • the agent that decreases cholesterol absorption in the intestine is ezetimibe.
  • the invention comprises a pharmaceutical composition comprising an antibody or fragment according to the invention and an agent that decreases cholesterol levels.
  • the agent that decreases cholesterol levels is selected from the group consisting of certain anti-psychotic agents, certain HIV protease inhibitors, dietary factors such as high fructose, sucrose, cholesterol or certain fatty acids and certain nuclear receptor agonists and antagonists for RXR, RAR, LXR, FXR.
  • the invention comprises a pharmaceutical composition
  • a pharmaceutical composition comprising an antibody or fragment according to the invention and a PPAR gamma agonist, PPAR alpha/gamma agonist, squalene synthase inhibitor, CETP inhibitor, antihypertensive, anti-diabetic agent (such as sulphonyl ureas, insulin, GLP-1 analogs, DDPIV inhibitors), ApoB modulator, MTP inhibitors, arteriosclerosis obliterans treatments, or a combination thereof.
  • a PPAR gamma agonist PPAR alpha/gamma agonist
  • squalene synthase inhibitor such as squalene synthase inhibitor
  • CETP inhibitor antihypertensive
  • anti-diabetic agent such as sulphonyl ureas, insulin, GLP-1 analogs, DDPIV inhibitors
  • ApoB modulator such as sulphonyl ureas, insulin, GLP-1
  • the invention comprises a pharmaceutical composition comprising an antibody or fragment according to the invention and an agent that increases HDL levels.
  • the agent that increases HDL levels is niacin, also known as nicotinic acid.
  • the niacin is a slow-release formulation.
  • the invention comprises a pharmaceutical composition comprising an antibody or fragment according to the invention and an agent that inhibits hepatic triglyceride production and/or very low density lipoprotein (VLDL) secretions.
  • the agent that inhibits hepatic triglyceride production and/or very low density lipoprotein (VLDL) secretions is acipimox.
  • the invention comprises a pharmaceutical composition comprising an antibody or fragment according to the invention and an agent that decreases lipid absorption in the intestine.
  • the agent that decreases lipid absorption in the intestine is selected from the group consisting of orlistat, lipstatin, and some combination thereof.
  • the invention comprises a pharmaceutical composition comprising an antibody or fragment according to the invention and an agent that is an antihypertensive and/or treats angina.
  • the agent that is an antihypertensive and/or treats angina is amlodipine.
  • the invention comprises a pharmaceutical composition comprising an antibody or fragment according to the invention and at least one other agent, wherein the combination allows for mitigation of undesirable side-effects of at least one other agent.
  • the antibody or antibody fragment according to the invention and the at least one other agent are administered concurrently.
  • the antibody or antibody fragment according to the invention or fragment or variant thereof and at least one other agent are not administered simultaneously, with the antibody or antibody fragment according to the invention being administered before or after the at least one other agent is administered.
  • the invention comprises a pharmaceutical composition comprising an antibody or fragment according to the invention and at least one other agent for treating a condition associated with aberrant cholesterol or for treating a condition wherein the individuals often have high cholesterol.
  • an antibody protein or fragment or variant thereof according to the invention may be combined or coadministered with other drugs such as ACE inhibitors, Angiotensin II receptor blockers (ARBs), Antiarrhythmics, Antiplatelet Drugs, aspirin, beta blockers, amiodarone, digoxin, aspirin, anti-clotting agents, digoxin, diuretics, heart failure drugs, vasodilators, blood thinners, other anti-cholesterol drugs such as holestyramine (Questran), gemfibrozil (Lopid, Gemcor), Omacor, and pantethine, other anti-hypertensives, antidiabetigenic drugs such as Alpha-glucosidase inhibitors, Biguanides, Dipeptidyl peptidase-4 inhibitor
  • the invention comprises a method for treating or preventing a condition associated with elevated serum cholesterol level in a patient comprising administering to a patient in need thereof an effective amount of at least one isolated antibody or antibody fragment according to the invention as disclosed herein.
  • the condition is hypercholesterolemia.
  • anti-PC SK9 antibodies or fragments according to the invention bind to PCSK9 with a KD that is less than about 100 nM. In some embodiments, the anti- PCSK9 antibodies or fragments according to the invention bind PCSK9 with a KD that is between about 10 and about 100 nM. In some embodiments, the anti-PCSK9 antibodies or fragments according to the invention bind PCSK9 with a KD that is less than about 10 nM. In some embodiments, the antibody or fragment that binds PCSK9 has a KD that is between about 1 and about 10 nM.
  • the anti-PC SK9 antibodies or fragments according to the invention that binds PCSK9 has a KD that is less than about 1 nM. In some embodiments, the anti-PCSK9 antibodies or fragments according to the invention has a KD that is between about 0.1 and about 1 nM. In some embodiments, the anti-PCSK9 antibodies or fragments according to the invention that binds PCSK9 has a KD that is between about 0.1 and about 0.5 nM. In some embodiments, the anti-PCSK9 antibodies or fragments according to the invention binds PCSK9 with a KD that is between about 0.01 and about 0.1 nM.
  • the anti-PCSK9 antibodies or fragments according to the invention binds PCSK9 with a KD that is between about 0.1 and about 10 nM. In some embodiments, the anti-PCSK9 antibodies or fragments according to the invention bind PCSK9 with a KD that is between 0.120 and about 7.99 nM.
  • the invention comprises a method for treating or preventing a condition associated with elevated serum cholesterol levels in a subject, said method comprising administering to a subject in need thereof an effective amount of at least one anti-PCSK9 antibody or fragment according to the invention simultaneously or sequentially with an agent that decreases cholesterol and which optionally further elevates the availability of LDLR protein.
  • the agent that reduces cholesterol and which optionally elevates the availability of LDLR protein comprises a statin.
  • the statin is selected from the group consisting of atorvastatin, cerivastatin, fluvastatin, lovastatin, mevastatin, pitavastatin, pravastatin, rosuvastatin, simvastatin, and some combination thereof.
  • the statin is combined with niacin, an absorption inhibitor (ezetimibe), a lipid modifying agent, or a combination thereof.
  • the agent that elevates the availability of LDLR protein levels comprises certain cytokines like oncostatin M, estrogen, and/or certain herbal ingredients such as berberine.
  • the invention comprises a method for treating or preventing a condition associated with elevated serum cholesterol levels in a subject, said method comprising administering to a subject in need thereof an effective amount of at least one anti-PCSK9 antibody or fragment according to the invention simultaneously or sequentially with an agent that increases high density lipoprotein (HDL) and/or decreases triglyceride levels.
  • the agent that increases high density lipoprotein (HDL) and/or decreases triglyceride levels comprises a fibrate.
  • the fibrate is selected from the group consisting of bezafibrate, ciprofibrate, clofibrate, gemfibrozil, fenofibrate, and some combination thereof.
  • the invention comprises a method for treating or preventing a condition associated with elevated serum cholesterol levels in a subject, said method comprising administering to a subject in need thereof an effective amount of at least one anti-PCSK9 antibody or fragment according to the invention simultaneously or sequentially with a bile acid sequestering agent.
  • the bile acid sequestering agent is selected from the group consisting of cholestyramine, colesevelam, colestipol, and some combination thereof.
  • the invention comprises a method for treating or preventing a condition associated with elevated serum cholesterol levels in a subject, said method comprising administering to a subject in need thereof an effective amount of at least one isolated anti-PCSK9 antibodies or fragments according to the invention simultaneously or sequentially with an agent that decreases cholesterol absorption in the intestine.
  • the agent that decreases cholesterol absorption in the intestine is ezetimibe.
  • the invention comprises a method for treating or preventing a condition associated with elevated serum cholesterol levels in a subject, said method comprising administering to a subject in need thereof an effective amount of at least one anti-PCSK9 antibody or fragment according to the invention simultaneously or sequentially with an agent that decreases cholesterol levels.
  • the agent that decreases cholesterol levels is selected from the group consisting of certain antipsychotic agents, certain HIV protease inhibitors, dietary factors such as high fructose, sucrose, cholesterol or certain fatty acids and certain nuclear receptor agonists and antagonists for RXR, RAR, LXR, FXR.
  • the invention comprises a method for treating or preventing a condition associated with elevated serum cholesterol levels in a subject, said method comprising administering to a subject in need thereof an effective amount of at least one anti-PCSK9 antibody or fragment according to the invention simultaneously or sequentially with an agent that increases HDL levels.
  • the agent that increases HDL levels is niacin, also known as nicotinic acid.
  • the niacin is a slow-release formulation.
  • the invention comprises a method for treating or preventing a condition associated with elevated serum cholesterol levels in a subject, said method comprising administering to a subject in need thereof an effective amount of at least one anti-PCSK9 antibody or fragment according to the invention simultaneously or sequentially with an agent that inhibits hepatic triglyceride production and/or very low density lipoprotein (VLDL) secretions.
  • the agent that inhibits hepatic triglyceride production and/or very low density lipoprotein (VLDL) secretions is acipimox.
  • the invention comprises a method for treating or preventing a condition associated with elevated serum cholesterol levels in a subject, said method comprising administering to a subject in need thereof an effective amount of at least one anti-PCSK9 antibody or fragment according to the invention simultaneously or sequentially with an agent that decreases lipid absorption in the intestine.
  • the agent that decreases lipid absorption in the intestine is selected from the group consisting of orlistat, lipstatin, and some combination thereof.
  • the invention comprises a method for treating or preventing a condition associated with elevated serum cholesterol levels in a subject, said method comprising administering to a subject in need thereof an effective amount of at least one anti-PCSK9 antibody or fragment according to the invention simultaneously or sequentially with an agent that is an anti-hypertensive and/or treats angina.
  • the agent that is an anti-hypertensive and/or treats angina is amlodipine.
  • the invention comprises a method for treating or preventing a condition associated with elevated serum cholesterol levels in a subject, said method comprising administering to a subject in need thereof an effective amount of at least one anti-PCSK9 antibody or fragment according to the invention simultaneously or sequentially with at least one other agent, wherein the combination allows for mitigation of undesirable side-effects of at least one other agent.
  • the anti-PCSK9 antibodies or fragments according to the invention and the at least one other agent are administered concurrently.
  • the antibody or antibody fragment according to the invention and at least one other agent are not administered simultaneously, with the anti-PC SK9 antibodies or fragments according to the invention being administered before or after the at least one other agent is administered.
  • the invention comprises a method of lowering the serum cholesterol level in a subject.
  • the method comprises administering to a subject an effective amount of at least one anti-PCSK9 antibody or fragment according to the invention.
  • the invention comprises a method of lowering serum cholesterol levels in a subject comprising administering to a subject an effective amount of at least one anti-PCSK9 antibody or fragment according to the invention, simultaneously or sequentially with an agent that reduces cholesterol and which optionally further optionally elevates the availability of LDLR protein.
  • the agent that reduces cholesterol and which may further elevate the availability of LDLR protein comprises a statin.
  • the statin is selected from the group consisting of atorvastatin, cerivastatin, fluvastatin, lovastatin, mevastatin, pitavastatin, pravastatin, rosuvastatin, simvastatin, and some combination thereof.
  • statin is combined with niacin, an absorption inhibitor (ezetimibe), a lipid modifying agent, or a combination thereof.
  • agent that elevates the availability of LDLR protein levels comprises certain cytokines like oncostatin M, estrogen, and/or certain herbal ingredients such as berberine.
  • the invention comprises a method of lowering serum cholesterol levels in a subject comprising administering to a subject an effective amount of at least one anti-PCSK9 antibody or fragment according to the invention, simultaneously or sequentially with an agent that increases high density lipoprotein (HDL) and/or decreases triglyceride levels.
  • the agent that increases high density lipoprotein (HDL) and/or decreases triglyceride levels comprises a fibrate.
  • the fibrate is selected from the group consisting of bezafibrate, ciprofibrate, clofibrate, gemfibrozil, fenofibrate, and some combination thereof.
  • the invention comprises a method of lowering serum cholesterol levels in a subject comprising administering to a subject an effective amount of at least one anti-PC SK9 antibody or fragment according to the invention, simultaneously or sequentially with a bile acid sequestering agent.
  • the bile acid sequestering agent is selected from the group consisting of cholestyramine, colesevelam, colestipol, and some combination thereof.
  • the invention comprises a method of lowering serum cholesterol levels in a subject comprising administering to a subject an effective amount of at least one at least one anti-PC SK9 antibody or fragment according to the invention, simultaneously or sequentially with an agent that decreases cholesterol absorption in the intestine.
  • the agent that decreases cholesterol absorption in the intestine is ezetimibe.
  • the invention comprises a method of lowering serum cholesterol levels in a subject comprising administering to a subject an effective amount of at least anti-PC SK9 antibody or fragment according to the invention, simultaneously or sequentially with an agent that decreases cholesterol levels.
  • the agent that decreases cholesterol levels is selected from the group consisting of certain antipsychotic agents, certain HIV protease inhibitors, dietary factors such as high fructose, sucrose, cholesterol or certain fatty acids and certain nuclear receptor agonists and antagonists for RXR, RAR, LXR, FXR.
  • the invention comprises a method of lowering serum cholesterol levels in a subject comprising administering to a subject an effective amount of at least one antibody or antibody fragment according to the invention simultaneously or sequentially with an agent that increases HDL levels.
  • the agent that increases HDL levels is niacin, also known as nicotinic acid.
  • the niacin is a slow-release formulation.
  • the invention comprises a method of lowering serum cholesterol levels in a subject comprising administering to a subject an effective amount of at least one anti-PC SK9 antibody or fragment according to the invention, simultaneously or sequentially with an agent that inhibits hepatic triglyceride production and/or very low density lipoprotein (VLDL) secretions.
  • the agent that inhibits hepatic triglyceride production and/or very low density lipoprotein (VLDL) secretions is acipimox.
  • the invention comprises a method of lowering serum cholesterol levels in a subject comprising administering to a subject an effective amount of at least one anti-PC SK9 antibody or fragment according to the invention, simultaneously or sequentially with an agent that decreases lipid absorption in the intestine.
  • the agent that decreases lipid absorption in the intestine is selected from the group consisting of orlistat, lipstatin, and some combination thereof or another known in the art.
  • the invention comprises a method of lowering serum cholesterol levels in a subject comprising administering to a subject an effective amount of at least one anti-PC SK9 antibody or fragment according to the invention, simultaneously or sequentially with an agent that is an anti-hypertensive and/or treats angina.
  • the agent that is an anti-hypertensive and/or treats angina is amlodipine or another anti-hypertensive such as those disclosed herein and known in the art.
  • the invention comprises a method of lowering serum cholesterol levels in a subject comprising administering to a subject an effective amount of at least one anti-PC SK9 antibody or fragment according to the invention, simultaneously or sequentially with at least one other agent, wherein the combination allows for mitigation of undesirable side-effects of at least one other agent.
  • the antibody or antibody fragment according to the invention and the at least one other agent are administered concurrently.
  • the anti-PCSK9 antibody or fragment according to the invention and at least one other agent are not administered simultaneously, with the antibody or antibody fragment according to the invention being administered before or after the at least one other agent is administered.
  • the invention comprises a method of increasing LDLR protein levels in a subject by administering to a subject an effective amount of at least one anti- PCSK9 antibody or fragment according to the invention as provided herein.
  • the invention comprises a method of increasing LDLR protein levels in a subject by administering to a subject an effective amount of at least one antibody or antibody fragment according to the invention simultaneously or sequentially with an agent that elevates the availability of LDLR protein.
  • the agent that elevates the availability of LDLR protein levels comprises a statin.
  • the statin is selected from the group consisting of atorvastatin, cerivastatin, fluvastatin, lovastatin, mevastatin, pitavastatin, pravastatin, rosuvastatin, simvastatin, and some combination thereof or another statin known in the art.
  • statin is combined with niacin, an absorption inhibitor (ezetimibe), a lipid modifying agent, or a combination thereof.
  • agent that elevates the availability of LDLR protein levels comprises certain cytokines like oncostatin M, estrogen, and/or certain herbal ingredients such as berberine.
  • the invention comprises a method of increasing LDLR protein levels in a subject by administering to a subject an effective amount of at least one antibody or antibody fragment according to the invention simultaneously or sequentially with an agent that increases high density lipoprotein (HDL) and/or decreases triglyceride levels.
  • the agent that increases high density lipoprotein (HDL) and/or decreases triglyceride levels comprises a fibrate.
  • the fibrate is selected from the group consisting of bezafibrate, ciprofibrate, clofibrate, gemfibrozil, fenofibrate, and some combination thereof.
  • the invention comprises a method of increasing LDLR protein levels in a subject by administering to a subject an effective amount of at least one antibody or antibody fragment according to the invention simultaneously or sequentially with a bile acid sequestering agent.
  • the bile acid sequestering agent is selected from the group consisting of cholestyramine, colesevelam, colestipol, and some combination thereof.
  • the invention comprises a method of increasing LDLR protein levels in a subject by administering to a subject an effective amount of at least one antibody or antibody fragment according to the invention simultaneously or sequentially with an agent that decreases cholesterol absorption in the intestine.
  • the agent that decreases cholesterol absorption in the intestine is ezetimibe.
  • the invention comprises a method of increasing LDLR protein levels in a subject by administering to a subject an effective amount of at least one antibody or antibody fragment according to the invention simultaneously or sequentially with an agent that decreases cholesterol levels.
  • the agent that decreases cholesterol levels is selected from the group consisting of certain anti-psychotic agents, certain HIV protease inhibitors, dietary factors such as high fructose, sucrose, cholesterol or certain fatty acids and certain nuclear receptor agonists and antagonists for RXR, RAR, LXR, FXR.
  • the invention comprises a method of increasing LDLR protein levels in a subject by administering to a subject an effective amount of at least one antibody or antibody fragment according to the invention simultaneously or sequentially with an agent that increases HDL levels.
  • the agent that increases HDL levels is niacin, also known as nicotinic acid.
  • the niacin is a slow-release formulation.
  • the invention comprises a method of increasing LDLR protein levels in a subject by administering to a subject an effective amount of at least one antibody or antibody fragment according to the invention simultaneously or sequentially with an agent that inhibits hepatic triglyceride production and/or very low density lipoprotein (VLDL) secretions.
  • the agent that inhibits hepatic triglyceride production and/or very low density lipoprotein (VLDL) secretions is acipimox.
  • the invention comprises a method of increasing LDLR protein levels in a subject by administering to a subject an effective amount of at least one antibody or antibody fragment according to the invention simultaneously or sequentially with an agent that decreases lipid absorption in the intestine.
  • the agent that decreases lipid absorption in the intestine is selected from the group consisting of orlistat, lipstatin, and some combination thereof.
  • the invention comprises a method of increasing LDLR protein levels in a subject by administering to a subject an effective amount of at least one antibody or antibody fragment according to the invention simultaneously or sequentially with an agent that is an anti-hypertensive and/or treats angina.
  • the agent that is an anti-hypertensive and/or treats angina is amlodipine.
  • the invention comprises a method of increasing LDLR protein levels in a subject by administering to a subject an effective amount of at least one antibody or antibody fragment according to the invention simultaneously or sequentially with at least one other agent, wherein the combination allows for mitigation of undesirable side-effects of at least one other agent.
  • the antibody or antibody fragment according to the invention and the at least one other agent are administered concurrently.
  • the antibody or antibody fragment according to the invention and at least one other agent are not administered simultaneously, with the antibody or antibody fragment according to the invention being administered before or after the at least one other agent is administered.
  • the invention comprises a neutralizing antibody or antibody fragment that binds to PCSK9 and reduces the low density lipoprotein receptor (LDLR) lowering effect of PCSK9 on LDLR.
  • the antibody or antibody fragment specifically binds to PCSK9.
  • the antibody or fragment binds to the catalytic domain of PCSK9.
  • humanized versions of the inventive antibodies may be derived from rabbit antibodies, using the humanization methods disclosed herein or other known humanization methods.
  • the invention contemplates any anti-PC SK9 antibody that contains at least one, two, three, four, five or all six of the CDRs of the anti-PCSK9 antibodies exemplified herein, as well as anti-PCSK9 antibodies and antibody fragments containing VH and/or VL regions which are at least 80, 90, 95, 96, 97, 98 or 99% identical to the VH and/or VL regions of any of the anti-PCSK9 antibodies or antibody fragments exemplified herein.
  • the invention contemplates polynucleotides encoding any anti-PCSK9 antibody that contains at least one, two, three, four, five or all six of the CDRs of the anti- PCSK9 antibodies exemplified herein, as well as anti-PCSK9 antibodies and antibody fragments containing VH and/or VL regions which are at least 80, 90, 95, 96, 97, 98 or 99% identical to the VH and/or VL regions of any of the anti-PCSK9 antibodies or antibody fragments exemplified herein, and host cells containing, i.e., antibodies or fragments capable of binding to PCSK9 and/or PCSK9/LDLR complexes.
  • the invention also contemplates conjugates of anti-PCSK9 antibodies and binding fragments thereof which may conjugated to one or more effector moiety, e.g., a detectable moiety.
  • the invention also contemplates methods of making anti-PCSK9 antibodies and fragments including, but are not limited to, Fab, Fab', F(ab')2, Fv, scFv fragments, SMIPs (small molecule immunopharmaceuticals), camelbodies, nanobodies, monovalent antibodies such as MetMabs and IgNAR.
  • the invention comprises a pharmaceutical or diagnostic composition comprising at least one isolated antibody or antibody fragment according to the invention.
  • the pharmaceutical or diagnostic composition further comprises a pharmaceutically acceptable diluent, carrier, solubilizer, emulsifier, preservative, or a mixture thereof.
  • the pharmaceutical or diagnostic composition further comprises at least one therapeutic agent for inflammation.
  • the therapeutic agent for inflammation comprises a cyclooxygenase type 1 inhibitor, a cyclooxygenase type 2 inhibitor, a small molecule modulator of p38-MAPK, a small molecule modulator of intracellular molecules involved in inflammation pathways, or mixtures thereof.
  • the pharmaceutical or diagnostic composition is lyophilized.
  • the invention comprises a method of making any of the antibody or antibody fragments containing any of the VH, VL or CDR amino acid sequences disclosed herein in a recombinant host cell, e.g., a yeast, fungi, mammalian cell, insect cell, bacterium, avian cell or egg, or a plant cell, and preferably a yeast, filamentous fungus or mammalian cell.
  • a recombinant host cell e.g., a yeast, fungi, mammalian cell, insect cell, bacterium, avian cell or egg, or a plant cell, and preferably a yeast, filamentous fungus or mammalian cell.
  • yeast fungi
  • filamentous fungi include, but are not limited to Pichia pastoris, Pichia fmlandica, Pichia trehalophila, Pichia koclamae, Pichia membranaefaciens, Pichia minuta (Ogataea minuta, Pichia lindneri), Pichia opuntiae, Pichia thermotolerans, Pichia salictaria, Pichia guercuum, Pichia pijperi, Pichia stiptis, Pichia methanolica, Pichia sp., Saccharomyces cerevisiae, Saccharomyces sp., Hansenula polymorpha, Kluyveromyces sp., Kluyveromyces lac
  • Pichia sp. any Saccharomyces sp., Hansenula polymorpha, any Kluyveromyces sp., Candida albicans, any Aspergillus sp., Trichoderma reesei, Chrysosporium lucknowense, any Fusarium sp. and Neurospora crassa.
  • invertebrate cells include insect cells such as Drosophila S2 and Spodoptera Sf9, as well as plant cells.
  • useful mammalian host cell lines include Chinese hamster ovary (CHO) and COS cells. More specific examples include monkey kidney CVl line transformed by SV40 (COS-7, ATCC CRL 1651); human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture, Graham et al, J. Gen Virol, 36:59 (1977)); Chinese hamster ovary cells/-DHFR (CHO, Urlaub and Chasin, Proc. Natl. Acad. Sci. USA, 77:4216 (1980)); mouse Sertoli cells (TM4, Mather, Biol.
  • human lung cells W138, ATCC CCL 75
  • human liver cells Hep G2, HB 8065
  • mouse mammary tumor MMT 060562, ATCC CCL51.
  • Preferred mammalian cells for antibody expression include CHO cells and COS cells.
  • the recombinant host cells are polyploidal yeast cells of the genus Pichia.
  • the host cell will comprise a Pichia pastoris cell, preferably diploidal.
  • the host cell will secrete the anti-PCSK9 antibody or fragment into the culture medium containing host cells, e.g., Pichia pastoris, at concentrations which are at least 10-25 mg/liter of said antibody.
  • Methods for producing recombinant host cells e.g., yeast, fungi, mammalian cells, insect cells, plant cells, avian cells, bacteria, et al, that contain heterologous antibody coding sequences and which express and secrete functional antibodies are well known.
  • the host cells that express the antibodies or fragments according to the invention are diploidal Pichia pastoris.
  • other yeast or fungi, including haploid forms may be used.
  • these methods in general comprise producing a recombinant diploidal yeast or fungal cell that expresses and secretes the antibody by: (i) introducing at least one expression vector containing one or more heterologous polynucleotides encoding the variable regions and optionally the constant regions of said antibody or antibody fragment, which sequences are operably linked to a promoter and a signal sequence into a host cell, e.g., a haploid yeast or fungal cell; (ii) producing by mating or spheroplast fusion a polyploidal yeast or fungi from said first and/or second haploid yeast or fungal cells; (iii) selecting polyploidal yeast or fungal cells that stably express said antibody; and (iv) producing stable polyploidal yeast or fungal cultures from said polyploidal yeast or fungal cells that stably express said antibody into the culture medium.
  • a host cell e.g., a haploid yeast or fungal cell
  • the yeast used may include any of the following genera: Arxiozyma; Ascobotryozyma; Citeromyces; Debaryomyces; Dekkera; Eremothecium; Issatchenkia; Kazachstania; Kluyveromyces; Kodamaea; Lodderomyces; Pachysolen; Pichia; Saccharomyces; Saturnispora; Tetrapisispora; Torulaspora; Williopsis; or Zygosaccharomyces.
  • the yeast genera is Pichia.
  • the species of Pichia is selected from Pichia pastoris, Pichia methanolica or Hansenula polymorpha (Pichia angusta). Suitable filamentous fungi which may be used to express the subject antibodies or fragments are identified supra.
  • the invention contemplates methods of making any anti- PCSK9 antibody or fragment containing any of the VH, VL or CDR amino acid sequences disclosed herein in a recombinant cell, wherein the recombinant cell comprises a heterologous polynucleotide encoding an anti-PCSK9 antibody containing a VH amino acid sequence at least 80, 85, 90, 95, 96, 97, 98 or 99% identical to any of the VH amino acid sequences in SEQ ID NO: 12, SEQ ID NO: 52, SEQ ID NO: 92, SEQ ID NO: 132, SEQ ID NO: 172, SEQ ID NO: 212, SEQ ID NO: 252, SEQ ID NO: 292, SEQ ID NO: 332, SEQ ID NO: 372, SEQ ID NO: 412, SEQ ID NO: 452, SEQ ID NO: 492, SEQ ID NO: 532, SEQ ID NO: 572, SEQ ID NO: 612, SEQ ID NO: 652, S
  • the heterologous polynucleotide further comprises a polynucleotide sequence encoding an anti-PCSK9 VL amino acid sequence at least 80, 85, 90, 95, 96, 97, 98 or 99% identical to any of the VL amino acid sequences in SEQ ID NO: 32, SEQ ID NO: 72, SEQ ID NO: 112, SEQ ID NO: 152, SEQ ID NO: 192, SEQ ID NO: 232, SEQ ID NO: 272, SEQ ID NO: 312, SEQ ID NO: 352, SEQ ID NO: 392, SEQ ID NO: 432, SEQ ID NO: 472, SEQ ID NO: 512, SEQ ID NO: 542, SEQ ID NO: 582, SEQ ID NO: 622, SEQ ID NO: 662, SEQ ID NO: 702, SEQ ID NO: 742, SEQ ID NO: 782, SEQ ID NO: 822, SEQ ID NO: 862, SEQ ID NO: 902, or SEQ
  • the heterologous polynucleotide comprises a sequence encoding VH and VL polypeptides at least 80, 85, 90, 95, 96, 97, 98 or 99% identical to any of the VH and VL amino acid sequences in contained in SEQ ID NO: 12 and SEQ ID NO: 32; SEQ ID NO: 52 and SEQ ID NO: 72; SEQ ID NO: 92 and SEQ ID NO: 112; SEQ ID NO: 132 and SEQ ID NO: 152; SEQ ID NO: 172 and SEQ ID NO: 192; SEQ ID NO: 212 and SEQ ID NO: 232; SEQ ID NO: 252 and SEQ ID NO: 272; SEQ ID NO: 292 and SEQ ID NO: 312; SEQ ID NO: 332 and SEQ ID NO: 352; SEQ ID NO: 372 and SEQ ID NO: 392; SEQ ID NO: 412 and SEQ ID NO: 432; SEQ ID NO: 452 and SEQ ID NO:
  • the heterologous polynucleotide encodes an anti-PCSK9 antibody or fragment wherein the antibody or fragment contains at least one CDR, at two or all three of the CDRs contained in a VL polypeptide and/or at least one CDR, two or all three of the CDRs contained in a VH polypeptide, wherein said VH and VL polypeptide sequences are selected from those in SEQ ID NO: 12, SEQ ID NO: 32; SEQ ID NO: 52, SEQ ID NO: 72; SEQ ID NO: 92, SEQ ID NO: 112; SEQ ID NO: 132, SEQ ID NO: 152; SEQ ID NO: 172, SEQ ID NO: 192; SEQ ID NO: 212, SEQ ID NO: 232, SEQ ID NO: 252, SEQ ID NO: 272; SEQ ID NO: 292, SEQ ID NO: 312; SEQ ID NO: 332, SEQ ID NO: 352; SEQ ID NO: 372, SEQ ID NO: 12; SEQ ID NO
  • the invention comprises a vector comprising the polynucleotide sequence above.
  • the invention comprises a host cell comprising the vector mentioned above.
  • the host cell mentioned above is a yeast cell belonging to the genus Pichia.
  • the invention comprises an isolated polynucleotide comprising the polynucleotide sequence encoding an anti-PCSK9 VL antibody amino acid sequence at least 80, 85, 90, 95, 96, 97, 98 or 99% identical or identical to any one of those in SEQ ID NO: 32, SEQ ID NO: 72, SEQ ID NO: 112, SEQ ID NO: 152, SEQ ID NO: 192, SEQ ID NO: 232, SEQ ID NO: 272, SEQ ID NO: 312, SEQ ID NO: 352, SEQ ID NO: 392, SEQ ID NO: 432, SEQ ID NO: 472, SEQ ID NO: 512, SEQ ID NO: 552, or SEQ ID NO: 592, SEQ ID NO: 632, SEQ ID NO: 672, SEQ ID NO: 712, SEQ ID NO: 752, SEQ ID NO: 792, SEQ ID NO: 832, SEQ ID NO: 872, SEQ ID NO: 912, or SEQ ID NO:
  • the invention comprises a vector comprising any combination of the polynucleotide sequence above.
  • the invention comprises a host cell comprising one or more vectors containing any of the polynucleotides mentioned above.
  • the invention embraces a host cell containing any of the afore -mentioned polynucleotides or a vector containing, e.g., a yeast, fungal, insect, plant, avian, bacterial or mammalian cell, and in an exemplary embodiment a yeast cell belonging to the genus Pichia.
  • the invention comprises an isolated nucleic acid comprising a polynucleotide that hybridizes under stringent conditions to SEQ ID NO: 12, SEQ ID NO: 32; SEQ ID NO: 52, SEQ ID NO: 72; SEQ ID NO: 92, SEQ ID NO: 112; SEQ ID NO: 132, SEQ ID NO: 152; SEQ ID NO: 172, SEQ ID NO: 192; SEQ ID NO: 212, SEQ ID NO: 232, SEQ ID NO: 252, SEQ ID NO: 272; SEQ ID NO: 292, SEQ ID NO: 312; SEQ ID NO: 332, SEQ ID NO: 352; SEQ ID NO: 372, SEQ ID NO: 392; SEQ ID NO: 412; SEQ ID NO: 432; SEQ ID NO: 452; SEQ ID NO: 472; SEQ ID NO: 492; SEQ ID NO: 512; SEQ ID NO: 532; SEQ ID NO: 552; SEQ
  • the invention also pertains to the use of anti-PCSK9 antibodies and binding fragments thereof containing or encoded by any of the afore-mentioned amino acid or polynucleotides sequences and variants thereof for the diagnosis, assessment and treatment of any of the diseases and disorders disclosed herein, i.e., especially disorders associated with PCSK9 or aberrant expression thereof.
  • the invention also contemplates the use of fragments of anti-PCSK9 antibodies and binding fragments thereof containing or encoded by any of the afore-mentioned amino acid or polynucleotides sequences and variants thereof for the diagnosis, assessment and treatment of diseases and disorders associated with PCSK9 or aberrant expression thereof.
  • Other specific embodiments of the invention relate to the production of anti-PCSK9 antibodies or fragments thereof in mammalian cells such as CHO, NSO or HEK 293 cells, or yeast cells (for example diploid yeast such as diploid Pichia) and other yeast strains.
  • Figures 1A-1G provide the polypeptide sequences of the full-length heavy chain for antibodies Abl-Ab24 aligned by their framework regions (FR), complementarity determining regions (CDRs), and constant regions.
  • FR framework regions
  • CDRs complementarity determining regions
  • Figures 2A-2D provide the polypeptide sequences of the full-length light chain for antibodies Abl-Ab24 aligned by their framework regions (FR), complementarity determining regions (CDRs), and constant regions.
  • FR framework regions
  • CDRs complementarity determining regions
  • Figure 3A-3S provide the polynucleotide sequences encoding the full-length heavy chain for antibodies Abl-Ab24 aligned by their framework regions (FR), complementarity determining regions (CDRs), and constant regions.
  • FR framework regions
  • CDRs complementarity determining regions
  • Figure 4A-4J provide the polynucleotide sequences encoding the full-length light chain for antibodies Abl-Ab24 aligned by their framework regions (FR), complementarity determining regions (CDRs), and constant regions.
  • FR framework regions
  • CDRs complementarity determining regions
  • Figure 5 provides the polypeptide sequence coordinates for the variable region and complementarity determining regions (CDRs) of the heavy chain for antibodies Abl- Ab24.
  • Figure 6 provides the polypeptide sequence coordinates for the constant region and framework regions (FR) of the heavy chain for antibodies Abl-Ab24.
  • Figure 7 provides the polypeptide sequence coordinates for the variable region and complementarity determining regions (CDRs) of the light chain for antibodies Abl-
  • Figure 8 provides the polypeptide sequence coordinates for the constant region and framework regions (FR) of the light chain for antibodies Abl-Ab24.
  • Figure 9 provides the polynucleotide sequence coordinates for the variable region and complementarity determining regions (CDRs) of the heavy chain for antibodies
  • Figure 10 provides the polynucleotide sequence coordinates for the constant region and framework regions (FR) of the heavy chain for antibodies Abl-Ab24.
  • Figure 11 provides the polynucleotide sequence coordinates for the variable region and complementarity determining regions (CDRs) of the light chain for antibodies Abl-Ab24.
  • Figure 12 provides the polynucleotide sequence coordinates for the constant region and framework regions (FR) of the light chain for antibodies Abl-Ab24.
  • Figure 13 provides the binding data for anti-PCSK9 antibodies to human PCSK9, obtained following the protocol in Example 1 infra for antibodies Abl, Ab2, Ab3, and Ab4.
  • Figure 14 provides the binding data for anti-PCSK9 antibodies to human PCSK9, obtained following the protocol in Example 1 infra for antibodies Ab5, Ab6, Ab8, and Ab9.
  • Figure 15 provides the binding data for anti-PCSK9 antibodies to human PCSK9, obtained following the protocol in Example 1 infra for antibodies Ab7, AblO, and Abl3.
  • Figure 16 provides the binding data for anti-PCSK9 antibodies to human
  • PCSK9 obtained following the protocol in Example 1 infra for antibodies Abl 1 and Abl2.
  • Figure 17 provides the binding data for anti-PCSK9 antibodies to human
  • PCSK9 obtained following the protocol in Example 1 infra for antibody Abl4.
  • Figure 18 provides the binding data for anti-PCSK9 antibodies to human
  • PCSK9 obtained following the protocol in Example 1 infra for antibody Abl5.
  • Figure 19 provides the binding data for anti-PCSK9 antibodies to human
  • PCSK9 obtained following the protocol in Example 1 infra for antibodies Abl 6 and Abl 7.
  • Figure 20 provides the binding data for anti-PCSK9 antibodies to human
  • PCSK9 obtained following the protocol in Example 1 infra for antibody Abl 8.
  • Figure 21 provides the binding data for anti-PCSK9 antibodies to human
  • PCSK9 obtained following the protocol in Example 1 infra for antibody Abl 9.
  • Figure 22 provides the binding data for anti-PCSK9 antibodies to human
  • PCSK9 obtained following the protocol in Example 1 infra for antibody Ab20.
  • Figure 23 provides the binding data for anti-PCSK9 antibodies to human
  • PCSK9 obtained following the protocol in Example 1 infra for antibody Ab22.
  • Figure 25 provides the binding data for anti-PCSK9 antibodies to human
  • PCSK9 obtained following the protocol in Example 1 infra for antibody Ab23.
  • Figure 26 provides the binding data for anti-PCSK9 antibodies to human
  • PCSK9 obtained following the protocol in Example 1 infra for antibody Ab24.
  • Figure 27 provides LDL-C uptake inhibition data obtained following the protocol in Example 1 infra for antibody Abl .
  • Figure 28 provides LDL-C uptake inhibition data obtained following the protocol in Example 1 infra for antibody Ab2.
  • Figure 29 provides LDL-C uptake inhibition data obtained following the protocol in Example 1 infra for antibody Ab3.
  • Figure 30 provides LDL-C uptake inhibition data obtained following the protocol in Example 1 infra for antibody Ab4.
  • Figure 31 provides LDL-C uptake inhibition data obtained following the protocol in Example 1 infra for antibody Ab5.
  • Figure 32 provides uptake inhibition data obtained following the protocol in Example 1 infra for antibodies Ab6 and Ab7.
  • Figure 33 provides LDL-C uptake inhibition data obtained following the protocol in Example 1 infra for antibody Ab8.
  • Figure 34 provides LDL-C uptake inhibition data obtained following the protocol in Example 1 infra for antibody Ab9.
  • Figure 35 provides LDL-C uptake inhibition data obtained following the protocol in Example 1 infra for antibodies AblO, Abl 1, and Abl2.
  • Figure 36 provides LDL-C uptake inhibition data obtained following the protocol in Example 1 infra for antibody Abl3.
  • Figure 37 provides LDL-C uptake inhibition data obtained following the protocol in Example 1 infra for antibody Abl 4.
  • Figure 38 provides LDL-C uptake inhibition data obtained following the protocol in Example 1 infra for antibody Abl5.
  • Figure 39 provides LDL-C uptake inhibition data obtained following the protocol in Example 1 infra for antibodies Abl6 and Abl7.
  • Figure 40 provides LDL-C uptake inhibition data obtained following the protocol in Example 1 infra for antibody Abl8.
  • Figure 41 provides LDL-C uptake inhibition data obtained following the protocol in Example 1 infra for antibody Abl9.
  • Figure 42 provides LDL-C uptake inhibition data obtained following the protocol in Example 1 infra for antibody Ab20.
  • Figure 43 provides LDL-C uptake inhibition data obtained following the protocol in Example 1 infra for antibody Ab21.
  • Figure 44 provides LDL-C uptake inhibition data obtained following the protocol in Example 1 infra for antibody Ab22.
  • Figure 45 provides LDL-C uptake inhibition data obtained following the protocol in Example 1 infra for antibody Ab23.
  • Figure 46 provides LDL-C uptake inhibition data obtained following the protocol in Example 1 infra for antibody Ab24.
  • Figure 47 provides the binding data for anti-PCSK9 antibodies to cynomolgus monkey PCSK9, obtained following the protocol in Example 1 infra for antibodies Abl, Ab2, Ab3, and Ab4.
  • Figure 48 provides the binding data for anti-PCSK9 antibodies to cynomolgus monkey PCSK9, obtained following the protocol in Example 1 infra for antibodies Ab5, Ab6, Ab7, and Ab8.
  • Figure 49 provides the binding data for anti-PCSK9 antibodies to cynomolgus monkey PCSK9, obtained following the protocol in Example 1 infra for antibodies Ab9, AblO, Abl l, and Abl2.
  • Figure 50 provides the binding data for anti-PCSK9 antibodies to cynomolgus monkey PCSK9, obtained following the protocol in Example 1 infra for antibody Abl3.
  • Figure 51 provides the binding data for anti-PCSK9 antibodies to cynomolgus monkey PCSK9, obtained following the protocol in Example 1 infra for antibody Abl4.
  • Figure 52 provides the binding data for anti-PCSK9 antibodies to cynomolgus monkey PCSK9, obtained following the protocol in Example 1 infra for antibody Abl5.
  • Figure 53 provides the binding data for anti-PCSK9 antibodies to cynomolgus monkey PCSK9, obtained following the protocol in Example 1 infra for antibodies Abl6 and AM 7.
  • Figure 54 provides the binding data for anti-PCSK9 antibodies to cynomolgus monkey PCSK9, obtained following the protocol in Example 1 infra for antibody Abl8.
  • Figure 55 provides the binding data for anti-PCSK9 antibodies to cynomolgus monkey PCSK9, obtained following the protocol in Example 1 infra for antibody Abl9.
  • Figure 56 provides the binding data for anti-PCSK9 antibodies to cynomolgus monkey PCSK9, obtained following the protocol in Example 1 infra for antibody Ab20.
  • Figure 57 provides the binding data for anti-PCSK9 antibodies to cynomolgus monkey PCSK9, obtained following the protocol in Example 1 infra for antibody Ab21.
  • Figure 58 provides the binding data for anti-PCSK9 antibodies to cynomolgus monkey PCSK9, obtained following the protocol in Example 1 infra for antibody Ab22.
  • Figure 59 provides the binding data for anti-PCSK9 antibodies to cynomolgus monkey PCSK9, obtained following the protocol in Example 1 infra for antibody Ab23.
  • Figure 60 provides the binding data for anti-PCSK9 antibodies to cynomolgus monkey PCSK9, obtained following the protocol in Example 1 infra for antibody Ab24.
  • Figure 61 provides the inhibition data for anti-PCSK9 antibodies to block the interaction of PCSK9 with LDLR, obtained following the protocol in Example 6 infra for antibody Abl .
  • Figure 62 provides the inhibition data for anti-PCSK9 antibodies to block the interaction of PCSK9 with LDLR, obtained following the protocol in Example 6 infra for antibody Ab2.
  • Figure 63 provides the inhibition data for anti-PCSK9 antibodies to block the interaction of PCSK9 with LDLR, obtained following the protocol in Example 6 infra for antibody Ab3.
  • Figure 64 provides the inhibition data for anti-PCSK9 antibodies to block the interaction of PCSK9 with LDLR, obtained following the protocol in Example 6 infra for antibody Ab4.
  • Figure 65 provides the inhibition data for anti-PCSK9 antibodies to block the interaction of PCSK9 with LDLR, obtained following the protocol in Example 6 infra for antibody Ab5.
  • Figure 66 provides the inhibition data for anti-PCSK9 antibodies to block the interaction of PCSK9 with LDLR, obtained following the protocol in Example 6 infra for antibody Ab6.
  • Figure 67 provides the inhibition data for anti-PCSK9 antibodies to block the interaction of PCSK9 with LDLR, obtained following the protocol in Example 6 infra for antibody Ab7.
  • Figure 68 provides the inhibition data for anti-PCSK9 antibodies to block the interaction of PCSK9 with LDLR, obtained following the protocol in Example 6 infra for antibody Ab8.
  • Figure 69 provides the inhibition data for anti-PCSK9 antibodies to block the interaction of PCSK9 with LDLR, obtained following the protocol in Example 6 infra for antibody Ab9.
  • Figure 70 provides the inhibition data for anti-PCSK9 antibodies to block the interaction of PCSK9 with LDLR, obtained following the protocol in Example 6 infra for antibody Ab 10.
  • Figure 71 provides the inhibition data for anti-PCSK9 antibodies to block the interaction of PCSK9 with LDLR, obtained following the protocol in Example 6 infra for antibody Abl 1.
  • Figure 72 provides the inhibition data for anti-PCSK9 antibodies to block the interaction of PCSK9 with LDLR, obtained following the protocol in Example 6 infra for antibody Abl 2.
  • Figure 73 provides the inhibition data for anti-PCSK9 antibodies to block the interaction of PCSK9 with LDLR, obtained following the protocol in Example 6 infra for antibody Abl3.
  • Figure 74 provides the inhibition data for anti-PCSK9 antibodies to block the interaction of PCSK9 with LDLR, obtained following the protocol in Example 6 infra for antibody Ab 14.
  • Figure 75 provides the inhibition data for anti-PCSK9 antibodies to block the interaction of PCSK9 with LDLR, obtained following the protocol in Example 6 infra for antibody Abl5.
  • Figure 76 provides the inhibition data for anti-PCSK9 antibodies to block the interaction of PCSK9 with LDLR, obtained following the protocol in Example 6 infra for antibody Abl6.
  • Figure 77 provides the inhibition data for anti-PCSK9 antibodies to block the interaction of PCSK9 with LDLR, obtained following the protocol in Example 6 infra for antibody Abl7.
  • Figure 78 provides the inhibition data for anti-PCSK9 antibodies to block the interaction of PCSK9 with LDLR, obtained following the protocol in Example 6 infra for antibody Ab 18.
  • Figure 79 provides the inhibition data for anti-PCSK9 antibodies to block the interaction of PCSK9 with LDLR, obtained following the protocol in Example 6 infra for antibody Ab 19.
  • Figure 80 provides the inhibition data for anti-PCSK9 antibodies to block the interaction of PCSK9 with LDLR, obtained following the protocol in Example 6 infra for antibody Ab20.
  • Figure 81 provides the inhibition data for anti-PCSK9 antibodies to block the interaction of PCSK9 with LDLR, obtained following the protocol in Example 6 infra for antibody Ab21.
  • Figure 82 provides the inhibition data for anti-PCSK9 antibodies to block the interaction of PCSK9 with LDLR, obtained following the protocol in Example 6 infra for antibody Ab22.
  • Figure 83 provides the inhibition data for anti-PCSK9 antibodies to block the interaction of PCSK9 with LDLR, obtained following the protocol in Example 6 infra for antibody Ab23.
  • Figure 84 provides the inhibition data for anti-PCSK9 antibodies to block the interaction of PCSK9 with LDLR, obtained following the protocol in Example 6 infra for antibody Ab24.
  • Figure 85 provides data showing the serum LDL-C cholesterol level in cynomolgus monkeys injected with Abl8.
  • Figure 86 provides data showing the serum total cholesterol level in cynomolgus monkeys injected with Abl8 as a percentage change from pre-dose levels.
  • Figure 87 provides data showing the serum HDL cholesterol level in cynomolgus monkeys injected with Abl8 as a percentage change from pre-dose levels.
  • Figure 88 provides data showing the serum LDL-C cholesterol level in cynomolgus monkeys injected with Abl 1 as a percentage change from pre-dose levels.
  • Figure 89 provides data showing the serum total cholesterol level in cynomolgus monkeys injected with Abl 1 as a percentage change from pre-dose levels.
  • Figure 90 provides data showing the serum HDL cholesterol level in cynomolgus monkeys injected with Abl 1 as a percentage change from pre-dose levels.
  • Figure 91 provides data showing the serum LDL-C cholesterol level in cynomolgus monkeys injected with Abl 9 as a percentage change from pre-dose levels.
  • Figure 92 provides data showing the serum LDL-C cholesterol level in cynomolgus monkeys injected with Ab20 as a percentage change from pre-dose levels.
  • Figure 93 provides data showing the serum LDL-C cholesterol level in cynomolgus monkeys injected with Ab22 as a percentage change from pre-dose levels.
  • Figure 94 provides data showing the serum LDL-C cholesterol level in cynomolgus monkeys injected with Ab24 as a percentage change from pre-dose levels.
  • a preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment that competes with and/or specifically binds to the same or overlapping epitope(s) on human PCSK9 as an anti-human PCSK9 antibody selected from the group consisting of Abl, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8, Ab9, AblO, Abl 1, Abl2, Abl3, Abl4, Abl5, Abl6, Abl7, Abl8, Abl9, Ab20, Ab21, Ab22, Ab23 and Ab24.
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment wherein said antibody or antibody fragment specifically binds to the same or overlapping epitope(s) on human PCSK9 as an anti- human PCSK9 antibody selected from the group consisting of Abl, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8, Ab9, AblO, Abl l, Abl2, Abl3, Abl4, Abl5, Abl6, Abl7, Abl8, Abl9, Ab20, Ab21, Ab22, Ab23 and Ab24.
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment wherein said epitope(s) are identified using a binding assay that detects the binding of said anti-human PCSK9 antibody to one or more peptides in a library of 10-15-mer peptides which are overlapping peptide fragments of human PCSK9 that correspond to all or substantially all of the length of the human PCSK9 polypeptide.
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment, wherein said binding assay is a Western
  • immunoblot assay which detects specific binding of the antibody or antibody fragment to one or more of said 10-15 mer peptides in said library by the use of a chemiluminescent label which emits a detectable chemiluminescent signal when specific binding of said antibody or antibody fragment to a peptide in said library occurs.
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment wherein said antibody or antibody fragment contains at least 2 complementarity determining regions (CDRs) of an anti-PCSK9 antibody selected from the group consisting of Abl, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8, Ab9, AblO, Abl l, Abl2, Abl3, Abl4, Abl5, Abl6, Abl7, Abl8, Abl9, Ab20, Ab21, Ab22, Ab23 and Ab24.
  • CDRs complementarity determining regions
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment, wherein said antibody or antibody fragment contains at least 3 complementarity determining regions (CDRs) of an anti-PCSK9 antibody selected from the group consisting of Abl, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8, Ab9, AblO, Abl l, Abl2, Abl3, Abl4, Abl5, Abl6, Abl7, Abl8, Abl9, Ab20, Ab21, Ab22, Ab23 and Ab24.
  • CDRs complementarity determining regions
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment , wherein said antibody or antibody fragment contains at least 4 complementarity determining regions (CDRs) of an anti-PCSK9 antibody selected from the group consisting of Abl, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8, Ab9, AblO, Abl l, Abl2, Abl3, Abl4, Abl5, Abl6, Abl7, Abl8, Abl9, Ab20, Ab21, Ab22, Ab23 and Ab24.
  • CDRs complementarity determining regions
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment, wherein said antibody or antibody fragment contains at least 5 complementarity determining regions (CDRs) of an anti-PCSK9 antibody selected from the group consisting of Abl, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8, Ab9, AblO, Abl l, Abl2, Abl3, Abl4, Abl5, Abl6, Abl7, Abl8, Abl9, Ab20, Ab21, Ab22, Ab23 and Ab24.
  • CDRs complementarity determining regions
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment, wherein said antibody or antibody fragment contains all 6 complementarity determining regions (CDRs) of an anti-PCSK9 antibody selected from the group consisting of Abl, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8, Ab9, AblO, Abl 1, Abl2, Abl3, Abl4, Abl5, Abl6, Abl7, Abl8, Abl9, Ab20, Ab21, Ab22, Ab23 and Ab24.
  • CDRs complementarity determining regions
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment wherein said antibody or antibody fragment contains (a) a variable heavy chain comprising a CDR1 sequence selected from the group consisting of SEQ ID NO: 4, SEQ ID NO: 44, SEQ ID NO: 84, SEQ ID NO: 124, SEQ ID NO: 164, SEQ ID NO: 204, SEQ ID NO: 244, SEQ ID NO: 284, SEQ ID NO: 324, SEQ ID NO: 364, SEQ ID NO: 404, SEQ ID NO: 444, SEQ ID NO: 484, SEQ ID NO: 524, SEQ ID NO: 564, SEQ ID NO: 604, SEQ ID NO: 644, SEQ ID NO: 684, SEQ ID NO: 724, SEQ ID NO: 764, SEQ ID NO: 804, SEQ ID NO: 844, SEQ ID NO: 884, and SEQ ID NO: 924; a CDR2 sequence selected from the group consisting of SEQ ID NO: 4, S
  • variable light chain comprising a CDR1 sequence selected from the group consisting of SEQ ID NO: 24, SEQ ID NO: 64, SEQ ID NO: 104, SEQ ID NO: 144, SEQ ID NO: 184, SEQ ID NO: 224, SEQ ID NO: 264, SEQ ID NO: 304, SEQ ID NO: 344, SEQ ID NO: 384, SEQ ID NO: 424, SEQ ID NO: 464, SEQ ID NO: 504, SEQ ID NO: 544, SEQ ID NO: 584, SEQ ID NO: 624, SEQ ID NO: 664, SEQ ID NO: 704, SEQ ID NO: 744, SEQ ID NO: 784, SEQ ID NO: 824, SEQ ID NO: 864, SEQ ID NO: 904, and SEQ ID NO: 944; a CDR2 sequence selected from the group consisting of SEQ ID NO: 26, SEQ ID NO: 66, SEQ ID NO: 106, SEQ ID NO: 146, SEQ
  • variable heavy chain comprises the CDRl sequence of SEQ ID NO: 4, the CDR2 sequence of SEQ ID NO: 6, and the CDR3 sequence of SEQ ID NO: 8; and/or the variable light chain comprises the CDRl sequence of SEQ ID NO: 24, the CDR2 sequence of SEQ ID NO: 26, and the CDR3 sequence of SEQ ID NO: 28.
  • variable heavy chain comprises the CDRl sequence of SEQ ID NO: 44, the CDR2 sequence of SEQ ID NO: 46, and the CDR3 sequence of SEQ ID NO: 48; and/or the variable light chain comprises the CDRl sequence of SEQ ID NO: 64, the CDR2 sequence of SEQ ID NO: 66, and the CDR3 sequence of SEQ ID NO: 68.
  • variable heavy chain comprises the CDRl sequence of SEQ ID NO: 84, the CDR2 sequence of SEQ ID NO: 86, and the CDR3 sequence of SEQ ID NO: 88; and/or the variable light chain comprises the CDRl sequence of SEQ ID NO: 104, the CDR2 sequence of SEQ ID NO: 106, and the CDR3 sequence of SEQ ID NO: 108.
  • variable heavy chain comprises the CDRl sequence of SEQ ID NO: 124, the CDR2 sequence of SEQ ID NO: 126, and the CDR3 sequence of SEQ ID NO: 128; and/or the variable light chain comprises the CDRl sequence of SEQ ID NO: 144, the CDR2 sequence of SEQ ID NO: 146, and the CDR3 sequence of SEQ ID NO: 148.
  • variable heavy chain comprises the CDRl sequence of SEQ ID NO: 164, the CDR2 sequence of SEQ ID NO: 166, and the CDR3 sequence of SEQ ID NO: 168; and the variable light chain comprises the CDRl sequence of SEQ ID NO: 184, the CDR2 sequence of SEQ ID NO: 186, and the CDR3 sequence of SEQ ID NO: 188.
  • variable heavy chain comprises the CDRl sequence of SEQ ID NO: 204, the CDR2 sequence of SEQ ID NO: 206, and the CDR3 sequence of SEQ ID NO: 208; and the variable light chain comprises the CDRl sequence of SEQ ID NO: 224, the CDR2 sequence of SEQ ID NO: 226, and the CDR3 sequence of SEQ ID NO: 228.
  • variable heavy chain comprises the CDRl sequence of SEQ ID NO: 244, the CDR2 sequence of SEQ ID NO: 246, and the CDR3 sequence of SEQ ID NO: 248; and the variable light chain comprises the CDRl sequence of SEQ ID NO: 264, the CDR2 sequence of SEQ ID NO: 266, and the CDR3 sequence of SEQ ID NO: 268.
  • variable heavy chain comprises the CDRl sequence of SEQ ID NO: 284, the CDR2 sequence of SEQ ID NO: 286, and the CDR3 sequence of SEQ ID NO: 288; and the variable light chain comprises the CDRl sequence of SEQ ID NO: 304, the CDR2 sequence of SEQ ID NO: 306, and the CDR3 sequence of SEQ ID NO: 308.
  • variable heavy chain comprises the CDRl sequence of SEQ ID NO: 324, the CDR2 sequence of SEQ ID NO: 326, and the CDR3 sequence of SEQ ID NO: 328; and/or the variable light chain comprises the CDRl sequence of SEQ ID NO: 344, the CDR2 sequence of SEQ ID NO: 346, and the CDR3 sequence of SEQ ID NO: 348.
  • variable heavy chain comprises the CDRl sequence of SEQ ID NO: 364, the CDR2 sequence of SEQ ID NO: 366, and the CDR3 sequence of SEQ ID NO: 368; and/or the variable light chain comprises the CDRl sequence of SEQ ID NO: 384, the CDR2 sequence of SEQ ID NO: 386, and the CDR3 sequence of SEQ ID NO: 388.
  • variable heavy chain comprises the CDRl sequence of SEQ ID NO: 404, the CDR2 sequence of SEQ ID NO: 406, and the CDR3 sequence of SEQ ID NO: 408; and/or the variable light chain comprises the CDRl sequence of SEQ ID NO: 424, the CDR2 sequence of SEQ ID NO: 426, and the CDR3 sequence of SEQ ID NO: 428.
  • variable heavy chain comprises the CDRl sequence of SEQ ID NO: 444, the CDR2 sequence of SEQ ID NO: 446, and the CDR3 sequence of SEQ ID NO: 448; and the variable light chain comprises the CDRl sequence of SEQ ID NO: 464, the CDR2 sequence of SEQ ID NO: 466, and the CDR3 sequence of SEQ ID NO: 468.
  • variable heavy chain comprises the CDRl sequence of SEQ ID NO: 484, the CDR2 sequence of SEQ ID NO: 486, and the CDR3 sequence of SEQ ID NO: 488; and/or the variable light chain comprises the CDRl sequence of SEQ ID NO: 504, the CDR2 sequence of SEQ ID NO: 506, and the CDR3 sequence of SEQ ID NO: 508.
  • variable heavy chain comprises the CDRl sequence of SEQ ID NO: 524, the CDR2 sequence of SEQ ID NO: 526, and the CDR3 sequence of SEQ ID NO: 528; and/or the variable light chain comprises the CDRl sequence of SEQ ID NO: 544, the CDR2 sequence of SEQ ID NO: 546, and the CDR3 sequence of SEQ ID NO: 548.
  • variable heavy chain comprises the CDRl sequence of SEQ ID NO: 564, the CDR2 sequence of SEQ ID NO: 566, and the CDR3 sequence of SEQ ID NO: 568; and/or the variable light chain comprises the CDRl sequence of SEQ ID NO: 584, the CDR2 sequence of SEQ ID NO: 586, and the CDR3 sequence of SEQ ID NO: 588.
  • variable heavy chain comprises the CDRl sequence of SEQ ID NO: 604, the CDR2 sequence of SEQ ID NO: 606, and the CDR3 sequence of SEQ ID NO: 608; and/or the variable light chain comprises the CDRl sequence of SEQ ID NO: 624, the CDR2 sequence of SEQ ID NO: 626, and the CDR3 sequence of SEQ ID NO: 628.
  • variable heavy chain comprises the CDRl sequence of SEQ ID NO: 644, the CDR2 sequence of SEQ ID NO: 646, and the CDR3 sequence of SEQ ID NO: 648; and/or the variable light chain comprises the CDRl sequence of SEQ ID NO: 664, the CDR2 sequence of SEQ ID NO: 666, and the CDR3 sequence of SEQ ID NO: 668.
  • variable heavy chain comprises the CDRl sequence of SEQ ID NO: 684, the CDR2 sequence of SEQ ID NO: 686, and the CDR3 sequence of SEQ ID NO: 688; and/or the variable light chain comprises the CDRl sequence of SEQ ID NO: 704, the CDR2 sequence of SEQ ID NO: 706, and the CDR3 sequence of SEQ ID NO: 708.
  • variable heavy chain comprises the CDRl sequence of SEQ ID NO: 724, the CDR2 sequence of SEQ ID NO: 726, and the CDR3 sequence of SEQ ID NO: 728; and/or the variable light chain comprises the CDRl sequence of SEQ ID NO: 744, the CDR2 sequence of SEQ ID NO: 746, and the CDR3 sequence of SEQ ID NO: 748.
  • variable heavy chain comprises the CDRl sequence of SEQ ID NO: 764, the CDR2 sequence of SEQ ID NO: 766, and the CDR3 sequence of SEQ ID NO: 768; and/or the variable light chain comprises the CDRl sequence of SEQ ID NO: 784, the CDR2 sequence of SEQ ID NO: 786, and the CDR3 sequence of SEQ ID NO: 788.
  • variable heavy chain comprises the CDR1 sequence of SEQ ID NO: 804, the CDR2 sequence of SEQ ID NO: 806, and the CDR3 sequence of SEQ ID NO: 808; and/or the variable light chain comprises the CDR1 sequence of SEQ ID NO: 824, the CDR2 sequence of SEQ ID NO: 826, and the CDR3 sequence of SEQ ID NO: 828.
  • variable heavy chain comprises the CDR1 sequence of SEQ ID NO: 844, the CDR2 sequence of SEQ ID NO: 846, and the CDR3 sequence of SEQ ID NO: 848; and/or the variable light chain comprises the CDR1 sequence of SEQ ID NO: 864, the CDR2 sequence of SEQ ID NO: 866, and the CDR3 sequence of SEQ ID NO: 868.
  • variable heavy chain comprises the CDR1 sequence of SEQ ID NO: 884, the CDR2 sequence of SEQ ID NO: 886, and the CDR3 sequence of SEQ ID NO: 888; and/or the variable light chain comprises the CDR1 sequence of SEQ ID NO: 904, the CDR2 sequence of SEQ ID NO: 906, and the CDR3 sequence of SEQ ID NO: 908.
  • variable heavy chain comprises the CDR1 sequence of SEQ ID NO: 924, the CDR2 sequence of SEQ ID NO: 926, and the CDR3 sequence of SEQ ID NO: 928; and/or the variable light chain comprises the CDR1 sequence of SEQ ID NO: 944, the CDR2 sequence of SEQ ID NO: 946, and the CDR3 sequence of SEQ ID NO: 948.
  • variable heavy chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 2 and/or the variable light chain comprises SEQ ID NO: 22.
  • variable heavy and light chains are each at least 90% identical to the variable heavy and light chains in SEQ ID NO: 2 and SEQ ID NO: 22, respectively.
  • variable heavy chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 42 and the variable light chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 62.
  • variable heavy and light chains are each at least 90% identical to the variable heavy and light chains in SEQ ID NO: 42 and SEQ ID NO: 62, respectively.
  • variable heavy chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 82 and the variable light chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 102.
  • variable heavy and light chains are each at least 90% identical to the variable heavy and light chains in SEQ ID NO: 82 and SEQ ID NO: 102, respectively.
  • variable heavy chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100%) identical to SEQ ID NO: 122 and the variable light chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 142.
  • variable heavy and light chains are each at least 90% identical to the variable heavy and light chains in SEQ ID NO: 122 and SEQ ID NO: 142, respectively.
  • variable heavy chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 162 and the variable light chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 182.
  • variable heavy and light chains are each at least 90% identical to the variable heavy and light chains in SEQ ID NO: 162 and SEQ ID NO: 182, respectively.
  • variable heavy chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 202 and the variable light chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 222.
  • variable heavy and light chains are each at least 90% identical to the variable heavy and light chains in SEQ ID NO: 202 and SEQ ID NO: 222, respectively.
  • variable heavy chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 242 and the variable light chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 262.
  • variable heavy and light chains are each at least 90% identical to the variable heavy and light chains in SEQ ID NO: 242 and SEQ ID NO: 262, respectively.
  • variable heavy chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 282 and the variable light chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 302.
  • variable heavy and light chains are each at least 90% identical to the variable heavy and light chains in SEQ ID NO: 282 and SEQ ID NO: 302, respectively.
  • variable heavy chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 322 and the variable light chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 342.
  • variable heavy and light chains are each at least 90% identical to the variable heavy and light chains in SEQ ID NO: 322 and SEQ ID NO: 342, respectively.
  • variable heavy chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 362 and the variable light chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 382.
  • variable heavy and light chains are each at least 90% identical to the variable heavy and light chains in SEQ ID NO: 362 and SEQ ID NO: 382, respectively.
  • variable heavy chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100%) identical to SEQ ID NO: 402 and the variable light chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 422.
  • variable heavy and light chains are each at least 90% identical to the variable heavy and light chains in SEQ ID NO: 402 and SEQ ID NO: 422, respectively.
  • variable heavy chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 442 and the variable light chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 462.
  • variable heavy and light chains are each at least 90% identical to the variable heavy and light chains in SEQ ID NO: 442 and SEQ ID NO: 462, respectively.
  • variable heavy chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 482 and the variable light chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 502.
  • variable heavy and light chains are each at least 90% identical to the variable heavy and light chains in SEQ ID NO: 482 and SEQ ID NO: 502, respectively.
  • variable heavy chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100%) identical to SEQ ID NO: 522 and the variable light chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 542.
  • variable heavy and light chains are each at least 90% identical to the variable heavy and light chains in SEQ ID NO: 522 and SEQ ID NO: 542, respectively.
  • variable heavy chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 562 and the variable light chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 582.
  • variable heavy and light chains are each at least 90% identical to the variable heavy and light chains in SEQ ID NO: 562 and SEQ ID NO: 582, respectively.
  • variable heavy chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 602 and the variable light chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 622.
  • variable heavy and light chains are each at least 90% identical to the variable heavy and light chains in SEQ ID NO: 602 and SEQ ID NO: 622, respectively.
  • variable heavy chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 642 and the variable light chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 662.
  • variable heavy and light chains are each at least 90% identical to the variable heavy and light chains in SEQ ID NO: 642 and SEQ ID NO: 662, respectively.
  • variable heavy chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 682 and the variable light chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 702.
  • variable heavy and light chains are each at least 90% identical to the variable heavy and light chains in SEQ ID NO: 682 and SEQ ID NO: 702, respectively
  • variable heavy chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 722 and the variable light chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 742.
  • variable heavy and light chains are each at least 90% identical to the variable heavy and light chains in SEQ ID NO: 722 and SEQ ID NO: 742, respectively
  • variable heavy chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 762 and the variable light chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 782.
  • variable heavy and light chains are each at least 90% identical to the variable heavy and light chains in SEQ ID NO: 762 and SEQ ID NO: 782, respectively.
  • variable heavy chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 802 and the variable light chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 822.
  • variable heavy and light chains are each at least 90% identical to the variable heavy and light chains in SEQ ID NO: 802 and SEQ ID NO: 822, respectively.
  • variable heavy chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 842 and the variable light chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 862.
  • variable heavy and light chains are each at least 90% identical to the variable heavy and light chains in SEQ ID NO: 842 and SEQ ID NO: 862, respectively.
  • variable heavy chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 882 and the variable light chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 902.
  • variable heavy and light chains are each at least 90% identical to the variable heavy and light chains in SEQ ID NO: 882 and SEQ ID NO: 902, respectively.
  • variable heavy chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 922 and the variable light chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 942.
  • variable heavy and light chains are each at least 90% identical to the variable heavy and light chains in SEQ ID NO: 922 and SEQ ID NO: 942, respectively.
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment, wherein the heavy chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 1 and the light chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 21.
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment wherein the heavy chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 41 and the light chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 61.
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment wherein the heavy chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 81 and the light chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 101.
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment wherein the heavy chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 121 and the light chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 141.
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment, wherein the heavy chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 161 and the light chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 181.
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment , wherein the heavy chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 201 and the light chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 221.
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment wherein the heavy chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 241 and the light chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 261.
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment wherein the heavy chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 281 and the light chain comprises SEQ ID NO: 301.
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment, wherein the heavy chain comprises SEQ ID NO: 321 and the light chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 341.
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment wherein the heavy chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 361 and the light chain comprises SEQ ID NO: 381.
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment, wherein the heavy chain comprises SEQ ID NO: 401 and the light chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 421.
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment, wherein the heavy chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 441 and the light chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 461.
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment, wherein the heavy chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 481 and the light chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 501.
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment, wherein the heavy chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 521 and the light chain comprises SEQ ID NO: 541.
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment wherein the heavy chain comprises SEQ ID NO: 561 and the light chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 581.
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment wherein the heavy chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 601 and the light chain comprises SEQ ID NO: 621.
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment, wherein the heavy chain comprises SEQ ID NO: 641 and the light chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 661.
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment of wherein the heavy chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 681 and the light chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100%) identical to SEQ ID NO: 701.
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment, wherein the heavy chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 721 and the light chain comprises SEQ ID NO: 741.
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment, wherein the heavy chain comprises SEQ ID NO: 761 and the light chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 781.
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment of wherein the heavy chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 801 and the light chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 821.
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment, wherein the heavy chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 841 and the light chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 861.
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment, wherein the heavy chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 881 and the light chain comprises SEQ ID NO: 901.
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment, wherein the heavy chain comprises SEQ ID NO: 921 and the light chain comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 941.
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment wherein the antibody or antibody fragment is selected from the group consisting of chimeric, humanized, and human antibodies or antibody fragments.
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment, wherein the antibody or antibody fragment is selected from the group consisting of scFvs, camelbodies, nanobodies, IgNAR, F a b fragments, F a b' fragments, MetMab like antibodies, monovalent antibody fragments, and F(ab')2 fragments.
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment, wherein the antibody or antibody fragment substantially or entirely lacks N-glycosylation and/or O-glycosylation.
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment, wherein the antibody or antibody fragment comprises a human constant domain.
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment, wherein the antibody is an IgGl, IgG2, IgG3, or IgG4 antibody.
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment, wherein the antibody or antibody fragment comprises an Fc region that has been modified to alter at least one of effector function, half-life, proteolysis, or glycosylation.
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment, wherein the Fc region contains one or more mutations that alter or eliminate N- and/or O-glycosylation.
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment, wherein the antibody or antibody fragment is a humanized antibody or antibody fragment.
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment wherein the antibody or antibody fragment binds to PCSK9 with a dissociation constant (3 ⁇ 4) of less than or equal to 10 ⁇ 2 M, 5x10 ⁇ 3 M, 10 "3 M, 5xl0 ⁇ 4 M, 10 "4 M, 5xl0 ⁇ 5 M, 10 "5 M, 5xl0 ⁇ 6 M, 10 "6 M, 5xl0 ⁇ 7 M, 10 ⁇ 7 M, 5xl0 ⁇ 8 M, 10 "8 M, 5xl0 ⁇ 9 M, 10 ⁇ 9 M, 5xl0 ⁇ 10 M, 10 ⁇ 10 M, 5xl0 ⁇ u M, 10 11 M, 5xl0 ⁇ 12 M, 10 ⁇ 12 M, 5xl0 ⁇ 13 M, or 10 "13 M.
  • a dissociation constant 3 ⁇ 4 M, 5xl0 ⁇ 5 M, 10 "5 M, 5xl0 ⁇ 6 M, 10 "6 M,
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment, wherein the antibody or antibody fragment binds to PCSK9 with a dissociation constant (Ka) of less than or equal to 10 "11 M, 5xl0 ⁇ 12 M, or 10 "12 M.
  • Ka dissociation constant
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment, which binds to PCSK9 with an off-rate of less than or equal to 10 "4 S 1 , 5xl0 ⁇ 5 S 1 , 10 "5 S 1 , 5xl0 ⁇ 6 S 1 , 10 "6 S “1 , 5xl0 ⁇ 7 S 1 , or 10 ⁇ 7 S "1 .
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment, wherein the antibody or antibody fragment is directly or indirectly attached to a detectable label or therapeutic agent.
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment, which when administered to a human subject inhibits or neutralizes at least one biological effect elicited by PCSK9.
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment which when administered to a human subject reduces serum cholesterol.
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment, wherein the antibody or antibody fragment is capable of inhibiting the binding of PCSK9 to LDLR.
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment, wherein the antibody or antibody fragment binds to PCSK9 with a K D that is less than about 100 nM.
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment, wherein the antibody or antibody fragment binds to PCSK9 with a K D that is less than about 10 nM.
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment, wherein the antibody or antibody fragment binds to PCSK9 with a K D that is less than about 1 nM.
  • Another preferred embodiment of the invention relates to an anti-human
  • PCSK9 antibody or antibody fragment wherein the antibody or antibody fragment binds to PCSK9 with a K D that is between about 1 and about 10 nM.
  • Another preferred embodiment of the invention relates to an anti-human
  • PCSK9 antibody or antibody fragment wherein the antibody or antibody fragment binds to PCSK9 with a K D that is between about 0.1 and about 1 nM.
  • Another preferred embodiment of the invention relates to an anti-human
  • PCSK9 antibody or antibody fragment wherein the antibody or antibody fragment binds to PCSK9 with a K D that is between 0.12 and 7.99 nM.
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment, wherein the antibody or antibody fragment is attached to at least one effector moiety.
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment , wherein effector moiety comprises a chemical linker.
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment, wherein the antibody or antibody fragment is attached to one or more detectable moieties.
  • detectable moiety comprises a fluorescent dye, enzyme, substrate, bioluminescent material, radioactive material, chemiluminescent moiety, or mixtures thereof.
  • Another preferred embodiment of the invention relates to an anti-human PCSK9 antibody or antibody fragment wherein the antibody or antibody fragment is attached to one or more functional moieties.
  • composition suitable for therapeutic, prophylaxis, or a diagnostic use comprising a therapeutically, prophylactically or diagnostically effective amount of at least one antibody or antibody fragment according to the invention.
  • Another preferred embodiment of the invention relates to an composition , which is suitable for subcutaneous administration containing at least one antibody or antibody fragment according to the invention.
  • Another preferred embodiment of the invention relates to an composition which is suitable for intravenous administration containing at least one antibody or antibody fragment according to the invention.
  • composition which is suitable for topical administration containing at least one antibody or antibody fragment according to the invention.
  • Another preferred embodiment of the invention relates to a composition , which is lyophilized containing at least one antibody or antibody fragment according to the invention.
  • compositions containing at least one antibody or antibody fragment according to the invention further comprising a pharmaceutically acceptable diluent, carrier, solubilizer, emulsifier, preservative, or mixture thereof.
  • Another preferred embodiment of the invention relates to a composition containing at least one antibody or antibody fragment according to the invention, further comprising another active agent.
  • Another preferred embodiment of the invention relates to an composition containing at least one antibody or antibody fragment according to the invention , wherein the other active agent is selected from the group consisting of the following: statins, ACE inhibitors, Angiotensin II receptor blockers (ARBs), Antiarrhythmics, Antiplatelet Drugs, aspirin, beta blockers, amiodarone, digoxin, aspirin, anti-clotting agents, digoxin, diuretics, heart failure drugs, vasodilators, blood thinners, other anti-cholesterol drugs such as holestyramine (Questran), gemfibrozil (Lopid, Gemcor), Omacor, pantethine, antihypertensives, antidiabetigenic drugs, Meglitinides, Sulfonylurea, and Thiazolidinediones.
  • statins ACE inhibitors
  • ARBs Angiotensin II receptor blockers
  • Antiplatelet Drugs aspirin, beta blockers, amiodarone,
  • Another preferred embodiment of the invention relates to an composition containing at least one antibody or antibody fragment according to the invention, wherein the ACE inhibitor is selected from : Capoten (captopril), Vasotec (enalapril), Prinivil, Zestril (lisinopril), Lotensin (benazepril), Monopril (fosinopril), Altace (ramipril), Accupril (quinapril), Aceon (perindopril), Mavik (trandolapril), Univasc (moexipril),
  • ARB is selected from: Cozaar (losartan), Diovan (valsartan), Avapro (irbesartan), Atacand (candesartan), and Micardis (telmisartan).
  • Another preferred embodiment of the invention relates to an composition containing at least one antibody or antibody fragment according to the invention, wherein the Antiarrhythmic is selected from Tambocor (flecainide), Procanbid (procainamide), Cordarone (amiodarone), and Betapace (sotalol).
  • Another preferred embodiment of the invention relates to an composition containing at least one antibody or antibody fragment according to the invention, wherein the anticlotting agent is selected from Anticlotting agents which may be used in combination with the subject anti-PCSK9 antibodies and antibody fragments include: Tissue plasminogen activator (TPA), Tenecteplase, Alteplase, Urokinase, Reteplase, and Streptokinase.
  • TPA Tissue plasminogen activator
  • Tenecteplase Tenecteplase
  • Alteplase Alteplase
  • Urokinase Urokinase
  • Reteplase Reteplase
  • Streptokinase Streptokinase
  • Beta blocker is selected from Sectral (acebutolol), Zebeta (bisoprolol), Brevibloc (esmolol), Inderal (propranolol), Tenormin (atenolol), Normodyne, Trandate (labetalol), Coreg (carvedilol), Lopressor, and Toprol-XL (metoprolol).
  • Another preferred embodiment of the invention relates to an composition containing at least one antibody or antibody fragment according to the invention, wherein the calcium channel blocker is selected from: Norvasc (amlodipine), Plendil (felodipine), Cardizem, Cardizem CD, Cardizem SR, Dilacor XR, Diltia XT, Tiazac (diltiazem), Calan, Calan SR, Covera-HS, Isoptin, Isoptin SR, Verelan, Verelan PM (verapamil), Adalat, Adalat CC, Procardia, Procardia XL (nifedipine), Cardene, Cardene SR (nicardipine), Sular (nisoldipine), Vascor (bepridil), and Caduet which is a combination of a statin cholesterol drug and amlodipine.
  • Another preferred embodiment of the invention relates to an composition containing at least one antibody or antibody fragment according to the invention, wherein the calcium channel block
  • Another preferred embodiment of the invention relates to an composition containing at least one antibody or antibody fragment according to the invention, wherein the heart failure drug is selected from Dobutrex (dobutamine), and Primacor (milrinone).
  • the heart failure drug is selected from Dobutrex (dobutamine), and Primacor (milrinone).
  • vasodilator is selected from Dilatrate-SR, Iso-Bid, Isonate, Isorbid, Isordil, Isotrate, Sorbitrate (isosorbide dinitrate), IMDUR (isorbide mononitrate), and BiDil (hydralazine with isosorbide dinitrate.
  • Another preferred embodiment of the invention relates to an composition containing at least one antibody or antibody fragment according to the invention, wherein the blood thinner is selected Warfarin (Coumadin), Heparin, Lovenox, and Fragmin.
  • Warfarin Cosmetic, Toiletry, and Fragmin.
  • compositions of containing an antibody according to the invention wherein the composition further comprises another therapeutic agent that elevates the availability of LDLR protein.
  • compositions containing at least one antibody or antibody fragment according to the invention wherein the composition further comprises another therapeutic agent that blocks or inhibits cholesterol synthesis.
  • compositions containing at least one antibody or antibody fragment according to the invention wherein the composition further comprises a statin.
  • Another preferred embodiment of the invention relates to an composition containing at least one antibody or antibody fragment according to the invention, wherein the statin is selected atorvastatin, cerivastatin, fluvastatin, lovastatin, mevastatin, pitavastatin, pravastatin, rosuvastatin, simvastatin, or mixtures thereof.
  • the statin is selected atorvastatin, cerivastatin, fluvastatin, lovastatin, mevastatin, pitavastatin, pravastatin, rosuvastatin, simvastatin, or mixtures thereof.
  • the composition further comprises another therapeutic agent that elevates the HDL level, or an agent which decreases triglyceride levels, or both.
  • Another preferred embodiment of the invention relates to an composition containing at least one antibody or antibody fragment according to the invention, wherein the composition further comprises a fibrate.
  • Another preferred embodiment of the invention relates to an composition containing at least one antibody or antibody fragment according to the invention, wherein the fibrate comprises bezafibrate, ciprofibrate, clofibrate, gemfibrozil, fenofibrate, or mixtures thereof.
  • compositions containing at least one antibody or antibody fragment according to the invention wherein the composition further comprises a bile sequestering agent.
  • Another preferred embodiment of the invention relates to an composition containing at least one antibody or antibody fragment according to the invention, wherein bile sequestering agent comprises cholestyramine, colesevelam, colestipol, or mixtures thereof.
  • compositions containing at least one antibody or antibody fragment according to the invention wherein the composition further comprises an agent that decreases cholesterol absorption in the intestines.
  • Another preferred embodiment of the invention relates to an composition containing at least one antibody or antibody fragment according to the invention, wherein the agent comprises ezetimibe.
  • compositions containing at least one antibody or antibody fragment according to the invention wherein the composition comprises an agent that that inhibits hepatic triglyceride production, inhibits VLDL secretions, or both.
  • agent comprises acipimox.
  • compositions containing at least one antibody or antibody fragment according to the invention wherein the composition further comprises an agent that decreases lipid absorption in the intestines.
  • Another preferred embodiment of the invention relates to an composition containing an antibody according to the invention, wherein the agent comprises orlistat, lipstatin, or mixtures thereof.
  • compositions containing at least one antibody or antibody fragment according to the invention wherein the composition further comprises an agent that is an anti-hypertensive, an agent that treats angina, or both.
  • Another preferred embodiment of the invention relates to an composition containing at least one antibody or antibody fragment according to the invention, wherein said anti-hypertensive or anti-angina agent is selected from a diuretic, an adrenergic receptor antagonist, a calcium channel blocker, a renin inhibitor, an ACE inhibitor, an angiotensin II receptor antagonist, aa aldosterone antagonist, a vasodilator or an alpha-2 agonist.
  • said anti-hypertensive or anti-angina agent is selected from a diuretic, an adrenergic receptor antagonist, a calcium channel blocker, a renin inhibitor, an ACE inhibitor, an angiotensin II receptor antagonist, aa aldosterone antagonist, a vasodilator or an alpha-2 agonist.
  • Another preferred embodiment of the invention relates to an composition containing at least one antibody or antibody fragment according to the invention, wherein the diuretics include bumetanide, thacrynic acid, furosemide, and torsemide; a thiazide diuretic such as epitizide, hydrochlorothiazide or chlorothiazide, or bendroflumethiazide; a thiazide-like diuretic such as indapamide, chlorthalidone, or metolazone; a potassium- sparing diuretic such as amiloride, triamterene, or spironolactone; the adrenergic receptor antagonists include beta blockers such as atenolol, metoprolol, nadolol, oxprenolol, pindolol, propranolol, or timolol; the alpha blockers include doxazosin, phentolamine, indora
  • Another preferred embodiment of the invention relates to an composition containing at least one antibody or antibody fragment according to the invention, which further comprises at least one other agent, wherein the combination allows for mitigation of undesirable side effects of at least one other agent contained therein.
  • Another preferred embodiment of the invention relates to an composition containing at least one antibody or antibody fragment according to the invention which further comprises at least one therapeutic agent for inflammation.
  • Another preferred embodiment of the invention relates to an composition containing at least one antibody or antibody fragment according to the invention, wherein the therapeutic agent for inflammation comprises a cyclooxygenase type 1 inhibitor, a cyclooxygenase type 2 inhibitor, a small molecule modulator of p38-MAPK, a small molecule modulator of intracellular molecules involved in inflammation pathways, or mixtures thereof.
  • Another preferred embodiment of the invention relates to an composition containing at least one antibody or antibody fragment according to the invention, which is lyophilized, stabilized and/or or formulated for administration by injection.
  • Another preferred embodiment of the invention relates to a method for blocking, inhibiting or neutralizing one or more biological effects associated with PCSK9
  • Another preferred embodiment of the invention relates to method for treating or preventing a condition associated with elevated serum cholesterol levels in a patient, comprising administering to a patient in need thereof an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent.
  • Another preferred embodiment of the invention relates to method for treating or preventing elevated serum cholesterol levels in a patient in need thereof or at risk of developing elevated serum cholesterol levels because of an existing condition, comprising administering to the patient an effective amount of at least one antibody according to an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent.
  • Another preferred embodiment of the invention relates to a method wherein the condition treated is selected from the group consisting of hypercholesterolemia, coronary heart disease, hyperlipidemia, hypertriglyceridaemia, sitosterolemia,
  • Atherosclerosis arteriosclerosis metabolic syndrome
  • acute coronary syndrome vascular inflammation
  • xanthoma vascular inflammation
  • diabetes obesity
  • hypertension hypertension
  • angina angina
  • Another preferred embodiment is a method for treating or preventing a disorder involving cholesterol or lipid homeostasis or complications associated therewith, comprising administering to the patient an effective amount of at least one antibody according to an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent.
  • Another preferred embodiment of the invention relates to a method of treatment wherein the treated condition is selected from hypercholesterolemia, hyperlipidemia, hypertriglyceridaemia, and sitosterolemia using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the at least one isolated anti- human PCSK9 antibody or antibody inhibits the binding of PCSK9 to LDLR.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the at least one isolated anti- human PCSK9 antibody or antibody fragment results in blocking or inhibition of cholesterol synthesis.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the method further comprises administering separately or co-administering another agent, which agent that elevates the availability of LDLR protein or which blocks or inhibits cholesterol synthesis.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the administration is part of a therapeutic regimen that further includes the administration of at least one of the following: statins, ACE inhibitors, Angiotensin II receptor blockers (ARBs),
  • Antiarrhythmics Antiplatelet Drugs, aspirin, beta blockers, amiodarone, digoxin, aspirin, anti-clotting agents, digoxin, diuretics, heart failure drugs, vasodilators, blood thinners, other anti-cholesterol drugs such as holestyramine (Questran), gemfibrozil (Lopid, Gemcor), Omacor, pantethine, anti-hypertensives, antidiabetigenic drugs, Meglitinides, Sulfonylurea, and Thiazolidinediones.
  • anti-cholesterol drugs such as holestyramine (Questran), gemfibrozil (Lopid, Gemcor), Omacor, pantethine, anti-hypertensives, antidiabetigenic drugs, Meglitinides, Sulfonylurea, and Thiazolidinediones.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the ACE inhibitor is selected from : Capoten (captopril), Vasotec (enalapril), Prinivil, Zestril (lisinopril), Lotensin
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent wherein the ARB is selected from : Cozaar (losartan), Diovan (valsartan), Avapro (irbesartan), Atacand (candesartan), and Micardis (telmisartan).
  • ARB is selected from : Cozaar (losartan), Diovan (valsartan), Avapro (irbesartan), Atacand (candesartan), and Micardis (telmisartan).
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent wherein the antiarythmic is selected from : Tambocor (flecainide), Procanbid (procainamide), Cordarone (amiodarone), and Betapace (sotalol).
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the anti-clotting agent is selected from: Tissue plasminogen activator (TP A), Tenecteplase, Alteplase, Urokinase, Reteplase, and Streptokinase.
  • Tissue plasminogen activator TP A
  • Tenecteplase Tenecteplase
  • Alteplase Alteplase
  • Urokinase Urokinase
  • Reteplase Reteplase
  • Streptokinase Streptokinase
  • Beta-blocker is selected from : Sectral (acebutolol), Zebeta (bisoprolol), Brevibloc (esmolol), Inderal (propranolol), Tenormin (atenolol), Normodyne, Trandate (labetalol), Coreg (carvedilol), Lopressor, and Toprol-XL (metoprolol).
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the calcium channel blocker is selected from : Norvasc (amlodipine), Plendil (felodipine), Cardizem, Cardizem CD, Cardizem SR, Dilacor XR, Diltia XT, Tiazac (diltiazem), Calan, Calan SR, Covera-HS, Isoptin, Isoptin SR, Verelan, Verelan PM (verapamil), Adalat, Adalat CC, Procardia, Procardia XL (nifedipine), Cardene, Cardene SR (nicardipine), Sular (nisoldipine), Vascor (bepridil), and Caduet which is a combination of a statin cholesterol drug and amlodipine.
  • the calcium channel blocker is selected from : Norvasc (amlo
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent wherein the antidiruetic is selected from: Lasix (furosemide), Bumex (bumetanide), Demadex (torsemide), Esidrix (hydrochlorothiazide), Zaroxolyn (metolazone), and Aldactone (spironolactone).
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the heart failure drug is selected from Dobutrex (dobutamine), and Primacor (milrinone).
  • the heart failure drug is selected from Dobutrex (dobutamine), and Primacor (milrinone).
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the vasodilator is selected from: Dilatrate-SR, Iso-Bid, Isonate, Isorbid, Isordil, Isotrate, Sorbitrate (isosorbide dinitrate), IMDUR (isorbide mononitrate), and BiDil (hydralazine with isosorbide dinitrate.
  • the vasodilator is selected from: Dilatrate-SR, Iso-Bid, Isonate, Isorbid, Isordil, Isotrate, Sorbitrate (isosorbide dinitrate), IMDUR (isorbide mononitrate), and BiDil (hydralazine with isosorbide dinitrate.
  • Another preferred embodiment of the invention relates to a method containing an antibody according to the invention, wherein the blood thinner is selected from Warfarin (Coumadin), Heparin, Lovenox, and Fragmin.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the agent that elevates the availability of LDLR protein or which blocks or inhibits cholesterol synthesis is administered simultaneously with the antibody or composition containing.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein another agent that elevates the availability of LDLR protein or which blocks or inhibits cholesterol synthesis is administered, sequentially relative to the administration of the antibody or composition containing.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the agent that blocks or inhibits cholesterol synthesis protein comprises a statin.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the statin is selected from atorvastatin, cerivastatin, fluvastatin, lovastatin, mevastatin, pitavastatin, pravastatin, rosuvastatin, simvastatin, or mixtures thereof.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent wherein the method further comprises administering an agent that elevates the HDL level, an agent that decreases triglyceride levels, or both.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the agent comprises a fibrate.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the fibrate agent comprises bezafibrate, ciprofibrate, clofibrate, gemfibrozil, fenofibrate, or mixtures thereof.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the method further comprises administering a bile sequestering agent.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the bile sequestering agent comprises cholestyramine, colesevelam, colestipol, or mixtures thereof.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the method further comprises administering an agent that decreases cholesterol absorption in the intestines.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the agent comprises ezetimibe.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent 174, wherein the method further comprises administering an agent that inhibits hepatic triglyceride production, inhibits VLDL secretions, or both.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the agent comprises acipimox.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the method further comprises administering an agent that decreases lipid absorption in the intestines.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the agent comprises orlistat, lipstatin, or mixtures thereof.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent 174, wherein the method further comprises administering an agent that is an anti-hypertensive, one that treats angina, or both.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein said anti-hypertensive or antiangina agent is selected from a diuretic, an adrenergic receptor antagonist, a calcium channel blocker, a renin inhibitor, an ACE inhibitor, an angiotensin II receptor antagonist, aa aldosterone antagonist, a vasodilator or an alpha-2 agonist.
  • said anti-hypertensive or antiangina agent is selected from a diuretic, an adrenergic receptor antagonist, a calcium channel blocker, a renin inhibitor, an ACE inhibitor, an angiotensin II receptor antagonist, aa aldosterone antagonist, a vasodilator or an alpha-2 agonist.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the diuretics include bumetanide, thacrynic acid, furosemide, and torsemide; a thiazide diuretic such as epitizide, hydrochlorothiazide or chlorothiazide, or bendroflumethiazide; a thiazide-like diuretic such as indapamide, chlorthalidone, or metolazone; a potassium-sparing diuretic such as amiloride, triamterene, or spironolactone; the adrenergic receptor antagonists include beta blockers such as atenolol, metoprolol, nadolol, oxprenolol, pindolol, propranolol, or timolol; the alpha blockers include dox
  • mixed alpha + beta blockers such as bucindolol, carvedilol, and labetalol
  • the calcium channel blockers include
  • dihydropyridines such as amlodipine, felodipine, isradipine, lercanidipine, nicardipine, nifedipine, nimodipine, and nitrendipine; non-dihydropyridines such as diltiazem and verapamil; renin inhibitors such as Aliskiren; an ACE inhibitors such as captopril, enalapril, fosinopril, lisinopril, perindopril, quinapril, ramipril, trandolapril, and benazepril; angiotensin II receptor antagonists such as candesartan, eprosartan, irbesartan, losartan, olmesartan, telmisartan, and valsartan; aldosterone antagonists such as eplerenone andspironolactone; vasodilators such as sodium nitro
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the method further comprises administering at least one other agent, wherein the combination allows for mitigation of undesirable side effects of at least one other agent.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the antibody or antibody fragment or composition containing and the at least one other agent are administered concurrently.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the antibody or antibody fragment is administered before or after the at least one other agent.
  • a method for lowering serum cholesterol level in a subject comprising administering to a subject an effective amount of at least one anti-human PCSK9 antibody or antibody fragment according to the invention or a composition containing.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein administering the at least one isolated anti-human PCSK9 antibody or antibody fragment or composition inhibits PCSK9 binding to LDLR.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the method further comprises administering an agent that elevates the availability of LDLR protein or which decreases serum cholesterol.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent wherein the agent that elevates the availability of LDLR protein or which decreases cholesterol is administered simultaneously with the antibody or composition containing .
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the agent that elevates the availability of LDLR protein or which decrease serum cholesterol is administered sequentially.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the agent that reduces serum cholesterol comprises a statin.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the statin comprises atorvastatin, cerivastatin, fluvastatin, lovastatin, mevastatin, pitavastatin, pravastatin, rosuvastatin, simvastatin, or a combination thereof.
  • the statin comprises atorvastatin, cerivastatin, fluvastatin, lovastatin, mevastatin, pitavastatin, pravastatin, rosuvastatin, simvastatin, or a combination thereof.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent wherein the method further comprises administering an agent that elevates the HDL level, an agent that decreases triglyceride levels, or both.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the agent comprises a fibrate.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the fibrate comprises bezafibrate, ciprofibrate, clofibrate, gemfibrozil, fenofibrate, or mixtures thereof.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent wherein the method further comprises administering a bile sequestering agent.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent wherein the bile sequestering agent comprises cholestyramine, colesevelam, colestipol, or mixtures thereof.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the method further comprises administering an agent that decreases cholesterol absorption in the intestines.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the agent comprises ezetimibe.
  • Another preferred embodiment of the invention relates to a method of any one containing an antibody according to the invention wherein the method further comprises administering an agent that inhibits hepatic triglyceride production, inhibits VLDL secretions, or both.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the agent comprises acipimox, Gemfibrozil or nicotinic acid, and nicotinic acid analogs.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the method further comprises administering an agent that decreases lipid absorption in the intestines.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the agent comprises orlistat, lipstatin, or mixtures thereof.
  • Another preferred embodiment of the invention relates to a method of using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent wherein the antibody or antibody fragment is administered before or after other active agent.
  • Another embodiment relates to a method of increasing LDLR protein level in a subject, the method comprising administering to a subject an effective amount of at least one isolated antibody or antibody fragment according to the invention or a composition containing as described herein.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein administering the at least one isolated anti-human PCSK9 antibody or antibody fragment inhibits PCSK9 binding to LDLR.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the method further comprises administering another agent that elevates the availability of LDLR protein or one which decreases serum cholesterol.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the agent that elevates the availability of LDLR protein or which decrease serum cholesterol is administered simultaneously with the antibody or antibody composition.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the agent that elevates the availability of LDLR protein or which reduces serum cholesterol is administered sequentially with respect to the antibody or antibody composition.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the agent that reduces serum cholesterol protein comprises a statin.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the statin comprises atorvastatin, cerivastatin, fluvastatin, lovastatin, mevastatin, pitavastatin, pravastatin, rosuvastatin, simvastatin, or a combination thereof.
  • the statin comprises atorvastatin, cerivastatin, fluvastatin, lovastatin, mevastatin, pitavastatin, pravastatin, rosuvastatin, simvastatin, or a combination thereof.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the method further comprises administering an agent that elevates the HDL level, an agent that decreases triglyceride levels, or both.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the other agent comprises a fibrate.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the fibrate comprises bezafibrate, ciprofibrate, clofibrate, gemfibrozil, fenofibrate, or mixtures thereof.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent 234, wherein the method further comprises administering a bile sequestering agent.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent wherein the bile sequestering agent comprises cholestyramine, colesevelam, colestipol, or mixtures thereof.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent wherein the method further comprises administering an agent that decreases cholesterol absorption in the intestines.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the agent comprises ezetimibe.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the method further comprises administering an agent that inhibits hepatic triglyceride production, inhibits VLDL secretions, or both.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the agent comprises acipimox, Gemfibrozil or nicotinic acid, or a nicotinic acid analog.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the method further comprises administering an agent that decreases lipid absorption in the intestines.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent 250, wherein the agent comprises orlistat, lipstatin, or mixtures thereof.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the method further comprises administering an agent that is an anti-hypertensive, treats angina, or both.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent wherein the agent comprises amlodipine, diuretic, an adrenergic receptor antagonist, a calcium channel blocker, a renin inhibitor, an ACE inhibitor, an angiotensin II receptor antagonist, aa aldosterone antagonist, a vasodilator, a nitrate or an alpha-2 agonist.
  • the agent comprises amlodipine, diuretic, an adrenergic receptor antagonist, a calcium channel blocker, a renin inhibitor, an ACE inhibitor, an angiotensin II receptor antagonist, aa aldosterone antagonist, a vasodilator, a nitrate or an alpha-2 agonist.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the diuretics include bumetanide, thacrynic acid, furosemide, and torsemide; a thiazide diuretic such as epitizide, hydrochlorothiazide or chlorothiazide, or bendroflumethiazide; a thiazide-like diuretic such as indapamide, chlorthalidone, or metolazone; a potassium-sparing diuretic such as amiloride, triamterene, or spironolactone; the adrenergic receptor antagonists include beta blockers such as atenolol, metoprolol, nadolol, oxprenolol, pindolol, propranolol, or timolol; the alpha blockers include dox
  • mixed alpha + beta blockers such as bucindolol, carvedilol, and labetalol
  • the calcium channel blockers include
  • dihydropyridines such as amlodipine, felodipine, isradipine, lercanidipine, nicardipine, nifedipine, nimodipine, and nitrendipine; non-dihydropyridines such as diltiazem and verapamil; renin inhibitors such as Aliskiren; an ACE inhibitors such as captopril, enalapril, fosinopril, lisinopril, perindopril, quinapril, ramipril, trandolapril, and benazepril; angiotensin II receptor antagonists such as candesartan, eprosartan, irbesartan, losartan, olmesartan, telmisartan, and valsartan; aldosterone antagonists such as eplerenone andspironolactone; vasodilators such as sodium nitro
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent wherein the antibody or antibody fragment or composition containing and at least one other agent are administered concurrently.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent wherein the antibody or antibody fragment or composition containing and at least one other agent are administered separately, optionally by different dosing methods.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent wherein the antibody or antibody fragment is administered before or after the at least one other agent.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent wherein the antibody or antibody fragment or composition containing are administered with an agent that inhibits inflammation.
  • Another preferred embodiment of the invention relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, wherein the therapeutic agent for inflammation comprises a cyclooxygenase type 1 inhibitor, a cyclooxygenase type 2 inhibitor, a small molecule modulator of p38-MAPK, a small molecule modulator of intracellular molecules involved in inflammation pathways, or mixtures thereof.
  • the therapeutic agent for inflammation comprises a cyclooxygenase type 1 inhibitor, a cyclooxygenase type 2 inhibitor, a small molecule modulator of p38-MAPK, a small molecule modulator of intracellular molecules involved in inflammation pathways, or mixtures thereof.
  • Another preferred embodiment relates to a method using an effective amount of at least one antibody according to the invention or a composition containing optionally with another active agent, that is used to treat or prevent a disease or the complications of a disease or condition selected from hypercholesterolemia, heart disease, metabolic syndrome, diabetes, coronary heart disease, stroke, cardiovascular diseases, Alzheimer's disease, dyslipidemias, elevated total serum cholesterol, elevated LDL, elevated
  • triglycerides elevated VLDL, low HDL, metabolic syndrome, diabetes mellitus, familial combined hyperlipidemia, familial hypertriglyceridemia, familial hypercholesterolemias, including heterozygous hypercholesterolemia, homozygous hypercholesterolemia, familial defective apop lipoprotein B-100; polygenic hypercholesterolemia; remnant removal disease, hepatic lipase deficiency; dyslipidemia secondary to any of the following: dietary indiscretion, hypothyroidism, drugs including estrogen and progestin therapy, beta- blockers, and thiazide diuretics; nephrotic syndrome, chronic renal failure, Cushing's syndrome, primary biliary cirrhosis, glycogen storage diseases, hepatoma, cholestasis, acromegaly, insulinoma, isolated growth hormone deficiency, and alcohol-induced hypertriglyceridemia, atherosclerotic diseases such as coronary heart disease, coronary artery disease
  • Another preferred embodiment of the invention relates to an isolated nucleic acid or nucleic acids which encode for and when expressed in a suitable host cell result in the expression of an anti-human PCSK9 antibody or antibody fragment or the variable heavy or light chain thereof, wherein said antibody or antibody fragment encoded by said nucleic acid or nucleic acids competes with and/or specifically binds to the same or overlapping epitope(s) on human PCSK9 as an anti-human PCSK9 antibody selected from the group consisting of Abl, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8, Ab9, AblO, Abl 1, Abl2, Abl3, Abl4, Abl5, Abl6, Abl7, Abl8, Abl9, Ab20, Ab21, Ab22, Ab23 and Ab24.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids that express an antibody or antibody fragment according to the invention wherein said expressed antibody or antibody fragment specifically binds to the same or overlapping epitope(s) on human PCSK9 as an anti-human PCSK9 antibody selected from the group consisting of Abl, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8, Ab9, AblO, Abl 1, Abl2, Abl3, Abl4, Abl5, Abl6, Abl7, Abl8, Abl9, Ab20, Ab21, Ab22, Ab23 and Ab24.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids that express an antibody or antibody fragment according to the invention, wherein said epitope(s) can be identified is a binding assay that detects the binding of an anti-human PCSK9 antibody to one or more peptides in a library of 10-15-mer peptides which are overlapping fragments that correspond to all or substantially all of the length of the human PCSK9 polypeptide.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids that express an antibody or antibody fragment according to the invention wherein the epitope bound thereby is determined using a Western immunoblot assay which detects specific binding of the antibody or antibody fragment to one or more of said 10-15 mer peptides in said library by the use of a chemiluminescent label which emits a detectable chemiluminescent signal when specific binding of said antibody or antibody fragment to a peptide in said library occurs.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids that express an antibody or antibody fragment according to the invention, wherein said expressed antibody or antibody fragment encoded by said nucleic acid or nucleic acids contains at least 2 complementarity determining regions (CDRs) of an anti- PCSK9 antibody selected from the group consisting of Abl, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8, Ab9, AblO, Abl l, Abl2, Abl3, Abl4, Abl5, Abl6, Abl7, Abl8, Abl9, Ab20, Ab21, Ab22, Ab23 and Ab24.
  • CDRs complementarity determining regions
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids that express an antibody or antibody fragment according to the invention, wherein said expressed anti-human anti- PCSK9 antibody or antibody fragment encoded by said nucleic acid or nucleic acids contains at least 3 complementarity determining regions (CDRs) of an anti-PCSK9 antibody selected from the group consisting of Abl, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8, Ab9, AblO, Abl l, Abl2, Abl3, Abl4, Abl5, Abl6, Abl 7, Abl 8, Abl 9, Ab20, Ab21, Ab22, Ab23 and Ab24.
  • CDRs complementarity determining regions
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids that express an antibody or antibody fragment according to the invention, wherein said expressed anti-human PCSK9 antibody or antibody fragment encoded by said nucleic acid or nucleic acids contains at least 4 complementarity determining regions (CDRs) of an anti-PCSK9 antibody selected from the group consisting of Abl, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8, Ab9, AblO, Abl l, Abl2, Abl3, Abl4, Abl5, Abl6, Abl7, Abl 8, Abl 9, Ab20, Ab21, Ab22, Ab23 and Ab24.
  • CDRs complementarity determining regions
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids that express an antibody or antibody fragment according to the invention, wherein said expressed anti-human PCSK9 antibody or antibody fragment encoded by said nucleic acid or nucleic acids contains at least 5 complementarity determining regions (CDRs) of an anti-PCSK9 antibody selected from the group consisting of Abl, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8, Ab9, AblO, Abl l, Abl2, Abl3, Abl4, Abl5, Abl6, Abl7, Abl 8, Abl 9, Ab20, Ab21, Ab22, Ab23 and Ab24.
  • CDRs complementarity determining regions
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids that express an antibody or antibody fragment according to the invention wherein said expressed antibody or antibody fragment encoded by said nucleic acid or nucleic acids contains all 6 complementarity determining regions (CDRs) of an anti- PCSK9 antibody selected from the group consisting of Abl, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8, Ab9, AblO, Abl l, Abl2, Abl3, Abl4, Abl5, Abl6, Abl7, Abl8, Abl9, Ab20, Ab21, Ab22, Ab23 and Ab24.
  • CDRs complementarity determining regions
  • nucleic acid or nucleic acids that express an antibody or antibody fragment according to the invention wherein said expressed anti-human PCSK9 antibody or antibody fragment encoded by said nucleic acid or nucleic acids contains (a)a variable heavy chain comprising a CDR1 sequence selected from the group consisting of SEQ ID NO: 4, SEQ ID NO: 44, SEQ ID NO: 84, SEQ ID NO: 124, SEQ ID NO: 164, SEQ ID NO: 204, SEQ ID NO: 244, SEQ ID NO: 284, SEQ ID NO: 324, SEQ ID NO: 364, SEQ ID NO: 404, SEQ ID NO: 444, SEQ ID NO: 484, SEQ ID NO: 524, SEQ ID NO: 564, SEQ ID NO: 604, SEQ ID NO: 644, SEQ ID NO: 684, SEQ ID NO: 724, SEQ ID NO: 764, SEQ ID NO: 804, SEQ ID NO: 844, SEQ ID NO
  • variable light chain comprising a CDR1 sequence selected from the group consisting of SEQ ID NO: 24, SEQ ID NO: 64, SEQ ID NO: 104, SEQ ID NO: 144, SEQ ID NO: 184, SEQ ID NO: 224, SEQ ID NO: 264, SEQ ID NO: 304, SEQ ID NO: 344, SEQ ID NO: 384, SEQ ID NO: 424, SEQ ID NO: 464, SEQ ID NO: 504, SEQ ID NO: 544, SEQ ID NO: 584, SEQ ID NO: 624, SEQ ID NO: 664, SEQ ID NO: 704, SEQ ID NO: 744, SEQ ID NO: 784, SEQ ID NO: 824, SEQ ID NO: 864, SEQ ID NO: 904, and SEQ ID NO: 944; a CDR2 sequence selected from the group consisting of SEQ ID NO: 26, SEQ ID NO: 66, SEQ ID NO: 106, SEQ ID NO: 146, SEQ
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids that express an antibody or antibody fragment according to the invention, wherein the variable heavy chain encoded by said nucleic acid or nucleic acids comprises the CDRl sequence of SEQ ID NO: 4, the CDR2 sequence of SEQ ID NO: 6, and the CDR3 sequence of SEQ ID NO: 8; and/or the variable light chain comprises the CDRl sequence of SEQ ID NO: 24, the CDR2 sequence of SEQ ID NO: 26, and the CDR3 sequence of SEQ ID NO: 28.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids that express an antibody or antibody fragment according to the invention, wherein the variable heavy chain encoded by said nucleic acid or nucleic acids comprises the CDRl sequence of SEQ ID NO: 44, the CDR2 sequence of SEQ ID NO: 46, and the CDR3 sequence of SEQ ID NO: 48; and/or the variable light chain comprises the CDRl sequence of SEQ ID NO: 64, the CDR2 sequence of SEQ ID NO: 66, and the CDR3 sequence of SEQ ID NO: 68.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids that express an antibody or antibody fragment according to the invention wherein the variable heavy chain encoded by said nucleic acid or nucleic acids comprises the CDRl sequence of SEQ ID NO: 84, the CDR2 sequence of SEQ ID NO: 86, and the CDR3 sequence of SEQ ID NO: 88; and/or the variable light chain comprises the CDRl sequence of SEQ ID NO: 104, the CDR2 sequence of SEQ ID NO: 106, and the CDR3 sequence of SEQ ID NO: 108.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the variable heavy chain encoded by said nucleic acid or nucleic acids comprises the CDRl sequence of SEQ ID NO: 124, the CDR2 sequence of SEQ ID NO: 126, and the CDR3 sequence of SEQ ID NO: 128; and/or the variable light chain comprises the CDRl sequence of SEQ ID NO: 144, the CDR2 sequence of SEQ ID NO: 146, and the CDR3 sequence of SEQ ID NO: 148.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the variable heavy chain encoded by said nucleic acid or nucleic acids comprises the CDRl sequence of SEQ ID NO: 164, the CDR2 sequence of SEQ ID NO: 166, and the CDR3 sequence of SEQ ID NO: 168; and the variable light chain comprises the CDRl sequence of SEQ ID NO: 184, the CDR2 sequence of SEQ ID NO: 186, and the CDR3 sequence of SEQ ID NO: 188.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein said expressed anti-human PCSK9 antibody or antibody fragment contains a variable heavy chain that comprises the CDRl sequence of SEQ ID NO: 204, the CDR2 sequence of SEQ ID NO: 206, and the CDR3 sequence of SEQ ID NO: 208; and the variable light chain comprises the CDRl sequence of SEQ ID NO: 224, the CDR2 sequence of SEQ ID NO: 226, and the CDR3 sequence of SEQ ID NO: 228.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the variable heavy chain encoded by said nucleic acid or nucleic acids comprises the CDRl sequence of SEQ ID NO: 244, the CDR2 sequence of SEQ ID NO: 246, and the CDR3 sequence of SEQ ID NO: 248; and the variable light chain comprises the CDRl sequence of SEQ ID NO: 264, the CDR2 sequence of SEQ ID NO: 266, and the CDR3 sequence of SEQ ID NO: 268.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the variable heavy chain encoded by said nucleic acid or nucleic acids comprises the CDRl sequence of SEQ ID NO: 284, the CDR2 sequence of SEQ ID NO: 286, and the CDR3 sequence of SEQ ID NO: 288; and the variable light chain comprises the CDRl sequence of SEQ ID NO: 304, the CDR2 sequence of SEQ ID NO: 306, and the CDR3 sequence of SEQ ID NO: 308.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the variable heavy chain encoded by said nucleic acid or nucleic acids comprises the CDRl sequence of SEQ ID NO: 324, the CDR2 sequence of SEQ ID NO: 326, and the CDR3 sequence of SEQ ID NO: 328; and/or the variable light chain comprises the CDRl sequence of SEQ ID NO: 344, the CDR2 sequence of SEQ ID NO: 346, and the CDR3 sequence of SEQ ID NO: 348.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the variable heavy chain encoded by said nucleic acid or nucleic acids comprises the CDRl sequence of SEQ ID NO: 364, the CDR2 sequence of SEQ ID NO: 366, and the CDR3 sequence of SEQ ID NO: 368; and/or the variable light chain comprises the CDRl sequence of SEQ ID NO: 384, the CDR2 sequence of SEQ ID NO: 386, and the CDR3 sequence of SEQ ID NO: 388.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the variable heavy chain encoded by said nucleic acid or nucleic acids comprises the CDRl sequence of SEQ ID NO: 404, the CDR2 sequence of SEQ ID NO: 406, and the CDR3 sequence of SEQ ID NO: 408; and/or the variable light chain comprises the CDRl sequence of SEQ ID NO: 424, the CDR2 sequence of SEQ ID NO: 426, and the CDR3 sequence of SEQ ID NO: 428.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the variable heavy chain encoded by said nucleic acid or nucleic acids comprises the CDRl sequence of SEQ ID NO: 444, the CDR2 sequence of SEQ ID NO: 446, and the CDR3 sequence of SEQ ID NO: 448; and the variable light chain comprises the CDRl sequence of SEQ ID NO: 464, the CDR2 sequence of SEQ ID NO: 466, and the CDR3 sequence of SEQ ID NO: 468.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the variable heavy chain encoded by said nucleic acid or nucleic acids comprises the CDRl sequence of SEQ ID NO: 484, the CDR2 sequence of SEQ ID NO: 486, and the CDR3 sequence of SEQ ID NO: 488; and/or the variable light chain comprises the CDRl sequence of SEQ ID NO: 504, the CDR2 sequence of SEQ ID NO: 506, and the CDR3 sequence of SEQ ID NO: 508.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the variable heavy chain encoded by said nucleic acid or nucleic acids comprises the CDRl sequence of SEQ ID NO: 524, the CDR2 sequence of SEQ ID NO: 526, and the CDR3 sequence of SEQ ID NO: 528; and/or the variable light chain comprises the CDRl sequence of SEQ ID NO: 544, the CDR2 sequence of SEQ ID NO: 546, and the CDR3 sequence of SEQ ID NO: 548.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the variable heavy chain encoded by said nucleic acid or nucleic acids comprises the CDRl sequence of SEQ ID NO: 564, the CDR2 sequence of SEQ ID NO: 566, and the CDR3 sequence of SEQ ID NO: 568; and/or the variable light chain comprises the CDRl sequence of SEQ ID NO: 584, the CDR2 sequence of SEQ ID NO: 586, and the CDR3 sequence of SEQ ID NO: 588.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the variable heavy chain encoded by said nucleic acid or nucleic acids comprises the CDRl sequence of SEQ ID NO: 604, the CDR2 sequence of SEQ ID NO: 606, and the CDR3 sequence of SEQ ID NO: 608; and/or the variable light chain comprises the CDRl sequence of SEQ ID NO: 624, the CDR2 sequence of SEQ ID NO: 626, and the CDR3 sequence of SEQ ID NO: 628.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the variable heavy chain encoded by said nucleic acid or nucleic acids comprises the CDRl sequence of SEQ ID NO: 644, the CDR2 sequence of SEQ ID NO: 646, and the CDR3 sequence of SEQ ID NO: 648; and/or the variable light chain comprises the CDRl sequence of SEQ ID NO: 664, the CDR2 sequence of SEQ ID NO: 666, and the CDR3 sequence of SEQ ID NO: 668.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the variable heavy chain encoded by said nucleic acid or nucleic acids comprises the CDRl sequence of SEQ ID NO: 684, the CDR2 sequence of SEQ ID NO: 686, and the CDR3 sequence of SEQ ID NO: 688; and/or the variable light chain comprises the CDRl sequence of SEQ ID NO: 704, the CDR2 sequence of SEQ ID NO: 706, and the CDR3 sequence of SEQ ID NO: 708.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the variable heavy chain encoded by said nucleic acid or nucleic acids comprises the CDRl sequence of SEQ ID NO: 724, the CDR2 sequence of SEQ ID NO: 726, and the CDR3 sequence of SEQ ID NO: 728; and/or the variable light chain comprises the CDRl sequence of SEQ ID NO: 744, the CDR2 sequence of SEQ ID NO: 746, and the CDR3 sequence of SEQ ID NO: 748.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the variable heavy chain encoded by said nucleic acid or nucleic acids comprises the CDRl sequence of SEQ ID NO: 764, the CDR2 sequence of SEQ ID NO: 766, and the CDR3 sequence of SEQ ID NO: 768; and/or the variable light chain comprises the CDRl sequence of SEQ ID NO: 784, the CDR2 sequence of SEQ ID NO: 786, and the CDR3 sequence of SEQ ID NO: 788.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the variable heavy chain encoded by said nucleic acid or nucleic acids comprises the CDRl sequence of SEQ ID NO: 804, the CDR2 sequence of SEQ ID NO: 806, and the CDR3 sequence of SEQ ID NO: 808; and/or the variable light chain comprises the CDRl sequence of SEQ ID NO: 824, the CDR2 sequence of SEQ ID NO: 826, and the CDR3 sequence of SEQ ID NO: 828.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the variable heavy chain encoded by said nucleic acid or nucleic acids comprises the CDRl sequence of SEQ ID NO: 844, the CDR2 sequence of SEQ ID NO: 846, and the CDR3 sequence of SEQ ID NO: 848; and/or the variable light chain comprises the CDRl sequence of SEQ ID NO: 864, the CDR2 sequence of SEQ ID NO: 866, and the CDR3 sequence of SEQ ID NO: 868.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the variable heavy chain encoded by said nucleic acid or nucleic acids comprises the CDRl sequence of SEQ ID NO: 884, the CDR2 sequence of SEQ ID NO: 886, and the CDR3 sequence of SEQ ID NO: 888; and/or the variable light chain encoded by said nucleic acid or nucleic acids comprises the CDRl sequence of SEQ ID NO: 904, the CDR2 sequence of SEQ ID NO: 906, and the CDR3 sequence of SEQ ID NO: 908.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the variable heavy chain encoded by said nucleic acid or nucleic acids comprises the CDRl sequence of SEQ ID NO: 924, the CDR2 sequence of SEQ ID NO: 926, and the CDR3 sequence of SEQ ID NO: 928; and/or the variable light chain encoded by said nucleic acid or nucleic acids comprises the CDRl sequence of SEQ ID NO: 944, the CDR2 sequence of SEQ ID NO: 946, and the CDR3 sequence of SEQ ID NO: 948.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the variable heavy chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 2 and/or the variable light chain encoded by said nucleic acid or nucleic acids comprises SEQ ID NO: 22.
  • variable heavy and light chains are each at least 90% identical to the variable heavy and light chains in SEQ ID NO: 2 and SEQ ID NO: 22, respectively.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the variable heavy chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 42 and the variable light chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 62.
  • variable heavy and light chains are each at least 90% identical to the variable heavy and light chains in SEQ ID NO: 42 and SEQ ID NO: 62, respectively.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the variable heavy chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 82 and the variable light chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 102.
  • variable heavy and light chains are each at least 90% identical to the variable heavy and light chains in SEQ ID NO: 82 and SEQ ID NO: 102, respectively.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the variable heavy chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 122 and the variable light chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 142.
  • variable heavy and light chains are each at least 90% identical to the variable heavy and light chains in SEQ ID NO: 122 and SEQ ID NO: 142, respectively.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the variable heavy chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 162 and the variable light chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 182.
  • variable heavy and light chains are each at least 90% identical to the variable heavy and light chains in SEQ ID NO: 162 and SEQ ID NO: 182, respectively.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the variable heavy chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 202 and the variable light chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 222.
  • variable heavy and light chains are each at least 90% identical to the variable heavy and light chains in SEQ ID NO: 202 and SEQ ID NO: 222, respectively.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the variable heavy chain encoded by said nucleic acid or nucleic acids comprises encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 242 and the variable light chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 262.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, 47, wherein the variable heavy and light chains are each at least 90% identical to the variable heavy and light chains in SEQ ID NO: 242 and SEQ ID NO: 262, respectively.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the variable heavy chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 282 and the variable light chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 302.
  • variable heavy and light chains are each at least 90% identical to the variable heavy and light chains in SEQ ID NO: 282 and SEQ ID NO: 302, respectively.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the variable heavy chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 322 and the variable light chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 342.
  • variable heavy and light chains are each at least 90% identical to the variable heavy and light chains in SEQ ID NO: 322 and SEQ ID NO: 342, respectively.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the variable heavy chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 362 and the variable light chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 382.
  • variable heavy and light chains are each at least 90% identical to the variable heavy and light chains in SEQ ID NO: 362 and SEQ ID NO: 382, respectively.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the variable heavy chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 402 and the variable light chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 422.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, 55, wherein the variable heavy and light chains are each at least 90% identical to the variable heavy and light chains in SEQ ID NO: 402 and SEQ ID NO: 422, respectively.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the variable heavy chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 442 and the variable light chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 462.
  • variable heavy and light chains are each at least 90% identical to the variable heavy and light chains in SEQ ID NO: 442 and SEQ ID NO: 462, respectively.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the variable heavy chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 482 and the variable light chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 502.
  • variable heavy and light chains are each at least 90% identical to the variable heavy and light chains in SEQ ID NO: 482 and SEQ ID NO: 502, respectively.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the variable heavy chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 522 and the variable light chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 542.
  • variable heavy and light chains are each at least 90% identical to the variable heavy and light chains in SEQ ID NO: 522 and SEQ ID NO: 542, respectively.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the variable heavy chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 562 and the variable light chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 582.
  • variable heavy and light chains are each at least 90% identical to the variable heavy and light chains in SEQ ID NO: 562 and SEQ ID NO: 582, respectively.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the variable heavy chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 602 and the variable light chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 622.
  • variable heavy and light chains are each at least 90% identical to the variable heavy and light chains in SEQ ID NO: 602 and SEQ ID NO: 622, respectively.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the variable heavy chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 642 and the variable light chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 662.
  • variable heavy and light chains are each at least 90% identical to the variable heavy and light chains in SEQ ID NO: 642 and SEQ ID NO: 662, respectively.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the variable heavy chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 682 and the variable light chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 702.
  • variable heavy and light chains are each at least 90% identical to the variable heavy and light chains in SEQ ID NO: 682 and SEQ ID NO: 702, respectively
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the variable heavy chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 722 and the variable light chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 742.
  • variable heavy and light chains are each at least 90% identical to the variable heavy and light chains in SEQ ID NO: 722 and SEQ ID NO: 742, respectively
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the variable heavy chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 762 and the variable light chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 782.
  • variable heavy and light chains are each at least 90% identical to the variable heavy and light chains in SEQ ID NO: 762 and SEQ ID NO: 782, respectively
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the variable heavy chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 802 and the variable light chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 822.
  • variable heavy and light chains are each at least 90% identical to the variable heavy and light chains in SEQ ID NO: 802 and SEQ ID NO: 822, respectively.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the variable heavy chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 842 and the variable light chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 862.
  • variable heavy and light chains are each at least 90% identical to the variable heavy and light chains in SEQ ID NO: 842 and SEQ ID NO: 862, respectively.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the variable heavy chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 882 and the variable light chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 902.
  • variable heavy and light chains are each at least 90% identical to the variable heavy and light chains in SEQ ID NO: 882 and SEQ ID NO: 902, respectively.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the variable heavy chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 922 and the variable light chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 942.
  • variable heavy and light chains are each at least 90% identical to the variable heavy and light chains in SEQ ID NO: 922 and SEQ ID NO: 942, respectively.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the heavy chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 1 and the light chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 21.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the heavy chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 41 and the light chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 61.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the heavy chain encoded by said nucleic acid or nucleic acids comprises a sequence is at least 80, 85, 90,
  • nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 101.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the heavy chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95,
  • nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 141.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the heavy chain encoded by said nucleic acid or nucleic acids a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 161 and the light chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 181.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the heavy chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 201 and the light chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 221.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the heavy chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 241 and the light chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 261.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the heavy chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 281 and the light chain encoded by said nucleic acid or nucleic acids comprises SEQ ID NO: 301.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the heavy chain encoded by said nucleic acid or nucleic acids comprises SEQ ID NO: 321 and the light chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 341.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the heavy chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 361 and the light chain encoded by said nucleic acid or nucleic acids comprises SEQ ID NO: 381.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the heavy chain encoded by said nucleic acid or nucleic acids comprises SEQ ID NO: 401 and the light chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 421.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the heavy chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 441 and the light chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 461.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the heavy chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 481 and the light chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 501.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the heavy chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 521 and the light chain encoded by said nucleic acid or nucleic acids comprises SEQ ID NO: 541.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the heavy chain encoded by said nucleic acid or nucleic acids comprises SEQ ID NO: 561 and the light chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 581.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the heavy chain encoded by said nucleic acid or nucleic acids a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 601 and the light chain encoded by said nucleic acid or nucleic acids comprises SEQ ID NO: 621.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the heavy chain encoded by said nucleic acid or nucleic acids comprises SEQ ID NO: 641 and the light chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 661.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the heavy chain encoded by said nucleic acid or nucleic acids comprises s a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 681 and the light chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 701.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the heavy chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 721 and the light chain encoded by said nucleic acid or nucleic acids comprises SEQ ID NO: 741.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the heavy chain encoded by said nucleic acid or nucleic acids comprises SEQ ID NO: 761 and the light chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 781.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the heavy chain encoded by said nucleic acid or nucleic acids comprises a sequence that is at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 801 and the light chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 821.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the heavy chain encoded by said nucleic acid or nucleic acids comprises a sequence that is at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 841 and the light chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 861.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the heavy chain encoded by said nucleic acid or nucleic acids comprises a sequence that is at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 881 and the light chain encoded by said nucleic acid or nucleic acids comprises SEQ ID NO: 901.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids that encode an antibody according to the invention wherein the heavy chain encoded by said nucleic acid or nucleic acids comprises SEQ ID NO: 921 and the light chain encoded by said nucleic acid or nucleic acids comprises a sequence at least 80, 85, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 941.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention wherein the antibody or antibody fragment encoded by said nucleic acid or nucleic acids is selected from the group consisting of chimeric, humanized, and human antibodies or antibody fragments.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the expressed antibody or antibody fragment encoded by said nucleic acid or nucleic acids is selected from the group consisting of scFvs, camelbodies, nanobodies, IgNAR, F a b fragments, F a b' fragments, MetMabs, monovalent antibody fragments, and F( a b')2 fragments.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the expressed antibody or antibody fragment encoded by said nucleic acid or nucleic acids substantially or entirely lacks N-glycosylation and/or O-glycosylation.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the expressed antibody or antibody fragment encoded by said nucleic acid or nucleic acids comprises a human constant domain.
  • Another preferred embodiment of the invention relates to a nucleic acid or nucleic acids encoding an antibody according to the invention, wherein the expressed antibody encoded by said nucleic acid or nucleic acids is an IgGl, IgG2, IgG3, or IgG4 antibody.
  • nucleic acid or nucleic acids encoding an antibody according to the invention, wherein said nucleic acid or nucleic acids which encode said antibody or antibody fragment comprise a sequence encoding a VH and a VL region at least 80, 90, 95, 96, 97, 98, 99 or 100% identical to SEQ ID NO: 12, SEQ ID NO: 32; SEQ ID NO: 52, SEQ ID NO: 72; SEQ ID NO: 92, SEQ ID NO: 112; SEQ ID NO: 132, SEQ ID NO: 152; SEQ ID NO: 172, SEQ ID NO: 192; SEQ ID NO: 212, SEQ ID NO: 232, SEQ ID NO: 252, SEQ ID NO: 272; SEQ ID NO: 292, SEQ ID NO: 312; SEQ ID NO: 332, SEQ ID NO: 352; SEQ ID NO: 372, SEQ ID NO: 392; SEQ ID NO: 412, SEQ ID NO:
  • a vector or vectors comprising the nucleic acid sequence or sequences encoding an antibody according to the invention.
  • a host cell comprising nucleic acid sequence or sequences encoding an antibody according to the invention or a vector or vectors containing.
  • Another preferred embodiment of the invention relates to an host cell containing a nucleic acid or acids encoding an antibody according to the invention, wherein said host cell is a mammalian, bacterial, fungal, yeast, avian or insect cell.
  • Another preferred embodiment of the invention relates to an host cell encoding an antibody according to the invention, which comprises a filamentous fungi or a yeast.
  • Another preferred embodiment of the invention relates to an host cell encoding an antibody according to the invention, which comprises a filamentous fungi or yeast include Pichia pastoris, Pichia fmlandica, Pichia trehalophila, Pichia koclamae, Pichia membranaefaciens, Pichia minuta (Ogataea minuta, Pichia lindneri), Pichia opuntiae, Pichia thermotolerans, Pichia salictaria, Pichia guercuum, Pichia pijperi, Pichia stiptis, Pichia methanolica, Pichia sp., Saccharomyces cerevisiae, Saccharomyces sp., Hansenula polymorpha, Kluyveromyces sp., Kluyveromyces lactis, Candida albicans, Aspergillus nidulans, Aspergillus niger, Aspergill
  • Pichia sp. any Saccharomyces sp., Hansenula polymorpha, any Kluyveromyces sp., Candida albicans, any Aspergillus sp., Trichoderma reesei, Chrysosporium lucknowense, any Fusarium sp. and Neurospora crassa.
  • Another preferred embodiment of the invention relates to an host cell encoding an antibody according to the invention, wherein said host cell is a mammalian cell.
  • Another preferred embodiment of the invention relates to an host cell encoding an antibody according to the invention, wherein said host cell is a CHO, COS, BHK, myeloma, monkey kidney CV1 line transformed by SV40 (COS-7, ATCC CRL 1651); human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture), mouse Sertoli cell; human lung cell; human liver cell, or a mouse mammary tumor cell.
  • Another preferred embodiment of the invention relates to an host cell encoding an antibody according to the invention, wherein the mammalian cell is a CHO cell.
  • Another preferred embodiment of the invention relates to an host cell encoding an antibody according to the invention, which is yeast cell belonging to the genus Pichia.
  • Another preferred embodiment of the invention relates to an host cell encoding an antibody according to the invention, which is a Pichia pastoris.
  • a method of making the antibody or antibody fragment according to the invention by expressing nucleic acids which encode for the expression of said antibody or antibody fragment in a recombinant host cell.
  • Another preferred embodiment of the invention relates to a method using a cell that expresses an antibody according to the invention wherein the host cell is selected from a bacteria, yeast, fungi, insect cell, plant cell, avian cell, or mammalian cell.
  • Another preferred embodiment of the invention relates to a method of using a cell that expresses an antibody according to the invention, wherein the host cell is a yeast or a filamentous fungi, which may optimally be polyploidal.
  • Another preferred embodiment of the invention relates to a method of using a cell that expresses an antibody according to the invention, wherein said a yeast or a filamentous fungi include Pichia pastoris, Pichia finlandica, Pichia trehalophila, Pichia koclamae, Pichia membranaefaciens, Pichia minuta (Ogataea minuta, Pichia lindneri), Pichia opuntiae, Pichia thermotolerans, Pichia salictaria, Pichia guercuum, Pichia pijperi, Pichia stiptis, Pichia methanolica, Pichia sp., Saccharomyces cerevisiae, Saccharomyces sp., Hansenula polymorpha, Kluyveromyces sp., Kluyveromyces lactis, Candida albicans, Aspergillus nidulans, Aspergillus nid
  • Hansenula polymorpha any Kluyveromyces sp., Candida albicans, any Aspergillus sp., Trichoderma reesei, Chrysosporium lucknowense, any Fusarium sp. and Neurospora crassa.
  • Another preferred embodiment of the invention relates to a method of using a cell that expresses an antibody according to the invention, wherein said host cell is a mammalian cell.
  • Another preferred embodiment of the invention relates to a method of using a cell that expresses an antibody according to the invention, wherein said host cell is a CHO, COS, BHK, myeloma, monkey kidney CV1 line transformed by SV40 (COS-7, ATCC CRL 1651); human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture), mouse Sertoli cell; human lung cell; human liver cell, or a mouse mammary tumor cell.
  • COS-7 CHO, COS, BHK, myeloma, monkey kidney CV1 line transformed by SV40 (COS-7, ATCC CRL 1651); human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture), mouse Sertoli cell; human lung cell; human liver cell, or a mouse mammary tumor cell.
  • Another preferred embodiment of the invention relates to a method of using a cell that expresses an antibody according to the invention, wherein the mammalian cell is a CHO cell.
  • Another preferred embodiment of the invention relates to a method of 383, wherein the recombinant host cell is a polyploid yeast culture that stably expresses and secretes into the culture medium at least 10-25 mg/liter of said antibody or antibody fragment.
  • Another preferred embodiment of the invention relates to a method of using a cell that expresses an antibody according to the invention, wherein the cell is a polyploidal yeast made by a method that comprises:
  • Another preferred embodiment of the invention relates to a method of using a yeast cell that expresses an antibody according to the invention, wherein said yeast is of the genera Pichia.
  • Another preferred embodiment relates to any therapeutic or diagnostic method that comprises the administration of a therapeutically or diagnostically effective amount of at least one antibody or antibody fragment according to the invention .
  • Another preferred embodiment of the invention relates to a method of using an antibody according to the invention, wherein the antibody or antibody fragment is administered by a means selected from buccal, epicutaneous, epidural, inhalation, intraarterial, intracardial, intracerebroventricular, intradermal, intramuscular, intranasal, intraocular, intraperitoneal, intraspinal, intrathecal, intravenous, oral, parenteral, rectally via an enema or suppository, subcutaneous, subdermal, sublingual, transdermal, and transmucosal.
  • a means selected from buccal, epicutaneous, epidural, inhalation, intraarterial, intracardial, intracerebroventricular, intradermal, intramuscular, intranasal, intraocular, intraperitoneal, intraspinal, intrathecal, intravenous, oral, parenteral, rectally via an enema or suppository, subcutaneous, subdermal, sublingual, transdermal, and transm
  • Another preferred embodiment of the invention relates to a method of using an antibody according to the invention, wherein the antibody or antibody fragment is administered by a means selected from subcutaneous, intravenous, , intraarterial, intracardial, intracerebroventricular, intramuscular, intraperitoneal, intraspinal, intrathecal, and parenteral.
  • Another preferred embodiment of the invention relates to a method of using an antibody according to the invention, wherein the antibody or antibody fragment is administered by subcutaneous means.
  • Another preferred embodiment of the invention relates to a method of using an antibody according to the invention wherein the antibody or antibody fragment is administered by intravenous means.
  • Another preferred embodiment of the invention relates to a method of using an antibody according to the invention, wherein the antibody or antibody fragment is contained in a powder, liquid, gel, drop, or other means of administration.
  • compositions containing an antibody or antibody fragment according to the invention which is suitable for administration by a means selected from buccal, epicutaneous, epidural, inhalation, intraarterial, intracardial, intracerebroventricular, intradermal, intramuscular, intranasal, intraocular, intraperitoneal, intraspinal, intrathecal, intravenous, oral, parenteral, rectally via an enema or suppository, subcutaneous, subdermal, sublingual, transdermal, and transmucosal.
  • Another preferred embodiment of the invention relates to an composition containing an antibody according to the invention , wherein the composition is
  • Another preferred embodiment of the invention relates to an composition encoding an antibody according to the invention, which is administrable by subcutaneous means.
  • Another preferred embodiment of the invention relates to a composition which is administrable by intravenous means.
  • compositions which comprises a powder, liquid, gel, drop, liposomal, or other dosage form.
  • Another preferred embodiment of the invention relates to a method of using an antibody or antibody fragment according to the invention to isolate, detect or purify PCSK9 in a sample.
  • Another preferred embodiment of the invention relates a method of using an antibody or antibody fragment according to the invention to detect the levels of PCSK9 in vivo or ex vivo.
  • Another preferred embodiment of the invention relates to a method of using the subject antibodies to assess whether a patient should be administered an anti-PC SK9 antibody or antibody fragment or other therapy.
  • Another preferred embodiment of the invention relates to detection method using the subject antibodies to assess the efficacy of a treatment method the objective of which is to reduce cholesterol or alter lipid levels.
  • Antibodies and binding fragments thereof that bind to PCSK9 are disclosed herein.
  • the antibody or antibody fragment according to the invention bind to PCSK9 and prevent PCSK9 from functioning in various ways.
  • the antibody or antibody fragment according to the invention block or reduce the ability of PCSK9 to interact with other substances, e.g., LDLR.
  • the antibody or antibody fragment according to the invention binds to PCSK9 in a manner that prevents or reduces the likelihood that PCSK9 will bind to LDLR.
  • antibody or antibody fragment according to the invention bind to PCSK9 but do not block PCSK9' s ability to interact with LDLR.
  • the antibody or antibody fragment according to the invention are human monoclonal antibodies.
  • altering the interactions between PCSK9 and LDLR can increase the amount of LDLR available for binding to LDL, which in turn decreases the amount of serum LDL-C in a subject, resulting in a reduction in the subject's serum cholesterol level.
  • an antibody or antibody fragment according to the invention can be used in various methods and compositions for treating subjects with elevated serum cholesterol levels, at risk of elevated serum cholesterol levels, or which could benefit from a reduction in their serum cholesterol levels. These conditions include any of the afore -mentioned conditions.
  • various methods and techniques for lowering, maintaining, or preventing an increase in serum cholesterol are also described herein.
  • the antibody or antibody fragment according to the invention allows for binding between PCSK9 and LDLR, but the antibody or antibody fragment according to the invention prevents or reduces the adverse activity of PCSK9 on LDLR. In some embodiments, the antibody or antibody fragment according to the invention prevents or reduces the binding of PCSK9 to LDLR.
  • proprotein convertase subtilisin kexin type 9 or "PCSK9” refers to a polypeptide as set forth in SEQ ID NO: 961 and/or SEQ ID NO: 962 or fragments thereof, as well as related polypeptides, which include, but are not limited to, allelic variants, splice variants, derivative variants, substitution variants, deletion variants, and/or insertion variants including the addition of an N-terminal methionine, fusion polypeptides, and interspecies homologs.
  • a PCSK9 polypeptide includes terminal residues, such as, but not limited to, leader sequence residues, targeting residues, amino terminal methionine residues, lysine residues, tag residues, and/or fusion protein residues.
  • PCSK9 has also been referred to as FH3, NARC1, HCHOLA3, proprotein convertase subtilisin/kexin type 9, and neural apoptosis regulated convertase 1.
  • the PCSK9 gene encodes a proprotein convertase protein that belongs to the proteinase K subfamily of the secretory subtilase family.
  • PCSK9 denotes both the proprotein (SEQ ID NO:
  • PCSK9 As used herein also includes naturally occurring alleles, such as the mutations D374Y, S127R and F216L.
  • PCSK9 also encompasses PCSK9 molecules incorporating post-translational modifications of the PCSK9 amino acid sequence, such as PCSK9 sequences that have been glycosylated, PEGylated, PCSK9 sequences from which its signal sequence has been cleaved, PCSK9 sequence from which its pro domain has been cleaved from the catalytic domain but not separated from the catalytic domain.
  • PCSK9 activity includes any biological effect of PCSK9.
  • PCSK9 activity includes the ability of PCSK9 to interact or bind to a substrate or receptor.
  • PCSK9 activity is represented by the ability of PCSK9 to bind to a LDL-R receptor (LDLR).
  • LDLR LDL-R receptor
  • PCSK9 binds to and catalyzes a reaction involving LDLR.
  • PCSK9 activity includes the ability of PCSK9 to alter (e.g., reduce) the availability of LDLR.
  • PCSK9 activity includes the ability of PCSK9 to increase the amount of LDL-C in a subject.
  • PCSK9 activity includes the ability of PCSK9 to decrease the amount of LDLR that is available to bind to LDL.
  • PCSK9 activity includes any biological activity resulting from PCSK9 signaling. Exemplary activities include, but are not limited to, PCSK9 binding to LDLR, PCSK9 enzyme activity that cleaves LDLR or other proteins, PCSK9 binding to proteins other than LDLR that facilitate PCSK9 action, PCSK9 altering APOB secretion (Sun X-M et al, "Evidence for effect of mutant PCSK9 on apoliprotein B secretion as the cause of unusually severe dominant hypercholesterolemia, Human Molecular Genetics 14: 1161- 1169, 2005 and Ouguerram K et al, "Apolipoprotein B100 metabolism in autosomal- dominant hypercholesterolemia related to mutations in PCSK9, Arterioscler Thromb Vase Biol.
  • hypocholesterolemia refers to a condition in which cholesterol levels are elevated above a desired level. In some embodiments, this denotes that serum cholesterol levels are elevated. In some embodiments, the desired level takes into account various "risk factors" that are known to one of skill in the art (and are described or referenced herein).
  • Recombinant cell or “recombinant host cell” herein in general refers to any cell engineered to express one or more antibody polypeptides according to the invention. This includes by way of example bacterial, fungal, yeast, mammalian, invertebrate such as insect, plant and avian cells. Preferred host cells are yeast, fungi, especially filamentous fungi and mammalian cells.
  • Yeast and filamentous fungi include, but are not limited to Pichia pastoris, Pichia fmlandica, Pichia trehalophila, Pichia koclamae, Pichia membranaefaciens, Pichia minuta (Ogataea minuta, Pichia lindneri), Pichia opuntiae, Pichia thermotolerans, Pichia salictaria, Pichia guercuum, Pichia pijperi, Pichia stiptis, Pichia methanolica, Pichia sp., Saccharomyces cerevisiae, Saccharomyces sp., Hansenula polymorpha, Kluyveromyces sp., Kluyveromyces lactis, Candida albicans, Aspergillus nidulans, Aspergillus niger, Aspergillus oryzae, Trichoderma reesei, Chrysospor
  • Pichia sp. any Saccharomyces sp., Hansenula polymorpha, any Kluyveromyces sp., Candida albicans, any Aspergillus sp., Trichoderma reesei, Chrysosporium lucknowense, any Fusarium sp. and Neurospora crassa.
  • invertebrate cells include insect cells such as Drosophila S2 and Spodoptera Sf9, as well as plant cells.
  • useful mammalian host cell lines include Chinese hamster ovary (CHO) and COS cells. More specific examples include monkey kidney CVl line transformed by SV40 (COS-7, ATCC CRL 1651); human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture, Graham et al, J. Gen Virol, 36:59 (1977)); Chinese hamster ovary cells/-DHFR (CHO, Urlaub and Chasin, Proc. Natl. Acad. Sci. USA, 77:4216 (1980)); mouse Sertoli cells (TM4, Mather, Biol.
  • human lung cells W138, ATCC CCL 75
  • human liver cells Hep G2, HB 8065
  • mouse mammary tumor MMT 060562, ATCC CCL51.
  • Preferred mammalian cells for antibody expression include CHO cells and COS cells.
  • the recombinant host cells are polyp loidal yeast cells of the genus Pichia.
  • Mating competent yeast species In the present invention this is intended to broadly encompass any diploid or tetraploid yeast which can be grown in culture. Such species of yeast may exist in a haploid, diploid, or other polyploid form. The cells of a given ploidy may, under appropriate conditions, proliferate for an indefinite number of generations in that form. Diploid cells can also sporulate to form haploid cells. Sequential mating can result in tetraploid strains through further mating or fusion of diploid strains. The present invention contemplates the use of haploid yeast, as well as diploid or other polyploid yeast cells produced, for example, by mating or spheroplast fusion.
  • Mating competent yeast include yeast which are a member of the Saccharomycetaceae family, which includes the genera Arxiozyma; Ascobotryozyma; Citeromyces; Debaryomyces; Dekkera; Eremothecium; Issatchenkia; Kazachstania; Kluyveromyces; Kodamaea; Lodderomyces; Pachysolen; Pichia; Saccharomyces; Saturnispora; Tetrapisispora; Torulaspora; Williopsis; and Zygosaccharomyces.
  • Other types of yeast potentially useful in the invention include Yarrowia; Rhodosporidium; Candida; Hansenula; Filobasium; Sporidiobolus; Bullera; Leucosporidium and Filobasidella.
  • the mating competent yeast is a member of the genus Pichia.
  • the mating competent yeast of the genus Pichia is one of the following species: Pichia pastoris, Pichia methanolica, and Hansenula polymorpha (Pichia angusta).
  • the mating competent yeast of the genus Pichia is the species Pichia pastoris.
  • Haploid Yeast Cell A cell having a single copy of each gene of its normal genomic (chromosomal) complement.
  • Polyploid Yeast Cell A cell having more than one copy of its normal genomic (chromosomal) complement.
  • Diploid Yeast Cell A cell having two copies (alleles) of essentially every gene of its normal genomic complement, typically formed by the process of fusion (mating) of two haploid cells.
  • Tetraploid Yeast Cell A cell having four copies (alleles) of essentially every gene of its normal genomic complement, typically formed by the process of fusion (mating) of two haploid cells. Tetraploids may carry two, three, four or more different expression cassettes. Such tetraploids might be obtained in S. cerevisiae by selective mating homozygotic heterothallic a/a and alpha/alpha diploids and in Pichia by sequential mating of haploids to obtain auxotrophic diploids.
  • a [met his] haploid can be mated with [ade his] ha loid to obtain diploid [his]; and a [met arg] haploid can be mated with [ade arg] haploid to obtain diploid [arg]; then the diploid [his] x diploid [arg] to obtain a tetraploid prototroph. It will be understood by those of skill in the art that reference to the benefits and uses of diploid cells may also apply to tetraploid cells.
  • Yeast Mating The process by which two haploid yeast cells naturally fuse to form one diploid yeast cell.
  • Meiosis The process by which a diploid yeast cell undergoes reductive division to form four haploid spore products. Each spore may then germinate and form a haploid vegetatively growing cell line.
  • a selectable marker is a gene or gene fragment that confers a growth phenotype (physical growth characteristic) on a cell receiving that gene as, for example through a transformation event.
  • the selectable marker allows that cell to survive and grow in a selective growth medium under conditions in which cells that do not receive that selectable marker gene cannot grow.
  • Selectable marker genes generally fall into several types, including positive selectable marker genes such as a gene that confers on a cell resistance to an antibiotic or other drug, temperature when two temperature sensitive ("ts") mutants are crossed or a ts mutant is transformed; negative selectable marker genes such as a biosynthetic gene that confers on a cell the ability to grow in a medium without a specific nutrient needed by all cells that do not have that biosynthetic gene, or a mutagenized biosynthetic gene that confers on a cell inability to grow by cells that do not have the wild type gene; and the like. Suitable markers include but are not limited to: ZEO; G418; LYS3; MET1; MET3a; ADE1; ADE3; URA3; and the like.
  • Expression Vector contain elements that facilitate manipulation for the expression of a foreign protein within the target host cell. Conveniently, manipulation of sequences and production of DNA for transformation is first performed in a bacterial host, e.g. E. coli, and usually vectors will include sequences to facilitate such manipulations, including a bacterial origin of replication and appropriate bacterial selection marker. Selection markers encode proteins necessary for the survival or growth of transformed host cells grown in a selective culture medium. Host cells not transformed with the vector containing the selection gene will not survive in the culture medium. Typical selection genes encode proteins that (a) confer resistance to antibiotics or other toxins, (b) complement auxotrophic deficiencies, or (c) supply critical nutrients not available from complex media.
  • Exemplary vectors and methods for transformation of yeast are described, for example, in Burke, D., Dawson, D., & Stearns, T. (2000). Methods in yeast genetics: a Cold Spring Harbor Laboratory course manual. Plainview, N.Y.: Cold Spring Harbor Laboratory Press.
  • Expression vectors for use in the methods of the invention will further include yeast specific sequences, including a selectable auxotrophic or drug marker for identifying transformed yeast strains.
  • a drug marker may further be used to amplify copy number of the vector in a yeast host cell.
  • the polypeptide coding sequence of interest is operably linked to transcriptional and translational regulatory sequences that provide for expression of the polypeptide in yeast cells.
  • These vector components may include, but are not limited to, one or more of the following: an enhancer element, a promoter, and a transcription termination sequence. Sequences for the secretion of the polypeptide may also be included, e.g. a signal sequence, and the like.
  • a yeast origin of replication is optional, as expression vectors are often integrated into the yeast genome.
  • the polypeptide of interest is operably linked, or fused, to sequences providing for optimized secretion of the polypeptide from yeast diploid cells.
  • Nucleic acids are "operably linked" when placed into a functional relationship with another nucleic acid sequence.
  • DNA for a signal sequence is operably linked to DNA for a polypeptide if it is expressed as a preprotein that participates in the secretion of the polypeptide; a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence.
  • "operably linked” means that the DNA sequences being linked are contiguous, and, in the case of a secretory leader, contiguous and in reading frame. However, enhancers do not have to be contiguous.
  • Promoters are untranslated sequences located upstream (5') to the start codon of a structural gene (generally within about 100 to 1000 bp) that control the transcription and translation of particular nucleic acid sequences to which they are operably linked.
  • Such promoters fall into several classes: inducible, constitutive, and repressible promoters (that increase levels of transcription in response to absence of a repressor). Inducible promoters may initiate increased levels of transcription from DNA under their control in response to some change in culture conditions, e.g., the presence or absence of a nutrient or a change in temperature.
  • the promoter fragment may also serve as the site for homologous recombination and integration of the expression vector into the same site in the host genome; alternatively a selectable marker is used as the site for homologous recombination.
  • Suitable promoters useful in Pichia include the AOX1 and promoter (Cregg et al. (1989) Mol. Cell. Biol. 9: 1316-1323); ICL1 promoter (Menendez et al. (2003) Yeast 20(13): 1097-108); glyceraldehyde-3 -phosphate dehydrogenase promoter (GAP) (Waterham et al. (1997) Gene 186(l):37-44); and FLD1 promoter (Shen et al. (1998) Gene 216(1):93-102).
  • the GAP promoter is a strong constitutive promoter and the AOX and FLD1 promoters are inducible.
  • yeast promoters include ADH1, alcohol dehydrogenase II, GAL4, PH03, PH05, Pyk, and chimeric promoters derived therefrom.
  • non-yeast promoters may be used in the invention such as mammalian, insect, plant, reptile, amphibian, bacterial, fungal, viral, and avian promoters. Most typically the promoter will comprise a mammalian promoter (potentially endogenous to the expressed genes) or will comprise a yeast or viral promoter that provides for efficient transcription in yeast systems.
  • the polypeptides of interest may be produced recombinantly not only directly, but also as a fusion polypeptide with a heterologous polypeptide, e.g. a signal sequence or other polypeptide having a specific cleavage site at the N-terminus of the mature protein or polypeptide.
  • a heterologous polypeptide e.g. a signal sequence or other polypeptide having a specific cleavage site at the N-terminus of the mature protein or polypeptide.
  • the signal sequence may be a component of the vector, or it may be a part of the polypeptide coding sequence that is inserted into the vector.
  • the heterologous signal sequence selected preferably is one that is recognized and processed through one of the standard pathways available within the host cell.
  • the S. cerevisiae alpha factor pre-pro signal has proven effective in the secretion of a variety of recombinant proteins from P. pastoris.
  • yeast signal sequences include the alpha mating factor signal sequence, the invertase signal sequence, and signal sequences derived from other secreted yeast polypeptides. Additionally, these signal peptide sequences may be engineered to provide for enhanced secretion in diploid yeast expression systems. Other secretion signals of interest also include mammalian signal sequences, which may be heterologous to the protein being secreted, or may be a native sequence for the protein being secreted. Signal sequences include pre-peptide sequences, and in some instances may include propeptide sequences.
  • signal sequences are known in the art, including the signal sequences found on immunoglobulin chains, e.g., K28 preprotoxin sequence, PHA-E, FACE, human MCP-1, human serum albumin signal sequences, human Ig heavy chain, human Ig light chain, and the like.
  • K28 preprotoxin sequence e.g., PHA-E, FACE, human MCP-1, human serum albumin signal sequences, human Ig heavy chain, human Ig light chain, and the like.
  • Transcription may be increased by inserting a transcriptional activator sequence into the vector.
  • These activators are cis-acting elements of DNA, usually about from 10 to 300 bp, which act on a promoter to increase its transcription.
  • Transcriptional enhancers are relatively orientation and position independent, having been found 5' and 3' to the transcription unit, within an intron, as well as within the coding sequence itself. The enhancer may be spliced into the expression vector at a position 5' or 3' to the coding sequence, but is preferably located at a site 5' from the promoter.
  • Expression vectors used in eukaryotic host cells may also contain sequences necessary for the termination of transcription and for stabilizing the mRNA. Such sequences are commonly available from 3' to the translation termination codon, in untranslated regions of eukaryotic or viral DNAs or cDNAs. These regions contain nucleotide segments transcribed as polyadenylated fragments in the untranslated portion of the mRNA.
  • Plasmids from the transformants are prepared, analyzed by restriction endonuclease digestion and/or sequenced.
  • recombination methods based on att sites and recombination enzymes may be used to insert DNA sequences into a vector. Such methods are described, for example, by Landy (1989) Ann.Rev.Biochem. 55:913-949; and are known to those of skill in the art. Such methods utilize intermolecular DNA recombination that is mediated by a mixture of lambda and E.coli -encoded recombination proteins. Recombination occurs between specific attachment ⁇ att) sites on the interacting DNA molecules.
  • Att sites may be introduced into a sequence of interest by ligating the sequence of interest into an appropriate vector; generating a PCR product containing att B sites through the use of specific primers; generating a cDNA library cloned into an appropriate vector containing att sites; and the like.
  • Folding refers to the three-dimensional structure of polypeptides and proteins, where interactions between amino acid residues act to stabilize the structure. While non-covalent interactions are important in determining structure, usually the proteins of interest will have intra- and/or intermolecular covalent disulfide bonds formed by two cysteine residues. For naturally occurring proteins and polypeptides or derivatives and variants thereof, the proper folding is typically the arrangement that results in optimal biological activity, and can conveniently be monitored by assays for activity, e.g. ligand binding, enzymatic activity, etc.
  • the expression host may be further modified by the introduction of sequences encoding one or more enzymes that enhance folding and disulfide bond formation, i.e. foldases, chaperonins, etc.
  • sequences may be constitutively or inducibly expressed in the yeast host cell, using vectors, markers, etc. as known in the art.
  • sequences, including transcriptional regulatory elements sufficient for the desired pattern of expression are stably integrated in the yeast genome through a targeted methodology.
  • the eukaryotic PDI is not only an efficient catalyst of protein cysteine oxidation and disulfide bond isomerization, but also exhibits chaperone activity. Co-expression of PDI can facilitate the production of active proteins having multiple disulfide bonds. Also of interest is the expression of BIP (immunoglobulin heavy chain binding protein); cyclophilin; and the like.
  • BIP immunoglobulin heavy chain binding protein
  • cyclophilin cyclophilin
  • each of the haploid parental strains expresses a distinct folding enzyme, e.g. one strain may express BIP, and the other strain may express PDI or combinations thereof.
  • the terms “desired protein” or “desired antibody” are used interchangeably and refer generally to a parent antibody or fragment specific to a target, i.e., PCSK9 or a chimeric or humanized antibody or a binding portion thereof derived therefrom or one containing the same CDRs or epitopic specificity as any of the anti-PC SK9 antibodies or fragments described herein.
  • the term “antibody” is intended to include any polypeptide chain-containing molecular structure with a specific shape that fits to and recognizes an epitope, where one or more non-covalent binding interactions stabilize the complex between the molecular structure and the epitope.
  • the archetypal antibody molecule is the immunoglobulin, and all types of immunoglobulins, IgG, IgM, IgA, IgE, IgD, etc., from all sources, e.g. human, rodent, rabbit, cow, sheep, pig, dog, other mammals, chicken, other avians, etc., are considered to be "antibodies.”
  • a preferred source for producing antibodies useful as starting material according to the invention is rabbits. Numerous antibody coding sequences have been described; and others may be raised by methods well-known in the art.
  • Examples thereof include chimeric antibodies, human antibodies and other non-human mammalian antibodies, humanized antibodies, single chain antibodies (such as scFvs), camelbodies, nanobodies, IgNAR (single-chain antibodies derived from sharks), small- modular immunopharmaceuticals (SMIPs), and antibody fragments such as Fabs, Fab', F(ab')2, monovalent antibody fragments such as MetMab like molecules, IgNars and the like. See Streltsov VA, et al., Structure of a shark IgNAR antibody variable domain and modeling of an early-developmental isotype, Protein Sci. 2005 Nov;14(l l):2901-9. Epub
  • the present invention includes in particular includes monovalent antibody molecules that bind PCSK9, which are analogous to MetMab molecules.
  • MetMab is a monovalent antibody specific to Met.
  • Met is a protein encoded by the nucleotide sequence set forth in Park et al., Proc. Natl. Acad. Sci. 84, 7479 ⁇ (1987), or fragments thereof, as well as related polypeptides, which include, but are not limited to, allelic variants, splice variants, derivative variants, substitution variants, deletion variants, and/or insertion variants, fusion polypeptides, and interspecies homo logs).
  • the MetMab antibody is a monovalent antibody known by different names including OA-5d5 (Genentech) and is also called One Armed 5d5, 5d5, MetMab, PR0143966, among others).
  • Antibody OA-5d5 including its structure and properties, and methods for making and using it, are described in U.S. Publication No. 2007/0092520.
  • an anti-PCSK9 antibody according to the invention may comprise a single Fab region linked to an Fc region.
  • an antibody of the invention may comprise light and heavy chain variable domains as described herein.
  • the antibody is monovalent and may comprise an intact Fc region.
  • the Fc region may comprise at least one protuberance (knob) and at least one cavity (hole), wherein the presence of the protuberance and cavity enhances formation of a complex between an Fc polypeptide comprising the protuberance and an Fc polypeptide comprising the cavity, for example as described in WO 2005/063816.
  • the Fc region of an antibody of the invention may comprise a first and a second Fc polypeptide, wherein the first and second polypeptide each comprises one or more mutations with respect to wild type human Fc.
  • a cavity mutation is T366S, L368A and/or Y407V.
  • a protuberance mutation is T366W.
  • a monovalent antibody according to the subject invention may comprise a one-armed antibody synthesized as described in WO2005/063816.
  • the one-armed antibody may comprise Fc mutations constituting "knobs" and "holes” as described in WO2005/063816.
  • a hole mutation can be one or more of T366A, L368A and/or Y407V in an Fc polypeptide, and a cavity mutation can be T366W.
  • the invention is also directed to an anti-human PCSK9 monovalent agent that binds with the same PCSK9 epitope and/or competes with an anti-PCSK9 antibody for binding to PCSK9 as an antibody or antibody fragment disclosed herein.
  • antibodies or antigen binding fragments may be produced by genetic engineering.
  • antibody-producing cells are sensitized to the desired antigen or immunogen.
  • the messenger R A isolated from antibody producing cells is used as a template to make cDNA using PCR amplification.
  • a library of vectors, each containing one heavy chain gene and one light chain gene retaining the initial antigen specificity, is produced by insertion of appropriate sections of the amplified immunoglobulin cDNA into the expression vectors.
  • a combinatorial library is constructed by combining the heavy chain gene library with the light chain gene library. This results in a library of clones which co-express a heavy and light chain (resembling the Fab fragment or antigen binding fragment of an antibody molecule).
  • the vectors that carry these genes are co-transfected into a host cell. When antibody gene synthesis is induced in the transfected host, the heavy and light chain proteins self-assemble to produce active antibodies that can be detected by screening with the antigen or immunogen.
  • Antibody coding sequences of interest include those encoded by native sequences, as well as nucleic acids that, by virtue of the degeneracy of the genetic code, are not identical in sequence to the disclosed nucleic acids, and variants thereof.
  • Variant polypeptides can include amino acid (aa) substitutions, additions or deletions. The amino acid substitutions can be conservative amino acid substitutions or substitutions to eliminate non-essential amino acids, such as to alter a glycosylation site, or to minimize misfolding by substitution or deletion of one or more cysteine residues that are not necessary for function.
  • Variants can be designed so as to retain or have enhanced biological activity of a particular region of the protein (e.g., a functional domain, catalytic amino acid residues, etc).
  • Variants also include fragments of the polypeptides disclosed herein, particularly biologically active fragments and/or fragments corresponding to functional domains. Techniques for in vitro mutagenesis of cloned genes are known. Also included in the subject invention are polypeptides that have been modified using ordinary molecular biological techniques so as to improve their resistance to proteolytic degradation or to optimize solubility properties or to render them more suitable as a therapeutic agent.
  • Chimeric antibodies may be made by recombinant means by combining the variable light and heavy chain regions (V L and V H ), obtained from antibody producing cells of one species with the constant light and heavy chain regions from another.
  • V L and V H variable light and heavy chain regions
  • chimeric antibodies utilize rodent or rabbit variable regions and human constant regions, in order to produce an antibody with predominantly human domains.
  • the production of such chimeric antibodies is well known in the art, and may be achieved by standard means (as described, e.g., in U.S. Patent No. 5,624,659, incorporated herein by reference in its entirety).
  • the human constant regions of chimeric antibodies of the invention may be selected from IgGl, IgG2, IgG3, and IgG4 constant regions.
  • Humanized antibodies are engineered to contain even more human- like immunoglobulin domains, and incorporate only the complementarity-determining regions of the animal-derived antibody. This is accomplished by carefully examining the sequence of the hyper-variable loops of the variable regions of the monoclonal antibody, and fitting them to the structure of the human antibody chains. Although facially complex, the process is straightforward in practice. See, e.g., U.S. Patent No. 6,187,287, incorporated fully herein by reference.
  • immunoglobulin fragments comprising the epitope binding site (e.g., Fab', F(ab') 2 , Fab, or other fragments) may be synthesized.
  • "Fragment” or minimal immunoglobulins may be designed utilizing recombinant immunoglobulin techniques.
  • Fv immunoglobulins for use in the present invention may be produced by synthesizing a fused variable light chain region and a variable heavy chain region. Combinations of antibodies are also of interest, e.g. diabodies, which comprise two distinct Fv specificities.
  • SMIPs small molecule immunopharmaceuticals
  • camelbodies, nanobodies, and IgNAR are encompassed by immunoglobulin fragments.
  • Immunoglobulins and fragments thereof may be modified post-trans lationally, e.g. to add effector moieties such as chemical linkers, detectable moieties, such as fluorescent dyes, enzymes, toxins, substrates, bioluminescent materials, radioactive materials, chemiluminescent moieties and the like, or specific binding moieties, such as streptavidin, avidin, or biotin, and the like may be utilized in the methods and compositions of the present invention. Examples of additional effector molecules are provided infra.
  • a "heterologous" region or domain of a DNA construct is an identifiable segment of DNA within a larger DNA molecule that is not found in association with the larger molecule in nature.
  • the heterologous region encodes a mammalian gene
  • the gene will usually be flanked by DNA that does not flank the mammalian genomic DNA in the genome of the source organism.
  • Another example of a heterologous region is a construct where the coding sequence itself is not found in nature (e.g., a cDNA where the genomic coding sequence contains introns, or synthetic sequences having codons different than the native gene). Allelic variations or naturally-occurring mutational events do not give rise to a heterologous region of DNA as defined herein.
  • a "coding sequence” is an in-frame sequence of codons that (in view of the genetic code) correspond to or encode a protein or peptide sequence. Two coding sequences correspond to each other if the sequences or their complementary sequences encode the same amino acid sequences. A coding sequence in association with appropriate regulatory sequences may be transcribed and translated into a polypeptide. A polyadenylation signal and transcription termination sequence will usually be located 3' to the coding sequence.
  • a “promoter sequence” is a DNA regulatory region capable of binding RNA polymerase in a cell and initiating transcription of a downstream (3' direction) coding sequence. Promoter sequences typically contain additional sites for binding of regulatory molecules (e.g., transcription factors) which affect the transcription of the coding sequence.
  • a coding sequence is "under the control" of the promoter sequence or "operatively linked” to the promoter when RNA polymerase binds the promoter sequence in a cell and transcribes the coding sequence into mRNA, which is then in turn translated into the protein encoded by the coding sequence.
  • Vectors are used to introduce a foreign substance, such as DNA, RNA or protein, into an organism or host cell.
  • Typical vectors include recombinant viruses (for polynucleotides) and liposomes (for polypeptides).
  • a "DNA vector” is a replicon, such as plasmid, phage or cosmid, to which another polynucleotide segment may be attached so as to bring about the replication of the attached segment.
  • An "expression vector” is a DNA vector which contains regulatory sequences which will direct polypeptide synthesis by an appropriate host cell.
  • Amplification of polynucleotide sequences is the in vitro production of multiple copies of a particular nucleic acid sequence.
  • the amplified sequence is usually in the form of DNA.
  • a variety of techniques for carrying out such amplification are described in a review article by Van Brunt (1990, Bio/Technol., 8(4):291-294).
  • Polymerase chain reaction or PCR is a prototype of nucleic acid amplification, and use of PCR herein should be considered exemplary of other suitable amplification techniques.
  • Antibodies consist of two identical light polypeptide chains of molecular weight approximately 23,000 Daltons (the "light chain”), and two identical heavy chains of molecular weight 53,000-70,000 (the “heavy chain”).
  • the four chains are joined by disulfide bonds in a "Y" configuration wherein the light chains bracket the heavy chains starting at the mouth of the "Y” configuration.
  • the "branch” portion of the "Y” configuration is designated the F ab region; the stem portion of the "Y” configuration is designated the Fc region.
  • the amino acid sequence orientation runs from the N-terminal end at the top of the "Y” configuration to the C-terminal end at the bottom of each chain.
  • the N-terminal end possesses the variable region having specificity for the antigen that elicited it, and is approximately 100 amino acids in length, there being slight variations between light and heavy chain and from antibody to antibody.
  • variable region is linked in each chain to a constant region that extends the remaining length of the chain and that within a particular class of antibody does not vary with the specificity of the antibody (i.e., the antigen eliciting it).
  • constant regions There are five known major classes of constant regions that determine the class of the immunoglobulin molecule (IgG, IgM, IgA, IgD, and IgE corresponding to ⁇ , ⁇ , ⁇ , ⁇ , and ⁇ (gamma, mu, alpha, delta, or epsilon) heavy chain constant regions).
  • the constant region or class determines subsequent effector function of the antibody, including activation of complement (Kabat, E.
  • variable region refers to the domains within each pair of light and heavy chains in an antibody that are involved directly in binding the antibody to the antigen.
  • Each heavy chain has at one end a variable domain (V H ) followed by a number of constant domains.
  • Each light chain has a variable domain (V L ) at one end and a constant domain at its other end; the constant domain of the light chain is aligned with the first constant domain of the heavy chain, and the light chain variable domain is aligned with the variable domain of the heavy chain.
  • V L variable domain
  • CDR complementarity determining region
  • hypervariable region refers to one or more of the hyper-variable or complementarity determining regions (CDRs) found in the variable regions of light or heavy chains of an antibody (See Kabat, E. A. et al., Sequences of Proteins of Immunological Interest, National Institutes of Health, Bethesda, Md., (1987)). These expressions include the hypervariable regions as defined by Kabat et al. ("Sequences of Proteins of Immunological Interest,” Kabat E., et al., US Dept. of Health and Human Services, 1983) or the hypervariable loops in 3- dimensional structures of antibodies (Chothia and Lesk, J Mol.
  • the CDRs in each chain are held in close proximity by framework regions and, with the CDRs from the other chain, contribute to the formation of the antigen binding site.
  • the CDRs there are select amino acids that have been described as the selectivity determining regions (SDRs) which represent the critical contact residues used by the CDR in the antibody-antigen interaction (Kashmiri, S., Methods, 36:25-34 (2005)).
  • An "epitope" or “binding site” is an area or region on an antigen to which an antigen-binding peptide (such as an antibody) specifically binds.
  • a protein epitope may comprise amino acid residues directly involved in the binding (also called immunodominant component of the epitope) and other amino acid residues, which are not directly involved in the binding, such as amino acid residues which are effectively blocked by the specifically antigen binding peptide (in other words, the amino acid residue is within the "footprint" of the specifically antigen binding peptide).
  • the term epitope herein includes both types of amino acid binding sites in any particular region of PCSK9 that specifically binds to an anti-PCSK9 antibody.
  • PCSK9 may comprise a number of different epitopes, which may include, without limitation, (1) linear peptide antigenic determinants, (2) conformational antigenic determinants which consist of one or more noncontiguous amino acids located near each other in a mature PCSK9 conformation; and (3) post-translational antigenic determinants which consist, either in whole or part, of molecular structures covalently attached to a PCSK9 protein such as carbohydrate groups.
  • a first antibody binds substantially or partially the same or overlapping epitope as a second antibody means that the first and second antibodies compete in binding to the antigen, as described above.
  • the term "binds to substantially the same epitope or determinant as" a monoclonal antibody means that an antibody "competes" with the antibody.
  • the phrase "binds to the same or overlapping epitope or determinant as" an antibody of interest means that an antibody "competes" with said antibody of interest for at least one, or all residues on PCSK9 to which said antibody of interest specifically binds.
  • the identification of one or more antibodies that bind(s) to substantially or essentially the same epitope as the monoclonal antibodies described herein can be readily determined using any one of variety of immunological screening assays in which antibody competition can be assessed. A number of such assays are routinely practiced and well known in the art (see, e.g., U.S. Pat. No. 5,660,827, issued Aug. 26, 1997, which is specifically incorporated herein by reference). It will be understood that actually determining the epitope to which an antibody described herein binds is not in any way required to identify an antibody that binds to the same or substantially the same or overlapping epitope as the monoclonal antibody described herein.
  • test antibodies to be examined are obtained from different source animals, or are even of a different Ig isotype
  • a simple competition assay may be employed in which the control antibody is mixed with the test antibody and then applied to a sample containing PCSK9. Protocols based upon ELISAs, radioimmunoassays, Western blotting, and the use of BIACORE analysis are suitable for use in such simple competition studies.
  • control anti-PCSK9 antibody with varying amounts of the test antibody (e.g., in ratios of about 1 :1, 1 :2, 1 : 10 or about 1 : 100) for a period of time prior to applying to the PCSK9 antigen sample.
  • control and varying amounts of test antibody can simply be added separately and admixed during exposure to the PCSK9 antigen sample.
  • test antibody As long as one can distinguish bound from free antibodies (e.g., by using separation or washing techniques to eliminate unbound antibodies) and control antibody from the test antibody (e.g., by using species specific or isotype specific secondary antibodies or by specifically labeling the control antibody with a detectable label) one will be able to determine if the test antibody reduces the binding of the control antibody to the PCSK9 antigens, indicating that the test antibody recognizes substantially the same epitope as the control ant-PCSK9 antibody.
  • the binding of the (labeled) control antibody in the presence of a completely irrelevant antibody (that does not bind PCSK9) can serve as the control high value.
  • the control low value can be obtained by incubating the labeled control antibody with the same but unlabeled control antibody, where competition would occur and reduce binding of the labeled antibody.
  • a significant reduction in labeled antibody reactivity in the presence of a test antibody is indicative of a test antibody that recognizes substantially the same epitope, i.e., one that competes with the labeled control antibody.
  • any test antibody that reduces the binding of the control antibody to PCSK9 s by at least about 50%, such as at least about 60%, or more preferably at least about 70%> (e.g., about 65- 100%), at any ratio of :test antibody between about 1 : 1 or 1 : 10 and about 1 : 100 is considered to be an antibody that binds to substantially the same or overlapping epitope or determinant as the control antibody.
  • such test antibody will reduce the binding of the control antibody to PCSK9 antigen preferably at least about 50%, at least about 60%, at least about 80% or at least about 90%> (e.g., about 95%>) of the binding of 1 the control antibody observed in the absence of the test antibody.
  • Competition can also or alternatively be assessed by, for example, a flow cytometry test. In such a test, cells bearing PCSK9 can be incubated first with a control antibody that binds PCSK9, and then with the test antibody labeled with a fluorochrome or biotin.
  • the antibody is said to compete with control antibody if the binding obtained upon preincubation with saturating amount of control antibody is about 80%, preferably about 50%), about 40%o or less (e.g., about 30%>) of the binding (as measured by mean of fluorescence) obtained by the test antibody without preincubation with control antibody.
  • an antibody is said to compete with the control antibody if the binding obtained with a labeled control antibody (by a fluorochrome or biotin) on cells preincubated with saturating amount of test antibody is about 80%>, preferably about 50%>, about 40%), or less (e.g., about 30%>) of the binding obtained without preincubation with the test antibody.
  • a simple competition assay in which a test antibody is pre-adsorbed and applied at saturating concentration to a surface onto which PCSK9 is immobilized also may be advantageously employed.
  • the surface in the simple competition assay is preferably a BIACORE chip (or other media suitable for surface plasmon resonance analysis).
  • the binding of a control antibody that binds PCSK9 to the PCSK9-coated surface is measured. This binding to the PCSK9-containing surface of the control antibody alone is compared with the binding of the control antibody in the presence of a test antibody.
  • a significant reduction in binding to the PCSK9-containing surface by the control antibody in the presence of a test antibody indicates that the test antibody recognizes substantially the same epitope as the control antibody such that the test antibody "competes" with the control antibody.
  • Any test antibody that reduces the binding of control antibody by at least about 20%) or more, at least about 40%>, at least about 50%>, at least about 70%>, or more, can be considered to be an antibody that binds to substantially the same epitope or determinant as the control antibody .
  • such test antibody will reduce the binding of the control antibody to PCSK9 by at least about 50%> (e.g., at least about 60%>, at least about 70%>, or more).
  • control and test antibodies can be reversed; i.e. the control antibody can be first bound to the surface and then the test antibody is brought into contact with the surface thereafter in a competition assay.
  • the antibody having higher affinity for PCSK9 antigen is bound to the PCSK9-containing surface first, as it will be expected that the decrease in binding seen for the second antibody (assuming the antibodies are competing) will be of greater magnitude.
  • assays are provided in e.g., Saunal and Regenmortel, (1995) J. Immunol. Methods 183: 33-41, the disclosure of which is incorporated herein by reference.
  • an antibody binds the same or overlapping epitope(s) on PCSK9 as another antibody or the epitope bound by a test antibody may in particular be determined using a western-blot based assay.
  • a library of peptides corresponding to the antigen bound by the antibody, herein PCSK9 is made, which correspond to overlapping portions of the protein, typically 10-25, 10-20 or or 10-15 amino acids long.
  • These different overlapping amino acid peptides encompassing the PCSK9 sequence are synthesized and covalently bound to a PepSpots nitrocellulose membrane (JPT Peptide technologies, Berlin, Germany). Blots are then prepared and probed according to the manufacturer's recommendations.
  • the immunoblot assay detects by fluorimetric means what peptides in the library bind to the test antibody and thereby can identify what residues on the antigen, i.e., PCSK9, interact with the test antibody. (See an embodiment of this technique in US Patent No. 7,935,340, incorporated by reference herein).
  • framework region refers to one or more of the framework regions within the variable regions of the light and heavy chains of an antibody ⁇ See Kabat, E. A. et al., Sequences of Proteins of Immunological Interest, National Institutes of Health, Bethesda, Md., (1987)). These expressions include those amino acid sequence regions interposed between the CDRs within the variable regions of the light and heavy chains of an antibody.
  • PCSK9 Proprotein convertase subtilisin kexin type 9
  • LDLR low density lipoprotein receptor
  • PCSK9 is a prohormone- proprotein convertase in the subtilisin (S8) family of serine proteases Seidah et al, 100(3) Proc. Nat ⁇ Acad. Sci. 928-33 (2003).
  • PCSK9 amino acid sequences are presented as SEQ ID NO: 961 and SEQ ID NO: 962.
  • An exemplary human PCSK9 coding sequence is presented as SEQ ID NO: 963.
  • PCSK9 proteins can also include fragments of the full length PCSK9 protein.
  • the structure of the PCSK9 protein has recently been solved by two groups (Cunningham et al, Nature Structural & Molecular Biology, 2007, and Piper et al, Structure, 15: 1-8, 2007), the entireties of both of which are herein incorporated by reference.
  • PCSK9 includes a signal sequence, a N-terminal prodomain, a subtilisin-like catalytic domain, and a C-terminal domain.
  • the present invention provides novel antibodies or antibody fragments that bind PCSK9, including human PCSK9.
  • the antibody or antibody fragment according to the invention comprises one or more complementarity determining regions (CDRs), of the anti-PCSK9 antibodies and antibody fragments described herein.
  • an anti-PCSK9 antibody or antibody fragment according to the invention will interfere with, block, reduce or modulate the interaction between PCSK9 and LDLR.
  • an anti-PCSK9 antibody or antibody fragment according to the invention is denoted as "neutralizing", e.g., if it totally prevents the interaction of PCSK9 and LDLR.
  • the antibody or antibody fragment neutralizes PCSK9, e.g., by remaining bound to PCSK9.
  • the antibody or antibody fragment according to the invention prevents or reduces the adverse influence of PCSK9 on LDLR without blocking the LDLR binding site on PCSK9.
  • the antibody or antibody fragment according to the invention modulates or alters PCSK9's ability to result in the degradation of LDLR, without having to prevent the binding interaction between PCSK9 and LDLR. More specifically, such an antibody or antibody fragment according to the invention can be specifically described as a "non-competitively neutralizing" antibody or antibody fragment.
  • the neutralizing antibody or antibody fragment according to the invention binds to PCSK9 in a location and/or manner that prevents PCSK9 from binding to LDLR.
  • the neutralizing antibody or antibody fragment according to the invention binds to PCSK9 in a location and/or manner that prevents endocytosis of the PCSK9/LDLR complex.
  • Such antibody or antibody fragment according to the invention can be specifically described as "competitively neutralizing" antibody or antibody fragment according to the invention. All of the above neutralizing antibodies upon in vivo administration may result in a greater amount of free LDLR being present in a subject, which results in more LDLR binding to LDL-C (thereby reducing the amount of LDL-C in the subject). This in turn this results in a reduction in the amount of serum cholesterol present in a subject.
  • the antibody or antibody fragment according to the invention are capable of inhibiting PCSK9-mediated activity (including binding).
  • the antibody or antibody fragment according to the invention are human, such as fully human antibodies to PCSK9.
  • the antibody or antibody fragment according to the invention binds to the catalytic domain of PCSK9. In some embodiments, the antibody or antibody fragment according to the invention binds to the mature form of PCSK9. In some embodiments the antibody or antibody fragment according to the invention binds in the prodomain of PCSK9. In some embodiments, the antibody or antibody fragment according to the invention selectively binds to the mature form of PCSK9. In some embodiments, the antibody or antibody fragment according to the invention binds to the catalytic domain in a manner such that PCSK9 cannot bind or bind as efficiently to LDLR. In some embodiments, the antibody or antibody fragment according to the invention does not bind to the c-terminus of the catalytic domain.
  • the antibody or antibody fragment according to the invention does not bind to the n-terminus of the catalytic domain. In some embodiments, the antibody or antibody fragment according to the invention does not bind to the n- or c-terminus of the PCSK9 protein. In some embodiments, the antibody or antibody fragment according to the invention bind to a specific conformational state of PCSK9 so as to prevent PCSK9 from interacting with LDLR. In some embodiments, the antibody or antibody fragment according to the invention binds to the V domain of PCSK9. In some more specific embodiments, the antibody or antibody fragment according to the invention binds to the V domain of PCSK9 and prevents (or reduces) PCSK9 from binding to LDLR.
  • the anti-PCSK9 antibodies or antibody fragments according to the invention have a variety of utilities.
  • the subject antibodies and fragments are useful in therapeutic applications, as well as diagnostically in binding assays, and are useful for affinity purification of PCSK9, in particular human PCSK9 or its ligands and in screening assays to identify other antagonists of PCSK9 activity.
  • Some of the antibodies or antibody fragments according to the invention are useful for inhibiting binding of PCSK9 to LDLR, or inhibiting PCSK9-mediated activities.
  • the antibody or antibody fragment according to the invention can be used in a variety of therapeutic applications.
  • the PCSK9 antibody or antibody fragment according to the invention are useful for treating conditions associated with PCSK9, such as cholesterol related disorders (or "serum cholesterol related disorders") including by way of example hypercholesterolemia, as further described herein.
  • the subject anti-PCSK9 antibodies and antibody fragments according to the invention can in particular be used for treating any subject wherein blocking, inhibiting or neutralizing the in vivo effect of PCSK9 or blocking or inhibiting the interaction of PCSK9 and LDLR is therapeutically desirable, wherein the subject anti-PCSK9 antibodies or antibody fragments may be used alone or in association with other active agents or drugs.
  • the subject anti-PCSK9 antibodies and antibody fragments according to the invention can also in particular be used for treating or preventing disorders of cholesterol or lipid homeostasis and disorders which may be associated therewith including by way of example hypercholesterolemia, hyperlipidemia, hypertriglyceridaemia, sitosterolemia, atherosclerosis, arteriosclerosis, coronary heart disease, metabolic syndrome, acute coronary syndrome, vascular inflammation, diabetes, obesity, angina, hypertension and xanthoma by the administration of the subject anti-PCSK9 antibodies and antibody fragments that specifically bind to PCSK9, wherein the subject antibodies and antibody fragments may be used alone or in association with other active agents.
  • disorders of cholesterol or lipid homeostasis and disorders which may be associated therewith including by way of example hypercholesterolemia, hyperlipidemia, hypertriglyceridaemia, sitosterolemia, atherosclerosis, arteriosclerosis, coronary heart disease, metabolic syndrome, acute coronary syndrome, vascular inflammation, diabetes, obesity, angina, hypertension and x
  • the subject anti-PCSK9 antibodies and antibody fragments according to the invention can also in particular be used for preventing or treating diseases and disorders associated with PCSK9, e.g., diseases associated with increased or decreased levels of PCSK9 and/or mutations in the PCSK9 gene that affect PCSK9 protein expression, primary sequence and/or function by administering said antibodies or fragments thereof alone or in combination with other active agents.
  • diseases and disorders associated with PCSK9 e.g., diseases associated with increased or decreased levels of PCSK9 and/or mutations in the PCSK9 gene that affect PCSK9 protein expression, primary sequence and/or function by administering said antibodies or fragments thereof alone or in combination with other active agents.
  • the subject anti-PCSK9 antibodies and antibody fragments according to the invention can also in particular be used for treating any subject having a condition or at risk of developing a condition wherein modulation of lipid or cholesterol levels is clinically desirable or where the subject has a condition that is often associated with high lipids or cholesterol.
  • the subject anti-PCSK9 antibodies and antibody fragments according to the invention can also in particular be used for treating or preventing disorders of cholesterol or lipid homeostasis and disorders and complications associated therewith, e.g., hypercholesterolemia, hyperlipidemia, hypertriglyceridaemia, sitosterolemia, atherosclerosis, arteriosclerosis, coronary heart disease, metabolic syndrome, acute coronary syndrome, vascular inflammation, xanthoma, hypertension, angina and related conditions by administration of the subject anti-PCSK9 antibodies and antibody fragments alone or in association with other active agents.
  • disorders of cholesterol or lipid homeostasis and disorders and complications associated therewith e.g., hypercholesterolemia, hyperlipidemia, hypertriglyceridaemia, sitosterolemia, atherosclerosis, arteriosclerosis, coronary heart disease, metabolic syndrome, acute coronary syndrome, vascular inflammation, xanthoma, hypertension, angina and related conditions.
  • the subject anti-PC SK9 antibodies and antibody fragments according to the invention can also in particular be used for improving blood cholesterol markers associated with increased risk of heart disease using the subject antibodies and antibody fragments alone or in association with other active agents.
  • markers include, but are not limited to, high total cholesterol, high LDL, high total cholesterol to HDL ratio and high LDL-Cto HDL ratio.
  • the subject anti-PCSK9 antibodies and antibody fragments according to the invention can also in particular be used in any of the aforementioned therapeutic indications or conditions in combination with other drugs that are typically used to treat such disorders, wherein the antibody and other drug or agent may be co-administered or separately administered.
  • drugs include that may be co-administered with the subject anti-PC SK9 antibodies or antibody fragments or in the same therapeutic regimen include by way of example statins, ACE inhibitors, Angiotensin II receptor blockers (ARBs), Antiarrhythmics, Antiplatelet Drugs, aspirin, beta blockers, amiodarone, digoxin, aspirin, anti-clotting agents, digoxin, diuretics, heart failure drugs, vasodilators, blood thinners, other anti-cholesterol drugs such as holestyramine (Questran), gemfibrozil (Lopid, Gemcor), Omacor, and pantethine, other anti-hypertensives, antidiabetigenic drugs such as Alpha-glucosidase inhibitors, Biguanides, Dipeptidyl peptidase-4 inhibitors, Insulin therapies, Meglitinides, Sulfonylurea, and Thiazolidinediones, and other drugs used to treat conditions wherein the treated individual
  • compositions containing the subject anti-PCSK9 antibodies or antibody fragments especially compositions are suitable for in vivo administration, e.g., subcutaneous, intravenous, intradermal, intranasal, intrathecal, vaginal, rectal, and other injectable or topical administrable dosage forms.
  • compositions containing the subject anti-PCSK9 antibodies or antibody fragments especially compositions which are suitable for in vivo administration, e.g., subcutaneous, intravenous, intradermal, intranasal, intrathecal, vaginal, rectal, oral and other injectable or topical dosage forms which optionally may contain another active agent such as statins, ACE inhibitors, Angiotensin II receptor blockers (ARBs), Antiarrhythmics, Antiplatelet Drugs, aspirin, beta blockers, amiodarone, digoxin, aspirin, anti-clotting agents, digoxin, diuretics, heart failure drugs, vasodilators, blood thinners, other anti-cholesterol drugs such as holestyramine (Questran), gemfibrozil (Lopid, Gemcor), Omacor, and pantethine, other anti-hypertensives, antidiabetigenic drugs such as Alpha-glucosidase inhibitors, Biguanides
  • the invention also provides novel dosage regimens using the subject anti-PC SK9 antibodies or antibody fragments, alone or in association with another active, especially subcutaneous, oral and intravenous dosing regimens.
  • Other uses for the antibodies or antibody fragments according to the invention include, for example, diagnosis of PCSK9-associated diseases or conditions and screening assays to determine the presence or absence of PCSK9.
  • Some of the antibody or antibody fragment according to the invention described herein are useful in treating consequences, symptoms, and/or the pathology associated with PCSK9 activity.
  • Exemplary anti-PC SK9 antibodies and antibody fragments according to the invention and the specific CDRs thereof are identified in the following section.
  • each exemplified antibody or fragment, and sequences contained therein, are separately described under a Header that identifies the exemplified antibody by a specific nomenclature, e.g., Abl, Ab2 and the like.
  • the invention includes antibodies and antibody fragments having binding specificity to PCSK9 that possess a heavy chain sequence comprising the sequence set forth below:
  • the invention includes antibodies and antibody fragments having binding specificity to PCSK9 that contain a variable heavy chain sequence comprising the sequence set forth below:
  • the invention includes antibodies and antibody fragments having binding specificity to PCSK9 that possess the same epitopic specificity as Abl and which contain a constant heavy chain sequence comprising the sequence set forth below:
  • the invention includes antibodies and antibody fragments having binding specificity to PCSK9 that contain a light chain sequence comprising the sequence set forth below:
  • the invention includes antibodies and antibody fragments having binding specificity to PCSK9 that contain a variable light chain sequence comprising the sequence set forth below:
  • the invention includes antibodies and antibody fragments having binding specificity to PCSK9 that bind the same epitope as Abl which contain a constant light chain sequence comprising the sequence set forth below: RT V AAP S VFIFPPSDEQLKS GT AS V VCLLNNF YPRE AKVQ WKVDN ALQ S GNS QE S VTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO: 30).
  • the invention includes antibodies and antibody fragments having binding specificity to PCSK9 that contain one, two, or three of the polypeptide sequences of SEQ ID NO: 4; SEQ ID NO: 6; and SEQ ID NO: 8 which correspond to the complementarity-determining regions (CDRs, or hypervariable regions) of the heavy chain sequence of SEQ ID NO: 1 or which contain the variable heavy chain sequence of SEQ ID NO: 2, and/or which further contain one, two, or three of the polypeptide sequences of SEQ ID NO: 24; SEQ ID NO: 26; and SEQ ID NO: 28 which correspond to the complementarity-determining regions (CDRs, or hypervariable regions) of the light chain sequence of SEQ ID NO: 21 or which contain the variable light chain sequence of SEQ ID NO: 22, or antibodies or fragments containing combinations of sequences which are at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical thereto.
  • the antibodies of the invention or fragments thereof comprise, or alternatively consist of, combinations of one or more of the exemplified variable heavy chain and variable light chain sequences, or the heavy chain and light chain sequences set forth above, or sequences that are at least 90%> or 95% identical thereto.
  • the invention further contemplates anti-PCSK9 antibodies and antibody fragments comprising one, two, three, or four of the polypeptide sequences of SEQ ID NO: 3; SEQ ID NO: 5; SEQ ID NO: 7; and SEQ ID NO: 9 which correspond to the framework regions (FRs or constant regions) of the heavy chain sequence of SEQ ID NO: 1 or the variable heavy chain sequence of SEQ ID NO: 2, and/or one, two, three, or four of the polypeptide sequences of SEQ ID NO: 23; SEQ ID NO: 25; SEQ ID NO: 27; and SEQ ID NO: 29 which correspond to the framework regions (FRs or constant regions) of the light chain sequence of SEQ ID NO: 21 or the variable light chain sequence of SEQ ID NO: 22, or combinations of these polypeptide sequences or sequences which are at least 80%>, 90%>, 95%, 96%, 97%, 98% or 99% identical therewith.
  • the antibodies and antibody fragments of the invention or fragments thereof comprise, or alternatively consist of, combinations of one or more of the FRs, CDRs, the variable heavy chain and variable light chain sequences, and the heavy chain and light chain sequences set forth above, including all of them or sequences which are at least 90% or 95% identical thereto.
  • the anti-PCSK9 antibody fragments of the invention comprise, or alternatively consist of, the polypeptide sequence of SEQ ID NO: 1 or SEQ ID NO: 2 or polypeptides that are at least 90% or 95% identical thereto.
  • antibody fragments of the invention comprise, or alternatively consist of, the polypeptide sequence of SEQ ID NO: 21 or SEQ ID NO: 22 or polypeptides that are at least 90%, 95%, 96%, 97%, 98% or 99% identical thereto.
  • the antibody or antibody fragment having binding specificity to PCSK9 comprises, or alternatively consists of, one, two, or three of the polypeptide sequences of SEQ ID NO: 4; SEQ ID NO: 6; and SEQ ID NO: 8 which correspond to the complementarity-determining regions (CDRs, or hypervariable regions) of the heavy chain sequence of SEQ ID NO: 1 or the variable heavy chain sequence of SEQ ID NO: 2 or sequences that are at least 90%> or 95% identical thereto.
  • CDRs complementarity-determining regions
  • the antibody or antibody fragment having binding specificity to PCSK9 comprises, or alternatively consists of, one, two, or three of the polypeptide sequences of SEQ ID NO: 24; SEQ ID NO: 26; and SEQ ID NO: 28 which correspond to the complementarity-determining regions (CDRs, or hypervariable regions) of the light chain sequence of SEQ ID NO: 21 or the variable light chain sequence of SEQ ID NO: 22 or sequences that are at least 90% or 95% identical thereto.
  • CDRs complementarity-determining regions
  • the antibody or antibody fragment having binding specificity to PCSK9 comprises, or alternatively consists of, one, two, three, or four of the polypeptide sequences of SEQ ID NO: 3; SEQ ID NO: 5; SEQ ID NO: 7; and SEQ ID NO: 9 which correspond to the framework regions (FRs or constant regions) of the heavy chain sequence of SEQ ID NO: 1 or the variable heavy chain sequence of SEQ ID NO: 2 or sequences that are at least 90% or 95% identical thereto.
  • the subject antibody or antibody fragment having binding specificity to PCSK9 comprises, or alternatively consists of, one, two, three, or four of the polypeptide sequences of SEQ ID NO: 23; SEQ ID NO: 25; SEQ ID NO: 27; and SEQ ID NO: 29 which correspond to the framework regions (FRs or constant regions) of the light chain sequence of SEQ ID NO: 21 or the variable light chain sequence of SEQ ID NO: 22 or sequences that are at least 90% or 95% identical thereto.
  • fragments of the antibodies having binding specificity to PCSK9 comprise, or alternatively consist of, one, two, three or more, including all of the following antibody fragments: the variable heavy chain region of SEQ ID NO: 2; the variable light chain region of SEQ ID NO: 22; the complementarity-determining regions (SEQ ID NO: 4; SEQ ID NO: 6; and SEQ ID NO: 8) of the variable heavy chain region of SEQ ID NO: 2; and the complementarity- determining regions (SEQ ID NO: 24; SEQ ID NO: 26; and SEQ ID NO: 28) of the variable light chain region of SEQ ID NO: 22 or sequences that are at least 90%, 95%, 96%, 97%, 98% or 99% identical thereto.
  • fragments of the antibodies having binding specificity to PCSK9 comprise, or alternatively consist of, one, two, three or more, including all of the following antibody fragments: the variable heavy chain region of SEQ ID NO: 2; the variable light chain region of SEQ ID NO: 22; the framework regions (SEQ ID NO: 3; SEQ ID NO: 5; SEQ ID NO: 7; and SEQ ID NO: 9) of the variable heavy chain region of SEQ ID NO: 2; and the framework regions (SEQ ID NO: 23; SEQ ID NO: 25; SEQ ID NO: 27; and SEQ ID NO: 29) of the variable light chain region of SEQ ID NO: 22 or sequences that are at least 90% or 95% identical thereto.
  • the anti-PCSK9 antibody is Abl, comprising, or alternatively consisting of, SEQ ID NO: 1 and SEQ ID NO: 21, or an antibody or antibody fragment comprising the CDRs of Abl and having at least one of the biological activities set forth herein or is an anti-PC SK9 antibody that competes with Abl in binding PCSK9, preferably one containing sequences that are at least 90%, 95%, 96%, 97%, 98% or 99% identical to that of Abl or an antibody that binds to the same or overlapping epitope(s) on PCSK9 as Abl .
  • antibody fragments comprise, or alternatively consist of, Fab (fragment antigen binding) fragments having binding specificity for PCSK9.
  • the Fab fragment preferably includes the variable heavy chain sequence of SEQ ID NO: 2 and the variable light chain sequence of SEQ ID NO: 22 or sequences that are at least 90%, 95%, 96%>, 97%, 98% or 99% identical thereto.
  • This embodiment of the invention further includes Fabs containing additions, deletions, and variants of SEQ ID NO: 2 and/or SEQ ID NO: 22 which retain the binding specificity for PCSK9.
  • Fab fragments may be produced by enzymatic digestion (e.g., papain) of Abl .
  • anti-PCSK9 antibodies such as Abl or Fab fragments thereof may be produced via expression in mammalian cells such as CHO, NSO or HEK 293 cells, fungal, insect, or microbial systems such as yeast cells (for example haploid or diploid yeast such as haploid or diploid Pichia) and other yeast strains.
  • yeast cells for example haploid or diploid yeast such as haploid or diploid Pichia
  • Suitable Pichia species include, but are not limited to, Pichia pastoris.
  • the invention is further directed to polynucleotides encoding antibody polypeptides having binding specificity to PCSK9, including the heavy and/or light chains of Abl as well as fragments, variants, combinations of one or more of the FRs, CDRs, the variable heavy chain and variable light chain sequences, and the heavy chain and light chain sequences set forth above, including all of them or sequences which are at least 90% or 95% identical thereto.
  • the invention includes antibodies and antibody fragments having binding specificity to PCSK9 that possess a heavy chain sequence comprising the sequence set forth below:
  • the invention includes antibodies and antibody fragments having binding specificity to PCSK9 that contain a variable heavy chain sequence comprising the sequence set forth below:
  • the invention includes antibodies and antibody fragments having binding specificity to PCSK9 that possess the same epitopic specificity as Ab2 and which contain a constant heavy chain sequence comprising the sequence set forth below:
  • the invention includes antibodies and antibody fragments having binding specificity to PCSK9 that contain a light chain sequence comprising the sequence set forth below:
  • the invention includes antibodies and antibody fragments having binding specificity to PCSK9 that contain a variable light chain sequence comprising the sequence set forth below:
  • the invention includes antibodies and antibody fragments having binding specificity to PCSK9 that bind the same epitope as Ab2 which contain a constant light chain sequence comprising the sequence set forth below: RT V AAP S VFIFPPSDEQLKS GT AS V VCLLNNF YPRE AKVQ WKVDN ALQ S GNS QE S VTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO: 70).
  • the invention includes antibodies and antibody fragments having binding specificity to PCSK9 that contain one, two, or three of the polypeptide sequences of SEQ ID NO: 44; SEQ ID NO: 46; and SEQ ID NO: 48 which correspond to the complementarity-determining regions (CDRs, or hypervariable regions) of the heavy chain sequence of SEQ ID NO: 41 or which contain the variable heavy chain sequence of SEQ ID NO: 42, and/or which further contain one, two, or three of the polypeptide sequences of SEQ ID NO: 64; SEQ ID NO: 66; and SEQ ID NO: 68 which correspond to the complementarity-determining regions (CDRs, or hypervariable regions) of the light chain sequence of SEQ ID NO: 61 or which contain the variable light chain sequence of SEQ ID NO: 62, or antibodies or fragments containing combinations of sequences which are at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical thereto.
  • the antibodies of the invention or fragments thereof comprise, or alternatively consist of, combinations of one or more of the exemplified variable heavy chain and variable light chain sequences, or the heavy chain and light chain sequences set forth above, or sequences that are at least 90%> or 95% identical thereto.
  • the invention further contemplates anti-PCSK9 antibodies and antibody fragments comprising one, two, three, or four of the polypeptide sequences of SEQ ID NO: 43; SEQ ID NO: 45; SEQ ID NO: 47; and SEQ ID NO: 49 which correspond to the framework regions (FRs or constant regions) of the heavy chain sequence of SEQ ID NO: 41 or the variable heavy chain sequence of SEQ ID NO: 42, and/or one, two, three, or four of the polypeptide sequences of SEQ ID NO: 63; SEQ ID NO: 65; SEQ ID NO: 67; and SEQ ID NO: 69 which correspond to the framework regions (FRs or constant regions) of the light chain sequence of SEQ ID NO: 61 or the variable light chain sequence of SEQ ID NO: 62, or combinations of these polypeptide sequences or sequences which are at least 80%, 90%, 95%, 96%, 97%, 98% or 99% identical therewith.
  • the antibodies and antibody fragments of the invention or fragments thereof comprise, or alternatively consist of, combinations of one or more of the FRs, CDRs, the variable heavy chain and variable light chain sequences, and the heavy chain and light chain sequences set forth above, including all of them or sequences which are at least 90%> or 95% identical thereto.
  • the anti-PCSK9 antibody fragments of the invention comprise, or alternatively consist of, the polypeptide sequence of SEQ ID NO: 41 or SEQ ID NO: 42 or polypeptides that are at least 90% or 95% identical thereto.
  • antibody fragments of the invention comprise, or alternatively consist of, the polypeptide sequence of SEQ ID NO: 61 or SEQ ID NO: 62 or polypeptides that are at least 90%, 95%, 96%, 97%, 98% or 99% identical thereto.
  • the antibody or antibody fragment having binding specificity to PCSK9 comprises, or alternatively consists of, one, two, or three of the polypeptide sequences of SEQ ID NO: 44; SEQ ID NO: 46; and SEQ ID NO: 48 which correspond to the complementarity-determining regions (CDRs, or hypervariable regions) of the heavy chain sequence of SEQ ID NO: 41 or the variable heavy chain sequence of SEQ ID NO: 42 or sequences that are at least 90%> or 95% identical thereto.
  • CDRs complementarity-determining regions
  • the antibody or antibody fragment having binding specificity to PCSK9 comprises, or alternatively consists of, one, two, or three of the polypeptide sequences of SEQ ID NO: 64; SEQ ID NO: 66; and SEQ ID NO: 68 which correspond to the complementarity-determining regions (CDRs, or hypervariable regions) of the light chain sequence of SEQ ID NO: 61 or the variable light chain sequence of SEQ ID NO: 62 or sequences that are at least 90% or 95% identical thereto.
  • CDRs complementarity-determining regions
  • the antibody or antibody fragment having binding specificity to PCSK9 comprises, or alternatively consists of, one, two, three, or four of the polypeptide sequences of SEQ ID NO: 43; SEQ ID NO: 45; SEQ ID NO: 47; and SEQ ID NO: 49 which correspond to the framework regions (FRs or constant regions) of the heavy chain sequence of SEQ ID NO: 41 or the variable heavy chain sequence of SEQ ID NO: 42 or sequences that are at least 90%> or 95% identical thereto.
  • the subject antibody or antibody fragment having binding specificity to PCSK9 comprises, or alternatively consists of, one, two, three, or four of the polypeptide sequences of SEQ ID NO: 63; SEQ ID NO: 65; SEQ ID NO: 67; and SEQ ID NO: 69 which correspond to the framework regions (FRs or constant regions) of the light chain sequence of SEQ ID NO: 61 or the variable light chain sequence of SEQ ID NO: 62 or sequences that are at least 90% or 95% identical thereto.
  • fragments of the antibodies having binding specificity to PCSK9 comprise, or alternatively consist of, one, two, three or more, including all of the following antibody fragments: the variable heavy chain region of SEQ ID NO: 42; the variable light chain region of SEQ ID NO: 62; the complementarity-determining regions (SEQ ID NO: 44; SEQ ID NO: 46; and SEQ ID NO: 48) of the variable heavy chain region of SEQ ID NO: 42; and the complementarity- determining regions (SEQ ID NO: 64; SEQ ID NO: 66; and SEQ ID NO: 68) of the variable light chain region of SEQ ID NO: 62 or sequences that are at least 90%, 95%, 96%, 97%, 98% or 99% identical thereto.
  • fragments of the antibodies having binding specificity to PCSK9 comprise, or alternatively consist of, one, two, three or more, including all of the following antibody fragments: the variable heavy chain region of SEQ ID NO: 42; the variable light chain region of SEQ ID NO: 62; the framework regions (SEQ ID NO: 43; SEQ ID NO: 45; SEQ ID NO: 47; and SEQ ID NO: 49) of the variable heavy chain region of SEQ ID NO: 42; and the framework regions (SEQ ID NO: 63; SEQ ID NO: 65; SEQ ID NO: 67; and SEQ ID NO: 69) of the variable light chain region of SEQ ID NO: 62 or sequences that are at least 90% or 95% identical thereto.
  • the anti-PCSK9 antibody is Ab2, comprising, or alternatively consisting of, SEQ ID NO: 41 and SEQ ID NO: 61, or an antibody or antibody fragment comprising the CDRs of Ab2 and having at least one of the biological activities set forth herein or is an anti-PC SK9 antibody that competes with Ab2 in binding PCSK9, preferably one containing sequences that are at least 90%, 95%, 96%, 97%, 98% or 99% identical to that of Ab2 or an antibody that binds to the same or overlapping epitope(s) on PCSK9 as Ab2.
  • antibody fragments comprise, or alternatively consist of, Fab (fragment antigen binding) fragments having binding specificity for PCSK9.
  • the Fab fragment preferably includes the variable heavy chain sequence of SEQ ID NO: 42 and the variable light chain sequence of SEQ ID NO: 62 or sequences that are at least 90%>, 95%, 96%, 97%, 98% or 99% identical thereto.
  • This embodiment of the invention further includes Fabs containing additions, deletions, and variants of SEQ ID NO: 42 and/or SEQ ID NO: 62 which retain the binding specificity for PCSK9.
  • Fab fragments may be produced by enzymatic digestion (e.g., papain) of Ab2.
  • anti-PCSK9 antibodies such as Ab2 or Fab fragments thereof may be produced via expression in mammalian cells such as CHO, NSO or HEK 293 cells, fungal, insect, or microbial systems such as yeast cells (for example haploid or diploid yeast such as haploid or diploid Pichia) and other yeast strains.
  • yeast cells for example haploid or diploid yeast such as haploid or diploid Pichia
  • Suitable Pichia species include, but are not limited to, Pichia pastoris.
  • the invention is further directed to polynucleotides encoding antibody polypeptides having binding specificity to PCSK9, including the heavy and/or light chains of Ab2 as well as fragments, variants, combinations of one or more of the FRs, CDRs, the variable heavy chain and variable light chain sequences, and the heavy chain and light chain sequences set forth above, including all of them or sequences which are at least 90% or 95% identical thereto.
  • the invention includes antibodies and antibody fragments having binding specificity to PCSK9 that possess a heavy chain sequence comprising the sequence set forth below:
  • the invention includes antibodies and antibody fragments having binding specificity to PCSK9 that contain a variable heavy chain sequence comprising the sequence set forth below:
  • the invention includes antibodies and antibody fragments having binding specificity to PCSK9 that possess the same epitopic specificity as Ab3 and which contain a constant heavy chain sequence comprising the sequence set forth below:
  • the invention includes antibodies and antibody fragments having binding specificity to PCSK9 that contain a light chain sequence comprising the sequence set forth below:
  • the invention includes antibodies and antibody fragments having binding specificity to PCSK9 that contain a variable light chain sequence comprising the sequence set forth below:
  • the invention includes antibodies and antibody fragments having binding specificity to PCSK9 that bind the same epitope as Ab3 which contain a constant light chain sequence comprising the sequence set forth below: RT V AAP S VFIFPPSDEQLKS GT AS V VCLLNNF YPRE AKVQ WKVDN ALQ S GNS QE S VTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO: 110).
  • the invention includes antibodies and antibody fragments having binding specificity to PCSK9 that contain one, two, or three of the polypeptide sequences of SEQ ID NO: 84; SEQ ID NO: 86; and SEQ ID NO: 88 which correspond to the complementarity-determining regions (CDRs, or hypervariable regions) of the heavy chain sequence of SEQ ID NO: 81 or which contain the variable heavy chain sequence of SEQ ID NO: 82, and/or which further contain one, two, or three of the polypeptide sequences of SEQ ID NO: 104; SEQ ID NO: 106; and SEQ ID NO: 108 which correspond to the complementarity-determining regions (CDRs, or hypervariable regions) of the light chain sequence of SEQ ID NO: 101 or which contain the variable light chain sequence of SEQ ID NO: 102, or antibodies or fragments containing combinations of sequences which are at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical thereto.
  • the antibodies of the invention or fragments thereof comprise, or alternatively consist of, combinations of one or more of the exemplified variable heavy chain and variable light chain sequences, or the heavy chain and light chain sequences set forth above, or sequences that are at least 90%> or 95% identical thereto.
  • the invention further contemplates anti-PCSK9 antibodies and antibody fragments comprising one, two, three, or four of the polypeptide sequences of SEQ ID NO: 83; SEQ ID NO: 85; SEQ ID NO: 87; and SEQ ID NO: 89 which correspond to the framework regions (FRs or constant regions) of the heavy chain sequence of SEQ ID NO: 81 or the variable heavy chain sequence of SEQ ID NO: 82, and/or one, two, three, or four of the polypeptide sequences of SEQ ID NO: 103; SEQ ID NO: 105; SEQ ID NO: 107; and SEQ ID NO: 109 which correspond to the framework regions (FRs or constant regions) of the light chain sequence of SEQ ID NO: 101 or the variable light chain sequence of SEQ ID NO: 102, or combinations of these polypeptide sequences or sequences which are at least 80%, 90%, 95%, 96%, 97%, 98% or 99% identical therewith.
  • the antibodies and antibody fragments of the invention or fragments thereof comprise, or alternatively consist of, combinations of one or more of the FRs, CDRs, the variable heavy chain and variable light chain sequences, and the heavy chain and light chain sequences set forth above, including all of them or sequences which are at least 90%> or 95% identical thereto.
  • the anti-PCSK9 antibody fragments of the invention comprise, or alternatively consist of, the polypeptide sequence of SEQ ID NO: 81 or SEQ ID NO: 82 or polypeptides that are at least 90% or 95% identical thereto.
  • antibody fragments of the invention comprise, or alternatively consist of, the polypeptide sequence of SEQ ID NO: 101 or SEQ ID NO: 102 or polypeptides that are at least 90%, 95%, 96%, 97%, 98% or 99% identical thereto.
  • the antibody or antibody fragment having binding specificity to PCSK9 comprises, or alternatively consists of, one, two, or three of the polypeptide sequences of SEQ ID NO: 84; SEQ ID NO: 86; and SEQ ID NO: 88 which correspond to the complementarity-determining regions (CDRs, or hypervariable regions) of the heavy chain sequence of SEQ ID NO: 81 or the variable heavy chain sequence of SEQ ID NO: 82 or sequences that are at least 90% or 95% identical thereto.
  • CDRs complementarity-determining regions
  • the antibody or antibody fragment having binding specificity to PCSK9 comprises, or alternatively consists of, one, two, or three of the polypeptide sequences of SEQ ID NO: 104; SEQ ID NO: 106; and SEQ ID NO: 108 which correspond to the complementarity-determining regions (CDRs, or hypervariable regions) of the light chain sequence of SEQ ID NO: 101 or the variable light chain sequence of SEQ ID NO: 102 or sequences that are at least 90% or 95% identical thereto.
  • CDRs complementarity-determining regions
  • the antibody or antibody fragment having binding specificity to PCSK9 comprises, or alternatively consists of, one, two, three, or four of the polypeptide sequences of SEQ ID NO: 83; SEQ ID NO: 85; SEQ ID NO: 87; and SEQ ID NO: 89 which correspond to the framework regions (FRs or constant regions) of the heavy chain sequence of SEQ ID NO: 81 or the variable heavy chain sequence of SEQ ID NO: 82 or sequences that are at least 90%> or 95% identical thereto.
  • the subject antibody or antibody fragment having binding specificity to PCSK9 comprises, or alternatively consists of, one, two, three, or four of the polypeptide sequences of SEQ ID NO: 103; SEQ ID NO: 105; SEQ ID NO: 107; and SEQ ID NO: 109 which correspond to the framework regions (FRs or constant regions) of the light chain sequence of SEQ ID NO: 101 or the variable light chain sequence of SEQ ID NO: 102 or sequences that are at least 90% or 95% identical thereto.
  • fragments of the antibodies having binding specificity to PCSK9 comprise, or alternatively consist of, one, two, three or more, including all of the following antibody fragments: the variable heavy chain region of SEQ ID NO: 82; the variable light chain region of SEQ ID NO: 102; the complementarity-determining regions (SEQ ID NO: 84; SEQ ID NO: 86; and SEQ ID NO: 88) of the variable heavy chain region of SEQ ID NO: 82; and the complementarity- determining regions (SEQ ID NO: 104; SEQ ID NO: 106; and SEQ ID NO: 108) of the variable light chain region of SEQ ID NO: 102 or sequences that are at least 90%, 95%, 96%, 97%, 98% or 99% identical thereto.
  • fragments of the antibodies having binding specificity to PCSK9 comprise, or alternatively consist of, one, two, three or more, including all of the following antibody fragments: the variable heavy chain region of SEQ ID NO: 82; the variable light chain region of SEQ ID NO: 102; the framework regions (SEQ ID NO: 83; SEQ ID NO: 85; SEQ ID NO: 87; and SEQ ID NO: 89) of the variable heavy chain region of SEQ ID NO: 82; and the framework regions (SEQ ID NO: 103; SEQ ID NO: 105; SEQ ID NO: 107; and SEQ ID NO: 109) of the variable light chain region of SEQ ID NO: 102 or sequences that are at least 90% or 95% identical thereto.
  • the anti-PCSK9 antibody is Ab3, comprising, or alternatively consisting of, SEQ ID NO: 81 and SEQ ID NO: 101, or an antibody or antibody fragment comprising the CDRs of Ab3 and having at least one of the biological activities set forth herein or is an anti-PC SK9 antibody that competes with Ab3 in binding PCSK9, preferably one containing sequences that are at least 90%, 95%, 96%, 97%, 98% or 99% identical to that of Ab3 or an antibody that binds to the same or overlapping epitope(s) on PCSK9 as Ab3.
  • antibody fragments comprise, or alternatively consist of, Fab (fragment antigen binding) fragments having binding specificity for PCSK9.
  • the Fab fragment preferably includes the variable heavy chain sequence of SEQ ID NO: 82 and the variable light chain sequence of SEQ ID NO: 102 or sequences that are at least 90%>, 95%, 96%, 97%, 98% or 99% identical thereto.
  • This embodiment of the invention further includes Fabs containing additions, deletions, and variants of SEQ ID NO: 82 and/or SEQ ID NO: 102 which retain the binding specificity for PCSK9.
  • Fab fragments may be produced by enzymatic digestion (e.g., papain) of Ab3.
  • anti-PCSK9 antibodies such as Ab3 or Fab fragments thereof may be produced via expression in mammalian cells such as CHO, NSO or HEK 293 cells, fungal, insect, or microbial systems such as yeast cells (for example haploid or diploid yeast such as haploid or diploid Pichia) and other yeast strains.
  • Suitable Pichia species include, but are not limited to, Pichia pastoris.
  • the invention is further directed to polynucleotides encoding antibody polypeptides having binding specificity to PCSK9, including the heavy and/or light chains of Ab3 as well as fragments, variants, combinations of one or more of the FRs, CDRs, the variable heavy chain and variable light chain sequences, and the heavy chain and light chain sequences set forth above, including all of them or sequences which are at least 90% or 95% identical thereto.
  • the invention includes antibodies and antibody fragments having binding specificity to PCSK9 that possess a heavy chain sequence comprising the sequence set forth below:
  • the invention includes antibodies and antibody fragments having binding specificity to PCSK9 that contain a variable heavy chain sequence comprising the sequence set forth below:
  • the invention includes antibodies and antibody fragments having binding specificity to PCSK9 that possess the same epitopic specificity as Ab4 and which contain a constant heavy chain sequence comprising the sequence set forth below:
  • the invention includes antibodies and antibody fragments having binding specificity to PCSK9 that contain a light chain sequence comprising the sequence set forth below:
  • the invention includes antibodies and antibody fragments having binding specificity to PCSK9 that contain a variable light chain sequence comprising the sequence set forth below:
  • the invention includes antibodies and antibody fragments having binding specificity to PCSK9 that bind the same epitope as Ab4 which contain a constant light chain sequence comprising the sequence set forth below: RT V AAP S VFIFPPSDEQLKS GT AS V VCLLNNF YPRE AKVQ WKVDN ALQ S GNS QE S VTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO: 150).
  • the invention includes antibodies and antibody fragments having binding specificity to PCSK9 that contain one, two, or three of the polypeptide sequences of SEQ ID NO: 124; SEQ ID NO: 126; and SEQ ID NO: 128 which correspond to the complementarity-determining regions (CDRs, or hypervariable regions) of the heavy chain sequence of SEQ ID NO: 121 or which contain the variable heavy chain sequence of SEQ ID NO: 122, and/or which further contain one, two, or three of the polypeptide sequences of SEQ ID NO: 144; SEQ ID NO: 146; and SEQ ID NO: 148 which correspond to the complementarity-determining regions (CDRs, or hypervariable regions) of the light chain sequence of SEQ ID NO: 141 or which contain the variable light chain sequence of SEQ ID NO: 142, or antibodies or fragments containing combinations of sequences which are at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical thereto.
  • the antibodies of the invention or fragments thereof comprise, or alternatively consist of, combinations of one or more of the exemplified variable heavy chain and variable light chain sequences, or the heavy chain and light chain sequences set forth above, or sequences that are at least 90%> or 95% identical thereto.
  • the invention further contemplates anti-PCSK9 antibodies and antibody fragments comprising one, two, three, or four of the polypeptide sequences of SEQ ID NO: 123; SEQ ID NO: 125; SEQ ID NO: 127; and SEQ ID NO: 129 which correspond to the framework regions (FRs or constant regions) of the heavy chain sequence of SEQ ID NO: 121 or the variable heavy chain sequence of SEQ ID NO: 122, and/or one, two, three, or four of the polypeptide sequences of SEQ ID NO: 143; SEQ ID NO: 145; SEQ ID NO: 147; and SEQ ID NO: 149 which correspond to the framework regions (FRs or constant regions) of the light chain sequence of SEQ ID NO: 141 or the variable light chain sequence of SEQ ID NO: 142, or combinations of these polypeptide sequences or sequences which are at least 80%, 90%, 95%, 96%, 97%, 98% or 99% identical therewith.
  • the antibodies and antibody fragments of the invention or fragments thereof comprise, or alternatively consist of, combinations of one or more of the FRs, CDRs, the variable heavy chain and variable light chain sequences, and the heavy chain and light chain sequences set forth above, including all of them or sequences which are at least 90%> or 95% identical thereto.
  • the anti-PCSK9 antibody fragments of the invention comprise, or alternatively consist of, the polypeptide sequence of SEQ ID NO: 121 or SEQ ID NO: 122 or polypeptides that are at least 90% or 95% identical thereto.
  • antibody fragments of the invention comprise, or alternatively consist of, the polypeptide sequence of SEQ ID NO: 141 or SEQ ID NO: 142 or polypeptides that are at least 90%, 95%, 96%, 97%, 98% or 99% identical thereto.
  • the antibody or antibody fragment having binding specificity to PCSK9 comprises, or alternatively consists of, one, two, or three of the polypeptide sequences of SEQ ID NO: 124; SEQ ID NO: 126; and SEQ ID NO: 128 which correspond to the complementarity-determining regions (CDRs, or hypervariable regions) of the heavy chain sequence of SEQ ID NO: 121 or the variable heavy chain sequence of SEQ ID NO: 122 or sequences that are at least 90%> or 95% identical thereto.
  • CDRs complementarity-determining regions
  • the antibody or antibody fragment having binding specificity to PCSK9 comprises, or alternatively consists of, one, two, or three of the polypeptide sequences of SEQ ID NO: 144; SEQ ID NO: 146; and SEQ ID NO: 148 which correspond to the complementarity-determining regions (CDRs, or hypervariable regions) of the light chain sequence of SEQ ID NO: 141 or the variable light chain sequence of SEQ ID NO: 142 or sequences that are at least 90% or 95% identical thereto.
  • CDRs complementarity-determining regions
  • the antibody or antibody fragment having binding specificity to PCSK9 comprises, or alternatively consists of, one, two, three, or four of the polypeptide sequences of SEQ ID NO: 123; SEQ ID NO: 125; SEQ ID NO: 127; and SEQ ID NO: 129 which correspond to the framework regions (FRs or constant regions) of the heavy chain sequence of SEQ ID NO: 121 or the variable heavy chain sequence of SEQ ID NO: 122 or sequences that are at least 90% or 95% identical thereto.
  • the subject antibody or antibody fragment having binding specificity to PCSK9 comprises, or alternatively consists of, one, two, three, or four of the polypeptide sequences of SEQ ID NO: 143; SEQ ID NO: 145; SEQ ID NO: 147; and SEQ ID NO: 149 which correspond to the framework regions (FRs or constant regions) of the light chain sequence of SEQ ID NO: 141 or the variable light chain sequence of SEQ ID NO: 142 or sequences that are at least 90% or 95% identical thereto.
  • fragments of the antibodies having binding specificity to PCSK9 comprise, or alternatively consist of, one, two, three or more, including all of the following antibody fragments: the variable heavy chain region of SEQ ID NO: 122; the variable light chain region of SEQ ID NO: 142; the complementarity-determining regions (SEQ ID NO: 124; SEQ ID NO: 126; and SEQ ID NO: 128) of the variable heavy chain region of SEQ ID NO: 122; and the complementarity-determining regions (SEQ ID NO: 144; SEQ ID NO: 146; and SEQ ID NO: 148) of the variable light chain region of SEQ ID NO: 142 or sequences that are at least 90%, 95%, 96%, 97%, 98% or 99% identical thereto.
  • fragments of the antibodies having binding specificity to PCSK9 comprise, or alternatively consist of, one, two, three or more, including all of the following antibody fragments: the variable heavy chain region of SEQ ID NO: 122; the variable light chain region of SEQ ID NO: 142; the framework regions (SEQ ID NO: 123; SEQ ID NO: 125; SEQ ID NO: 127; and SEQ ID NO: 129) of the variable heavy chain region of SEQ ID NO: 122; and the framework regions (SEQ ID NO: 143; SEQ ID NO: 145; SEQ ID NO: 147; and SEQ ID NO: 149) of the variable light chain region of SEQ ID NO: 142 or sequences that are at least 90% or 95% identical thereto.
  • the anti-PCSK9 antibody is Ab4, comprising, or alternatively consisting of, SEQ ID NO: 121 and SEQ ID NO: 141, or an antibody or antibody fragment comprising the CDRs of Ab4 and having at least one of the biological activities set forth herein or is an anti-PC SK9 antibody that competes with Ab4 in binding PCSK9, preferably one containing sequences that are at least 90%, 95%, 96%, 97%, 98% or 99% identical to that of Ab4 or an antibody that binds to the same or overlapping epitope(s) on PCSK9 as Ab4.
  • antibody fragments comprise, or alternatively consist of, Fab (fragment antigen binding) fragments having binding specificity for PCSK9.
  • the Fab fragment preferably includes the variable heavy chain sequence of SEQ ID NO: 122 and the variable light chain sequence of SEQ ID NO: 142 or sequences that are at least 90%>, 95%, 96%, 97%, 98% or 99% identical thereto.
  • This embodiment of the invention further includes Fabs containing additions, deletions, and variants of SEQ ID NO: 122 and/or SEQ ID NO: 142 which retain the binding specificity for PCSK9.
  • Fab fragments may be produced by enzymatic digestion (e.g., papain) of Ab4.
  • anti-PCSK9 antibodies such as Ab4 or Fab fragments thereof may be produced via expression in mammalian cells such as CHO, NSO or HEK 293 cells, fungal, insect, or microbial systems such as yeast cells (for example haploid or diploid yeast such as haploid or diploid Pichia) and other yeast strains.
  • Suitable Pichia species include, but are not limited to, Pichia pastoris.
  • the invention is further directed to polynucleotides encoding antibody polypeptides having binding specificity to PCSK9, including the heavy and/or light chains of Ab4 as well as fragments, variants, combinations of one or more of the FRs, CDRs, the variable heavy chain and variable light chain sequences, and the heavy chain and light chain sequences set forth above, including all of them or sequences which are at least 90% or 95% identical thereto.
  • Antibody Ab5 is further directed to polynucleotides encoding antibody polypeptides having binding specificity to PCSK9, including the heavy and/or light chains of Ab4 as well as fragments, variants, combinations of one or more of the FRs, CDRs, the variable heavy chain and variable light chain sequences, and the heavy chain and light chain sequences set forth above, including all of them or sequences which are at least 90% or 95% identical thereto.
  • the invention includes antibodies and antibody fragments having binding specificity to PCSK9 that possess a heavy chain sequence comprising the sequence set forth below:
  • the invention includes antibodies and antibody fragments having binding specificity to PCSK9 that contain a variable heavy chain sequence comprising the sequence set forth below:
  • the invention includes antibodies and antibody fragments having binding specificity to PCSK9 that possess the same epitopic specificity as Ab5 and which contain a constant heavy chain sequence comprising the sequence set forth below:
  • the invention includes antibodies and antibody fragments having binding specificity to PCSK9 that contain a light chain sequence comprising the sequence set forth below:
  • the invention includes antibodies and antibody fragments having binding specificity to PCSK9 that contain a variable light chain sequence comprising the sequence set forth below:
  • the invention includes antibodies and antibody fragments having binding specificity to PCSK9 that bind the same epitope as Ab5 which contain a constant light chain sequence comprising the sequence set forth below: RT V AAP S VFIFPPSDEQLKS GT AS V VCLLNNF YPRE AKVQ WKVDN ALQ S GNS QE S VTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO: 190).
  • the invention includes antibodies and antibody fragments having binding specificity to PCSK9 that contain one, two, or three of the polypeptide sequences of SEQ ID NO: 164; SEQ ID NO: 166; and SEQ ID NO: 168 which correspond to the complementarity-determining regions (CDRs, or hypervariable regions) of the heavy chain sequence of SEQ ID NO: 161 or which contain the variable heavy chain sequence of SEQ ID NO: 162, and/or which further contain one, two, or three of the polypeptide sequences of SEQ ID NO: 184; SEQ ID NO: 186; and SEQ ID NO: 188 which correspond to the complementarity-determining regions (CDRs, or hypervariable regions) of the light chain sequence of SEQ ID NO: 181 or which contain the variable light chain sequence of SEQ ID NO: 182, or antibodies or fragments containing combinations of sequences which are at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical thereto.
  • the antibodies of the invention or fragments thereof comprise, or alternatively consist of, combinations of one or more of the exemplified variable heavy chain and variable light chain sequences, or the heavy chain and light chain sequences set forth above, or sequences that are at least 90%> or 95% identical thereto.
  • the invention further contemplates anti-PCSK9 antibodies and antibody fragments comprising one, two, three, or four of the polypeptide sequences of SEQ ID NO: 163; SEQ ID NO: 165; SEQ ID NO: 167; and SEQ ID NO: 169 which correspond to the framework regions (FRs or constant regions) of the heavy chain sequence of SEQ ID NO: 161 or the variable heavy chain sequence of SEQ ID NO: 162, and/or one, two, three, or four of the polypeptide sequences of SEQ ID NO: 183; SEQ ID NO: 185; SEQ ID NO: 187; and SEQ ID NO: 189 which correspond to the framework regions (FRs or constant regions) of the light chain sequence of SEQ ID NO: 181 or the variable light chain sequence of SEQ ID NO: 182, or combinations of these polypeptide sequences or sequences which are at least 80%, 90%, 95%, 96%, 97%, 98% or 99% identical therewith.
  • the antibodies and antibody fragments of the invention or fragments thereof comprise, or alternatively consist of, combinations of one or more of the FRs, CDRs, the variable heavy chain and variable light chain sequences, and the heavy chain and light chain sequences set forth above, including all of them or sequences which are at least 90%> or 95% identical thereto.
  • the anti-PCSK9 antibody fragments of the invention comprise, or alternatively consist of, the polypeptide sequence of SEQ ID NO: 161 or SEQ ID NO: 162 or polypeptides that are at least 90% or 95% identical thereto.
  • antibody fragments of the invention comprise, or alternatively consist of, the polypeptide sequence of SEQ ID NO: 181 or SEQ ID NO: 182 or polypeptides that are at least 90%, 95%, 96%, 97%, 98% or 99% identical thereto.
  • the antibody or antibody fragment having binding specificity to PCSK9 comprises, or alternatively consists of, one, two, or three of the polypeptide sequences of SEQ ID NO: 164; SEQ ID NO: 166; and SEQ ID NO: 168 which correspond to the complementarity-determining regions (CDRs, or hypervariable regions) of the heavy chain sequence of SEQ ID NO: 161 or the variable heavy chain sequence of SEQ ID NO: 162 or sequences that are at least 90% or 95% identical thereto.
  • CDRs complementarity-determining regions
  • the antibody or antibody fragment having binding specificity to PCSK9 comprises, or alternatively consists of, one, two, or three of the polypeptide sequences of SEQ ID NO: 184; SEQ ID NO: 186; and SEQ ID NO: 188 which correspond to the complementarity-determining regions (CDRs, or hypervariable regions) of the light chain sequence of SEQ ID NO: 181 or the variable light chain sequence of SEQ ID NO: 182 or sequences that are at least 90% or 95% identical thereto.
  • CDRs complementarity-determining regions
  • the antibody or antibody fragment having binding specificity to PCSK9 comprises, or alternatively consists of, one, two, three, or four of the polypeptide sequences of SEQ ID NO: 163; SEQ ID NO: 165; SEQ ID NO: 167; and SEQ ID NO: 169 which correspond to the framework regions (FRs or constant regions) of the heavy chain sequence of SEQ ID NO: 161 or the variable heavy chain sequence of SEQ ID NO: 162 or sequences that are at least 90% or 95% identical thereto.
  • the subject antibody or antibody fragment having binding specificity to PCSK9 comprises, or alternatively consists of, one, two, three, or four of the polypeptide sequences of SEQ ID NO: 183; SEQ ID NO: 185; SEQ ID NO: 187; and SEQ ID NO: 189 which correspond to the framework regions (FRs or constant regions) of the light chain sequence of SEQ ID NO: 181 or the variable light chain sequence of SEQ ID NO: 182 or sequences that are at least 90% or 95% identical thereto.
  • fragments of the antibodies having binding specificity to PCSK9 comprise, or alternatively consist of, one, two, three or more, including all of the following antibody fragments: the variable heavy chain region of SEQ ID NO: 162; the variable light chain region of SEQ ID NO: 182; the complementarity-determining regions (SEQ ID NO: 164; SEQ ID NO: 166; and SEQ ID NO: 168) of the variable heavy chain region of SEQ ID NO: 162; and the complementarity-determining regions (SEQ ID NO: 184; SEQ ID NO: 186; and SEQ ID NO: 188) of the variable light chain region of SEQ ID NO: 182 or sequences that are at least 90%, 95%, 96%, 97%, 98% or 99% identical thereto.
  • fragments of the antibodies having binding specificity to PCSK9 comprise, or alternatively consist of, one, two, three or more, including all of the following antibody fragments: the variable heavy chain region of SEQ ID NO: 162; the variable light chain region of SEQ ID NO: 182; the framework regions (SEQ ID NO: 163; SEQ ID NO: 165; SEQ ID NO: 167; and SEQ ID NO: 169) of the variable heavy chain region of SEQ ID NO: 162; and the framework regions (SEQ ID NO: 183; SEQ ID NO: 185; SEQ ID NO: 187; and SEQ ID NO: 189) of the variable light chain region of SEQ ID NO: 182 or sequences that are at least 90% or 95% identical thereto.
  • the anti-PCSK9 antibody is Ab5, comprising, or alternatively consisting of, SEQ ID NO: 161 and SEQ ID NO: 181, or an antibody or antibody fragment comprising the CDRs of Ab5 and having at least one of the biological activities set forth herein or is an anti-PC SK9 antibody that competes with Ab5 in binding PCSK9, preferably one containing sequences that are at least 90%, 95%, 96%, 97%, 98% or 99% identical to that of Ab5 or an antibody that binds to the same or overlapping epitope(s) on PCSK9 as Ab5.
  • antibody fragments comprise, or alternatively consist of, Fab (fragment antigen binding) fragments having binding specificity for PCSK9.
  • the Fab fragment preferably includes the variable heavy chain sequence of SEQ ID NO: 162 and the variable light chain sequence of SEQ ID NO: 182 or sequences that are at least 90%>, 95%, 96%, 97%, 98% or 99% identical thereto.
  • This embodiment of the invention further includes Fabs containing additions, deletions, and variants of SEQ ID NO: 162 and/or SEQ ID NO: 182 which retain the binding specificity for PCSK9.
  • Fab fragments may be produced by enzymatic digestion (e.g., papain) of Ab5.
  • anti-PCSK9 antibodies such as Ab5 or Fab fragments thereof may be produced via expression in mammalian cells such as CHO, NSO or HEK 293 cells, fungal, insect, or microbial systems such as yeast cells (for example haploid or diploid yeast such as haploid or diploid Pichia) and other yeast strains.
  • yeast cells for example haploid or diploid yeast such as haploid or diploid Pichia
  • Suitable Pichia species include, but are not limited to, Pichia pastoris.
  • the invention is further directed to polynucleotides encoding antibody polypeptides having binding specificity to PCSK9, including the heavy and/or light chains of Ab5 as well as fragments, variants, combinations of one or more of the FRs, CDRs, the variable heavy chain and variable light chain sequences, and the heavy chain and light chain sequences set forth above, including all of them or sequences which are at least 90% or 95% identical thereto.
  • the invention includes antibodies and antibody fragments having binding specificity to PCSK9 that possess a heavy chain sequence comprising the sequence set forth below:
  • SLSLSPGK (SEQ ID NO: 201).
  • the invention includes antibodies and antibody fragments having binding specificity to PCSK9 that contain a variable heavy chain sequence comprising the sequence set forth below:
  • the invention includes antibodies and antibody fragments having binding specificity to PCSK9 that possess the same epitopic specificity as Ab6 and which contain a constant heavy chain sequence comprising the sequence set forth below:
  • the invention includes antibodies and antibody fragments having binding specificity to PCSK9 that contain a light chain sequence comprising the sequence set forth below:
  • the invention includes antibodies and antibody fragments having binding specificity to PCSK9 that contain a variable light chain sequence comprising the sequence set forth below:
  • the invention includes antibodies and antibody fragments having binding specificity to PCSK9 that bind the same epitope as Ab6 which contain a constant light chain sequence comprising the sequence set forth below: RT V AAP S VFIFPPSDEQLKS GT AS V VCLLNNF YPRE AKVQ WKVDN ALQ S GNS QE S VTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO: 230).
  • the invention includes antibodies and antibody fragments having binding specificity to PCSK9 that contain one, two, or three of the polypeptide sequences of SEQ ID NO: 204; SEQ ID NO: 206; and SEQ ID NO: 208 which correspond to the complementarity-determining regions (CDRs, or hypervariable regions) of the heavy chain sequence of SEQ ID NO: 201 or which contain the variable heavy chain sequence of SEQ ID NO: 202, and/or which further contain one, two, or three of the polypeptide sequences of SEQ ID NO: 224; SEQ ID NO: 226; and SEQ ID NO: 228 which correspond to the complementarity-determining regions (CDRs, or hypervariable regions) of the light chain sequence of SEQ ID NO: 221 or which contain the variable light chain sequence of SEQ ID NO: 222, or antibodies or fragments containing combinations of sequences which are at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical thereto.
  • the antibodies of the invention or fragments thereof comprise, or alternatively consist of, combinations of one or more of the exemplified variable heavy chain and variable light chain sequences, or the heavy chain and light chain sequences set forth above, or sequences that are at least 90%> or 95% identical thereto.
  • the invention further contemplates anti-PCSK9 antibodies and antibody fragments comprising one, two, three, or four of the polypeptide sequences of SEQ ID NO: 203; SEQ ID NO: 205; SEQ ID NO: 207; and SEQ ID NO: 209 which correspond to the framework regions (FRs or constant regions) of the heavy chain sequence of SEQ ID NO: 201 or the variable heavy chain sequence of SEQ ID NO: 202, and/or one, two, three, or four of the polypeptide sequences of SEQ ID NO: 223; SEQ ID NO: 225; SEQ ID NO: 227; and SEQ ID NO: 229 which correspond to the framework regions (FRs or constant regions) of the light chain sequence of SEQ ID NO: 221 or the variable light chain sequence of SEQ ID NO: 222, or combinations of these polypeptide sequences or sequences which are at least 80%, 90%, 95%, 96%, 97%, 98% or 99% identical therewith.
  • the antibodies and antibody fragments of the invention or fragments thereof comprise, or alternatively consist of, combinations of one or more of the FRs, CDRs, the variable heavy chain and variable light chain sequences, and the heavy chain and light chain sequences set forth above, including all of them or sequences which are at least 90% or 95% identical thereto.
  • the anti-PCSK9 antibody fragments of the invention comprise, or alternatively consist of, the polypeptide sequence of SEQ ID NO: 201 or SEQ ID NO: 202 or polypeptides that are at least 90% or 95% identical thereto.
  • antibody fragments of the invention comprise, or alternatively consist of, the polypeptide sequence of SEQ ID NO: 221 or SEQ ID NO: 222 or polypeptides that are at least 90%, 95%, 96%, 97%, 98% or 99% identical thereto.
  • the antibody or antibody fragment having binding specificity to PCSK9 comprises, or alternatively consists of, one, two, or three of the polypeptide sequences of SEQ ID NO: 204; SEQ ID NO: 206; and SEQ ID NO: 208 which correspond to the complementarity-determining regions (CDRs, or hypervariable regions) of the heavy chain sequence of SEQ ID NO: 201 or the variable heavy chain sequence of SEQ ID NO: 202 or sequences that are at least 90%> or 95% identical thereto.
  • CDRs complementarity-determining regions
  • the antibody or antibody fragment having binding specificity to PCSK9 comprises, or alternatively consists of, one, two, or three of the polypeptide sequences of SEQ ID NO: 224; SEQ ID NO: 226; and SEQ ID NO: 228 which correspond to the complementarity-determining regions (CDRs, or hypervariable regions) of the light chain sequence of SEQ ID NO: 221 or the variable light chain sequence of SEQ ID NO: 222 or sequences that are at least 90% or 95% identical thereto.
  • CDRs complementarity-determining regions
  • the antibody or antibody fragment having binding specificity to PCSK9 comprises, or alternatively consists of, one, two, three, or four of the polypeptide sequences of SEQ ID NO: 203; SEQ ID NO: 205; SEQ ID NO: 207; and SEQ ID NO: 209 which correspond to the framework regions (FRs or constant regions) of the heavy chain sequence of SEQ ID NO: 201 or the variable heavy chain sequence of SEQ ID NO: 202 or sequences that are at least 90% or 95% identical thereto.
  • the subject antibody or antibody fragment having binding specificity to PCSK9 comprises, or alternatively consists of, one, two, three, or four of the polypeptide sequences of SEQ ID NO: 223; SEQ ID NO: 225; SEQ ID NO: 227; and SEQ ID NO: 229 which correspond to the framework regions (FRs or constant regions) of the light chain sequence of SEQ ID NO: 221 or the variable light chain sequence of SEQ ID NO: 222 or sequences that are at least 90% or 95% identical thereto.
  • fragments of the antibodies having binding specificity to PCSK9 comprise, or alternatively consist of, one, two, three or more, including all of the following antibody fragments: the variable heavy chain region of SEQ ID NO: 202; the variable light chain region of SEQ ID NO: 222; the complementarity-determining regions (SEQ ID NO: 204; SEQ ID NO: 206; and SEQ ID NO: 208) of the variable heavy chain region of SEQ ID NO: 202; and the complementarity-determining regions (SEQ ID NO: 224; SEQ ID NO: 226; and SEQ ID NO: 228) of the variable light chain region of SEQ ID NO: 222 or sequences that are at least 90%, 95%, 96%, 97%, 98% or 99% identical thereto.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Organic Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Hematology (AREA)
  • Diabetes (AREA)
  • Molecular Biology (AREA)
  • Obesity (AREA)
  • Biochemistry (AREA)
  • Urology & Nephrology (AREA)
  • Cardiology (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Epidemiology (AREA)
  • Microbiology (AREA)
  • Biomedical Technology (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Endocrinology (AREA)
  • Mycology (AREA)
  • Food Science & Technology (AREA)
  • General Physics & Mathematics (AREA)
  • Cell Biology (AREA)
  • Biotechnology (AREA)
  • Pathology (AREA)
  • Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • Vascular Medicine (AREA)
PCT/US2013/040112 2012-05-08 2013-05-08 Anti-pcsk9 antibodies and use thereof Ceased WO2013169886A1 (en)

Priority Applications (11)

Application Number Priority Date Filing Date Title
EP19218830.8A EP3753950A2 (en) 2012-05-08 2013-05-08 Anti-pcsk9 antibodies and use thereof
MX2014013612A MX2014013612A (es) 2012-05-08 2013-05-08 Anticuerpos anti-pcsk9 y uso de los mismos.
CN201380036215.2A CN104583237B (zh) 2012-05-08 2013-05-08 抗pcsk9抗体及其用途
EP13787331.1A EP2844673A4 (en) 2012-05-08 2013-05-08 ANTI-PCSK9 ANTIBODIES AND THEIR USE
CA2872777A CA2872777A1 (en) 2012-05-08 2013-05-08 Anti-pcsk9 antibodies and use thereof
AU2013259562A AU2013259562B2 (en) 2012-05-08 2013-05-08 Anti-PCSK9 antibodies and use thereof
SG11201407099WA SG11201407099WA (en) 2012-05-08 2013-05-08 Anti-pcsk9 antibodies and use thereof
NZ702304A NZ702304A (en) 2012-05-08 2013-05-08 Anti-pcsk9 antibodies and use thereof
KR1020147034039A KR102137291B1 (ko) 2012-05-08 2013-05-08 항-pcsk9 항체 및 그의 용도
JP2015511658A JP6386996B2 (ja) 2012-05-08 2013-05-08 抗pcsk9抗体およびその使用
IL235436A IL235436A0 (en) 2012-05-08 2014-10-30 Anti-pcsk9 preparations and their use

Applications Claiming Priority (6)

Application Number Priority Date Filing Date Title
US201261644065P 2012-05-08 2012-05-08
US61/644,065 2012-05-08
US201261654481P 2012-06-01 2012-06-01
US61/654,481 2012-06-01
US13/795,674 2013-03-12
US13/795,674 US9255154B2 (en) 2012-05-08 2013-03-12 Anti-PCSK9 antibodies and use thereof

Publications (2)

Publication Number Publication Date
WO2013169886A1 true WO2013169886A1 (en) 2013-11-14
WO2013169886A9 WO2013169886A9 (en) 2014-01-23

Family

ID=49548786

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2013/040112 Ceased WO2013169886A1 (en) 2012-05-08 2013-05-08 Anti-pcsk9 antibodies and use thereof

Country Status (14)

Country Link
US (3) US9255154B2 (https=)
EP (2) EP3753950A2 (https=)
JP (1) JP6386996B2 (https=)
KR (1) KR102137291B1 (https=)
CN (2) CN109796533A (https=)
AR (1) AR092005A1 (https=)
AU (1) AU2013259562B2 (https=)
CA (1) CA2872777A1 (https=)
IL (1) IL235436A0 (https=)
MX (1) MX2014013612A (https=)
NZ (2) NZ732652A (https=)
SG (1) SG11201407099WA (https=)
TW (1) TW201348260A (https=)
WO (1) WO2013169886A1 (https=)

Cited By (21)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8859741B2 (en) 2007-08-23 2014-10-14 Amgen Inc. Antigen binding proteins to proprotein convertase subtilisin kexin type 9 (PCSK9)
CN104447619A (zh) * 2014-10-24 2015-03-25 江南大学 一种氢氯噻嗪半抗原和完全抗原及其制备方法
WO2015092393A3 (en) * 2013-12-17 2015-09-11 Kymab Limited Ligands specifically binding to human targets of interest
CN106232627A (zh) * 2014-02-21 2016-12-14 免疫医疗有限责任公司 抗pcsk9~glp‑1融合体及其使用方法
JP2017506626A (ja) * 2014-02-14 2017-03-09 リジェネロン・ファーマシューティカルズ・インコーポレイテッドRegeneron Pharmaceuticals, Inc. 中程度用量スタチン療法により適切に管理されない高コレステロール血症を有する患者を処置するための方法
WO2017118307A1 (zh) 2016-01-05 2017-07-13 江苏恒瑞医药股份有限公司 Pcsk9抗体、其抗原结合片段及其医药用途
WO2018054240A1 (en) * 2016-09-20 2018-03-29 Wuxi Biologics (Shanghai) Co. Ltd. Novel anti-pcsk9 antibodies
WO2018189705A1 (en) 2017-04-13 2018-10-18 Cadila Healthcare Limited Novel peptide based pcsk9 vaccine
US10435477B2 (en) 2016-04-07 2019-10-08 Mab-Science (Hong Kong) Limited Proprotein convertase subtilisin kexin type 9 binding proteins and uses thereof
WO2020150473A2 (en) 2019-01-18 2020-07-23 Dogma Therapeutics, Inc. Pcsk9 inhibitors and methods of use thereof
US10752701B2 (en) 2011-07-28 2020-08-25 Regeneron Pharmaceuticals, Inc. Stabilized formulations containing anti-PCSK9 antibodies
US10772956B2 (en) 2015-08-18 2020-09-15 Regeneron Pharmaceuticals, Inc. Methods for reducing or eliminating the need for lipoprotein apheresis in patients with hyperlipidemia by administering alirocumab
US10793643B2 (en) 2015-12-31 2020-10-06 Jiangsu Hengrui Medicine Co., Ltd. PCSK9 antibody, antigen-binding fragment thereof, and medical application thereof
US10941210B2 (en) 2008-12-15 2021-03-09 Regeneron Pharmaceuticals, Inc. Anti-PCSK9 antibodies
US11028184B2 (en) 2016-06-08 2021-06-08 Changzhou Bojia Biotechnology Co., Ltd Long-acting PCSK9-specific binding protein and application thereof
US11116839B2 (en) 2011-09-16 2021-09-14 Regeneron Pharmaceuticals, Inc. Methods for reducing lipoprotein(a) levels by administering an inhibitor of proprotein convertase subtilisin kexin-9 (PCSK9)
US12083176B2 (en) 2011-01-28 2024-09-10 Sanofi Biotechnology Human antibodies to PCSK9 for use in methods of treating particular groups of subjects
US12534539B2 (en) 2011-05-10 2026-01-27 Amgen Inc. Methods of treating or preventing cholesterol related disorders
US12584120B2 (en) 2019-01-18 2026-03-24 Astrazeneca Ab PCSK9 inhibitors and methods of use thereof
US12606638B2 (en) 2013-11-12 2026-04-21 Sanofi Biotechnology Dosing regimens for use with PCSK9 inhibitors
US12612466B2 (en) 2023-04-28 2026-04-28 Regeneron Pharmaceuticals, Inc. Stabilized formulations containing anti-PCSK9 antibodies

Families Citing this family (45)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
ES2892925T3 (es) 2006-03-31 2022-02-07 Chugai Pharmaceutical Co Ltd Métodos para controlar la farmacocinética en sangre de anticuerpos
CN101874042B9 (zh) 2007-09-26 2019-01-01 中外制药株式会社 利用cdr的氨基酸取代来改变抗体等电点的方法
KR102057826B1 (ko) 2008-04-11 2019-12-20 추가이 세이야쿠 가부시키가이샤 복수 분자의 항원에 반복 결합하는 항원 결합 분자
TWI812066B (zh) 2010-11-30 2023-08-11 日商中外製藥股份有限公司 具有鈣依存性的抗原結合能力之抗體
US9255154B2 (en) 2012-05-08 2016-02-09 Alderbio Holdings, Llc Anti-PCSK9 antibodies and use thereof
EP3597747B1 (en) 2012-08-24 2023-03-15 Chugai Seiyaku Kabushiki Kaisha Mouse fcgammarii-specific fc antibody
TW202237660A (zh) 2012-08-24 2022-10-01 日商中外製藥股份有限公司 FcγRIIb特異性Fc區域變異體
AU2014250434B2 (en) 2013-04-02 2019-08-08 Chugai Seiyaku Kabushiki Kaisha Fc region variant
CA2940242C (en) 2014-02-20 2026-01-13 H. Lundbeck A/S Anti-acth antibodies and use thereof
AU2015289874A1 (en) * 2014-07-14 2017-02-02 Amgen Inc. Crystalline antibody formulations
WO2016054114A1 (en) 2014-09-29 2016-04-07 The Regents Of The University Of California Compositions for expanding regulatory t cells (treg), and treating autoimmune and inflammatory diseases and conditions
EP3835319B1 (en) * 2014-12-19 2025-11-19 H. Lundbeck A/S Humanized anti-acth antibodies and use thereof
KR101860280B1 (ko) 2014-12-19 2018-05-21 추가이 세이야쿠 가부시키가이샤 항-마이오스타틴 항체, 변이체 Fc 영역을 함유하는 폴리펩타이드, 및 사용 방법
CN114773470A (zh) 2015-02-05 2022-07-22 中外制药株式会社 包含离子浓度依赖性的抗原结合结构域的抗体,fc区变体,il-8-结合抗体及其应用
RU2022102472A (ru) 2015-03-13 2022-03-15 Эсперион Терапеутикс, Инк. Фиксированные комбинации и составы, содержащие etc-1002 и эзетимиб, и способы лечения или уменьшения риска развития сердечно-сосудистого заболевания
MA41793A (fr) 2015-03-16 2018-01-23 Esperion Therapeutics Inc Associations de doses fixes comprenant du etc1002 et une ou plusieurs statines permettant de traiter ou de réduire un risque cardiovasculaire
EP3973958A3 (en) 2015-03-20 2022-06-22 Aarhus Universitet Inhibitors of pcsk9 for treatment of lipoprotein metabolism disorders
CA2982861A1 (en) 2015-04-16 2016-10-20 Alder Biopharmaceuticals, Inc. Anti-pacap antibodies and uses thereof
EP3288584A2 (en) 2015-04-30 2018-03-07 President and Fellows of Harvard College Anti-ap2 antibodies and antigen binding agents to treat metabolic disorders
CN106589127A (zh) * 2015-10-16 2017-04-26 钜川生物医药 一种pcsk9抗体及其制备方法和应用
US11359009B2 (en) 2015-12-25 2022-06-14 Chugai Seiyaku Kabushiki Kaisha Anti-myostatin antibodies and methods of use
EP3426288A4 (en) * 2016-04-15 2019-10-30 Alder Biopharmaceuticals, Inc. ANTI-PACAP ANTIBODIES AND USES THEREOF
BR112018076703A2 (pt) * 2016-06-27 2019-04-02 President And Fellows Of Harvard College compostos úteis para tratar distúrbios metabólicos
TWI693940B (zh) 2016-08-05 2020-05-21 日商中外製藥股份有限公司 Il-8相關疾病之治療用或預防用組成物
CA3035875A1 (en) 2016-09-20 2018-03-29 Aarhus Universitet Compounds for treatment of lipoprotein metabolism disorders
WO2018148417A1 (en) * 2017-02-08 2018-08-16 Esperion Therapeutics, Inc. Triplet combination formulations and methods of treating or reducing the risk of cardiovascular disease
CA3066733A1 (en) 2017-06-09 2018-12-13 President And Fellows Of Harvard College Method to identify compounds useful to treat dysregulated lipogenesis, diabetes, and related disorders
CA3067835A1 (en) * 2017-06-22 2018-12-27 Apexigen, Inc. Anti-vista antibodies and methods of use
CN110799538B (zh) * 2017-08-28 2023-08-01 西雅图免疫公司 抗cd3抗体及其制备和使用方法
CN109897110B (zh) * 2017-12-08 2022-05-17 深圳华大生命科学研究院 纳米抗体及其制备方法
CA3115341A1 (en) 2018-05-16 2019-11-21 Lib Therapeutics, Llc Compositions comprising pcsk9-binding molecules and methods of use
EP3856242A4 (en) * 2018-09-25 2022-05-18 Academia Sinica ANTI-SIGLEC ANTIBODIES, PHARMACEUTICAL COMPOSITION THEREOF AND USES THEREOF
CN121253826A (zh) 2018-10-05 2026-01-02 西雅图儿童医院以西雅图儿童研究机构名义经营 针对原发性免疫缺陷、胱氨酸病和威尔逊病的新生儿筛查
GB201820687D0 (en) 2018-12-19 2019-01-30 Kymab Ltd Antagonists
EP3969620B1 (en) 2019-05-17 2025-06-25 Regeneron Pharmaceuticals, Inc. Genome-based methods for reducing cardiovascular risk
JP7692411B2 (ja) * 2019-11-07 2025-06-13 メディミューン,エルエルシー 心血管疾患の治療用の内皮リパーゼ抗体
BR112022009587A2 (pt) * 2019-11-18 2022-08-02 Ad Pharmaceuticals Co Ltd Anticorpo anti-pcsk9 e uso do mesmo
EP4126966A4 (en) 2020-03-31 2024-08-07 Seattle Children's Hospital d/b/a Seattle Children's Research Institute PROTEOMIC SCREENING FOR LYSOSOMAL STORAGE DISEASES
CN115298215A (zh) * 2020-04-02 2022-11-04 西雅图儿童医院以西雅图儿童研究机构名义经营 特异性地结合与原发性免疫缺陷:维斯科特-奥尔德里奇综合征和x连锁无丙种球蛋白血症相关的肽的抗体
KR20210158693A (ko) * 2020-06-24 2021-12-31 바이오스트림테크놀러지스(주) 항 pcsk9 항체 및 이의 용도
EP4548931A1 (en) * 2022-06-30 2025-05-07 AD Pharmaceuticals Co., Ltd. Anti-pcsk9 antibody preparation and use thereof
CN115960238A (zh) * 2022-12-26 2023-04-14 河南城建学院 一种能特异性结合pcsk9抗原的纳米抗体及其制备方法
CN119569860B (zh) * 2023-09-07 2025-11-18 菲鹏生物股份有限公司 一种抗p24抗体及其应用
CN120131991A (zh) * 2023-12-13 2025-06-13 成都百利多特生物药业有限责任公司 抗人Claudin18.2抗体-喜树碱类药物偶联物及其医药用途
CN118620078B (zh) * 2024-07-09 2024-11-19 武汉爱博泰克生物科技有限公司 抗人cd45ra蛋白的抗体、抗体偶联物及其应用

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20100166768A1 (en) 2008-12-15 2010-07-01 Regeneron Pharmaceuticals, Inc. High Affinity Human Antibodies to PCSK9

Family Cites Families (177)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20100291099A1 (en) 1999-09-27 2010-11-18 Millennium Pharmaceuticals, Inc. Novel 27411, 23413, 22438, 23553, 25278, 26212, narc sc1, narc 10a, narc 1, narc 12, narc 13, narc17, narc 25, narc 3, narc 4, narc 7, narc 8, narc 11, narc 14a, narc 15, narc 16, narc 19, narc 20, narc 26, narc 27, narc 28, narc 30, narc 5, narc 6, narc 9, narc 10c, narc 8b, narc 9, narc2a, narc 16b, narc 1c, narc 1a, narc 25, 86604 and 32222 molecules and uses therefor
US7029895B2 (en) 1999-09-27 2006-04-18 Millennium Pharmaceuticals, Inc. 27411, a novel human PGP synthase
US20110230392A1 (en) 1999-10-22 2011-09-22 Millennium Pharmaceuticals, Inc. Novel narc sc1, narc 10a, narc 1, narc 12, narc 13, narc17, narc 25, narc 3, narc 4, narc 7, narc 8, narc 11, narc 14a, narc 15, narc 16, narc 19, narc 20, narc 26, narc 27, narc 28, narc 30, narc 5, narc 6, narc 9, narc 10c, narc 8b, narc 9, narc2a, narc 16b, narc 1c, narc 1a, and narc 25 molecules and uses therefor
CA2399727A1 (en) 2000-02-07 2001-08-09 Millennium Pharmaceuticals, Inc. Narc-1, subtilase-like homologs
US20070173473A1 (en) 2001-05-18 2007-07-26 Sirna Therapeutics, Inc. RNA interference mediated inhibition of proprotein convertase subtilisin Kexin 9 (PCSK9) gene expression using short interfering nucleic acid (siNA)
EP2305812A3 (en) 2002-11-14 2012-06-06 Dharmacon, Inc. Fuctional and hyperfunctional sirna
EP1471152A1 (en) 2003-04-25 2004-10-27 Institut National De La Sante Et De La Recherche Medicale (Inserm) Mutations in the human PCSK9 gene associated to hypercholesterolemia
US20110313024A1 (en) 2004-08-20 2011-12-22 Leonid Beigelman RNA INTERFERENCE MEDIATED INHIBITION OF PROPROTEIN CONVERTASE SUBTILISIN KEXIN 9 (PCSK9) GENE EXPRESSION USING SHORT INTERFERING NUCLEIC ACID (siNA)
BRPI0610133A2 (pt) 2005-05-17 2010-06-01 Schering Corp heterociclos como agonistas de receptor de ácido nicotìnico para o tratamento de dislipidemia
US20090130691A1 (en) 2005-09-16 2009-05-21 Institut De Recherches Cliniques De Montreal Screening proteinase modulators using a chimeric protein and ski-i proprotein convertase substrates and inhibitors
EP2023940B1 (en) 2006-05-05 2011-06-22 Isis Pharmaceuticals, Inc. Compounds and methods for modulating expression of sglt2
EP2021467A4 (en) 2006-05-08 2010-01-20 Adaerata Ltd Partnership CHIMERIC PCSK9 PROTEINS, THESE INCLUDING CELLS AND TEST METHODS THEREWITH
ES2874149T3 (es) 2006-05-11 2021-11-04 Alnylam Pharmaceuticals Inc Composiciones y métodos para inhibir la expresión del gen PCSK9
US7572618B2 (en) 2006-06-30 2009-08-11 Bristol-Myers Squibb Company Polynucleotides encoding novel PCSK9 variants
EP3192788A1 (en) 2006-10-03 2017-07-19 Arbutus Biopharma Corporation Lipid containing formulations
ES2603379T3 (es) 2006-10-09 2017-02-27 Roche Innovation Center Copenhagen A/S Compuestos antagonistas de ARN para la modulación de PCSK9
US20100040611A1 (en) 2006-11-07 2010-02-18 Sparrow Carl P Antagonists of pcsk9
CA2667894A1 (en) 2006-11-07 2008-05-15 Merck & Co., Inc. Antagonists of pcsk9
WO2008133647A2 (en) 2006-11-07 2008-11-06 Merck & Co., Inc. Antagonists of pcsk9
WO2008057458A2 (en) 2006-11-07 2008-05-15 Merck & Co., Inc. Antagonists of pcsk9
EP2799547B1 (en) 2006-11-08 2016-12-21 Veritas Bio, LLC In Vivo Delivery of RNA to a Target Cell
US8093222B2 (en) 2006-11-27 2012-01-10 Isis Pharmaceuticals, Inc. Methods for treating hypercholesterolemia
US20100105134A1 (en) 2007-03-02 2010-04-29 Mdrna, Inc. Nucleic acid compounds for inhibiting gene expression and uses thereof
WO2008106982A2 (en) 2007-03-07 2008-09-12 Aarhus Universitet Pig model for atherosclerosis
WO2008109871A2 (en) 2007-03-08 2008-09-12 Irm Llc Crystal structure of proprotein convertase 9 (pcsk9) and uses thereof
EP2142217B1 (en) 2007-03-27 2014-11-05 Merck Sharp & Dohme Corp. Method for detecting autoprocessed, secreted pcsk9
US8343941B2 (en) 2007-03-30 2013-01-01 Rutgers, The State University Of New Jersey Compositions and methods for gene silencing
CN101679527A (zh) 2007-04-13 2010-03-24 诺瓦提斯公司 用于调节前蛋白转化酶枯草杆菌蛋白酶/kexin9型(pcsk9)的分子和方法
US20130072665A1 (en) 2007-08-23 2013-03-21 Simon Mark Jackson Antigen binding proteins to proprotein convertase subtilisin kexin type 9 (pcsk9)
JOP20080381B1 (ar) * 2007-08-23 2023-03-28 Amgen Inc بروتينات مرتبطة بمولدات مضادات تتفاعل مع بروبروتين كونفيرتاز سيتيليزين ككسين من النوع 9 (pcsk9)
WO2009027527A2 (en) 2007-08-30 2009-03-05 Santaris Pharma A/S Rna antagonist compounds for the modulation of fabp4/ap2
CA2603615A1 (en) 2007-09-21 2009-03-21 Patrick Labonte Methods of reducing viral infection and kits therefore
EP2205639B1 (en) 2007-10-26 2015-12-23 Merck Sharp & Dohme Corp. Anti-pcsk9 and methods for treating lipid and cholesterol disorders
WO2009082607A2 (en) 2007-12-04 2009-07-02 Alnylam Pharmaceuticals, Inc. Targeting lipids
EP2231194B1 (en) 2007-12-04 2017-02-22 Alnylam Pharmaceuticals Inc. Folate-irna conjugates
WO2009091815A2 (en) 2008-01-14 2009-07-23 President And Fellows Of Harvard College Methods for modulating de novo hepatic lipogenesis by modulating xbp-1 activity
MX2010008394A (es) 2008-01-31 2010-11-12 Alnylam Pharmaceuticals Inc Metodos optimizados para administracion de arndc focalizando el gen pcsk9.
AR070316A1 (es) 2008-02-07 2010-03-31 Merck & Co Inc Antagonistas de pcsk9 (proproteina subtilisina-kexina tipo 9)
AR070315A1 (es) 2008-02-07 2010-03-31 Merck & Co Inc Anticuerpos 1b20 antagonistas de pcsk9
US10131904B2 (en) 2008-02-11 2018-11-20 Rxi Pharmaceuticals Corporation Modified RNAi polynucleotides and uses thereof
US20100081632A1 (en) 2008-03-06 2010-04-01 Odyssey Thera, Inc. High-content and high throughput assays for identification of lipid-regulating pathways, and novel therapeutic agents for lipid disorders
WO2009114475A2 (en) 2008-03-09 2009-09-17 Intradigm Corporation Compositions comprising human pcsk9 and apolipoprotein b sirna and methods of use
US20110224280A1 (en) 2008-04-16 2011-09-15 Niels Fisker Nielsen Pharmaceutical Composition Comprising Anti PCSK9 Oligomers
US9994923B2 (en) 2008-04-23 2018-06-12 Amgen Inc. Neutralizing proprotein convertase subtilisin kexin type 9 (PCSK9) variants and uses thereof
US20090275053A1 (en) 2008-04-30 2009-11-05 Board Of Regents, The University Of Texas System Cell-based pcsk9 screening assay
US7928189B2 (en) 2008-05-05 2011-04-19 Ottawa Health Research Institute PCSK9 polypeptide fragment
WO2009143367A2 (en) 2008-05-22 2009-11-26 Schering Corporation Egf-a domain-mediated modulation of pcsk9
KR100985090B1 (ko) 2008-05-23 2010-10-04 한국과학기술연구원 크라이센 노출 여부 확인용 바이오마커 및 이를 이용한확인 방법
WO2009143633A1 (en) 2008-05-30 2009-12-03 Institut De Recherches Cliniques De Montreal Pcsk9 inhibitors and methods of use thereof
JP2011521992A (ja) 2008-06-06 2011-07-28 ニコックス エス エイ アトルバスタチン4−(ニトロキシ)ブチルエステルおよび脂質低下剤を含む組成物
US8206943B1 (en) 2008-06-30 2012-06-26 Schering Corporation Assay for PCSK9 inhibitors
US20110172292A1 (en) 2008-06-30 2011-07-14 Hansen Jens Bo Rode Antidote oligomers
RU2546291C2 (ru) 2008-08-14 2015-04-10 Нестек С.А. Композиции и способы воздействия на насыщение, липидный метаболизм и потребление жира
TWI516501B (zh) 2008-09-12 2016-01-11 禮納特神經系統科學公司 Pcsk9拮抗劑類
HUE037082T2 (hu) 2008-11-10 2018-08-28 Arbutus Biopharma Corp Új lipidek és készítmények terápiás hatóanyagok szállítására
WO2010054384A1 (en) 2008-11-10 2010-05-14 Alnylam Pharmaceuticals, Inc. Lipids and compositions for the delivery of therapeutics
US20100183598A1 (en) 2008-11-12 2010-07-22 Carolus Therapeutics, Inc. Methods of treating cardiovascular disorders
WO2010068526A1 (en) 2008-12-12 2010-06-17 Merck Sharp & Dohme Corp. Pcsk9 immunoassay
US20130064834A1 (en) 2008-12-15 2013-03-14 Regeneron Pharmaceuticals, Inc. Methods for treating hypercholesterolemia using antibodies to pcsk9
US8357371B2 (en) 2008-12-15 2013-01-22 Regeneron Pharmaceuticals, Inc. Methods for treating hypercholesterolemia using antibodies to PCSK9
US9493774B2 (en) 2009-01-05 2016-11-15 Rxi Pharmaceuticals Corporation Inhibition of PCSK9 through RNAi
EP3243504A1 (en) 2009-01-29 2017-11-15 Arbutus Biopharma Corporation Improved lipid formulation
US20120004289A1 (en) 2009-03-06 2012-01-05 The Johns Hopkins University Annexin a11 and associated genes as biomarkers for cancer
NZ624963A (en) 2009-04-29 2016-07-29 Amarin Pharmaceuticals Ie Ltd Pharmaceutical compositions comprising epa and a cardiovascular agent and methods of using the same
WO2010138555A2 (en) 2009-05-26 2010-12-02 University Of Florida Research Foundation, Inc. Small peptide expression system in mammalian cells
NZ597504A (en) 2009-06-15 2013-10-25 Alnylam Pharmaceuticals Inc Lipid formulated dsrna targeting the pcsk9 gene
WO2010147992A1 (en) 2009-06-15 2010-12-23 Alnylam Pharmaceuticals, Inc. Methods for increasing efficacy of lipid formulated sirna
WO2011005861A1 (en) 2009-07-07 2011-01-13 Alnylam Pharmaceuticals, Inc. Oligonucleotide end caps
US8927513B2 (en) 2009-07-07 2015-01-06 Alnylam Pharmaceuticals, Inc. 5′ phosphate mimics
US8563528B2 (en) 2009-07-21 2013-10-22 Santaris Pharma A/S Antisense oligomers targeting PCSK9
DK2470656T3 (da) 2009-08-27 2015-06-22 Idera Pharmaceuticals Inc Sammensætning til hæmning af genekspression og anvendelser heraf
PE20161551A1 (es) 2009-09-03 2017-01-18 Pfizer Vaccines Llc Vacuna de pcsk9
US9187746B2 (en) 2009-09-22 2015-11-17 Alnylam Pharmaceuticals, Inc. Dual targeting siRNA agents
US20120219558A1 (en) 2009-09-25 2012-08-30 Yan Ni Antagonists of pcsk9
US20120270929A1 (en) 2009-09-25 2012-10-25 Isis Pharmaceuticals, Inc. Modulation of ttc39 expression to increase hdl
BR112012007241A2 (pt) 2009-10-01 2019-09-24 Cadila Healthcare Ltd Soc Indiana compostos , composição farmacêutica, método para tratar desordens, uso dos compostos, medicamento, método para selecionar inibidores com pequenas moléculas de pcsk9 e pequenas moléculas
EP2488663A4 (en) 2009-10-16 2012-09-05 Genetics Invest Pty Ltd SENSITIVITY TO MACRONUTRIENT
WO2011053665A1 (en) 2009-10-30 2011-05-05 Merck Sharp & Dohme Corp. Pcsk9 immunoassay
CN102596249A (zh) 2009-10-30 2012-07-18 默沙东公司 Ax1和ax189 pcsk9拮抗剂和变体
WO2011053783A2 (en) 2009-10-30 2011-05-05 Merck Sharp & Dohme Corp. Ax213 and ax132 pcsk9 antagonists and variants
EP2494355A4 (en) 2009-10-30 2013-05-01 Merck Sharp & Dohme PCSK9 IMMUNOASSAY
US20110136241A1 (en) 2009-12-08 2011-06-09 Stephen Naylor Type ii diabetes molecular bioprofile and method and system of using the same
AR079336A1 (es) 2009-12-11 2012-01-18 Irm Llc Antagonistas de la pro-proteina convertasa-subtilisina/quexina tipo 9 (pcsk9)
JP2013515005A (ja) 2009-12-17 2013-05-02 ネイティビス, インコーポレイテッド 水性組成物および方法
CA2784568A1 (en) 2009-12-18 2011-06-23 The University Of British Columbia Lipid particles for delivery of nucleic acids
JO3274B1 (ar) 2009-12-24 2018-09-16 Regeneron Pharma أجسام مضادة بشرية للبروتين 4 المشابه لأجيوبيوتين البشري
SG183867A1 (en) 2010-03-11 2012-10-30 Rinat Neuroscience Corp ANTIBODIES WITH pH DEPENDENT ANTIGEN BINDING
EP2548029B1 (en) 2010-03-16 2014-06-04 BG Medicine, Inc. Methods for predicting cardiovascular events and monitoring treatment using pcsk9
GB201005005D0 (en) 2010-03-25 2010-05-12 Angeletti P Ist Richerche Bio New vaccine
WO2011123621A2 (en) 2010-04-01 2011-10-06 Alnylam Pharmaceuticals Inc. 2' and 5' modified monomers and oligonucleotides
EA022983B1 (ru) 2010-04-13 2016-04-29 Бристол-Майерс Сквибб Компани Белки на основе структурного домена фибронектина, связывающие pcsk9
US10913767B2 (en) 2010-04-22 2021-02-09 Alnylam Pharmaceuticals, Inc. Oligonucleotides comprising acyclic and abasic nucleosides and analogs
WO2011133871A2 (en) 2010-04-22 2011-10-27 Alnylam Pharmaceuticals, Inc. 5'-end derivatives
US9254327B2 (en) 2010-05-10 2016-02-09 Alnylam Pharmaceuticals, Inc. Methods and compositions for delivery of active agents
SG186085A1 (en) 2010-06-03 2013-01-30 Alnylam Pharmaceuticals Inc Biodegradable lipids for the delivery of active agents
CN102933559B (zh) 2010-06-04 2016-01-27 兴和株式会社 光学活性二苄胺衍生物及其制备方法
WO2012016188A2 (en) 2010-07-30 2012-02-02 Alnylam Pharmaceuticals, Inc. Methods and compositions for delivery of active agents
WO2012016184A2 (en) 2010-07-30 2012-02-02 Alnylam Pharmaceuticals, Inc. Methods and compositions for delivery of active agents
JP5875006B2 (ja) 2010-08-31 2016-03-02 国立大学法人大阪大学 オリゴヌクレオチド、およびオリゴヌクレオチドを有効成分として含有する脂質異常症治療剤
EP2627340A4 (en) 2010-10-12 2014-04-16 Univ Mcmaster METHOD FOR REGULATING PLASMA LIPOPROTEINS
WO2012054438A1 (en) 2010-10-22 2012-04-26 Schering Corporation Anti-pcsk9
WO2012058693A2 (en) 2010-10-29 2012-05-03 Alnylam Pharmaceuticals, Inc. Compositions and methods for inhibition of pcsk9 genes
US20120129715A1 (en) 2010-11-12 2012-05-24 Sidhu Sachdev S Gb1 peptidic libraries and methods of screening the same
JO3756B1 (ar) 2010-11-23 2021-01-31 Regeneron Pharma اجسام مضادة بشرية لمستقبلات الجلوكاجون
KR20130118925A (ko) 2010-12-22 2013-10-30 제넨테크, 인크. 항-pcsk9 항체 및 사용 방법
CA2824526C (en) 2011-01-11 2020-07-07 Alnylam Pharmaceuticals, Inc. Pegylated lipids and their use for drug delivery
PL3395836T3 (pl) 2011-01-28 2021-12-13 Sanofi Biotechnology Ludzkie przeciwciała przeciwko pcsk9 do zastosowania w sposobach leczenia konkretnych grup osobników
AU2012214251A1 (en) 2011-02-11 2013-09-12 Novartis Ag PCSK9 antagonists
US20140004142A1 (en) 2011-03-02 2014-01-02 Pfizer Inc. Pcsk9 vaccine
EP2681556A2 (en) 2011-03-04 2014-01-08 Merck Sharp & Dohme Corp. Cd16a reporter assay for evaluation of adcc potential of biologics
US20140011236A1 (en) 2011-03-22 2014-01-09 Merch Sharp & Dohme Corp. Promoters for high level recombinant expression in fungal host cells
EP2694655A4 (en) 2011-04-08 2015-01-14 Merck Sharp & Dohme pAVEC
AR088782A1 (es) 2011-04-29 2014-07-10 Sanofi Sa Sistemas de ensayo y metodos para identificar y caracterizar farmacos hipolipemiantes
US20140004122A1 (en) 2011-05-10 2014-01-02 Amgen Inc. Methods for treating or preventing cholesterol related disorders
JOP20200043A1 (ar) 2011-05-10 2017-06-16 Amgen Inc طرق معالجة أو منع الاضطرابات المختصة بالكوليسترول
AR087329A1 (es) 2011-06-17 2014-03-19 Regeneron Pharma Anticuerpos humanos contra proteina 3 de tipo angiopoietina humana
EP2721063A4 (en) 2011-06-20 2015-01-14 Hoffmann La Roche PCSK9 BINDING POLYPEPTIDES AND METHOD OF USE THEREOF
US20140275211A1 (en) 2011-06-21 2014-09-18 Alnylam Pharmaceuticals, Inc. Assays and methods for determining activity of a therapeutic agent in a subject
CN104093423A (zh) 2011-07-14 2014-10-08 辉瑞公司 使用抗pcsk9抗体的治疗
AR087305A1 (es) 2011-07-28 2014-03-12 Regeneron Pharma Formulaciones estabilizadas que contienen anticuerpos anti-pcsk9, metodo de preparacion y kit
RS54639B1 (sr) 2011-09-13 2016-08-31 Affiris Ag Pcsk9 vakcina
AR087715A1 (es) 2011-09-16 2014-04-09 Lilly Co Eli Anticuerpos anti pcsk9 y usos de los mismos
ES2992345T3 (es) 2011-09-16 2024-12-11 Regeneron Pharma Métodos para reducir los niveles de lipoproteína(a) mediante la administración de un inhibidor de la proproteína convertasa subtilisina kexina-9 (PCSK9)
ES2675035T3 (es) 2011-10-14 2018-07-05 Amgen, Inc Inyector y método de ensamblaje
WO2013056148A2 (en) 2011-10-15 2013-04-18 Genentech, Inc. Methods of using scd1 antagonists
US20140308304A1 (en) 2011-12-07 2014-10-16 Alnylam Pharmaceuticals, Inc. Lipids for the delivery of active agents
EP2788316B1 (en) 2011-12-07 2019-04-24 Alnylam Pharmaceuticals, Inc. Branched alkyl and cycloalkyl terminated biodegradable lipids for the delivery of active agents
WO2013091103A1 (en) 2011-12-20 2013-06-27 Adaerata, Limited Partnership Single domain antibodies as inhibitors of pcsk9
US10028926B2 (en) 2012-01-06 2018-07-24 Gemphire Therapeutics Inc. Methods of reducing risk of cardiovascular disease
AR089853A1 (es) 2012-02-01 2014-09-24 Boehringer Ingelheim Int Inhibidores de oxadiazol de la produccion de leucotrienos para terapia de combinacion, composicion farmaceutica, uso
AU2013221212B2 (en) 2012-02-17 2018-08-09 The Children's Hospital Of Philadelphia AAV vector compositions and methods for gene transfer to cells, organs and tissues
NZ628587A (en) 2012-03-06 2016-07-29 Boehringer Ingelheim Int Benzodioxanes in combination with other actives for inhibiting leukotriene production
JP2015515472A (ja) 2012-04-06 2015-05-28 ファイザー・インク ジアシルグリセロールアシルトランスフェラーゼ2阻害薬
US9255154B2 (en) 2012-05-08 2016-02-09 Alderbio Holdings, Llc Anti-PCSK9 antibodies and use thereof
EP2849788B1 (en) 2012-05-17 2018-01-03 Cyon Therapeutics Inc. Proprotein convertase subtilisin kexin 9 (pcsk9) inhibitors for use in treating sepsis and septic shock
ES2552371T3 (es) 2012-05-25 2015-11-27 Zora Biosciences Oy Biomarcadores sensibles, eficaces e inocuos, para la inhibición de la Proproteína Convertasa Subtilisina/Kexina de tipo 9 (PCSK9)
CA2874244A1 (en) 2012-05-25 2013-11-28 Catabasis Pharmaceuticals, Inc. Methods of lowering proprotein convertase subtilisin/kexin type 9 (pcsk9)
EP2669381A1 (en) 2012-05-30 2013-12-04 AmVac AG Method for expression of heterologous proteins using a recombinant negative-strand RNA virus vector comprising a mutated P protein
EP2861624A1 (en) 2012-06-15 2015-04-22 F. Hoffmann-La Roche AG Anti-pcsk9 antibodies, formulations, dosing, and methods of use
US20140194512A1 (en) 2012-06-17 2014-07-10 Matinas Biopharma, Inc. Compositions comprising docosapentaenoic acid and methods of use
WO2014004987A2 (en) 2012-06-30 2014-01-03 Hellstrom Harold R Short-term infarction-based test for investigative drugs
US20150190369A1 (en) 2012-07-03 2015-07-09 Majambu Mbikay Quercetin-3-glucoside and uses thereof
US9956291B2 (en) 2012-07-10 2018-05-01 Shaker A. Mousa Nanoformulation and methods of use of thyroid receptor beta1 agonists for liver targeting
HK1210953A1 (en) 2012-08-02 2016-05-13 Stealth Peptides International, Inc. Methods for treatment of atherosclerosis
TWI596115B (zh) 2012-08-13 2017-08-21 再生元醫藥公司 具有pH-依賴性結合特性之抗-PCSK9抗體
WO2014028946A2 (en) 2012-08-17 2014-02-20 The Broad Institute, Inc. Modulators of hepatic lipoprotein metabolism
US20140324460A1 (en) 2012-09-26 2014-10-30 Health Diagnostic Laboratory, Inc. Method for determining and managing total cardiodiabetes risk
AR092924A1 (es) 2012-10-09 2015-05-06 Sanofi Sa Derivados de pirrolidinona como moduladores de gpr119 para el tratamiento de diabetes, obesidad, dislipidemia y trastornos relacionados
UA116217C2 (uk) 2012-10-09 2018-02-26 Санофі Пептидна сполука як подвійний агоніст рецепторів glp1-1 та глюкагону
US20140120091A1 (en) 2012-10-31 2014-05-01 University Of Washington Through Its Center For Commercialization Fusion proteins for therapy of autoimmune and cardiovascular disease
WO2014089212A1 (en) 2012-12-05 2014-06-12 Sangamo Biosciences, Inc. Methods and compositions for regulation of metabolic disorders
HK1211232A1 (en) 2012-12-21 2016-05-20 Sanofi Exendin-4 derivatives as dual glp1/gip or trigonal glp1/gip/glucagon agonists
HK1213194A1 (zh) 2013-03-14 2016-06-30 Daiichi Sankyo Co., Ltd. 用於新型的结合蛋白质pcsk9
WO2014145744A1 (en) 2013-03-15 2014-09-18 Alder Biopharmaceuticals, Inc. Antibody purification and purity monitoring
US10202630B2 (en) 2013-03-15 2019-02-12 Alderbio Holdings Llc Temperature shift for high yield expression of polypeptides in yeast and other transformed cells
US8980864B2 (en) 2013-03-15 2015-03-17 Moderna Therapeutics, Inc. Compositions and methods of altering cholesterol levels
EP2972330A4 (en) 2013-03-15 2016-10-26 Alder Biopharmaceuticals Inc PROTOCOL FOR THE IDENTIFICATION AND ISOLATION OF ANTIGEN-SPECIFIC B-CELLS AND FOR THE PREPARATION OF ANTIBODIES FOR DESIRED ANTIGENES
MX2015014666A (es) 2013-04-17 2016-03-01 Pfizer Derivados de n-piperidin-3-ilbenzamida para tratar enfermedades cardiovasculares.
TWI682780B (zh) 2013-05-30 2020-01-21 美商再生元醫藥公司 醫藥組成物用於製造治療與pcsk9功能獲得性突變有關之體染色體顯性高膽固醇血症的藥物之用途
US10111953B2 (en) 2013-05-30 2018-10-30 Regeneron Pharmaceuticals, Inc. Methods for reducing remnant cholesterol and other lipoprotein fractions by administering an inhibitor of proprotein convertase subtilisin kexin-9 (PCSK9)
US20150004174A1 (en) 2013-06-28 2015-01-01 Amgen Inc. Methods for treating homozygous familial hypercholesterolemia
KR20240090694A (ko) 2013-07-22 2024-06-21 더 칠드런스 호스피탈 오브 필라델피아 변종 aav 및 조성물, 세포, 기관 및 조직으로의 유전자 전이를 위한 방법 및 용도
US20150037816A1 (en) 2013-08-01 2015-02-05 Atherotech, Inc. PCSK9 Function Assay
KR20220048051A (ko) 2013-10-11 2022-04-19 사노피 바이오테크놀로지 고지혈증을 치료하기 위한 pcsk9 억제제의 용도
MX2016006226A (es) 2013-11-12 2016-09-07 Sanofi Biotechnology Regimenes de dosificacion para uso con inhibidores de pcsk9.
HK1224186A1 (zh) 2013-11-20 2017-08-18 Cymabay Therapeutics, Inc. 纯阖家族型高胆固醇血症的治疗
WO2015086728A1 (en) 2013-12-13 2015-06-18 Sanofi Exendin-4 peptide analogues as dual glp-1/gip receptor agonists
WO2015086732A1 (en) 2013-12-13 2015-06-18 Sanofi Exendin-4 peptide analogues
WO2015086733A1 (en) 2013-12-13 2015-06-18 Sanofi Dual glp-1/glucagon receptor agonists
TW201609799A (zh) 2013-12-13 2016-03-16 賽諾菲公司 雙重glp-1/gip受體促效劑
EP3080152A1 (en) 2013-12-13 2016-10-19 Sanofi Non-acylated exendin-4 peptide analogues
US9023359B1 (en) 2014-07-15 2015-05-05 Kymab Limited Targeting rare human PCSK9 variants for cholesterol treatment
US9034332B1 (en) 2014-07-15 2015-05-19 Kymab Limited Precision medicine by targeting rare human PCSK9 variants for cholesterol treatment
US8883157B1 (en) 2013-12-17 2014-11-11 Kymab Limited Targeting rare human PCSK9 variants for cholesterol treatment
US9045548B1 (en) 2014-07-15 2015-06-02 Kymab Limited Precision Medicine by targeting rare human PCSK9 variants for cholesterol treatment
US9051378B1 (en) 2014-07-15 2015-06-09 Kymab Limited Targeting rare human PCSK9 variants for cholesterol treatment
CN106029096A (zh) 2014-02-14 2016-10-12 瑞泽恩制药公司 用于治疗具有未被中等剂量他汀疗法充分控制的高胆固醇血症的患者的方法

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20100166768A1 (en) 2008-12-15 2010-07-01 Regeneron Pharmaceuticals, Inc. High Affinity Human Antibodies to PCSK9

Non-Patent Citations (21)

* Cited by examiner, † Cited by third party
Title
BENJANNET ET AL., J. BIO. CHERN., vol. 279, 2004, pages 48865 - 75
CHAPARRO-RIGGERS ET AL.: "increasing serum half-life and extending cholesterol lowering in vivo by engineering antibody with pH-sensitive binding to PCSK9", JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 287, no. 14, 30 March 2012 (2012-03-30), pages 11090 - 11097
CHAPARRO-RIGGERS, JAVIER. ET AL.: "Increasing serum half-life and extending cholesterol lowering in vivo by engineering antibody with pH-sensitive bindi ng to PCSK9", JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 287, no. 14, 30 March 2012 (2012-03-30), pages 11090 - 11097, XP002684539 *
CHILEWSKI ET AL.: "validation of preclinical pharmacokinetic and immunogeneticity assays for an anti-PCSK9 antibody", JOURNAL OF IMMUNOASSAY AND IMMUNOHISTOCHEMISTRY, vol. 32, no. 4, 2011, pages 296 - 317, XP002749070, DOI: doi:10.1080/15321819.2011.569046
DIAS ET AL.: "a phase I, randomized, double-blind, placebo-controlled, ascending single dose study to evaluate the safety, tolerability and pharmacodynamics of AMG145", CIRCULATION, vol. 124, no. 21, November 2011 (2011-11-01)
HORTON ET AL., TRENDS BIOCHEM. SCI., vol. 32, no. 2, 2007, pages 71 - 77
LAGACE ET AL., J. CLIN. INVEST., vol. 116, no. 11, 2006, pages 2995 - 3005
LIANG ET AL.: "proprotein convertase substilisin/kexin type 9 antagonism reduces low-density lipoprotein cholesterol in statin-treated hypercholesterolemic nonhuman primates", THE JOURNAL OF PHARMACOLOGY AND EXPERIMENTAL THERAPEUTICS, vol. 340, no. 2, 21 October 2011 (2011-10-21), pages 228 - 235
LIANG, HONG. ET AL.: "Proprotein convertase substilisin/kexin type 9 antagonism reduces low-density lipoprotein cholesterol in statin-treated hypercholesterolemic nonhuman primates", THE JOURNAL OF PHARMACOLOGY AND EXPERIMENTAL THERAPEUTICS, vol. 340, no. 2, 21 October 2011 (2011-10-21), pages 228 - 235, XP009166142 *
MAXWELL ET AL., PROC. NAT. ACAD. SCI., vol. 102, no. 6, 2005, pages 2069 - 74
MAXWELL ET AL., PROC. NAT'L ACAD. SCI., vol. 102, no. 6, 2005, pages 2069 - 74
NI ET AL.: "a PCSK9-binding antibody that structurally mimics the EG F(A) domain of LDL-receptor reduces LDL cholesterol in vivo", JOURNAL OF LIPID RESEARCH, vol. 52, no. 1, 19 October 2010 (2010-10-19), pages 78 - 86, XP002686538, DOI: doi:10.1194/jlr.m011445
NI, YAN G. ET AL.: "A PCSK9-binding antibody that structurally mimics the EG F(A) domain of LDL-receptor reduces LDL cholesterol in vivo", JOURNAL OF LIPID RESEARCH, vol. 52, no. 1, 19 October 2010 (2010-10-19), pages 78 - 86, XP002686538 *
PARK ET AL., J. BIOL. CHEM., vol. 279, 2004, pages 50630 - 38
PARK ET AL., J. BIOL. CHERN., vol. 279, 2004, pages 50630 - 38
RASHID ET AL., PROC. NAT'L ACAD. SCI., vol. 102, no. 15, 2005, pages 5374 - 79
See also references of EP2844673A4
SEIDAH; PRAT, J. MOL. MED., vol. 85, no. 7, 2007, pages 685 - 96
SWERGOLD ET AL.: "safety, lipid, and lipoprotein effects of REGN727/SAR236553, a fully-human proprotein convertase subtilisin kexin 9 (PCSK9) monoclonal antibody administered intravenously to healthy volunteers", CIRCULATION, vol. 122, no. 21, 1 November 2010 (2010-11-01)
ZHANG ET AL.: "that an anti-PCSK9 antibody reduces LDL-cholesterol on top of a statin and suppresses hepatocyte SREBP-regulated genes", INTERNATIONAL JOURNAL OF BIOLOGICAL SCIENCES, vol. 8, no. 3, 9 February 2012 (2012-02-09), pages 310 - 327, XP055079135, DOI: doi:10.7150/ijbs.3524
ZHANG, LIWEN. ET AL.: "An anti-PCSK9 antibody reduces LDL-cholesterol on top Of a statin and suppresses hepatocyte SREBP-regulated genes", INTERNATIONAL JOURNAL OF BIOLOGICAL SCIENCES, vol. 8, no. 3, 9 February 2012 (2012-02-09), pages 310 - 327, XP055079135 *

Cited By (36)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9056915B2 (en) 2007-08-23 2015-06-16 Amgen Inc. Antigen binding proteins to proprotein convertase subtilisin kexin type 9 (PCSK9)
US9493576B2 (en) 2007-08-23 2016-11-15 Amgen Inc. Antigen binding proteins to proprotein convertase subtilisin kexin type 9 (PCSK9)
US8871913B2 (en) 2007-08-23 2014-10-28 Amgen Inc. Antigen binding proteins to proprotein convertase subtilisin kexin type 9 (PCSK9)
US8859741B2 (en) 2007-08-23 2014-10-14 Amgen Inc. Antigen binding proteins to proprotein convertase subtilisin kexin type 9 (PCSK9)
US8889834B2 (en) 2007-08-23 2014-11-18 Amgen Inc. Antigen binding proteins to proprotein convertase subtilisin kexin type 9 (PCSK9)
US8981064B2 (en) 2007-08-23 2015-03-17 Amgen Inc. Antigen binding proteins to proprotein convertase subtilisin kexin type 9 (PCSK9)
US9920134B2 (en) 2007-08-23 2018-03-20 Amgen Inc. Monoclonal antibodies to proprotein convertase subtilisin kexin type 9 (PCSK9)
US9045547B2 (en) 2007-08-23 2015-06-02 Amgen Inc. Methods of using antigen binding proteins to proprotein convertase subtilisin kexin type 9 (PCSK9)
US8871914B2 (en) 2007-08-23 2014-10-28 Amgen, Inc. Antigen binding proteins to proprotein convertase subtilisin kexin type 9 (PCSK9)
US8883983B2 (en) 2007-08-23 2014-11-11 Amgen Inc. Antigen binding proteins to proprotein convertase subtilisin kexin type 9 (PCSK9)
US12269897B2 (en) 2008-12-15 2025-04-08 Regeneron Pharmaceuticals, Inc. Anti-PCSK9 antibodies
US10941210B2 (en) 2008-12-15 2021-03-09 Regeneron Pharmaceuticals, Inc. Anti-PCSK9 antibodies
US12083176B2 (en) 2011-01-28 2024-09-10 Sanofi Biotechnology Human antibodies to PCSK9 for use in methods of treating particular groups of subjects
US12534539B2 (en) 2011-05-10 2026-01-27 Amgen Inc. Methods of treating or preventing cholesterol related disorders
US10752701B2 (en) 2011-07-28 2020-08-25 Regeneron Pharmaceuticals, Inc. Stabilized formulations containing anti-PCSK9 antibodies
US11673967B2 (en) 2011-07-28 2023-06-13 Regeneron Pharmaceuticals, Inc. Stabilized formulations containing anti-PCSK9 antibodies
US11116839B2 (en) 2011-09-16 2021-09-14 Regeneron Pharmaceuticals, Inc. Methods for reducing lipoprotein(a) levels by administering an inhibitor of proprotein convertase subtilisin kexin-9 (PCSK9)
US12612465B2 (en) 2013-05-02 2026-04-28 Amgen Inc. Formulations comprising PCSK9 specific monoclonal antibodies
US12606638B2 (en) 2013-11-12 2026-04-21 Sanofi Biotechnology Dosing regimens for use with PCSK9 inhibitors
WO2015092393A3 (en) * 2013-12-17 2015-09-11 Kymab Limited Ligands specifically binding to human targets of interest
JP2017506626A (ja) * 2014-02-14 2017-03-09 リジェネロン・ファーマシューティカルズ・インコーポレイテッドRegeneron Pharmaceuticals, Inc. 中程度用量スタチン療法により適切に管理されない高コレステロール血症を有する患者を処置するための方法
CN106232627A (zh) * 2014-02-21 2016-12-14 免疫医疗有限责任公司 抗pcsk9~glp‑1融合体及其使用方法
CN104447619A (zh) * 2014-10-24 2015-03-25 江南大学 一种氢氯噻嗪半抗原和完全抗原及其制备方法
US11904017B2 (en) 2015-08-18 2024-02-20 Regeneron Pharmaceuticals, Inc. Methods for reducing or eliminating the need for lipoprotein apheresis in patients with hyperlipidemia by administering alirocumab
US10772956B2 (en) 2015-08-18 2020-09-15 Regeneron Pharmaceuticals, Inc. Methods for reducing or eliminating the need for lipoprotein apheresis in patients with hyperlipidemia by administering alirocumab
US10793643B2 (en) 2015-12-31 2020-10-06 Jiangsu Hengrui Medicine Co., Ltd. PCSK9 antibody, antigen-binding fragment thereof, and medical application thereof
WO2017118307A1 (zh) 2016-01-05 2017-07-13 江苏恒瑞医药股份有限公司 Pcsk9抗体、其抗原结合片段及其医药用途
US10435477B2 (en) 2016-04-07 2019-10-08 Mab-Science (Hong Kong) Limited Proprotein convertase subtilisin kexin type 9 binding proteins and uses thereof
US11028184B2 (en) 2016-06-08 2021-06-08 Changzhou Bojia Biotechnology Co., Ltd Long-acting PCSK9-specific binding protein and application thereof
WO2018054240A1 (en) * 2016-09-20 2018-03-29 Wuxi Biologics (Shanghai) Co. Ltd. Novel anti-pcsk9 antibodies
WO2018189705A1 (en) 2017-04-13 2018-10-18 Cadila Healthcare Limited Novel peptide based pcsk9 vaccine
EP4470609A2 (en) 2019-01-18 2024-12-04 Astrazeneca AB Pcsk9 inhibitors and methods of use thereof
US12584120B2 (en) 2019-01-18 2026-03-24 Astrazeneca Ab PCSK9 inhibitors and methods of use thereof
US12552807B2 (en) 2019-01-18 2026-02-17 Astrazeneca Ab PCSK9 inhibitors and methods of use thereof
WO2020150473A2 (en) 2019-01-18 2020-07-23 Dogma Therapeutics, Inc. Pcsk9 inhibitors and methods of use thereof
US12612466B2 (en) 2023-04-28 2026-04-28 Regeneron Pharmaceuticals, Inc. Stabilized formulations containing anti-PCSK9 antibodies

Also Published As

Publication number Publication date
KR20150006471A (ko) 2015-01-16
EP2844673A4 (en) 2016-04-20
US10259885B2 (en) 2019-04-16
EP3753950A2 (en) 2020-12-23
US20160194408A1 (en) 2016-07-07
CA2872777A1 (en) 2013-11-14
NZ732652A (en) 2018-10-26
SG11201407099WA (en) 2014-11-27
US9255154B2 (en) 2016-02-09
IL235436A0 (en) 2014-12-31
JP2015519050A (ja) 2015-07-09
TW201348260A (zh) 2013-12-01
MX2014013612A (es) 2015-10-26
CN109796533A (zh) 2019-05-24
NZ702304A (en) 2017-09-29
US20130302399A1 (en) 2013-11-14
JP6386996B2 (ja) 2018-09-05
AU2013259562B2 (en) 2018-05-10
CN104583237B (zh) 2018-12-25
US20190389968A1 (en) 2019-12-26
CN104583237A (zh) 2015-04-29
WO2013169886A9 (en) 2014-01-23
AU2013259562A1 (en) 2014-11-27
KR102137291B1 (ko) 2020-07-23
AR092005A1 (es) 2015-03-18
EP2844673A1 (en) 2015-03-11

Similar Documents

Publication Publication Date Title
US10259885B2 (en) Anti-PCSK9 antibodies and use thereof
AU2019202643B2 (en) Use of anti-CGRP or anti-CGRP-R antibodies or antibody fragments to treat or prevent chronic and acute forms of diarrhea
EP2646468B1 (en) Anti-ngf compositions and use thereof
US9884909B2 (en) Anti-NGF compositions and use thereof
US10457727B2 (en) Methods of preventing inflammation and treating pain using anti-NGF compositions
EA034747B1 (ru) Способ предотвращения или ингибирования светобоязни или отвращения к свету с использованием антител против cgrp
US10221236B2 (en) Anti-NGF antibodies that selectively inhibit the association of NGF with TRKA without affecting the association of NGF with P75
HK40009057A (en) Anti-pcsk9 antibodies and use thereof

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 13787331

Country of ref document: EP

Kind code of ref document: A1

DPE1 Request for preliminary examination filed after expiration of 19th month from priority date (pct application filed from 20040101)
ENP Entry into the national phase

Ref document number: 2872777

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2015511658

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: MX/A/2014/013612

Country of ref document: MX

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2013259562

Country of ref document: AU

Date of ref document: 20130508

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2013787331

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 20147034039

Country of ref document: KR

Kind code of ref document: A