WO2013041962A1 - Protein-based therapy and diagnosis of tau-mediated pathology in alzheimer's disease - Google Patents

Protein-based therapy and diagnosis of tau-mediated pathology in alzheimer's disease Download PDF

Info

Publication number
WO2013041962A1
WO2013041962A1 PCT/IB2012/002246 IB2012002246W WO2013041962A1 WO 2013041962 A1 WO2013041962 A1 WO 2013041962A1 IB 2012002246 W IB2012002246 W IB 2012002246W WO 2013041962 A1 WO2013041962 A1 WO 2013041962A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
tau
antibody
peptide
subject
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/IB2012/002246
Other languages
English (en)
French (fr)
Inventor
Michal NOVÄK
Eva KONTSEKOVÄ
Branislav KOVÁCECH
Norbert ZILKA
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Axon Neuroscience SE
Original Assignee
Axon Neuroscience SE
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=47216372&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=WO2013041962(A1) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Priority to DK12788639.8T priority Critical patent/DK2758433T3/en
Priority to KR1020147010525A priority patent/KR102130439B1/ko
Priority to EP12788639.8A priority patent/EP2758433B1/en
Priority to KR1020217024024A priority patent/KR20210099167A/ko
Priority to HK14112922.2A priority patent/HK1199459B/xx
Priority to AU2012311234A priority patent/AU2012311234B2/en
Priority to HRP20180083TT priority patent/HRP20180083T8/hr
Priority to US14/345,561 priority patent/US9518101B2/en
Priority to SI201231187T priority patent/SI2758433T1/en
Priority to JP2014530333A priority patent/JP6253583B2/ja
Priority to MYPI2014000803A priority patent/MY183989A/en
Priority to BR112014006376-1A priority patent/BR112014006376B1/pt
Priority to RS20180054A priority patent/RS56852B1/sr
Priority to KR1020207018712A priority patent/KR102285743B1/ko
Priority to LTEP12788639.8T priority patent/LT2758433T/lt
Priority to MX2014003357A priority patent/MX347505B/es
Priority to MX2017005573A priority patent/MX391157B/es
Priority to CN201810662577.7A priority patent/CN109265543B/zh
Priority to MEP-2018-18A priority patent/ME03008B/me
Priority to CN202210373330.XA priority patent/CN115417916B/zh
Priority to UAA201404170A priority patent/UA115657C2/uk
Priority to ES12788639.8T priority patent/ES2656442T3/es
Application filed by Axon Neuroscience SE filed Critical Axon Neuroscience SE
Priority to CN201280056856.XA priority patent/CN104185640B/zh
Priority to SG11201400125RA priority patent/SG11201400125RA/en
Priority to RU2014115481A priority patent/RU2645259C2/ru
Priority to CA2848346A priority patent/CA2848346A1/en
Priority to PL12788639T priority patent/PL2758433T3/pl
Priority to SM20180109T priority patent/SMT201800109T1/it
Publication of WO2013041962A1 publication Critical patent/WO2013041962A1/en
Priority to ZA2014/01333A priority patent/ZA201401333B/en
Priority to IL231201A priority patent/IL231201B/en
Anticipated expiration legal-status Critical
Priority to US15/342,629 priority patent/US9828421B2/en
Priority to US15/599,685 priority patent/US9845352B2/en
Priority to US15/801,341 priority patent/US11098106B2/en
Priority to AU2017272259A priority patent/AU2017272259B2/en
Priority to CY20181100058T priority patent/CY1119792T1/el
Priority to IL259775A priority patent/IL259775B/en
Priority to AU2020200624A priority patent/AU2020200624B2/en
Priority to IL274440A priority patent/IL274440B/en
Priority to US17/443,779 priority patent/US12404322B2/en
Priority to IL287794A priority patent/IL287794A/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/1703Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • A61K38/1709Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0007Nervous system antigens; Prions
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6843Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a material from animals or humans
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6849Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K49/00Preparations for testing in vivo
    • A61K49/0004Screening or testing of compounds for diagnosis of disorders, assessment of conditions, e.g. renal clearance, gastric emptying, testing for diabetes, allergy, rheuma, pancreas functions
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/02Drugs for disorders of the nervous system for peripheral neuropathies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/28Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4711Alzheimer's disease; Amyloid plaque core protein
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6893Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids related to diseases not provided for elsewhere
    • G01N33/6896Neurological disorders, e.g. Alzheimer's disease
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55505Inorganic adjuvants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511Organic adjuvants
    • A61K2039/55566Emulsions, e.g. Freund's adjuvant, MF59
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/60Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
    • A61K2039/6031Proteins
    • A61K2039/6081Albumin; Keyhole limpet haemocyanin [KLH]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/54F(ab')2
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/55Fab or Fab'
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00Detection or diagnosis of diseases
    • G01N2800/28Neurological disorders
    • G01N2800/2814Dementia; Cognitive disorders
    • G01N2800/2821Alzheimer
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00Detection or diagnosis of diseases
    • G01N2800/52Predicting or monitoring the response to treatment, e.g. for selection of therapy based on assay results in personalised medicine; Prognosis

Definitions

  • SEQUENCE_LISTING.txt is 155,400 bytes in size.
  • the present invention features protein-based (e.g., antibodies, peptides) methods and means for interfering with the production and clearance of certain forms of tau that are involved in the promotion and/or development of pathological tau-tau aggregates in Alzheimer's disease, as well as methods for producing anti-tau antibodies that are useful for diagnosis and treatment of
  • the invention further concerns methods and means for diagnosing Alzheimer's disease, including methods for staging and evaluating treatment progression.
  • AD Alzheimer's disease
  • the disease leads to deficits in cognitive function and declines in memory, learning, language, and in the ability to perform intentional and purposeful movements.
  • AD is also accompanied by concomitant behavioral, emotional, interpersonal, and social deterioration. These cognitive and behavioral deficits render living difficult (Burns et ai, 2002).
  • Late-stage AD patients are often unable to speak, comprehend language, and handle their own basic personal care, eventually requiring full-time care and supervision, and are often dependent on family members and nursing homes.
  • AD is the leading cause of senile dementia, and is predicted to increase in prevalence as the proportion of elderly persons in the population grows.
  • AD The total number of persons with AD is predicted to increase at least threefold just between 2000 and 2050, rendering AD a world-wide public health problem (Sloane et al., 2002).
  • Clinical management of AD remains largely supportive. That is, patients are given treatments aimed at prevention, control, or relief of complications and side effects from AD, and to improve their comfort and quality of life. There is still an unmet need for treatments that directly target the disease process and have disease-modifying effects.
  • AD is histologically characterized by the presence of extraneuronal plaques and intracellular and extracellular neurofibrillary tangles in the brain.
  • Plaques are composed mainly of ⁇ amyloid ( ⁇ ), whereas tangles comprise pathological forms of tau, such as pathological tau conformers and their aggregates.
  • amyloid
  • tangles comprise pathological forms of tau, such as pathological tau conformers and their aggregates.
  • the relationship between plaques and tangles and the disease process remains unclear, although studies suggest a link between amyloid and tau pathogenesis (Hardy et al., 1998; Oddo et al., 2004; Rapoport et al., 2002; Roberson, et al., 2007; Shipton et ai, 201 1 ).
  • AD pathology A central role for ⁇ in AD pathology was initially proposed in a hypothesis called the " ⁇ cascade," wherein ⁇ deposition is followed by tau phosphorylation and tangle formation, and then neuronal death (Hardy and Allsop, 1991 ; Hardy and Selkoe, 2002; for a review see, Walsh and Selkoe, 2004; also see Seabrook et al. 2007). Accordingly, initial therapeutic approaches for AD focused primarily on targeting ⁇ . However, there is a documented lack of correlation between the extent of brain ⁇ pathology in AD patients and clinical progression of the disease (Braak and Braak, 1991 ).
  • asymptomatic individuals have shown extensive, often diffuse, amyloid deposition at autopsy (Braak and Braak, 1991 ), and at least in early-stage AD, neuronal loss and amyloid deposition occur in different regions of the brain (Carter and Lippa, 2001 ). Therefore targeting ⁇ alone cannot suffice to alter the disease process in any or all patients. Nevertheless, the most advanced disease-targeting therapies undergoing clinical trials in AD patients remain those aimed at the production and clearance of ⁇ . These therapies include passive immunotherapies, e.g., BAPINEUZUMAB, SOLANEUZUMAB, and PONEZUMAB, as well as the small molecule gamma-secretase inhibitor
  • a recognized role for tau in AD pathology has been demonstrated in numerous studies. For example, Braak showed that the closest correlate for AD neurodegeneration was the presence of tau tangles, and not of amyloid plaques (Braak and Braak, 1991 ). In another study, ⁇ neurotoxicity in cultured neurons appeared to depend on tau (Rapoport et al., 2002). Recently, reducing endogenous tau prevented behavioral deficits in transgenic mice that expressed the human amyloid precursor protein, without altering their high ⁇ levels (Roberson et ai, 2007). Tau reduction also protected both transgenic and nontransgenic mice against excitotoxicity. Id.. Santacruz et al. demonstrated that a reduction in the amount of tau restored memory function in a model of tauopathy (Santacruz et al., 2005).
  • therapies aimed at reducing tau can represent an effective strategy for treating AD and other tau-related disease conditions.
  • Tau belongs to a family of intrinsically disordered proteins
  • hyperphosphorylation can cause pathological transformations from an intrinsically disordered state to multiple soluble and insoluble misdisordered structures, including paired helical filaments (PHFs) and other aggregates (Wischik et al., 1988a; Wischik et al., 1988b; Novak et al., 1993; Skrabana et al., 2006; Zilka et al., 2008; Kovacech et ai, 2010). These structural changes lead to a toxic gain of function, to a loss of physiological function of the native protein, or both (Zilka et al., 2008; Kovacech et ai, 2010).
  • PHFs paired helical filaments
  • Tau's physiological function is in mediating the assembly of tubulin monomers into microtubules that constitute the neuronal microtubules network (Buee et ai, 2000). Tau binds to microtubules through repetitive regions located in the C- terminal portion of the protein. Id. These repeat domains (R1 -R4), are not identical to each other, but comprise highly conserved 31 -32 amino acids (Taniguchi et ai, 2005b).
  • tau repeats are believed to participate in the formation of pathological tau aggregates and other structures.
  • PHFs pathological paired helical filaments
  • the pronase resistant core of pathological paired helical filaments consists of the microtubule binding regions of 3- and 4- repeat tau isoforms (Jakes et al., 1991 ; Wischik, et al. 1988a; Wischik, et al. 1988b).
  • tau is considered an intracellular cytoplasmic protein
  • intracellular tau can be released into the extracellular space and contribute to neurodegeneration (Gomez-Ramos et al., 2006).
  • neuronal loss has been linked to the topographic distribution of neurofibrillary tangles (made up of tau protein) in AD brains (West et al., 1994;
  • AD blood-brain-barrier
  • a growing number of pre-clinical and clinical studies report that antibody-mediated therapies can clear AD aggregates from the brain, and propose multiple mechanisms of action, such as (i) antibody uptake into the brain via an altered BBB permeability in AD, or BBB leakage; (ii) antibodies working as "peripheral sinks" for soluble plaque-forming amyloid species; (iii) entrance of antibody-secreting cells from the periphery into the brain, delivering antibodies locally; and (iv) transport of IgG within and across cells.
  • BBB blood-brain-barrier
  • therapeutic antibodies targeting disease forms of tau represent a prospective approach for treatment and/or diagnosis of AD and other tauopathies (WO 2004/007547, US2008/0050383).
  • Taniguchi's RTA- 1 and RTA-2 antibodies bound specifically to R1 and R2, respectively. Neither antibody bound more than one tau repeat and none was reportedly tested for in vivo effects on either tau aggregation or clearance.
  • at least three anti-amyloid antibodies in clinical trials for passive immunization-based therapy of AD (i.e., one in which antibodies are administered to the patient), no clinical testing reports of passive, tau-based immunotherapies for AD are yet available.
  • AD Alzheimer's disease
  • AD-targeted drugs interfere with at least some of the earliest stages of the disease.
  • Such molecules would provide new, advantageous options in the early diagnosis (which could itself improve treatment outcomes), prevention, and treatment of AD.
  • the invention provides an isolated antibody, wherein the antibody binds to one or more tau epitopes and is capable of two or more of the following:
  • each tau epitope comprises an aggregation-promoting region of tau.
  • this isolated antibody is such that each of the one or more epitopes is independently selected from epitopes within:
  • the isolated antibody having the properties described in the embodiments of the previous paragraphs is capable of binding to one or more forms of pathological tau chosen from misordered tau, misdisordered tau, sarkosyl-insoluble tau, neurofibrillary tangles, neuropil threads, and neuritic plaques in a brain biopsy of a human Alzheimer's disease patient, in a brain sample from an animal model of Alzheimer's disease, or in both.
  • the isolated antibody is such that at least one of the epitopes that it recognizes is a conformational epitope.
  • the invention provides an isolated antibody, wherein the antibody binds to one or more tau epitopes and is capable of two or more of the following:
  • each tau epitope comprises an aggregation-promoting region of tau.
  • this isolated antibody is such that each of the one or more epitopes is independently selected from epitopes within:
  • this isolated antibody is such that each of the one or more epitopes it binds to is independently selected from epitopes within:
  • an antibody light chain variable region comprising:
  • QSLLNSRTRKNY (SEQ ID NO: 1 17) or SEQ ID NO: 247 for CDR1 ;
  • WAS (SEQ ID NO: 1 18) or SEQ ID NO: 253 for CDR2;
  • KQSFYLRT (SEQ ID NO: 1 19) or any one of SEQ ID NOs: 255, 257, 258, 259, and 260 for CDR3;
  • an antibody heavy chain variable region comprising:
  • GYIFTDYVIS SEQ ID NO: 120
  • SEQ ID NO: 261 SEQ ID NO: 262 for CDRI ;
  • ARDYYGTSFAMDY (SEQ ID NO: 122), SEQ ID NO: 266, SEQ ID NO:
  • the invention also provides an isolated antibody that binds one or more epitopes on tau in a conformationally-specific manner wherein:
  • each of the one or more epitopes is independently selected from epitopes within:
  • one, two, three, or four of the epitopes is/are conformational epitope(s).
  • the invention also provides an isolated antibody that binds one or more epitopes on tau in a conformationally-specific manner wherein:
  • each of the one or more epitopes is independently selected from epitopes within:
  • one, two, three, or four of the epitopes is/are conformational epitope(s) .
  • this antibody is DC8E8, wherein DC8E8 is an antibody produced by the hybridoma deposited under American Type Culture Collection Patent Deposit no. PTA-1 1994.
  • the isolated antibody binds to one or more of the same epitopes on tau as those bound by DC8E8. In an embodiment, the isolated antibody competes with monoclonal antibody DC8E8 for binding to tau.
  • the invention also provides an isolated antibody comprising in its epitope binding domain one or more complementarity determining region (CDR) sequences chosen from:
  • an antibody light chain variable region comprising:
  • an antibody heavy chain variable region comprising:
  • the invention also provides that any of the antibodies described in the previous embodiments can be such that the isolated antibody comprises:
  • antibody DC8E8 or one or more sequences having at least 80%, 90%, or 95% identity after optimum alignment with one of these light chain CDRs; and b) one or more sequences of the heavy chain CDRs from the monoclonal
  • antibody DC8E8 or one or more sequences having at least 80%, 90%, or 95% identity after optimum alignment with one of these heavy chain CDRs; and wherein:
  • the light chain CDRs comprise a sequence chosen from QSLLNSRTRKNY (SEQ ID NO: 1 17), WAS (SEQ ID NO: 1 18), and KQSFYLRT (SEQ ID NO: 1 19); and
  • the heavy chain CDRs comprise a sequence chosen from GYIFTDYVIS (SEQ ID NO: 120), IFPRSGST (SEQ ID NO: 121 ), and ARDYYGTSFAMDY (SEQ ID NO: 122).
  • any of the antibodies described in the previous embodiments can consist of or comprise a Fab, Fab', F(ab') 2 , Fabc, Fv fragment, any other antigen-binding fragment; or an antigen-binding antibody portion thereof; having one or more of the following immunological binding characteristics:
  • the antibody binds one or more tau epitopes in a conformationally-specific manner, wherein: a) each of the one or more tau epitopes is independently selected from epitopes within:
  • the antibody binds two or more tau epitopes and is capable of displaying a higher affinity for pathological tau than for physiological tau, wherein the two tau epitopes are selected from epitopes within:
  • any of the antibodies described in the previous embodiments can consist of or comprise a Fab, Fab', F(ab')2, Fabc, Fv fragment, any other antigen-binding fragment; or an antigen-binding antibody portion thereof; having one or more of the following immunological binding characteristics:
  • the antibody binds one or more tau epitopes in a conformationally-specific manner, wherein:
  • each of the one or more tau epitopes is independently selected from epitopes within:
  • the antibody binds two or more tau epitopes and is capable of displaying a higher affinity for pathological tau than for physiological tau, wherein the two tau epitopes are selected from epitopes within:
  • the invention also relates to any isolated antibody that competitively binds to tau against any of the isolated antibodies described in the previous embodiments.
  • the isolated antibody competitively binds to tau when tested against isolated DC8E8 for binding to tau.
  • the antibody comprises a light chain comprising SEQ ID NO.: 141 . In some embodiments, the antibody comprises a light chain comprising SEQ ID NO.:138. In some embodiments, the antibody comprises a light chain comprising SEQ ID NO.: 141 and a light chain comprising SEQ ID NO.:138.
  • the invention provides that the antibodies provided by the invention can be chosen from:
  • any of the isolated antibodies provided by the invention can be raised in a mammal.
  • the isolated antibody is produced by a recombinant animal or by a recombinant host cell.
  • any of the isolated anti-tau antibodies provided herein can be such that they are detectably labeled with one or more labeling agents.
  • at least one labeling agent is chosen from an enzyme, a radioisotope, a fluorophore, a nuclear magnetic resonance marker, and a heavy metal.
  • the antibody comprises at least one drug (combination agent) attached to the antibody molecule.
  • the invention also provides isolated nucleic acids encoding at least one CDR, or at least the binding domain or variable region of an immunoglobulin chain of any of the anti-tau antibodies described in the previous embodiments. Also provided are isolated vectors comprising any of those nucleic acids. In some embodiments, the invention provides an isolated host cell comprising one or more of these isolated nucleic acids and vectors.
  • the invention provides an isolated cell line expressing any of the anti-tau antibodies described in the previous embodiments.
  • the isolated cell line is a hybridoma.
  • the isolated cell line is the hybridoma from which monoclonal antibody DC8E8 is produced, and which cell line has been deposited with the American Type Culture Collection, Manassas, VA, USA, on July 13, 201 1 , with the ATCC Patent Deposit Designation PTA-1 1994.
  • the invention provides for the use of any of the anti-tau antibodies, nucleic acids, and cells provided herein, as a drug or in the manufacture of a medicament for the diagnosis, prevention, or treatment of Alzheimer's disease or a related tauopathy.
  • the antibodies are comprised in a
  • the pharmaceutical composition further comprising pharmaceutically acceptable carrier and/or diluent.
  • the pharmaceutical composition comprises a combination of antibodies and a pharmaceutically acceptable carrier and/or diluent, wherein the combination comprises at least two different antibodies, and wherein each of the antibodies is independently selected from the antibodies described in the previous embodiments.
  • at least one of the antibodies is DC8E8, or a human version of DC8E8, or a humanized version of DC8E8.
  • the antibodies are comprised in a composition, further comprising a diluent and/or a carrier.
  • the composition can be a
  • composition can further comprise at least one compound or agent selected from a detectable label, keyhole limpet hemocyanin, tetanus toxoid or a toxoid derived from other pathogenic bacteria, serum albumins, bovine serum albumin, an immunoglobulin molecule or fragment thereof, thyroglobulin,
  • ovoglobulin a universal T-cell epitope, a cytokine, a chemokine, interleukin 1 -alpha (IL-1 a), IL- ⁇ ⁇ , IL-2, IL-10, interferon -gamma (IFN- ⁇ ), granulocyte macrophage colony-stimulating factor (GM-CSF), macrophage inflammatory protein 1 alpha ( ⁇ 1 ⁇ ), ⁇ 1 ⁇ , and RANTES (regulated upon activation, normal T-cell expressed and secreted).
  • IL-1 a interleukin 1 -alpha
  • IFN- ⁇ interferon -gamma
  • GM-CSF granulocyte macrophage colony-stimulating factor
  • ⁇ 1 ⁇ macrophage inflammatory protein 1 alpha
  • RANTES regulated upon activation, normal T-cell expressed and secreted.
  • the invention also provides an article of manufacture (e.g., a kit) for pharmaceutical or diagnostic use, comprising packaging material and a container comprising a solution of a lyophilized form any one or more of the anti-tau antibodies provided herein.
  • the container is a component of a device or system for delivery of the antibody to a subject.
  • the invention provides a medical device comprising an anti-tau antibody as provided herein (see above), wherein the device is suitable for contacting or administering the antibody by at least one mode selected from parenteral, subcutaneous, intramuscular, intravenous, intrarticular,
  • intrabronchial intraabdominal, intracapsular, intracartilaginous, intracavitary, intracelial, intracerebellar, intracerebroventricular, intrathecal, intracolic, intracervical, intragastric, intrahepatic, intramyocardial, intraosteal, intrapelvic, intrapericardiac, intraperitoneal, intrapleural, intraprostatic, intrapulmonary, intrarectal, intrarenal, intraretinal, intraspinal, intrasynovial, intrathoracic, intrauterine, intravesical, intralesional, bolus, vaginal, rectal, buccal, sublingual, intranasal, and transdermal.
  • the invention relates to a method of treating or preventing the progression of Alzheimer's disease or a related tauopathy in a subject, the method comprising administering to said subject an effective amount of at least one of the anti-tau antibodies provided herein.
  • the method is capable of reducing motor impairment, improving motor function, reducing cognitive impairment, improving cognitive function, or of a combination thereof.
  • the invention relates to a method of
  • the method comprising administering to said subject an effective amount of at least one of the anti-tau antibodies provided herein.
  • the invention provides a method of diagnosing or screening a subject for the presence of Alzheimer's disease or a related tauopathy in a subject, or for determining a subject's risk for developing Alzheimer's disease or a related tauopathy, the method comprising:
  • the invention provides a method of monitoring a subject for the presence, progression, regression, or stabilization of Alzheimer's disease or a related tauopathy in a subject, or for determining the stage of
  • Alzheimer's disease or a related tauopathy in a subject for the method comprising: a) contacting the subject, or a cell, tissue, organ, fluid, or any other sample of the subject, with an effective amount of at least one of the anti-tau antibodies provided herein; and
  • the antibody is administered intravenously, intramuscularly, subcutaneously, intraperitoneally, intranasally,
  • the effective amount of each antibody is at least 1 mg/kg body weight of the subject, per dose. In some embodiments, the effective amount of each antibody is at least 10 mg/kg body weight of the subject, per dose. In some embodiments, at least one of the antibodies is administered in multiple dosages over a period of at least six months. In some embodiments, the antibody is administered peripherally to a human subject to exert its beneficial effects.
  • the antibody when administered peripherally to a human subject, binds to soluble tau, sarkosyl-insoluble tau, or to both. In some embodiments, the antibody, when administered peripherally to a human subject, binds to tau, wherein tau is in one or more pathological forms chosen from misordered tau, misdisordered tau, sarkosyl-insoluble tau, neurofibrillary tangles, neuropil threads, and neuritic plaques in a brain biopsy of a human Alzheimer's disease patient, in a brain sample from an animal model of Alzheimer's disease. In some embodiments, the antibody, when administered peripherally to a human subject, exerts one or more effector-function mediated beneficial effects on the subject.
  • the antibody is delivered to the periphery by injection/implantation of an antibody-expressing cell into the subject's brain.
  • the antibody-expressing cell is an hybridoma cell.
  • the hybridoma cell is a hybridoma expressing DC8E8.
  • the invention provides an isolated peptide, wherein:
  • the isolated peptide is a fragment of tau that is at least 6
  • amino-acid-residues-long at least 7 amino-acid-residues-long, at least 9 amino-acid-residues-long, at least 10 amino-acid-residues-long, at least 12 amino-acid-residues-long, or 30 amino-acid-residues-long;
  • the isolated peptide comprises a tau therapeutic epitope.
  • the therapeutic epitope comprises a therapeutic epitope selected from those within:
  • the invention provides an isolated peptide, wherein:
  • the isolated peptide is a fragment of tau that is at least 6 amino-acid-residues- long, at least 7 amino-acid-residues-long, at least 9 amino-acid-residues-long, at least 10 amino-acid-residues-long, at least 12 amino-acid-residues-long, or 30 amino-acid-residues-long; and
  • the isolated peptide comprises a tau therapeutic epitope.
  • the therapeutic epitope comprises a therapeutic epitope selected from those within:
  • the therapeutic epitope is selected from: i. position 268-273 or residues HQPGGG (SEQ ID NO: 223), relative
  • the isolated peptide is a sequence selected from SEQ ID NOs: 1 -4, SEQ ID NOs: 9-101 , and SEQ ID NOs: 108-1 12,
  • NIKAVPGGGS SEQ ID NO: 200
  • NIKHVPGGGS SEQ ID NO: 201
  • IKHVPGGGS SEQ ID NO: 202
  • KHVPGGGSV SEQ ID NO: 203
  • HVPGGGSVQ SEQ ID NO: 204
  • VPGGGSVQ SEQ ID NO: 205
  • GWSIHSPGGGSC SEQ ID NO: 250
  • SVFQHLPGGGSC SEQ ID NO: 251
  • ANIKHVPGGGS SEQ ID NO: 144
  • DAIKHVPGGGS SEQ ID NO: 146
  • DNAKHVPGGGS SEQ ID NO: 149
  • DNIAHVPGGGS (SEQ ID NO: 151 ), DNIKAVPGGGS (SEQ ID NO: 159),
  • DNIKHAPGGGS SEQ ID NO: 161
  • DNIKHVPGGGS SEQ ID NO: 171 .
  • the isolated peptide is a sequence selected from SEQ ID NO: 270 (TENLKHQPGGGK); SEQ ID NO: 271 (KHQPGGG), SEQ ID NO: 272 (HQPGGG); SEQ ID NO: 275
  • DNIKHVPGGGSVQIVYKPV SEQ ID NO: 281 (HHKPGGG), SEQ ID NO: 282 (HKPGGG), and SEQ ID NO: 283 (THVPGGG).
  • the isolated peptide is a sequence selected from SEQ ID NO: 270 (TENLKHQPGGGK); SEQ ID NO: 271 (KHQPGGG), SEQ ID NO: 272 (HQPGGG); SEQ ID NO: 275
  • DNIKHVPGGGSVQIVYKPV SEQ ID NO: 281 (HHKPGGG), SEQ ID NO: 282 (HKPGGG), and SEQ ID NO: 283 (THVPGGG); and the therapeutic epitope is selected from:
  • the isolated peptide is a sequence selected from SEQ ID NO: 272 (HQPGGG) and SEQ ID NO: 277 (HVPGGG).
  • the isolated peptide is active in at least one assay, selected from assays that measure the peptide's:
  • the invention also relates to compounds comprising any of the isolated peptides provided herein and a moiety.
  • the moiety is N- terminal, C-terminal, or linked to an internal amino acid of the peptide, and wherein the moiety is selected from one or more of a cysteine residue, phospho group, keyhole limpet hemocyanin, tetanus toxoid or a toxoid derived from other pathogenic bacteria, serum albumins, bovine serum albumin, an immunoglobulin molecule or fragment thereof, thyroglobulin, ovoglobulin, a universal T-cell epitope, a cytokine, a chemokine, interleukin 1 -alpha (IL-1 a), IL- ⁇ ⁇ , IL-2, IL-10, interferon -gamma (IFN- ⁇ ), granulocyte macrophage colony-stimulating factor (GM-CSF), macrophage inflammatory protein 1 al
  • compositions comprising one or more of the isolated peptides and/or compounds provided by the invention and a pharmaceutically acceptable carrier, and/or a diluent, and/or an adjuvant.
  • the pharmaceutical composition is adapted to provide a dosage of the peptide or of the compound between 1 ng and 10 mg. In certain embodiments, the pharmaceutical composition is adapted to provide a dosage of the peptide or of the compound greater than 10 micrograms.
  • the invention also relates to an article of manufacture (e.g., a kit) for pharmaceutical or diagnostic use, comprising packaging material and a container comprising a solution of a lyophilized form of a peptide and/or compound provided by the invention.
  • the container is a component of a device or system for delivery of the peptide or the compound to a subject.
  • kits comprising a peptide, a compound, and/or a peptide/compound composition as provided by the invention, wherein the device is suitable for contacting or administering the antibody by at least one mode selected from parenteral, subcutaneous, intramuscular, intravenous, intrarticular, intrabronchial, intraabdominal, intracapsular, intracartilaginous, intracavitary, intracelial, intracerebellar, intracerebroventricular, intrathecal, intracolic, intracervical, intragastric, intrahepatic, intramyocardial, intraosteal, intrapelvic, intrapericardiac, intraperitoneal, intrapleural, intraprostatic, intrapulmonary, intrarectal, intrarenal, intraretinal, intraspinal, intrasynovial, intrathoracic, intrauterine, intravesical, intralesional, bolus, vaginal, rectal, buccal, sublingual, intranasal, and transdermal.
  • the invention provides a method of treating or preventing the progression of Alzheimer's disease or related tauopathies in a subject, the method comprising administering to said subject an effective amount of at least one peptide and/or at least one compound as provided by the invention.
  • the method is capable of reducing motor impairment, improving motor function, reducing cognitive impairment, improving cognitive function, or a combination thereof.
  • the invention provides a method of
  • the method comprising administering to said subject an effective amount of at least one peptide and/or at least one compound as provided by the invention.
  • the method comprises administering to a human patient a peptide and/or a compound as provided by the invention, and/or an adjuvant that augments the immune response, which method effects an immune response comprising antibodies against pathological tau, thereby treating, preventing the progression, or ameliorating at least one of the symptoms associated with AD in the human patient.
  • the invention also provides a method of producing an antibody that is able to compete with DC8E8 for binding to tau, the method comprising immunizing a subject with at least one peptide and/or with at least one compound as provided by the invention.
  • at least one peptide is a peptide is chosen from any one of SEQ ID NOs: 1 -4, SEQ ID NOs: 9-101 , and SEQ ID NOs: 108-1 12, NIKHVPGGGS (SEQ ID NO: 201 ), IKHVPGGGS (SEQ ID NO: 202), KHVPGGGSV (SEQ ID NO: 203), HVPGGGSVQ (SEQ ID NO: 204), VPGGGSVQ (SEQ ID NO: 205), GWSIHSPGGGSC (SEQ ID NO: 250), SVFQHLPGGGSC (SEQ ID NO: 251 ), ANIKHVPGGGS (SEQ ID NO: 144), DAIKHVPGGGS (SEQ ID NO: 144), DAIKH
  • DNAKHVPGGGS (SEQ ID NO: 149), DNIAHVPGGGS (SEQ ID NO: 151 ),
  • DNIKAVPGGGS SEQ ID NO: 159
  • DNIKHAPGGGS SEQ ID NO: 161
  • DNIKHVPGGGS SEQ ID NO: 171
  • the peptide is chosen from SEQ ID NOs: 1 -4.
  • the peptide is SEQ ID NO. 108.
  • the peptide is GWSIHSPGGGSC (SEQ ID NO: 250).
  • the peptide is SVFQHLPGGGSC (SEQ ID NO: 251 ).
  • the peptide is selected from SEQ ID NO: 270 (TENLKHQPGGGK); SEQ ID NO: 271 (KHQPGGG), SEQ ID NO: 272 (HQPGGG); SEQ ID NO: 275 (ENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGS), SEQ ID NO: 276 (KHVPGGG), SEQ ID NO: 277 (HVPGGG), SEQ ID NO: 280
  • the peptide is selected from SEQ ID NO: 272 (HQPGGG) and SEQ ID NO: 277 (HVPGGG).
  • the invention provides a method of diagnosing or screening a subject for the presence of Alzheimer's disease or related tauopathies in a subject, or for determining a subject's risk for developing Alzheimer's disease or related tauopathies, the method comprising:
  • the invention provides a method of monitoring a subject for the presence, progression, regression, or stabilization of Alzheimer's disease or related tauopathies, or for determining the stage of Alzheimer's disease or related tauopathies in a subject, the method comprising:
  • the antibody, peptide , and/or compound is administered intravenously, intramuscularly, subcutaneously, intraperitoneally, intranasally, intracerebroventricularly, intrathecally, or as an aerosol.
  • the effective amount of each peptide and/or compound is at least 1 g per dose, at least 10 ig per dose, at least 100 g per dose.
  • the effective amount of each peptide and/or compound is at least 10 g per dose in the presence of an adjuvant, and at least 100 g per dose in the absence of an adjuvant.
  • at least one peptide or compound is administered in multiple dosages over a period of at least six months.
  • the invention provides a method of treating or preventing the progression of Alzheimer's disease or related tauopathies in a subject, the method comprising administering to said subject an effective amount of at least one antibody, and/or at least one peptide, and/or at least one compound as provided by the invention, in combination with at least one combination agent chosen from acetylcholinesterase inhibitors, N-Methyl-D-aspartate (NMDA) receptor antagonists, transition metal chelators, growth factors, hormones, nonsteroidal anti-inflammatory drugs (NSAID), antioxidants, lipid lowering agents, selective phosphodiesterase inhibitors, inhibitors of tau aggregation, inhibitors of protein kinases, inhibitors of heat shock proteins, anti-amyloid passive and active immunization, anti-amyloid aggregation inhibitors, and secretase inhibitors.
  • the method is capable of reducing motor impairment, improving motor function, reducing cognitive impairment, improving cognitive function, or a
  • the invention provides a method of
  • the method comprising administering to said subject an effective amount of at least one antibody, at least one peptide, and/or at least one compound as provided by the invention, in combination with at least one combination agent chosen from acetylcholinesterase inhibitors, NMDA receptor antagonists, transition metal chelators, growth factors, hormones, non-steroidal anti-inflammatory drugs (NSAID), antioxidants, lipid lowering agents, selective phosphodiesterase inhibitors, inhibitors of tau aggregation, inhibitors of protein kinases, inhibitors of heat shock proteins, anti-amyloid-passive and -active immunization reagents, anti-amyloid aggregation inhibitors, and secretase inhibitors.
  • acetylcholinesterase inhibitors NMDA receptor antagonists
  • transition metal chelators transition metal chelators
  • growth factors hormones
  • non-steroidal anti-inflammatory drugs (NSAID) non-steroidal anti-inflammatory drugs
  • antioxidants antioxidants
  • lipid lowering agents selective phosphodiesterase inhibitor
  • the method comprises administering to a human patient an effective amount of at least one antibody, at least one peptide, and/or at least one compound as provided by the invention, and/or an adjuvant that augments the immune response; in combination with at least one combination agent chosen from acetylcholinesterase inhibitors, NMDA receptor antagonists, transition metal chelators, growth factors, hormones, non-steroidal anti-inflammatory drugs (NSAID), antioxidants, lipid lowering agents, selective phosphodiesterase inhibitors, inhibitors of tau aggregation, inhibitors of protein kinases, inhibitors of heat shock proteins, anti-amyloid passive and -active immunization, anti-amyloid aggregation inhibitors, and secretase inhibitors; wherein the method effects an immune response
  • at least one combination agent chosen from acetylcholinesterase inhibitors, NMDA receptor antagonists, transition metal chelators, growth factors, hormones, non-steroidal anti-inflammatory drugs (NSAID), antioxidants, lipid lowering agents, selective
  • the combination agent is administered prior to, simultaneously with, or after the administration of an antibody, a peptide, and/or a compound as provided by the invention.
  • the invention also provides a pharmaceutical composition
  • a pharmaceutical composition comprising a pharmaceutically acceptable carrier and/or diluent; and a) an antibody as provided by the invention; and/or
  • the antibody is DC8E8. In certain embodiments, the antibody comprises at least one CDR from DC8E8.
  • the antibody comprise at least one variable chain (light or heavy) from DC8E8.
  • a humanized or human version of DC8E8 can be used.
  • at least one peptide is chosen from any one of SEQ ID NOs: 1 -4, SEQ ID NOs: 9-101 , and SEQ ID NOs: 108-1 12, NIKHVPGGGS (SEQ ID NO: 201 ), IKHVPGGGS (SEQ ID NO: 202), KHVPGGGSV (SEQ ID NO: 203), HVPGGGSVQ (SEQ ID NO: 204), VPGGGSVQ (SEQ ID NO: 205), GWSIHSPGGGSC (SEQ ID NO: 250), SVFQHLPGGGSC (SEQ ID NO: 251 ), ANIKHVPGGGS (SEQ ID NO: 144), DAIKHVPGGGS (SEQ ID NO: 146), DNAKHVPGGGS (SEQ ID NO: 149), DNIAHVPGGGS
  • the peptide is chosen from SEQ ID NOs: 1 -4. In another embodiment, the peptide is SEQ ID NO. 108. In one embodiment, the peptide is GWSIHSPGGGSC (SEQ ID NO: 250). In certain embodiments, the peptide is SVFQHLPGGGSC (SEQ ID NO: 251 ). In certain embodiments the peptide is selected from SEQ ID NO: 270 (TENLKHQPGGGK); SEQ ID NO: 271 (KHQPGGG), SEQ ID NO: 272 (HQPGGG); SEQ ID NO: 275
  • the peptide is selected from SEQ ID NO: 272 (HQPGGG) and SEQ ID NO: 277 (HVPGGG).
  • Figure 1 Schematic of six isoforms of human tau.
  • Figure 2 Schematic functional map of human tau (2N4R).
  • Figure 2 discloses "VQIINK” and “VQIVYK” as SEQ ID NOS 1 16 and 1 15, respectively.
  • FIG. 3 The nucleotide and amino-acid sequences of DC8E8 variable regions and their alignment to the closest mouse germ line sequences.
  • the figure shows nucleotide (SEQ ID NO: 165) (A) and amino acid (SEQ ID NOS 141 (for the variable light chain) and 1 17-1 19 (for each of its CDRs, according to IMGT), respectively, in order of appearance); (B) sequences of the variable light (VL) chain region of DC8E8 (alignment discloses SEQ ID NOS 166 and 168, respectively, in order of appearance); and (C) alignment of DC8E8's variable light chain V-gene to the closest mouse germline sequence IGKV8-21 * 01 (alignment discloses SEQ ID NOS 166 and 167, respectively, in order of appearance; followed by the alignment of DC8E8's VL J-gene (SEQ ID NO:168) to closest mouse J gene, IGKJ1 * 01 (SEQ ID NO: 169).
  • the figure shows the nucleotide (SEQ ID NO: 170) ( in D) and amino acid sequence of DC8E8's variable heavy chain and its three CRDs (SEQ ID NOS 171 and 120-122, respectively, in order of appearance) sequences.
  • (F) are shown the following alignments for DC8E8: first, the variable heavy (VH) chain V-gene of DC8E8 (SEQ ID NO 172) with the closest mouse germline sequence IGHV1 -81 * 01 (SEQ ID NO 172); second, the variable heavy (VH) chain D-gene of DC8E8 (SEQ ID NO 174) with the closest mouse germline sequence IGHD2-14 * 01 (SEQ ID NO 175); and last, the variable heavy (VH) chain J-gene of DC8E8 (SEQ ID NO 176) with the closest mouse germline sequence IGHJ4 * 01 (SEQ ID NO 177).
  • DC8E8 kappa light chain constant region SEQ ID NO: 178) (G) and sequence of heavy chain constant region (SEQ ID NO: 179) (H) are also shown.
  • Complementarity determining regions CDRs are underlined in the protein sequences (B) and (E) and were identified according to IMGT numbering system.
  • FIG. 4 Alignment of DC8E8 Variable Light (VL) chain sequence (SEQ ID NOS 166 (V-gene) and 168 (J-gene), respectively, to the closest human germline VL gene (SEQ ID NOS 180-181 , respectively, in order of appearance).
  • Figure 5 Alignment of DC8E8 Variable Heavy (VH) chain sequence (SEQ ID NOS 172,174, and 176, for V, D, and J genes, respectively) to the closest human germline VH gene (SEQ ID NOS 182-183 and 185, respectively, in order of appearance).
  • FIG. 6 Epitope mapping of DC8E8 by tau deletion mutants using ELISA.
  • A Schematic of tau proteins used for DC8E8 epitope mapping, and (B) their amino acid sequence (SEQ ID NOS 186-197, 102, 104, and 198-199, respectively, in order of appearance).
  • C ELISA readouts.
  • DC8E8 recognizes the following tau proteins: ⁇ 358-441 , ⁇ 421 -441 , ⁇ 134-168, ⁇ 1 -220, ⁇ 1 -126, 2N4R, 2N3R, ⁇ (1 -296;392-441 ) and A(1 -150;392-441 )/4R.
  • DC8E8 does not recognize the following tau proteins: ⁇ 222-427, ⁇ 306-400, ⁇ 228-441 , ⁇ 300-312, ⁇ 257-400, ⁇ 137- 441 , ⁇ 283-441 .
  • Figure 7 (A) and (B) Schematic of synthetic peptides (SEQ ID NOS 206, 207, 208, 2, 210, 21 1 , 212, 3, 214, 215, 4, 217, 26, 219, 36, 221 , 222, 109, and 88, respectively, in order of appearance) for epitope mapping and their sequence, respectively.
  • C Epitope mapping of DC8E8 with synthetic peptide by ELISA.
  • D Schematic of epitopes that DC8E8 is capable of binding to within tau. DC8E8 is capable of binding to any one of four separate binding regions, each of which is a separate epitope, named epitope 1 through 4.
  • the four epitopes each are separately located within the 1 st (epitope #1 ), 2 nd (epitope #2), 3rd (epitope #3), and 4 th (epitope #4) repeat domains of protein tau.
  • the four DC8E8 epitopes are each respectively encompassed within one of each of the following amino acid sequences: 267-KHQPGGG-273 (SEQ ID NO: 98) (within 1 st repeat domain of tau protein), 298- KHVPGGG-304 (SEQ ID NO: 99) (within 2 nd repeat domain of tau protein), 329- HHKPGGG-335 (SEQ ID NO: 100) (within 3 rd repeat domain of tau protein) and 361 - THVPGGG-367 (SEQ ID NO: 101 ) (within 4 th repeat domain of tau protein), respectively.
  • Figure 8 (A) Alignment of human tau amino acid sequence (SEQ ID NO: 225) to tau protein sequence from other species (SEQ ID NOS 226-245, respectively, in order of appearance). The full length of human tau protein was used for the alignment; only amino acids 265-368 of human tau from the alignment are shown. The regions comprising the four separate DC8E8 epitopes on human tau and the aligned sequences are boxed and shown in bold.
  • Figure 9 (A). Surface plasmon resonance (SPR) to characterize DC8E8's binding to tauA(1 -150;392-441 )/4R and 2N4R. (B). Surface plasmon resonance (SPR) to characterize DC8E8's binding to tauA(1 -150;392-441 )/3R and 2N3R.
  • Figure 10 (A). Association and dissociation rates of DC8E8 binding to tauA(1 -150;392-441 )/4R and to tau 2N4R, as determined by SPR. (B). Association and dissociation rates of DC8E8 binding to tauA(1 -150;392-441 )/3R and to tau 2N3R, as determined by SPR. The concentrations used in the measurements are indicated in the plots, dashed lines were interpolated by computer program BIA evaluation software 4.1 (Biacore AB) from measured data for kinetic parameter calculations.
  • FIG. 1 Monoclonal antibody DC8E8 is able to discriminate between preclinical AD, clinically incipient AD and fully developed final stage AD.
  • DC8E8 displays staining of early stages (tau monomers, dimers) of pathological tau in human preclinical AD - Braak's Stage I.
  • A The antibody recognizes the stage of pathological tau oligomers (arrows) and the stage of pathological tau polymers (tangles) (arrowhead) (B).
  • DC8E8 recognizes mainly pathological tau polymers in forms of the neurofibrillary tangles (arrowhead), neuritic plaques (inside the circle) and neuritic threads (inside the pentagon) (C). Scale bar: ⁇ ⁇ .
  • Monoclonal antibody DC8E8 recognizes all developmental stages of tangle formation in Alzheimer's disease (D).
  • DC8E8 recognizes early developmental stages of tangle formation - monomeric, dimeric and early oligomeric stage (D1 ), and late oligomeric, pre- tangle stage (D2), as well as late developmental stages of pathological tau polymers - intracellular (D3) and extracellular neurofibrillary tangles (D4).
  • Arrowhead indicates small oligomeric tau aggregates inside pyramidal hippocampal neurons (D1 ).
  • Scale bar 10 ⁇
  • FIG. 12 (A) Monoclonal antibody DC8E8 recognizes neurofibrillary degeneration in transgenic rats SHR72. DC8E8 recognizes tau oligomeric stage (arrows) and tangle stage (arrowhead) of tau neurodegeneration. Moreover, the antibody reacts with misfolded tau that is located in the axonal fibers (inside the rectangle). (B) In age-matched control rat brains the antibody does not display intraneuronal staining. Scale bar: 20 ⁇ . DC8E8 also recognizes all developmental stages of tangle formation in transgenic rat brain (SHR 72) as in human Alzheimer's disease.
  • DC8E8 recognizes early developmental stages of tangle formation - monomeric, dimeric and early oligomeric stage (C) and late oligomeric pre tangle stage (D), as well as late developmental stages of pathological tau polymers - intracellular (E) and extracellular neurofibrillary tangles (missing nucleus) (F).
  • Figure 13 (A) DC8E8 staining of neurofibrillary tangles in the cortex of SHR24 transgenic rats, which express tauA(1 -150;392-441 )/3R. (B) DC8E8 recognized neurofibrillary tangles in the brainstem of the transgenic rats SHR72, which express tauA(1 -150;392-441 )/4R. Tissue sections were counterstained with methylgreen. Arrows - neurofibrillary tangles. Scale bar: 50 ⁇
  • FIG. 14 Monoclonal antibody DC8E8 recognizes both soluble (A) and insoluble tau protein (B) in the brain samples isolated from transgenic rat model SHR24 (isocortex) and Alzheimer's disease patients (allocortex tissue including hippocampus, entorhinal and temporal cortex). Arrowhead - human truncated tau, arrow - rat endogenous tau. For soluble tau fractions 15 ⁇ g of protein were loaded per lane. For insoluble tau fractions the pellets were dissolved in 1 x sodium dodecyl sulfate (SDS) samples loading buffer in 1/50 volume of the 1 S, the same volume were loaded as in the case of soluble fractions.
  • SDS sodium dodecyl sulfate
  • Monoclonal antibody DC8E8 recognizes both soluble and insoluble tau proteins in the brain samples isolated from Alzheimer's disease patients (allocortex tissue including hippocampus, entorhinal and temporal cortex) (C) and from transgenic rat model SHR72 (brain stem) (D).
  • Figure 16 Analysis of the inhibitory potential of DC8E8 to prevent the formation of tau dimers, trimers, and oligomers by truncated tau protein tauA(1 - 296;392-441 )/4R by immunoblotting using HRP-conjugated mAb DC25.
  • FIG. 17 Uptake and degradation of TauA(1 -150;392-441 )/4R by microglia BV2 cells.
  • TauA(1 -150;392-441 )/4R was added to mouse BV2 cells either alone (1 ⁇ ) or in complex with monoclonal antibody DC8E8 (1 ⁇ tauA(1 -150;392- 441 )/4R + 1 ⁇ DC8E8).
  • the BV2 cells were acid-washed, cellular proteins were extracted and the levels of internalized tau were analyzed by Western blotting with pan-tau antibody DC25.
  • TauA(1 -150;392-441 )/4R was immunolabeled in cell lysates (intracellular tau) (A) and in cell cultivation medium (extracellular tau) (B).
  • DC8E8 antibody was visualized with anti-mouse HRP-conjugated antibody. 20 g of protein were loaded per lane.
  • Figure 18 Stability (shelf-life) of DC8E8 at 37°C, as tested by ELISA.
  • the antibody recognized tauA(1 -150;392-441 )/4R after several months of storage (1 , 2, 3 and 4 months).
  • the bars represent serial dilutions of the antibody as indicated. The measurements were performed in triplicate.
  • FIG. 19 DC8E8 recognizes and targets misfolded (diseased) tau in the brain tissues of the human Alzheimer's disease.
  • A Western blot analysis with pan-tau DC25 antibody:
  • FIG. 20 DC8E8 recognizes and targets misfolded (diseased) tau in brain tissues of the SHR72 rat model of AD.
  • A Western blot analysis with pan-tau DC25 antibody:
  • DC8E8 recognizes and targets misfolded (diseased) tau in brain tissues of human Alzheimer's disease.
  • FIG. 21 In vivo, DC8E8 targets pathological forms of tau in the brain of transgenic rats (SHR72) and transports pathological tau from the brain to the peripheral blood.
  • SHR72 transgenic rats
  • A Concentration of the DC8E8 antibody in the serum of DC8E8 treated animals reached 466, 200 and 273 pg/ml, respectively.
  • B In vivo transport of the DC8E8-t.au complexes from the brain into the peripheral blood was observed. Pathological tau reached the average concentration of 350 pg/ml of the serum.
  • FIG. 22 DC8E8 monoclonal antibody removes pathological tau from the brain of transgenic rats (SHR72).
  • A Intracerebral application of DC8E8 (left panel) removes (arrows) pathological tau from the neurons in comparison with mock treated animals (right panel).
  • B Quantification of the amount of pathological tau in the neurons of the mock-treated and DC8E8-treated animals showed radical reduction in the amount of pathological tau in animals treated with DC8E8
  • Figure 23 Recombinant scFv fragment (scDC8E8v) of monoclonal antibody DC8E8, expressed in bacteria, recognizes pathological misdisordered tauA(1 -150;392-441 )/4R.
  • FIG. 24 Recombinant scFv fragment of monoclonal antibody DC8E8 (scDC8E8v) exhibits tau binding properties similar to the DC8E8 antibody - selectively recognizes tauA(1 -150;392-441 )/4R.
  • A Kinetic affinity determination by SPR of scDC8E8v binding to AD tauA(1 -150;392-441 )/4R.
  • B Kinetic affinity determination by SPR of scDC8E8v binding to tau 2N4R.
  • C Rate constants (k 0 N and koFF) and association equilibrium constant for scDC8E8v binding.
  • Figure 25 Identification of residues in scDC8E8v combining site that influence scDC8E8v/DC8E8's recognition of misdisordered tau.
  • A Coomassie Brilliant Blue staining of polyacrylamide gels after separation of proteins from crude lysate of BL21 bacteria harboring scDC8E8v expression plasmid (wt) and its mutant forms. Each numbered lane corresponds to the respective clone number, (e.g. lane 2 corresponds to 2-VL-R33A). Expressed single chain proteins are indicated by asterisks. Control bacterial cultures do not express single chain proteins.
  • Figure 26 (A)Schematic of tau 2N4R (SEQ ID NO: 102) with the four DC8E8 epitopes shown in hatched boxes within the enlarged region between residues 261 and 373 (SEQ ID NO. 246): SEQ ID NOs 98-101 , respectively.
  • B (B)
  • FIG. 27 Neurobehavioral evaluation of transgenic rats (SHR72) modeling AD treated with tau 251 -PDLKNVKSKIGSTENLKHQPGGGKVQIINK-280 (SEQ ID NO:1 ). Ten days after 5 th dose of the immunogen, the transgenic rats were used for behavioral testing. Diagrams represent mean ⁇ SEM. All statistical data were obtained using nonparametric Mann-Whitney U-test. (A) Beam walking test (3.5 beam). (B) Number of hindlimb slips (3.5 beam). (C) Neuroscale.
  • FIG. 28 Vaccination of transgenic rats SHR72 with tau peptide SEQ ID NO:1 resulted in 49% reduction of neurofibrillary tangle (NFT) load.
  • Antibody AT8 was used for evaluation of NFTs in the brain tissues of transgenic rats SHR72.
  • Figure 29 Quantitative immunoblot analysis of insoluble tau prepared from the brain stems of transgenic rats (SHR72) treated with tau 256- VKSKIGSTENLKHQPGGGKVQIINKKLDLS-285 (SEQ ID NO:2) with adjuvant or control rats treated with adjuvant alone. Mean values are presented with standard error of the mean.
  • Figure 30 Neurobehavioral evaluation of transgenic rats (SHR72) treated with tau 256-VKSKIGSTENLKHQPGGGKVQIINKKLDLS-285 (SEQ ID NO:2). All statistical data were obtained using nonparametric Mann-Whitney U-test.
  • A Beam walking test (3.5 beam).
  • B Number of hindlimb slips (3.5 beam).
  • C Neuroscale.
  • FIG. 31 Vaccination of transgenic rats SHR72 with tau peptide SEQ ID NO:2 resulted in 60% reduction of neurofibrillary tangle (NFT) load.
  • Antibody AT8 was used for evaluation of NFTs in the brain tissues of transgenic rats SHR72.
  • Figure 32 Quantitative immunoblot analysis of insoluble tau prepared from the brain stems of transgenic rats (SHR72) treated with tau 256- VKSKIGSTENLKHQPGGGKVQIINKKLDLS-285 with phosphorylated Ser262 (SEQ ID NO:2) with adjuvant or control rats treated with adjuvant alone. Mean values are presented with standard error of the mean.
  • Figure 33 Vaccination of transgenic rats SHR72 with tau peptide SEQ ID NO:2/Phospho resulted in 77% reduction of neurofibrillary tangle (NFT) load.
  • Antibody AT8 was used for evaluation of NFTs in the brain tissues of transgenic rats SHR72.
  • Figure 34 Quantitative immunoblot analysis of insoluble tau prepared from the brain stems of transgenic rats (SHR72) treated with tau 259- KIGSTENLKHQPGGGKVQIINKKLDLSNVQ-288 (SEQ ID NO:3) with adjuvant or control rats treated with adjuvant alone. Mean values are presented with standard error of the mean.
  • Figure 35 Neurobehavioral evaluation of transgenic rats (SHR72) treated with tau 259- KIGSTENLKHQPGGGKVQIINKKLDLSNVQ-288 (SEQ ID NO:3). All statistical data were obtained using nonparametric Mann-Whitney U-test.
  • A Beam walking test (3.5 beam).
  • B Number of hindlimb slips (3.5 beam).
  • C Neuroscale.
  • FIG. 36 Vaccination of transgenic rats SHR72 with tau peptide SEQ ID NO:3 resulted in 58% reduction of neurofibrillary tangle (NFT) load.
  • Antibody AT8 was used for evaluation of NFTs in the brain tissues of transgenic rats SHR72.
  • Figure 37 Quantitative immunoblot analysis of insoluble tau prepared from the brain stems of transgenic rats (SHR72) treated with tau 275-VQIINKKLDL SNVQSKCGSKDNIKHVPGGG-304 (SEQ ID NO:4) or control rats treated with adjuvant alone. Mean values are presented with standard error of the mean.
  • FIG. 38 Vaccination of transgenic rats SHR72 with tau peptide SEQ ID NO:4 showed moderate improvement in neurobehavioral parameters.
  • A Beam walking test (3.5 cm beam).
  • B Number of hind-limb slips (3.5 cm beam).
  • C Neuroscale. Data are presented as mean values with standard error of the mean.
  • FIG 39 Vaccination of transgenic rats SHR72 with tau peptide SEQ ID NO:4 resulted in 66% reduction of neurofibrillary tangle (NFT) load.
  • Antibody AT8 was used for evaluation of NFTs in the brain tissues of transgenic rats SHR72.
  • Figure 40 Immunoblot analysis of insoluble tau prepared from the brain stem of transgenic rats (SHR72) immunized with tau 201 - GSPGTPGSRSRTPSLPTPPT REPKKVAVVR-230/carrying phosphorylated threonine at position 217 (SEQ ID NO:5) with adjuvant or control rats treated with adjuvant alone. Mean values are presented with standard error of the mean.
  • Figure 41 Neurobehavioral evaluation of transgenic rats (SHR72) treated with tau 201 - GSPGTPGSRSRTPSLPTPPT REPKKVAVVR-230/carrying phosphorylated threonine at position 217 (SEQ ID NO:5). All statistical data were obtained using nonparametric Mann-Whitney U-test.
  • A Beam walking test (3.5 beam).
  • B Number of hindlimb slips (3.5 beam).
  • C Neuroscale.
  • FIG. 42 Vaccination of transgenic rats SHR72 with tau peptide SEQ ID NO:5 showed no effect on neurofibrillary tangle (NFT) load.
  • Antibody AT8 was used for evaluation of NFTs in the brain tissues of transgenic rats SHR72.
  • Figure 43 Immunoblot analysis of insoluble tau prepared from the brain stem of transgenic rats (SHR72) immunized with tau 379- RENAKAKTDHGAEIVYKSPW SGDTSPRHL-408 carrying phosphorylated serine residues at position 396 and 404 (SEQ ID NO:6) and adjuvant or control rats treated with adjuvant alone. Mean values are presented with standard error of the mean.
  • Figure 44 Neurobehavioral evaluation of transgenic rats (SHR72) treated with tau SEQ ID NO:6 phosphorylated at Ser396/Ser404. All statistical data were obtained using nonparametric Mann-Whitney U-test.
  • A Beam walking test (3.5 beam).
  • B Number of hindlimb slips (3.5 beam).
  • C Neuroscale.
  • Figure 45 Vaccination of transgenic rats SHR72 with tau peptide SEQ ID NO:6 showed no reduction of neurofibrillary tangle (NFT) load.
  • Antibody AT8 was used for evaluation of NFTs in the brain tissues of transgenic rats SHR72.
  • Figure 46 Immunoblot analysis of insoluble tau prepared from the brain stem of rats(SHR72) immunized with tau 181 -
  • TPPSSGEPPKSGDRSGYSSPGSPGTPGSRS-210 carrying phosphorylated serine residue at position 202 and threonine residue at 205 (SEQ ID NO:7) with adjuvant or control rats treated with adjuvant alone. Mean values are presented with standard error of the mean.
  • Figure 47 Neurobehavioral evaluation of SHR72 rats treated with tau 181 -TPPSSGEPPKSGDRSGYSSPGSPGTPGSRS-210 carrying phosphorylated serine residue at position 202 and threonine residue at 205 (SEQ ID NO:7). All statistical data were obtained using nonparametric Mann-Whitney U-test.
  • A Beam walking test (3.5 beam).
  • B Number of hindlimb slips (3.5 beam).
  • C Neuroscale.
  • FIG. 48 Vaccination of transgenic rats SHR72 with tau peptide SEQ ID NO:7 showed no effect on neurofibrillary tangle (NFT) load.
  • Antibody AT8 was used for evaluation of NFTs in the brain tissues of transgenic rats SHR72.
  • Figure 49 Immunoblot analysis of insoluble tau prepared from the brain stem of rats (SHR72) immunized with tau 300-VPGGGSVQIVYKPVDLSK-317 (SEQ ID NO:8) with adjuvant or control rats treated with adjuvant alone. Mean values are presented with standard error of the mean.
  • Figure 50 Neurobehavioral evaluation of transgenic AD rats (SHR72) treated with tau 300-VPGGGSVQIVYKPVDLSK-317 (SEQ ID NO:8). All statistical data were obtained using nonparametric Mann-Whitney U-test.
  • A Beam walking test (3.5 beam).
  • B Number of hindlimb slips (3.5 beam).
  • C Neuroscale.
  • FIG. 51 Vaccination of transgenic rats SHR72 with tau peptide SEQ ID NO:8 showed no reduction of neurofibrillary tangle (NFT) load.
  • Antibody AT8 was used for evaluation of NFTs in the brain tissues of transgenic rats SHR72.
  • Figure 52 Vaccination of transgenic rats SHR72 with tau peptide (SEQ ID NO:108) statistically significantly reduced insoluble pathological tau (p ⁇ 0.001 ). Pathological insoluble tau was extracted from the brains of transgenic rats SHR72 immunized with tau peptide and analyzed by immunoblotting. Mean values are presented with standard error of the mean.
  • Figure 53 Vaccination of transgenic rats SHR72 with tau peptide (SEQ ID NO:108) statistically significantly improved neurobehavioral parameters (p ⁇ 0.05).
  • A Beam walking test (3.5 cm beam).
  • B Number of hind-limb slips (3.5 cm beam).
  • C Neuroscale. Data are presented as mean values with standard error of the mean.
  • Figure 54 Vaccination of transgenic rats SHR72 with tau peptide (SEQ ID NO:108) resulted in 60% reduction of neurofibrillary tangle (NFT) load.
  • Antibody AT8 was used for evaluation of NFTs in the brain tissues of transgenic rats SHR72.
  • Figure 55 ELISA of antisera generated from immunization of transgenic rats (SHR72) with peptide tau 275-
  • VQIINKKLDLSNVQSKCGSKDNIKHVPGGG-304 shows a difference in the antisera's binding to human pathological tauA(1 -150; 392-441 )/4R and human physiological tau 2N4R.
  • FIG. 56 Vaccination of transgenic rats SHR72 with tau peptide SEQ ID NO:108 induced formation of antibodies preferentially binding to pathological tau protein.
  • Geometric mean antibody titers measured with ELISA show that antibodies elicited by vaccination with tau peptide SEQ ID NO:108 exhibited highest binding activity to immunogen (SEQ ID NO:108 peptide) and to pathological tauA(1 -150; 392-441 )/4R.
  • Physiological tau (tau2N4R), which was used as a control, was more weakly recognized.
  • FIG. 57 Vaccination of transgenic rats SHR72 with tau peptide SEQ ID NO:108 preferentially induced formation of IgG antibody isotypes specific to pathological tau.
  • the isotype profile of antibodies induced by tau peptide SEQ ID NO:108 is shown.
  • Sera from individual rats were diluted 1 :800 and binding activity to pathological tauA(1 -150; 392-441 )/4R was analyzed by ELISA.
  • Figure 58 SPR affinity determination of antisera generated from immunization of SHR72 rats with peptide tau 275-
  • VQIINKKLDLSNVQSKCGSKDNIKHVPGGG-304 (SEQ ID NO:4) for binding to human tauA(1 -150;392-441 )/4R and human tau 2N4R.
  • Figure 59 Immunohistochemical staining of brains from a human AD patient with rat antibodies generated from immunization of transgenic rats (SHR72) with tau 275-VQIINKKLDL SNVQSKCGSKDNIKHVPGGG-304 (SEQ ID NO: 4).
  • SHR72 transgenic rats
  • tau 275-VQIINKKLDL SNVQSKCGSKDNIKHVPGGG-304 SEQ ID NO: 4
  • A The antisera recognized neurofibrillary lesions in Alzheimer's disease brain, hippocampus.
  • B Higher magnification showed neurofibrillary tangles. Scale bars: 100 pm (A), 10 ⁇ (B).
  • Figure 60 Vaccination of transgenic rats SHR72 with tau peptide SEQ ID NO:108 induced antibodies recognizing pathological tau proteins in sections from human Alzheimer's disease brain tissues. Representative immunostaining of the rat serum Nos. 3 (A), 5 (B), 6 (C), 7 (D), and 8 (E) show that all tested rat serum antibodies recognized neurofibrillary tangles in Pre-a layer of the entorhinal cortex of an Alzheimer's disease patient. Pooled sera from rats immunized with adjuvant only were used as a negative control (F). Serial brain tissue sections from the entorhinal cortex were used. Scale bar: 50 pm.
  • Figure 61 Vaccination of transgenic rats SHR72 with tau peptide SEQ ID NO:108 induced specific antibodies recognizing pathological tau proteins in human Alzheimer's disease brains as well as in the brains of transgenic rats SHR72.
  • Pathological tau was extracted from human and rat brain tissues and analyzed by immunoblotting with pooled sera from peptide SEQ ID NO:108 immunized transgenic rats SHR72. The sera antibodies recognized monomeric (lane No.1 , 2 and No.3) and oligomeric (lane No.2 and No.3) pathological tau including AD characteristic A68 pathological tau.
  • the graph represents statistical evaluation of ELISA results for individual sera diluted at 1 :800. Mean values are shown with standard error of the mean.
  • the graph represents statistical evaluation of ELISA results for individual sera diluted at 1 :800. Mean values are shown with standard error of the mean.
  • the graph represents statistical evaluation of ELISA results for individual sera diluted at 1 :800. Mean values are shown with standard error of the mean.
  • Figure 65 Immunization of mice with tau peptide SEQ ID NO:1 12 induced antibodies exhibiting statistically significantly higher binding activity to pathological tauA(1 -150; 392-441 )/4R than to physiological tau 2N4R ( p ⁇ 0.001 ).
  • the graph represents statistical evaluation of ELISA results for individual sera diluted at 1 :800. Mean values are shown with standard error of the mean.
  • Figure 66 Designer therapeutic epitopes GWSIHSPGGGSC (SEQ ID NO: 250) and SVFQHLPGGGSC (SEQ ID NO: 251 ) competed with pathological tauA(1 -150;392-441 )4R for binding to antibody DC8E8.
  • Figure 67 Designer therapeutic epitopes GWSIHSPGGGSC (SEQ ID NO: 250) and SVFQHLPGGGSC (SEQ ID NO: 251 ) induced production of antibodies that statistically significantly discriminated between pathological tauA(1 - 150;392-441 )4R and physiological tau 2N4R, as assayed by ELISA.
  • Sera at 1 :3200 dilution
  • mice immunized with one of the peptides 250 and 251 were tested for antibodies specific for tau proteins: pathological tauA(1 -150;392-441 )4R and physiological tau 2N4R by ELISA.
  • GWSIHSPGGGSC SEQ ID NO: 250
  • SVFQHLPGGGSC SEQ ID NO: 251
  • Figure 69 Quantitative SPR (Surface Plasmon Resonance) measurements show that antibodies induced by designer therapeutic epitope 1 (GWSIHSPGGGSC, SEQ ID NO: 250) ( Figure 69A) and designer therapeutic epitope 2 (SVFQHLPGGGSC, SEQ ID NO: 251 ) ( Figure 69B) statistically
  • Figure 70 Immunohistochemical staining of human AD diseased brain tissues with sera generated against designer therapeutic epitope 1
  • A Antisera against designer therapeutic epitope 1 recognized neurofibrillary pathology in the brain of AD patient.
  • C High magnification of the neurofibrillary tangle and neuropil threads (arrows).
  • B Antisera against designer therapeutic epitope 2 recognized neurofibrillary pathology in the brain of AD patient.
  • D High magnification of the stained neurofibrillary tangle and neuropil threads (arrows).
  • Antisera against designer therapeutic epitope 1 and designer therapeutic epitope 2 did not recognize normal tau in the control human brain (E, F). scale bar: 50 ⁇ (A, B, E, F), 20 ⁇ (C, D).
  • Serum generated against designer therapeutic epitope 2 (SVFQHLPGGGSC, SEQ ID NO: 251 ) recognizes neurofibrillary lesions in transgenic rats SHR72.
  • H In age-matched control rat brains the antibody does not display intraneuronal staining. The serum recognizes oligomeric pre tangle stage (I), as well as intracellular (J). Scale bar: 20 ⁇ (A, B), 10 ⁇ (C, D).
  • Figure 71 Antibodies induced by designer therapeutic epitope 1 (GWSIHSPGGGSC, SEQ ID NO: 250) and designer therapeutic epitope 2
  • SEQ ID NO: 251 recognized soluble and sarkosyl-insoluble pathological tau isolated from the human Alzheimer's disease brain tissues.
  • Figure 72 Antibodies induced by designer therapeutic epitope 1 (GWSIHSPGGGSC, SEQ ID NO: 250) and designer therapeutic epitope 2
  • Neuroscale neurobehavioral parameters of treated SHR72 rats.
  • A Beam walking test.
  • B Number of hind-limb slips (p ⁇ 0.05).
  • C Neuroscale. Rats treated with the designer therapeutic epitope 2 (SEQ ID NO: 251 ) showed: a) decreased escape latencies by 27% in the beam walking test, b) reduced number of the hind-limb slips by 44% (p ⁇ 0.05), and c) the reduced Neuroscale score by 26% than the transgenic control rats that received adjuvant alone. All statistical data were obtained using nonparametric Mann-Whitney U-test.
  • Immunotherapy statistically significantly (p ⁇ 0.05) reduced the amount of pathological insoluble tau in immunized animals compared to the control transgenic rats that received adjuvant alone. The reduction of pathological insoluble tau was observed at all analyzed tau epitopes (P ⁇ 0.05).
  • Figure 75 (A) Schematic of synthetic peptides used for further evaluation of DC8E8's minimal epitope (therapeutic core unit) and immunogenic potency determination and (B) their amino acid sequences.
  • Figure 76 Determination of DC8E8 minimal epitope (therapeutic core unit) using synthetic peptides by competitive ELISA.
  • Ten tau peptides (SEQ ID NOs: 270, 271 , 272, 275, 276, 277, 280, 281 , 282 and 283) that contain at least 6 amino acids of the DC8E8 recognition sequence are capable to compete with pathological tauA(1 -150;392- 441 )/4R for binding to antibody DC8E8.
  • Tau peptides containing only 5 amino acids of the DC8E8 recognition sequence (SEQ ID NOs: 273, 274, 278 and 279) do not compete with tauA(1 -150;392-441 )/4R (SEQ ID NO: 199) for binding to antibody DC8E8.
  • FIG. 77 Induction of tau specific antibodies after immunization of C57BL mice with tau peptides.
  • A 12-mer, 7-mer and 6-mer peptides (SEQ ID NOs: 270, 271 and 272, respectively) are immunogenic.
  • the antibodies induced by immunization exhibit statistically significantly higher binding activity to pathological tauA(1 -150; 392-441 )/4R than to physiological tau 2N4R ( p ⁇ 0.0079; p ⁇ 0.0052;
  • 5-mer peptides SEQ ID NOs: 273 and 274 are not immunogenic.
  • B 42-mer, 19-mer, 7-mer and 6-mer peptides (SEQ ID NOs: 275, 280, 276 and 277, respectively) are immunogenic.
  • Antibodies induced by these peptides statistically significantly (p ⁇ 0.0079, p ⁇ 0.0159, p ⁇ 0.0079 and p ⁇ 0.0379, respectively) discriminated between pathological tauA(1 -150;392-441 )/4R and physiological tau 2N4R.
  • 5-mer peptides SEQ ID NOs: 278 and 279 are not immunogenic.
  • FIG. 78 Geometric mean antibody titers of tau specific antibodies after immunization of C57BL mice with tau peptides. Vaccination of C57BL mice with tau peptide SEQ ID NOs: 270, 271 , 272, 275, 276, 277, 280, 281 and 283 induced formation of tau specific antibodies. Geometric mean antibody titers measured with ELISA show that antibodies elicited by vaccination with tau peptide SEQ ID NOs: 270, 271 , 272, 275, 276, 277, 280, 281 and 283 exhibited higher binding activity to pathological tauA(1 -150; 392- 441 )/4R than to physiological tau (tau2N4R). Lower titers of tau specific antibodies were detected after immunization of mice with tau peptides SEQ ID NOs: 273, 274, 278, 279 and 282.
  • FIG. 79A and 79B The isotype profile of antibodies induced by tau peptides is shown. Immunization of C57/BL mice with tau peptides carrying minimal DC8E8 epitope preferentially induced formation of lgG1 and lgG2b antibody isotypes specific to pathological tau. Pooled sera from individual mice were diluted 1 :800 and binding activity to pathological tauA(1 -150; 392-441 )/4R was analyzed by ELISA.
  • Figure 80 Quantitative evaluation of the binding capacity of antibodies, which were induced in mice C75BL immunized with tau peptides, to tauA(1 -150;392- 441 )/4R and 2N4R.
  • SPR Surface plasmon resonance
  • Figure 81 Antibodies induced in mice immunized with tau peptides recognize pathological forms of tau in Western blotting. Vaccination of C57BL mice with tau peptides SEQ ID NOs: 270, 271 , 272, 275, 276, 277, 280, 281 and 283 induced specific antibodies, which recognize pathological tau proteins isolated from human Alzheimer's disease brain tissue as well as from the brain stems of
  • transgenic rats SHR72 Antisera after immunization of mice with peptides SEQ ID NOs: 273, 274, 278, 279 and 282 did not recognize pathological tau forms.
  • Figures 82A-C Neurofibrillary tangles recognized by tau peptide- induced antibodies in human AD brain tissues. Vaccination of C57BL mice with tau peptides SEQ ID NOs: 270, 271 , 272, 275, 276, 277, 280, 281 and 283 induced antibodies recognizing neurofibrillary lesions in hippocampus of Alzheimer's disease brain. Sera from mice immunized with adjuvant only were used as a negative control. Brain tissue sections from the hippocampus CA1 were used. Scale bar: 100 ⁇ .
  • Figure 83 Summary of immunohistochemical staining (and respective relative intensities) of brain tissues from a human AD patient with sera antibodies generated from immunization of C57BL mice with tau peptides SEQ ID NOS: 270, 271 , 272, 273, 274, 275, 276, 277, 278, 279, 280, 281 , 282, and 283.
  • antibody refers to an immunoglobulin, whether genetically engineered, natural, or wholly or partially synthetically or recombinantly produced. All derivatives, portions, and fragments thereof that maintain antigen-binding properties and at least one of the tau-related characteristic properties according to the invention are also included in the term.
  • the term also encompasses any protein having a binding domain which is homologous or largely homologous to an immunoglobulin binding domain. These proteins can be derived from natural sources, or partly or wholly synthetically or recombinantly produced.
  • An antibody can be monoclonal or polyclonal.
  • the antibody can be a member of any immunoglobulin class, including any of the human classes: IgG, IgM, IgA, IgD, and IgE. Derivatives of the IgG class are preferred in some embodiments of the present invention.
  • isolated antibody and "isolated peptide” refer to a protein or peptide produced from cDNA-, recombinant RNA-, or any other synthetic-origin, or some combination thereof; as well as to proteins and peptides that, by virtue of their origin, or source of derivation, either (1 ) are not associated with proteins found in nature, (2) are free of other proteins from the same source, e.g. free of murine proteins, (3) are expressed by a cell from a different species, or (4) do not occur in nature.
  • the antibodies according to the invention include, in addition, such antibodies having "conservative sequence modifications,” nucleotide and amino acid sequence modifications which do not affect or alter the above-mentioned
  • substitutions include ones in which the amino acid residue is replaced with an amino acid residue having a similar side chain.
  • Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g.
  • glycine asparagine, glutamine, serine, threonine, tyrosine, cysteine, tryptophan
  • nonpolar side chains e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine
  • beta- branched side chains e.g., threonine, valine, isoleucine
  • aromatic side chains e.g., tyrosine, phenylalanine, tryptophan, histidine.
  • a predicted nonessential amino acid residue in a anti-tau antibody can be for example replaced with another amino acid residue from the same side chain family.
  • Antibody fragments and “antibody portions” comprise a portion of a full length antibody, generally at least the antigen binding portion/domain or the variable region thereof.
  • antibody fragments include diabodies, single- chain antibody molecules, immunotoxins, and multispecific antibodies formed from antibody fragments.
  • antibody fragments comprise single chain
  • polypeptides having the characteristics of a VH chain binding pathological tau namely being able to assemble together with a VL chain or of a VL chain binding to pathological tau, namely being able to assemble together with a VH chain to form a functional antigen binding pocket and thereby providing the property of binding to pathological tau.
  • the terms also comprise fragments that per se are not able to provide effector functions (e.g., ADCC/CDC) but provide this function after being combined with the appropriate antibody constant domain(s).
  • chimeric antibody refers to a monoclonal antibody comprising a variable region, i.e., binding region, from one source or species and at least a portion of a constant region derived from a different source or species, usually prepared by recombinant DNA techniques. Chimeric antibodies comprising a murine variable region and a human constant region are especially preferred. Such murine/human chimeric antibodies are the product of expressed immunoglobulin genes comprising DNA segments encoding murine immunoglobulin variable regions and DNA segments encoding human immunoglobulin constant regions.
  • Other forms of "chimeric antibodies" encompassed by the present invention are those in which the class or subclass has been modified or changed from that of the original antibody.
  • Such “chimeric” antibodies are also referred to as "class-switched antibodies.”
  • Methods for producing chimeric antibodies involve conventional recombinant DNA and gene transfection techniques now known in the art. See, e.g., Morrison, S. L, et al., Proc. Natl. Acad Sci. USA 81 (1984) 6851 -6855; U.S. Pat. Nos. 5,202,238 and 5,204,244.
  • humanized antibody refers to antibodies in which the framework regions (FR) and/or the complementarity determining regions (CDR) have been modified to comprise the CDR of an immunoglobulin of different specificity as compared to that of the parent immunoglobulin.
  • FR framework regions
  • CDR complementarity determining regions
  • a murine CDR is grafted into the framework region of a human antibody to prepare the "humanized antibody.” See, e.g., Riechmann, L, et al., Nature 332 (1988) 323-327; and
  • CDRs correspond to those representing sequences recognizing the antigens and epitopes described herein as "therapeutic epitopes" on tau.
  • human antibody is intended to include antibodies having variable and constant regions derived from human germline immunoglobulin sequences.
  • the constant regions of the antibody can be, for example, constant regions of human lgG1 type. Such regions can be allotypic and are described by, e.g., Johnson, G., and Wu, T. T., Nucleic Acids Res. 28 (2000) 214-218 and the databases referenced therein, and are preferentially useful for some embodiments, as long as the properties of induction of ADCC and for example CDC according to the invention are retained.
  • recombinant human antibody is intended to include all human antibodies that are prepared, expressed, created or isolated by recombinant means, such as antibodies isolated from a host cell such as a NSO or CHO cell or from an animal (e.g. a mouse such as a XENOMOUSE, a genetically modified mouse that produces antibodies having amino acid sequences of human antibodies, e.g., human framework (FR) and human constant region amino acid sequences) that is transgenic for human immunoglobulin genes or antibodies expressed using a recombinant expression vector transfected into a host cell.
  • recombinant human antibodies have variable and constant regions derived from human germline immunoglobulin sequences in a rearranged form.
  • the recombinant human antibodies according to the invention have been subjected to in vivo somatic hypermutation.
  • the amino acid sequences of the VH and VL regions of the recombinant antibodies are sequences that, while derived from and related to human germline VH and VL sequences, can not naturally exist within the human antibody germline repertoire in vivo.
  • effector functions includes, but is not limited to, C1 q binding; complement dependent cytotoxicity (CDC); Fc receptor binding; antibody-dependent cell-mediated cytotoxicity (ADCC); phagocytosis; and down regulation of cell surface receptors (e.g. B cell receptor; BCR).
  • epitope is used here to refer to binding sites recognized by a binding protein or an antibody.
  • Epitopes can be any molecule or grouping thereof, including, but not limited to, amino acids, amino acid side chains, sugars, and lipids, and can have a specific three-dimensional structure or conformation.
  • an epitope can comprise any portion of a tau peptide/protein molecule that includes primary, secondary, tertiary, or quaternary structure, as those terms are generally known in the art.
  • A"linear epitope” is made up of a continuous sequence of amino acid residues.
  • a linear epitope is one that is present on physiological tau (e.g., is present in tau 2N/4R).
  • a “conformational epitope” is an epitope to which the antibody or binding protein binds in a conformational-specific manner.
  • the binding can depend on the epitope-carrying-protein's secondary, tertiary, or quaternary structure.
  • the antibody binds in a structure- specific manner, a tertiary-structure-specific manner, or a quaternary-structure- specific manner.
  • a conformational epitope is one that is present in pathological tau (e.g., present in tauA(1 -150;392-441 )/4R)).
  • the term "therapeutic epitope” refers to regions within tau that were identified herein and were found to promote tau-tau aggregation, when in certain conformations (recognized by the DC8E8 antibody). Antibodies (and other binding proteins) that bind to one or more of these regions inhibit early and late stages of tau aggregation, including the conversion of tau monomer to dimer, and conversion to higher aggregate forms; i.e , the antibodies inhibit the conversion from physiological tau to pathological tau. These regions within tau can be involved in promoting tau fibrillization into paired helical filaments (PHFs), by promoting the formation of beta- sheets within adjacent regions of tau.
  • PHFs paired helical filaments
  • Therapeutic epitopes are comprised within 267-KHQPGGG-273 (within 1 st repeat domain of tau protein), 298-KHVPGGG-304 (within 2 nd repeat domain of tau protein), 329-HHKPGGG-335 (within 3 rd repeat domain of tau protein), and 361 -THVPGGG-367(within 4 th repeat domain of tau protein.
  • the therapeutic epitopes are each comprised within 268-HQPGGG-273 (within 1 st repeat domain of tau protein), 299-HVPGGG-304 (within 2 nd repeat domain of tau protein), 330-HKPGGG-335 (within 3 rd repeat domain of tau protein), and 362-HVPGGG-367, respectively.
  • the term "displaying a higher affinity for pathological tau than for physiological tau” refers to a higher degree of interaction between the antibody and at least one form of pathological tau than between the antibody and at least one form of physiological tau.
  • the interaction can be measured by, e.g., ELISA or surface plasmon resonance (SPR), as described in the EXAMPLES below.
  • the terms “specifically binds,” “binds specifically,” and “specific to,” are interchangeable and mean that an antibody or antigen-binding fragment thereof (or other binding protein) forms a complex with an antigen or epitope that is relatively stable under physiologic conditions.
  • Specific binding can be characterized by a dissociation constant of about 1 10 "6 M or smaller, for example less than about 100 nM, and most for example less than 10 nM.
  • Methods for determining whether two molecules specifically bind are known in the art and include, for example, equilibrium dialysis, surface plasmon resonance, and the like.
  • an antibody or antigen- binding fragment thereof provided by the invention is a molecule that binds the antigen or an epitope with such a dissociation constant of at least about 1 ⁇ 10 "6 M or smaller, but does not bind other molecules with such a dissociation constant.
  • Preferentially bind refers to binding with higher affinity to pathological tau than to physiological tau, for example, binding with higher affinity to tauA(1 - 150;392-441 )/4R than to 2N4R.
  • a "universal T-cell epitope” is a sequence selected from Influenza Hemagluttinin: HA307-319 (PKYVKQNTLKLAT) (SEQ ID NO: 123); PADRE
  • HBsA919_28 (FFLLTRILTI) (SEQ ID NO: 126); Heat Shock Protein 65:
  • hsp65153_171 (DQSIGDLIAEAMDKVGNEG) (SEQ ID NO: 127); bacille Calmette- Guerin (QVHFQPLPPAWKL) (SEQ ID NO: 128); Tetanus toxoid: TI830-844
  • the term "intrinsically disordered tau” refers to the normal/physiological form of tau protein, which lacks any defined 3D structure. It exists in the healthy brain (Kovacech et al., 2010).
  • Misdisordered truncated tau is able to induce neurofibrillary degeneration in vivo. It does not exist in a healthy brain (Kovacech et al., 2010). "Misordered tau” refers to a structured pathological form of tau assembled into polymers of PHFs, which form NFTs. Misordered tau does not exist in a healthy brain (Kovacech et al., 2010).
  • SHR24 refers to transgenic rat line that expresses tau type MB (151 - 391/R3).
  • the transgenic rats developed progressive age-dependent neurofibrillary degeneration in the cortical brain areas.
  • Neurofibrillary tangles (NFTs) in SHR24 rats satisfy several key histological criteria used to identify neurofibrillary degeneration in human Alzheimer's disease including argyrophilia, Congo red birefringence, and Thioflavin S reactivity. These criteria can be used for analysis of neurofibrillary degeneration in subjects receiving any of the embodiments of the invention.
  • Neurofibrillary tangles were also identified with antibodies used to detect pathologic tau in the human brain, including DC1 1 , recognizing an abnormal tau conformation and antibodies that are specific for hyperphosphorylated forms of tau protein.
  • neurofibrillary degeneration was characterized by extensive formation of sarkosyl insoluble tau protein complexes consisting of rat endogenous and truncated tau species (Filipcik et al., 2010).
  • SHR72 refers to transgenic rats that express human truncated tauA(1 -150;392-441 )/4R according to the International Patent Application PCT WO 2004/007547), in several brain regions and spinal cord. Generation of this rat line was described by Zilka et al., 2006, and tau pathology was described in Koson et al., 2008.
  • tau type IA refers to N- and C- terminally double truncated tau proteins that have at least the first 236 N-terminal amino acids and at least the last 45 C- terminal amino acids of the 4 repeat containing tau43 truncated.
  • tau type IB refers to N- and C- terminally double truncated tau proteins that have at least the first 236 N-terminal amino acids and at least the last 45 C- terminal amino acids of the 3 repeat containing tau44 truncated. The molecules are detectable in Alzheimer's diseased brain tissue whereas the molecules are not detectable in normal healthy brain tissue (WO2004/007547 A2).
  • tau type IIA refers to N- and C- terminally double truncated tau proteins that have at least the first 68 N-terminal amino acids and at least the last 40 C- terminal amino acids of the 4 repeat containing tau43 truncated.
  • the molecules are detectable in Alzheimer's diseased brain tissue whereas the molecules are not detectable in normal healthy brain tissue (WO2004/007547 A2).
  • tau type MB refers to N- and C- terminally double truncated tau proteins that have at least the first 68 N-terminal amino acids and at least the last 20 C- terminal amino acids of the 3 repeat containing tau44 truncated.
  • the molecules are detectable in Alzheimer's diseased brain tissue whereas the molecules are not detectable in normal healthy brain tissue (WO2004/007547 A2).
  • treatment refers to obtaining a desired pharmacologic and/or physiologic effect.
  • the effect can be prophylactic in terms of completely or partially preventing a disease or symptom thereof and/or can be therapeutic in terms of a partial or complete cure for a disease and/or adverse affect attributable to the disease.
  • Treatment also covers any treatment of AD or related tauopathies in a mammal, particularly in a human, and includes: (a) preventing the disease from occurring in a subject which can be predisposed to the disease or at risk of acquiring the disease but has not yet been diagnosed as having it; (b) inhibiting the disease, i.e., arresting its
  • treating refers to administering a therapeutic agent to a patient suspected of suffering or already suffering from AD or another tauopathy. It can also refer to reducing, eliminating, or at least partially arresting, as well as to exerting any beneficial effect, on one or more symptoms of the disease and/or associated with the disease and/or its complications.
  • prevention refers to administration to a patient susceptible to, or otherwise at risk of, a particular disease.
  • An individual in the general population is at risk for AD. Some individuals have an increased, genetic risk for AD.
  • Prevention can eliminate or reduce the risk or delay the onset of disease. Delay of onset or progression can be measured based on standard times of disease progression in similar populations or individuals.
  • Tauopathy refers to a disease associated with the formation of pathological tau.
  • Physiological tau refers to any one of the 6 isoforms of normal human tau, namely:
  • Pathological tau includes pathological tau conformers and structures and encompasses all of the following: Tau Type IA, IB, IIA, and MB, misordered, misdisordered tau (monomer, dimer, trimer, oligomer), misdisordered soluble tau, sarkosyl-insoluble tau, extracellular tau deposits, tau aggregates, paired helical filaments, neurofibrillary pathology, including neurofibrillary lesions, tangles, threads, fibrils, axonal spheriods, highly phosphorylated forms of truncated tau and of full- length tau, or any other form of tau associated with AD or another tauopathy.
  • Linked refers to attachment of a moiety to a peptide, antibody, or compound.
  • the moiety can be coupled, or complexed, or covalently or non- covalently attached.
  • the moiety can be chemically crosslinked or expressed or synthesized as a fusion with the peptide or antibody.
  • Moiety refers to any compound, organic, peptide, protein, nucleic acid, carrier, adjuvant, that is able to be attached to the peptide, antibody, or binding protein, but that is not the claimed peptide, antibody, or binding protein itself.
  • Immunogenic refers to something that can elicit an immune response.
  • the immune response can be antibody- or cell-mediated, or both.
  • adjuvant refers to a substance that is capable of increasing, amplifying, or modulating the immune response to the accompanying peptide.
  • “Other therapy” refers to additional therapies that the subject patients can receive.
  • “Clearance” refers to a reduction in levels or detection of pathological tau and/or a pathological tau structure. Clearance does not have to be a complete disappearance of pathological tau, i.e., it can be a partial disappearance.
  • promoting encompasses inducing, improving, or increasing.
  • Brain tissue refers to any neuronal tissue, e.g., from the brain, brain stem, and spinal cord.
  • the term “specific binding” and “high affinity”, respectively, refers to antibody binding to a predetermined antigen, i.e. the tau epitope defined above.
  • the antibody binds with a dissociation constant (KD) of 10 "6 M or less, and binds to the predetermined antigen with a KD that is at least twofold less than its KD for binding to a nonspecific antigen (e.g., BSA, casein, or any other specified polypeptide) other than the predetermined antigen.
  • KD dissociation constant
  • an antibody which binds specifically to an antigen As used herein "highly specific" binding means that the relative K D of the antibody for misdisordered tau is at least 4-fold less than the K D for binding that antibody to other ligands or to normal full-length tau.
  • prokaryotic is meant to include all bacteria which can be transformed or transfected with a DNA or RNA molecule for the expression of an antibody of the invention or one or more of the corresponding immunoglobulin chains.
  • Prokaryotic hosts can include gram negative as well as gram positive bacteria such as, for example, E. coli, S. typhimurium, Serratia marcescens and Bacillus subtilis.
  • eukaryotic is meant to include yeast, higher plant, insect and for example mammalian cells, most for example HEK 293, NSO, and CHO cells.
  • the term "chemical derivative” describes a molecule that contains additional chemical moieties that are not normally a part of the base molecule. Such moieties can improve the solubility, half-life, absorption, etc. of the base molecule. Alternatively the moieties can attenuate undesirable side effects of the base molecule or decrease the toxicity of the base molecule.
  • nucleic acid refers to a precise sequence of nucleotides, modified or not, defining a fragment or a region of a nucleic acid, containing unnatural nucleotides or not, and being either a double- strand DNA, a single-strand DNA or transcription products of said DNAs.
  • isolated polynucleotide or “isolated nucleic acid” as used herein shall mean a polynucleotide of genomic, cDNA, or synthetic origin or some combination thereof, which by virtue of its origin either (1 ) is not associated with all or a portion of a polynucleotide in which the "isolated polynucleotide” is found in nature, (2) is operably linked to a polynucleotide which it is not linked to in nature, or (3) does not occur in nature as part of a larger sequence.
  • 267-KHQPGGG-273 SEQ ID NO: 98
  • epitope #1 is located within 2
  • These antibodies are capable of recognizing misordered and misdisordered tau in human AD brains, as well as in transgenic rat models of AD and related tauopathies, expressing human misdisordered truncated tauA(1 -150;392-441 )/3R or tauA(1 -150;392-441 )/4R.
  • the isolated antibodies are also capable of interfering with one or several of the multiple tau-mediated activities contributing to AD pathology, including: (i) transition from either misordered or from physiological tau to misdisordered tau; (ii) formation of "pathological tau” monomers, dimers, trimers, and other tau multimers;” (iii) formation of insoluble tau aggregates; and (iv) promoting clearance of extracellular tau.
  • the disclosed invention is based, in part, on the discovery that antibodies that specifically bind to one of four previously unidentified functional regions of tau selected from 267-KHQPGGG-273 (SEQ ID NO: 98) (within 1 st repeat domain of tau protein), 298-KHVPGGG-304 (SEQ ID NO: 99) (within 2 nd repeat domain of tau protein), 329-HHKPGGG-335 (SEQ ID NO: 100) (within 3 rd repeat domain of tau protein), and 361 -THVPGGG-367 (SEQ ID NO: 101 ) (within 4 th repeat domain of tau protein) are capable of inhibiting formation of pathological tau aggregates , and of detecting various pathological forms of tau, some of which are the earliest formed in the disease (e.g., pathological monomers).
  • Hybridomas produced against human misdisordered tau II (151 -391 /4R), which is also referred in this application as tauA(1 -150;392-441 )/4R, were screened for the production of monoclonal antibodies specific to human PHFs both by immunohistochemistry (IHC) and Enzyme-linked Immuno Assays (ELISAs).
  • the resulting set included mouse monoclonal antibody (mAb) DC8E8, which is of the lgG1 subclass.
  • mAb mouse monoclonal antibody
  • Epitope mapping of DC8E8 revealed it to bind four previously unidentified epitopes on human tau.
  • further functional analysis of DC8E8 revealed that each epitope represents a distinct functional region within tau.
  • regions which can now be described as novel targets for AD diagnosis and therapy, and thus are referred to as "therapeutic epitopes,” are comprised within 267-KHQPGGG-273 (SEQ ID NO: 98) (within 1 st repeat domain of tau protein), 298-KHVPGGG-304 (SEQ ID NO: 99) (within 2 nd repeat domain of tau protein), 329-HHKPGGG-335 (SEQ ID NO: 100) (within 3 rd repeat domain of tau protein), and 361 -THVPGGG-367 (SEQ ID NO: 101 ) (within 4 th repeat domain of tau protein).
  • SEQ ID NO: 98 within 1 st repeat domain of tau protein
  • 298-KHVPGGG-304 SEQ ID NO: 99
  • 329-HHKPGGG-335 SEQ ID NO: 100
  • 361 -THVPGGG-367 SEQ ID NO: 101
  • one or more of the therapeutic epitopes is comprised within 268-HQPGGG-273 (SEQ ID NO: 223) (within 1 st repeat domain of tau protein), 299-HVPGGG-304 (SEQ ID NO: 154) (within 2 nd repeat domain of tau protein), 330-HKPGGG-335 (SEQ ID NO: 224) (within 3 rd repeat domain of tau protein), and 362-HVPGGG-367 (SEQ ID NO: 154) (within 4 th repeat domain of tau protein).
  • at least one of the therapeutic epitopes is comprised within 299-HVPGGG-304 (SEQ ID NO: 154) (within 2 nd repeat domain of tau protein).
  • one or more of the therapeutic epitopes is 299-HVPGGG-304 (SEQ ID NO: 154).
  • DC8E8 is capable of discriminating between pathological and normal tau proteins, suggesting that at least one of these four epitopes is conformational.
  • DC8E8 revealed that at least one of the regions encompassed by each of the four therapeutic epitopes shows a conformation in pathological tau that is different from the shape(s) it assumes in intrinsically disordered tau (normal tau).
  • DC8E8 is able to sense or detect that change in that it binds to pathological tau with a higher affinity than it binds to physiological tau.
  • DC8E8 binding to tau is capable of inhibiting tau-tau interactions leading up to the formation of pathological tau aggregates, as measured by DC8E8's ability to inhibit the formation of insoluble tau aggregates in vitro.
  • DC8E8 binding to normal tau is capable of preventing one or more of the
  • binding of DC8E8 to one of these four regions within normal tau is capable of preventing one of the earliest pathological changes in tau identified to date: a change that is needed to promote, or that iself promotes or allows for the formation of beta-sheets within tau.
  • binding of DC8E8 to one of these four regions within normal tau is capable of preventing one of the earliest pathological changes in tau identified to date: a change that is needed to promote, or that iself promotes or allows for the formation of beta-sheets within tau.
  • misdisordered/pathological tau i.e., after one or more of the four has already changed to a pathological conformation, is still capable of inhibiting pathological tau- tau aggregation at least because it still inhibits beta-sheet formation, blocks tau-tau physical interaction, or both.
  • antibodies that bind to one or more of these therapeutic epitopes, are capable of promoting the clearance of pathological tau from the extracellular environment, at least because they are capable of mediating the uptake and degradation of pathological tau by microglia, in vitro; a decrease in extracellular and intracellular tau in the brain, in vivo; or both.
  • these antibodies have the capacity to help reduce the damage that such pathological forms of tau cause to the brain.
  • antibodies that specifically bind to one or more therapeutic epitopes on tau wherein each of the therapeutic epitopes is separately located within amino acid residues 267-KHQPGGG-273 (SEQ ID NO: 98) (epitope #1 , within 1 st repeat domain of tau protein), 298-KHVPGGG-304 (SEQ ID NO: 99) (epitope #2, within 2 nd repeat domain of tau protein), 329-HHKPGGG-335 (SEQ ID NO: 100) (epitope #3, within 3 rd repeat domain of tau protein), and 361 - THVPGGG-367 (SEQ ID NO: 101 ) (epitope #4, within 4 th repeat domain of tau protein).
  • the therapeutic epitopes #1 through 4 are comprised within 268-HQPGGG-273 (SEQ ID NO: 223) (within 1 st repeat domain of tau protein), 299-HVPGGG-304 (SEQ ID NO: 154) (within 2 nd repeat domain of tau protein), 330- HKPGGG-335 (SEQ ID NO: 224) (within 3 rd repeat domain of tau protein), and 362- HVPGGG-367 (SEQ ID NO: 154) (within 4 th repeat domain of tau protein).
  • the antibodies can be monoclonal or polyclonal. Also included are antigen-binding antibody portions, antibody fragments, antibody variants, engineered proteins, and polymer scaffolds.
  • immunoglobulin molecules that comprises at least a portion of an immunoglobulin molecule, such as, but not limited to, at least one complementarity determining region (CDR) of a heavy or light chain or a ligand binding portion thereof, a heavy chain or light chain variable region, a heavy chain or light chain constant region, a framework region, or any portion thereof.
  • CDR complementarity determining region
  • a suitable antibody, antibody portion, fragment, or variant, as provided by the present invention can bind to at least one of the described therapeutic epitopes.
  • the term "antibody” also includes antibody digestion fragments, specified antibody portions and variants thereof, including antibody mimetics, or portions of antibodies that mimic the structure and/or function of an antibody or specified fragment or portion thereof, including single chain antibodies and fragments thereof.
  • Functional fragments include antigen-binding fragments that bind to one or more therapeutic epitopes.
  • antibody fragments capable of binding to a therapeutic epitope include, but are not limited to Fab (e.g., by papain digestion), Fab' (e.g., by pepsin digestion and partial reduction) and F(ab') 2 (e.g., by pepsin digestion), facb (e.g., by plasmin digestion), pFc' (e.g., by pepsin or plasmin digestion), Fd (e.g., by pepsin digestion, partial reduction and re- aggregation), Fv or scFv (e.g., by molecular biology techniques) fragments, are provided by the present invention. See also, William E.
  • Antibodies can also be produced in a variety of truncated forms using antibody genes in which one or more stop codons have been introduced upstream of the natural stop site.
  • a combination gene encoding an F(ab')2 heavy chain portion can be designed to include DNA sequences encoding the CH1 domain and/or hinge region of the heavy chain.
  • the various portions of antibodies can be joined together chemically by conventional techniques, or can be prepared as a contiguous protein using routine genetic engineering techniques.
  • the basic antibody structural unit is known to comprise a tetramer.
  • Each tetramer is composed of two identical pairs of polypeptide chains, each pair having one "light” (about 25-kDa) and one "heavy" chain (about 50-70 kDa).
  • the amino-terminal portion of each chain includes a variable region of about 100 to 1 10 or more amino acids primarily responsible for antigen recognition.
  • the carboxyl- terminal portion of each chain defines a constant region primarily responsible for effector function.
  • Human light chains are classified as kappa and lambda light chains.
  • Heavy chains are classified as mu, delta, gamma, alpha, or epsilon, and define the antibody's isotype as IgM, IgD, IgA, and IgE, respectively.
  • the variable and constant regions are joined by a "J" region of about 12 or more amino acids, with the heavy chain also including a "D” region of about 10 more amino acids. See generally, Fundamental Immunology Ch. 7 (Paul, W., ed., 2nd ed. Raven Press, N.Y. (1989)) (incorporated by reference in its entirety for all purposes).
  • the variable regions of each light/heavy chain pair form the antibody binding site.
  • an intact antibody has two binding sites.
  • both light and heavy chains comprise the domains FR1 , CDR1 , FR2, CDR2, FR3, CDR3 and FR4.
  • IMGT immunoglobulin deficiency genome sequence
  • a subject antibody comprises a light chain comprising an amino acid sequence having at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, or at least about 99% amino acid sequence identity to any one of SEQ ID NOs:141 , 143, 152, and 153.
  • a subject antibody comprises a light chain comprising an amino acid sequence that differs from any one of SEQ ID NOs:141 , 143, 152, and 153 by only one, two, three, four, five, six, seven, eight, nine, or ten amino acids. Those of ordinary skill in the art can determine which amino acids in a light chain variable region can be altered.
  • a subject antibody comprises a light chain comprising an amino acid sequence as set forth in any one of SEQ ID NOs:141 , 143, 152, and 153.
  • a subject antibody comprises a heavy chain comprising an amino acid sequence having at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, or at least about 99% amino acid sequence identity to any one of SEQ ID NOs:138, 140, 147, and 148.
  • a subject antibody comprises a heavy chain comprising an amino acid sequence that differs from any one of SEQ ID NOs:138, 140, 147, and 148 by only one, two, three, four, five, six, seven, eight, nine, or ten amino acids.
  • amino acids in a heavy chain variable region can be altered. For example, by comparing the amino acid
  • a subject antibody comprises a heavy chain comprising an amino acid sequence as set forth in any one of SEQ ID NOs:138, 140, 147, and 148.
  • a subject antibody comprises a light chain comprising an amino acid sequence as set forth in SEQ ID NO:141 and a heavy chain comprising an amino acid sequence as set forth in SEQ ID NO:138. In some embodiments, a subject antibody comprises a light chain comprising an amino acid sequence as set forth in SEQ ID NO:141 and a heavy chain comprising an amino acid sequence as set forth in SEQ ID NO:140. In some embodiments, a subject antibody comprises a light chain comprising an amino acid sequence as set forth in SEQ ID NO:141 and a heavy chain comprising an amino acid sequence as set forth in SEQ ID NO:147.
  • a subject antibody comprises a light chain comprising an amino acid sequence as set forth in SEQ ID NO:141 and a heavy chain comprising an amino acid sequence as set forth in SEQ ID NO:148. In some embodiments, a subject antibody comprises a light chain comprising an amino acid sequence as set forth in SEQ ID NO:143 and a heavy chain comprising an amino acid sequence as set forth in SEQ ID NO:138. In some embodiments, a subject antibody comprises a light chain comprising an amino acid sequence as set forth in SEQ ID NO:143 and a heavy chain comprising an amino acid sequence as set forth in SEQ ID NO:140.
  • a subject antibody comprises a light chain comprising an amino acid sequence as set forth in SEQ ID NO:143 and a heavy chain comprising an amino acid sequence as set forth in SEQ ID NO:147. In some embodiments, a subject antibody comprises a light chain comprising an amino acid sequence as set forth in SEQ ID NO:143 and a heavy chain comprising an amino acid sequence as set forth in SEQ ID NO:148. In some embodiments, a subject antibody comprises a light chain comprising an amino acid sequence as set forth in SEQ ID NO:152 and a heavy chain comprising an amino acid sequence as set forth in SEQ ID NO:138.
  • a subject antibody comprises a light chain comprising an amino acid sequence as set forth in SEQ ID NO:152 and a heavy chain comprising an amino acid sequence as set forth in SEQ ID NO:140. In some embodiments, a subject antibody comprises a light chain comprising an amino acid sequence as set forth in SEQ ID NO:152 and a heavy chain comprising an amino acid sequence as set forth in SEQ ID NO:147. In some embodiments, a subject antibody comprises a light chain comprising an amino acid sequence as set forth in SEQ ID NO:152 and a heavy chain comprising an amino acid sequence as set forth in SEQ ID NO:148.
  • a subject antibody comprises a light chain comprising an amino acid sequence as set forth in SEQ ID NO:153 and a heavy chain comprising an amino acid sequence as set forth in SEQ ID NO:138. In some embodiments, a subject antibody comprises a light chain comprising an amino acid sequence as set forth in SEQ ID NO:153 and a heavy chain comprising an amino acid sequence as set forth in SEQ ID NO:140. In some embodiments, a subject antibody comprises a light chain comprising an amino acid sequence as set forth in SEQ ID NO:153 and a heavy chain comprising an amino acid sequence as set forth in SEQ ID NO:147. In some embodiments, a subject antibody comprises a light chain comprising an amino acid sequence as set forth in SEQ ID NO:153 and a heavy chain comprising an amino acid sequence as set forth in SEQ ID NO:148.
  • the subject antibody comprises a light chain variable region comprising at least one, at least two, or three CDRs chosen from SEQ ID NOs. 1 17-1 19. In some embodiments, the subject antibody comprises a heavy chain variable region comprising at least one, at least two, or three CDRs chosen from SEQ ID NOs. 120-122. Also provided are embodiments in which any one of these six CDRs is altered as described in EXAMPLE 14. In some
  • At least one of the altered CDRs in the light chain is chosen from SEQ ID NO: 247 for CDR1 , SEQ ID NO: 253 for CDR2, and any one of SEQ ID NOs: 255, 257, 258, 259, and 260 for CDR3.
  • at least one of the altered CDRs in the heavy chain is chosen from SEQ ID NO: 261 , or SEQ ID NO: 262 for CDR1 , SEQ ID NO: 264, or SEQ ID NO: 265 for CDR2, and SEQ ID NO: 266, SEQ ID NO: 267, or SEQ ID NO: 269 for CDR3.
  • a bispecific or bifunctional antibody is an artificial hybrid antibody having two different heavy/light chain pairs and two different binding sites.
  • Bispecific antibodies can be produced by a variety of methods including fusion of hybridomas or linking of Fab' fragments. See, e.g., Songsivilai & Lachmann Clin. Exp. Immunol. 79: 315-321 (1990), Kostelny et al. J. Immunol. 148:1547-1553 (1992). Production of bispecific antibodies can be a relatively labor intensive process compared with production of conventional antibodies and yields and degree of purity are generally lower for bispecific antibodies. Bispecific antibodies do not exist in the form of fragments having a single binding site (e.g., Fab, Fab', and Fv).
  • the invention does not relate to antibodies in natural form, i.e., they are not taken from their natural environment but are isolated and obtained by purification from natural sources, or obtained by genetic recombination or chemical synthesis, and thus they can carry unnatural amino acids.
  • the twenty conventional amino acids and their abbreviations follow conventional usage. See Immunology-A Synthesis (2nd Edition, E. S. Golub and D. R. Gren, Eds., Sinauer Associates, Sunderland, Mass. (1991 )), which is incorporated herein by reference.
  • Stereoisomers e.g., D-amino acids, Nle, Nva, Cha, Orn, Hie, Chg, Hch, or Har
  • unnatural amino acids such as .alpha.-, . alpha. -disubstituted amino acids, N-alkyl amino acids, lactic acid, and other unconventional amino acids
  • unconventional amino acids include (i.e., are not limited to): 4-hydroxyproline, gamma.
  • the left-hand direction is the amino terminal direction and the right-hand direction is the carboxy-terminal direction, in accordance with standard usage and convention
  • nucleotide sequences in their natural chromosomal environment i.e., in a natural state.
  • the sequences of the present invention have been isolated and purified, i.e., they were sampled directly or indirectly, for example by a copy, their environment having been at least partially modified.
  • Isolated nucleic acids obtained by recombinant genetics, by means, for example, of host cells, or obtained by chemical synthesis are also provided
  • the "percentage identity" between two sequences of nucleic acids or amino acids means the percentage of identical nucleotides or amino acid residues between the two sequences to be compared, obtained after optimal alignment, this percentage being purely statistical and the differences between the two sequences being distributed randomly along their length.
  • the comparison of two nucleic acid or amino acid sequences is traditionally carried out by comparing the sequences after having optimally aligned them, said comparison being able to be conducted by segment or by using an "alignment window”.
  • Optimal alignment of the sequences for comparison can be carried out, in addition to comparison by hand, by means of the local homology algorithm of Smith and Waterman (1981 ) [Ad. App. Math.
  • the percentage identity between two nucleic acid or amino acid sequences is determined by comparing the two optimally-aligned sequences in which the nucleic acid or amino acid sequence to compare can have additions or deletions compared to the reference sequence for optimal alignment between the two sequences. Percentage identity is calculated by determining the number of positions at which the amino acid nucleotide or residue is identical between the two sequences, for example between the two complete sequences, dividing the number of identical positions by the total number of positions in the alignment window and multiplying the result by 100 to obtain the percentage identity between the two sequences.
  • the BLAST program "BLAST 2 sequences” (Tatusova et ai, "Blast 2 sequences - a new tool for comparing protein and nucleotide sequences", FEMS Microbiol., 1999, Lett. 174:247-250) available on the site http://www.ncbi.nlm.nih.gov/gorf/bl2.html, can be used with the default parameters (notably for the parameters "open gap penalty”: 5, and “extension gap penalty”: 2; the selected matrix being for example the "BLOSUM 62" matrix proposed by the program); the percentage identity between the two sequences to compare is calculated directly by the program.
  • amino acid sequence exhibiting at least 80%, for example 85%, 90%, 95% and 98% identity with a reference amino acid sequence
  • preferred examples include those containing the reference sequence, certain modifications, notably a deletion, addition or substitution of at least one amino acid, truncation or extension.
  • substitutions are preferred in which the substituted amino acids are replaced by "equivalent” amino acids.
  • the expression “equivalent amino acids” is meant to indicate any amino acids likely to be substituted for one of the structural amino acids without however modifying the biological activities of the corresponding antibodies and of those specific examples defined below.
  • Equivalent amino acids can be determined either on their structural homology with the amino acids for which they are substituted or on the results of comparative tests of biological activity between the various antibodies likely to be generated.
  • the table below summarizes the possible substitutions likely to be carried out without resulting in a significant modification of the biological activity of the corresponding modified antibody; inverse substitutions are naturally possible under the same conditions.
  • the invention provides an antibody produced by the mouse hybridoma cell line deposited with the American Type Culture Collection, (ATCC, 10801
  • Suitable antibodies can be produced by a cell line, a mixed cell line, an immortalized cell or clonal population of immortalized cells, as known in the art. See, e.g., Ausubel et al. (Ed.), Current Protocols in Molecular Biology, (John Wiley & Sons, Inc., New York, N.Y. (1987-2001 )); Sambrook et al., Molecular Cloning: A Laboratory Manual, 2nd Edition, (Cold Spring Harbor, N.Y.
  • a hybridoma is produced by fusing a suitable immortal cell line (e.g., a myeloma cell line) with one of a variety of antibody-producing cells.
  • suitable immortal cell lines include, but not limited to, Sp2/0, Sp2/0-AG14, P3/NS1/Ag4-1 , NSO, P3X63Ag8.653, MCP-1 1 , S-194, heteromyelomas, fusion products thereof, or any cell or fusion cell derived therefrom, or any other suitable cell line as known in the art, and/or commercially available for this purpose (e.g., ATCC).
  • Suitable antibody producing cells include, but are not limited to, isolated or cloned spleen, peripheral blood, lymph, tonsil, or other immune or B cell containing cells, or any other cells
  • sequences either as endogenous or heterologous nucleic acid, as recombinant or endogenous, viral, bacterial, algal, prokaryotic, amphibian, insect, reptilian, fish, mammalian, rodent, equine, ovine, goat, sheep, primate, eukaryotic, genomic DNA, cDNA, rDNA, mitochondrial DNA or RNA, chloroplast DNA or RNA, hnRNA, mRNA, tRNA, single, double or triple stranded, hybridized, and the like or any combination of the same. See, e.g., Ausubel, supra, and Colligan, Immunology, supra, Chapter 2, entirely incorporated herein by reference.
  • embodiments described above include, but are not limited to, methods that select recombinant antibodies from peptide or protein libraries, including those
  • mice comprise at least one transgene comprising DNA from at least one human immunoglobulin locus that is functionally rearranged, or which can undergo functional rearrangement; the endogenous immunoglobulin loci in such mice can be disrupted or deleted to eliminate the capacity of the animal to produce antibodies encoded by endogenous genes); selection methods including ribosome display, single cell antibody producing technologies (e.g., selected lymphocyte antibody method ("SLAM”)), and B-cell selection; subtractive
  • the antibodies are optimized full-length antibodies, chimeric or humanized, which can be produced by any one or a combination of known techniques, as listed and exemplified in, for example,
  • CDR grafting such as UBC's SLAM technology, PDL's SMART technology, Arana Therapeutics pic's Superhumanization, Framework patching, techniques for making composit human antibodies, BioAtla LLC's ATLAb platform, humaneering, Mutational Lineage Guided (MLG) strategies, deimmunisation strategies, humanation strategies, human engineering (e.g., XOMA's HE
  • the antibodies are fully human monoclonal antibodies, and can be produced by one or a combination of technology platforms, as listed and exemplified in, for example, Chapter 4 of "Business Insights, Preclinical Development of Monoclonal Antibodies and Related Biologicals-Emerging technologies and new therapeutic candidates, by James Shirvill, 2010,” and including, but not limited to: phage display (e.g., PDL, Dyax Corp; Cambridge, MA, US); Molecule Based Antibody Screening (MBAS) (e.g., Affitech A/S, described in, e.g., EP0547201 and US 6,730,483); cell based antibody selection (CBAS) platforms; Human Combinatorial Antibody Libraries (HuCAL; e.g., MorphoSys AG); MAbstract platforms (e.g.
  • phage display e.g., PDL, Dyax Corp; Cambridge, MA, US
  • MBAS Molecule Based Antibody Screening
  • Viventia platforms e.g., Fusogenics, UnLock, ImmunoMine
  • Natural Human Antibodies platforms (e.g., OncoMab, Patrys, Acceptys); MablgX (e.g., Kenta Biotech); Reverse Translational Medicine platforms (e.g., Neuimmune Therapeutics); l-STAR (e.g., Theraclone Sciences); CellSpot (e.g., Trellis
  • iBioLaunch e.g., iBio Inc.
  • the antibodies are modified by linking them to non-antibody agents, using one or more of the technology platforms and methods as described in Chapter s of "Business Insights, Preclinical Development of Monoclonal Antibodies and Related Biologicals-Emerging technologies and new therapeutic candidates, by James Shirvill, 2010,” including: antibody drug conjugate (e.g., ADC, Seattle Genetics); targeted antibody payload (TAP; Immunogen Inc); Probodies (e.g., CytomX Therapeutics); antibody cloaking (e.g., BioTransformations); targeted photodynamic therapy (e.g., PhotoBiotics; AlbudAb (e.g., GSK); hyFc (e.g.,
  • Ligand traps e.g., BioLogix
  • CovX-Body e.g., CovX
  • Dynamic Cross- Linking e.g., InNexus Biotechnology
  • LEC Technology e.g., Pivotal Biosciences, Morphotek
  • the antibody or its encoding cDNAs can be further modified.
  • the invention provides methods of producing the antibodies of the various embodiments, wherein the methods comprise any one of the step(s) of producing a chimeric antibody, humanized antibody, or an analog of any one of those.
  • the production of chimeric antibodies is as described in international application WO89/09622.
  • the antibody or its encoding cDNAs can be further modified.
  • the invention provides methods comprising any one of the step(s) of producing a single-chain antibody, Fab-fragment, bi-specific antibody, fusion antibody, labeled antibody or an analog of any one of those.
  • the antibody of the invention can exist in a variety of forms besides complete antibodies; including, for example, Fv, Fab and F(ab)2, as well as in single chains. See e.g. international application WO88/09344.
  • diabodies and V-like domain binding molecules are well-known to the person skilled in the art; see, e.g. U.S. Pat. No. 7,166,697.
  • the antibodies are modified or serve as the basis for making binding molecules with one or more of the antigen- binding properties described for the DC8E8 antibody.
  • binding proteins can be made by one or more of the techniques listed and exemplified in, for example, Chapter 6 of "Business Insights, Preclinical Development of Monoclonal Antibodies and Related Biologicals-Emerging technologies and new therapeutic candidates, by James Shirvill, 2010,” including:Fab, TetraMABs (e.g., Galileo Oncologics); scFv; Immuna (e.g., ESBA Tech AG); [scFv]2, including binding molecules that bind any two of the four therapeutic epitopes of DC8E8; BiTE (Affitech, Micromet AG);
  • Avibodies e.g., Avipep Pty
  • TandAb e.g., Affimed Therapeutics
  • Flexibody e.g., Affirmed
  • V-NAR e.g., AdAlta
  • Nanobody e.g., Ablynx NV
  • Domain Antibodies e.g, Diversys Ltd. GSK, US Patent No. 6,248,516 and EP0368684
  • Heteropolymer e.g., Elusys Therapeutics Inc.
  • Unibody e.g., GenMab A S
  • Domain Exchanged e.g., GenMab A S
  • Antibodies e.g., Calmune Corporation, Science. 2003 Jun 27;300(5628):2065-71 ); Small Modular ImmunoPharmaceuticals (SMIP) and SCORPION molecules (e.g., Trubion Pharmaceuticals); Dual Variable Domain Immunoglobulin, DVD-lg (Abbott Laboratories); and the like.
  • SMIP Small Modular ImmunoPharmaceuticals
  • SCORPION molecules e.g., Trubion Pharmaceuticals
  • Dual Variable Domain Immunoglobulin, DVD-lg (Abbott Laboratories); and the like.
  • the antibodies of the present invention or their corresponding immunoglobulin chain(s) can be further modified using conventional techniques known in the art, for example, by using amino acid deletion(s), insertion(s), substitution(s), addition(s), and/or recombination(s) and/or any other modification(s) known in the art either alone or in combination. See, e.g., the EXAMPLES provided further below. Methods for introducing such modifications in the DNA sequence underlying the amino acid sequence of an immunoglobulin chain are known to the person skilled in the art. See, e.g., Sambrook (supra) and Ausubel (Supra).
  • Modifications of the antibody of the invention include chemical and/or enzymatic derivatizations at one or more constituent amino acids, including side chain modifications, backbone modifications, and N- and C-terminal modifications including acetylation, hydroxylation, methylation, amidation, and the attachment or removal of carbohydrate or lipid moieties, cofactors, and the like.
  • the present invention encompasses the production of chimeric proteins which comprise the described antibody or some fragment thereof at the amino terminus fused to heterologous molecule such as an immunostimulatory ligand at the carboxyl terminus. See, e.g., international application WO00/30680 for corresponding technical details,
  • the invention relates to a method for the
  • the isolation comprises contacting the antibody- containing sample with one of the peptides provided by the invention, to which the antibody binds to.
  • the transformed hosts can be grown in fermentors and cultured according to techniques known in the art to achieve optimal cell growth. Once expressed, the whole antibodies, their dimers, individual light and heavy chains, or other immunoglobulin forms of the present invention, can be purified according to standard procedures of the art, including ammonium sulfate precipitation, affinity columns, column chromatography, gel electrophoresis and the like; see, Scopes, "Protein Purification", Springer Verlag, N.Y. (1982). The antibody or its
  • immunoglobulin chain(s) can then be isolated from the growth medium, cellular lysates, or cellular membrane fractions.
  • the isolation and purification of the, e.g., recombinantly expressed antibodies or immunoglobulin chains provided by the invention can be done by any conventional means such as, for example preparative chromatographic separations and immunological
  • Substantially pure immunoglobulins of at least about 90 to 95% homogeneity are preferred, and 98 to 99% or more homogeneity most preferred, for pharmaceutical uses.
  • the antibodies can then be used therapeutically (including extracorporally) or in developing and performing assay procedures.
  • the invention also provides antibodies coupled to other moieties for purposes such as drug targeting and imaging applications.
  • Such coupling can be conducted chemically after expression of the antibody to site of attachment or the coupling product can be engineered into the antibody of the invention at the DNA level.
  • the DNAs are then expressed in a suitable host system, and the expressed proteins are collected and renatured, if necessary.
  • the present invention also involves a method for producing cells capable of expressing an antibody of the invention or its corresponding
  • immunoglobulin chain(s) comprising genetically engineering cells with the
  • the cells obtainable by the method of the invention can be used, for example, to test the interaction of the antibody of the invention with its antigen.
  • the invention provides also antibody-producing cell lines and
  • the present invention further relates to diagnostic assays and kits that comprise the antibodies provided by the invention or an equivalent binding molecule and to therapeutic methods based thereon.
  • the invention also provides methods for producing antibodies that are capable of competing with DC8E8 and are also capable of inhibiting pathological tau- tau interactions. Those antibodies can be screened by their ability to sufficiently compete with DC8E8 for binding to tau and binding to one, two, three, or all four of the "therapeutic epitopes" identified herein.
  • the present invention also relates to polynucleotides encoding one or more of the antibody-based agents provided by the invention.
  • the nucleotide for example encodes at least the binding domain or variable region of an immunoglobulin chain of the antibodies described above.
  • said variable region encoded by the polynucleotide comprises at least one complementarity determining region (CDR) of the VH and/or VL of the variable region of the said antibody.
  • CDR complementarity determining region
  • each variable domain (the heavy chain VH and light chain VL) of an antibody comprises three hypervariable regions, sometimes called complementarity determining regions or "CDRs" flanked by four relatively conserved framework regions or "FRs" and refer to the amino acid residues of an antibody which are responsible for antigen-binding.
  • CDRs complementarity determining regions
  • FRs relatively conserved framework regions
  • the hypervariable regions or CDRs of the human IgG subtype of antibody comprise amino acid residues from residues 24-34 (L1 ), 50-56 (L2) and 89- 97 (L3) in the light chain variable domain and 31 -35 (H1 ), 50-65 (H2) and 95-102 (H3) in the heavy chain variable domain as described by Kabat et ai, Sequences of Proteins of Immunological Interest, 5th Ed Public Health Service, National Institutes of Health, Bethesda, Md. (1991 ) and/or those residues from a hypervariable loop, i.e.
  • the IMGT unique numbering provides a standardized delimitation of the framework regions (FR1 -IMGT: positions 1 to 26, FR2-IMGT: 39 to 55, FR3-IMGT: 66 to 104 and FR4-IMGT: 1 18 to 128) and of the complementarity determining regions: CDR1 -IMGT: 27 to 38, CDR2-IMGT: 56 to 65 and CDR3-IMGT: 105 to 1 17.
  • the IMGT unique numbering is used in 2D graphical representations, designated as IMGT Colliers de Perles. See, e.g., Ruiz, M. and Lefranc, M.-P., Immunogenetics, 53, 857-883 (2002); Kaas, Q. and Lefranc, M.-P., Current Bioinformatics, 2, 21 -30 (2007). It is also used for representing 3D
  • Framework or FR residues are those variable domain residues other than and bracketing the hypervariable regions.
  • the invention also relates to an isolated nucleic acid characterized in that it is selected among the following nucleic acids (including any degenerate genetic code):
  • nucleic acid DNA or RNA, coding for an antibody according to the invention
  • nucleic acid of at least 18 nucleotides capable of hybridizing under highly stringent conditions with at least one of the CDRs chosen from SEQ ID NOs. 1 17-122 and SEQ ID NOs. 247, 253, 255, 257-259, 122, 261 , 262, 264, 265-267, and 269; and d) a nucleic acid of at least 18 nucleotides capable of hybridizing under highly stringent conditions with at least the light chain of nucleic acid sequence SEQ ID 165 and/or the heavy chain of nucleic acid sequence SEQ ID No. 170, or a sequence with at least 80%, for example 85%, 90%, 95% and 98% identity after optimal alignment with sequences SEQ ID Nos. 165 and/or SEQ ID 170, for example with at least one of the CDRs therefrom according to the IMGT numbering.
  • Nucleic sequences exhibiting a percentage identity of at least 80%, for example 85%, 90%, 95% and 98%, after optimal alignment with a preferred sequence means nucleic sequences exhibiting, with respect to the reference nucleic sequence, certain modifications such as, in particular, a deletion, a truncation, an extension, a chimeric fusion and/or a substitution, notably punctual.
  • these are sequences which code for the same amino acid sequences as the reference sequence, this being related to the degeneration of the genetic code, or complementarity sequences that are likely to hybridize specifically with the reference sequences, for example under highly stringent conditions, notably those defined below.
  • Hybridization under highly stringent conditions means that conditions related to temperature and ionic strength are selected in such a way that they allow hybridization to be maintained between two complementarity DNA fragments.
  • the highly stringent conditions of the hybridization step for the purpose of defining the polynucleotide fragments described above are
  • DNA-DNA or DNA-RNA hybridization is carried out in two steps: (1 ) prehybridization at 42°C for three hours in phosphate buffer (20 mM, pH 7.5) containing 5X SSC (1 X SSC corresponds to a solution of 0.15 M NaCI + 0.015 M sodium citrate), 50% formamide, 7% sodium dodecyl sulfate (SDS), 10X Denhardt's, 5% dextran sulfate and 1 % salmon sperm DNA; (2) primary hybridization for 20 hours at a temperature depending on the length of the probe (i.e.: 42°C for a probe >100 nucleotides in length) followed by two 20-minute washings at 20°C in 2X SSC + 2% SDS, one 20-minute washing at 20°C in 0.1 X SSC + 0.1 % SDS.
  • the last washing is carried out in 0.1 X SSC + 0.1 % SDS for 30 minutes at 60°C for a probe >100 nucleotides in length.
  • the highly stringent hybridization conditions described above for a polynucleotide of defined size can be adapted by a person skilled in the art for longer or shorter oligonucleotides, according to the procedures described in Sambrook, et al. (Molecular cloning: a laboratory manual, Cold Spring Harbor Laboratory; 3rd edition, 2001 ).
  • the affinity or avidity of an antibody for an antigen can be determined experimentally using any suitable method; see, for example, Pope ME, Soste MV, Eyford BA, Anderson NL, Pearson TW. (2009) J Immunol Methods. 341 (1 -2):86-96. and methods described herein.
  • the measured affinity of a particular antibody- antigen interaction can vary if measured under different conditions, e.g., salt concentration, pH.
  • affinity and other antigen-binding parameters e.g., K sub D, IC50, are for example made with standardized solutions of antibody and antigen, and a standardized buffer.
  • variable domain of the antibody having the above-described variable domain can be used for the construction of other polypeptides or antibodies of desired specificity and biological function.
  • present invention also encompasses polypeptides and antibodies comprising at least one CDR of the above-described variable domain and which advantageously have substantially the same or similar binding properties as the antibody described in the appended examples.
  • the person skilled in the art will appreciate that using the variable domains or CDRs described herein antibodies can be constructed according to methods known in the art, e.g., as described in European patent applications EP 0 451 216 A1 and EP 0 549 581 A1 .
  • binding affinity can be enhanced by making amino acid substitutions within the CDRs or within the hypervariable loops (Chothia and Lesk, J. Mol. Biol. 196 (1987), 901 -917) which partially overlap with the CDRs, as defined by Kabat.
  • the present invention also relates to antibodies wherein one or more of the mentioned CDRs comprise one or more, for example not more than two amino acid
  • the antibody of the invention comprises in one or both of its immunoglobulin chains two or all three CDRs of the variable regions as set forth in FIGURES 3B and 3E. In some embodiments, the antibody of the invention comprises in one or both of its immunoglobulin chains two or all three CDRs as set forth in FIGURE 25B.
  • the polynucleotides or nucleic acids encoding the above described antibodies can be, e.g., DNA, cDNA, RNA or synthetically produced DNA or RNA or a recombinantly produced chimeric nucleic acid molecule comprising any of those polynucleotides either alone or in combination. In some embodiments,the
  • polynucleotide is part of a vector.
  • Such vectors can comprise further genes such as marker genes which allow for the selection of said vector in a suitable host cell and under suitable conditions.
  • the polynucleotide is operatively linked to one or more expression control sequences, allowing expression in prokaryotic or eukaryotic cells.
  • Expression of said polynucleotide comprises transcription of the polynucleotide into a translatable mRNA.
  • Regulatory elements ensuring expression in eukaryotic cells for example mammalian cells, are known to those skilled in the art. They usually comprise regulatory sequences ensuring initiation of transcription and optionally poly-A signals ensuring termination of transcription and stabilization of the transcript. Additional regulatory elements can include transcriptional as well as translational enhancers, and/or naturally associated or heterologous promoter regions.
  • polynucleotides encoding at least the variable domain of the light and/or heavy chain can encode the variable domains of both immunoglobulin chains or only one.
  • said polynucleotides can be under the control of the same promoter or can be separately controlled for expression.
  • Possible regulatory elements permitting expression in prokaryotic host cells comprise, e.g., the PL, lac, trp or tac promoter in E. coli, and examples for regulatory elements permitting expression in eukaryotic host cells are the AOX1 or GAL1 promoter in yeast or the CMV-, SV40-, RSV- promoter, CMV-enhancer, SV40-enhancer or a globin intron in mammalian and other animal cells.
  • Beside elements that are responsible for the initiation of transcription can also comprise transcription termination signals, such as the SV40-poly-A site or the tk-poly-A site, downstream of the polynucleotide.
  • transcription termination signals such as the SV40-poly-A site or the tk-poly-A site, downstream of the polynucleotide.
  • leader sequences capable of directing the polypeptide to a cellular compartment or secreting it into the medium can be added to the coding sequence of the polynucleotides and are known in the art.
  • the leader sequence(s) is (are) assembled in appropriate phase with translation, initiation and termination sequences, and optionally, a leader sequence capable of directing secretion of translated protein, or a portion thereof, into the periplasmic space or extracellular medium.
  • the heterologous sequence can encode a fusion protein including a C- or N-terminal identification peptide imparting desired characteristics, e.g., stabilization or simplified purification of expressed recombinant product.
  • suitable expression vectors include, without limitation, the Okayama-Berg cDNA
  • the expression control sequences can be eukaryotic promoter systems in vectors capable of transforming or transfecting eukaryotic host cells, but control sequences for prokaryotic hosts can also be used.
  • the vector Once the vector has been incorporated into the appropriate host, the host is maintained under conditions suitable for high level expression of the nucleotide sequences, and, as desired, the collection and purification of the immunoglobulin light chains, heavy chains, light/heavy chain dimers or intact antibodies, binding fragments or other immunoglobulin forms can follow. See, e.g., Beychok, Cells of Immunoglobulin Synthesis, Academic Press, N.Y., (1979).
  • the invention provides vectors, particularly plasmids, cosmids, viruses and bacteriophages used conventionally in genetic engineering that comprise a polynucleotide encoding a variable domain of an immunoglobulin chain of an antibody of the invention; optionally in combination with a polynucleotide of the invention that encodes the variable domain of the other immunoglobulin chain of an antibody of the invention.
  • said vector is an expression vector and/or a gene transfer or targeting vector.
  • Expression vectors derived from viruses such as retroviruses, vaccinia virus, adeno-associated virus, herpes viruses, or bovine papilloma virus, can be used for delivery of the polynucleotides or vector of the invention into targeted cell population. Any methods that are known to those skilled in the art can be used to construct recombinant viral vectors. See, for example, the techniques described in Sambrook (supra) and Ausubel (supra).
  • the polynucleotides and vectors provided by the invention can be reconstituted into liposomes for delivery to target cells.
  • the vectors containing the polynucleotides provided by the invention e.g., the heavy and/or light variable domain(s) of the immunoglobulin chains encoding sequences and expression control sequences
  • the vectors containing the polynucleotides provided by the invention can be transferred into the host cell by known methods, which vary depending on the type of cellular host. For example, calcium chloride transfection is commonly utilized for prokaryotic cells, whereas calcium phosphate treatment or electroporation can be used for other cellular hosts.
  • the present invention furthermore relates to host cells transformed with a polynucleotide or vector provided by the invention.
  • the host cell can be a prokaryotic or eukaryotic cell.
  • the polynucleotide or vector that is present in the host cell can either be integrated into the genome of the host cell or it can be maintained extrachromosomally.
  • the host cell can be any prokaryotic or eukaryotic cell, such as a bacterial, insect, fungal, plant, animal or human cell.
  • Preferred fungal cells are, for example, those of the genus Saccharomyces, in particular those of the species S. cerevisiae.
  • the antibodies or immunoglobulin chains encoded by the polynucleotide of the present invention can be glycosylated or can be non-glycosylated. Certain antibodies provided by the invention, or the corresponding immunoglobulin chains, can also include an initial methionine amino acid residue.
  • a polynucleotide of the invention can be used to transform or transfect the host using any of the techniques commonly known to those of ordinary skill in the art. Furthermore, methods for preparing fused, operably linked genes and expressing them in, e.g., mammalian cells and bacteria are well-known in the art. See, e.g., Sambrook.
  • the genetic constructs and methods described therein can be utilized for expression of the antibodies provided by the invention, or their corresponding immunoglobulin chains, in eukaryotic or prokaryotic hosts.
  • expression vectors containing promoter sequences which facilitate the efficient transcription of the inserted polynucleotide are used in connection with the host.
  • the expression vector typically contains an origin of replication, a promoter, and a terminator, as well as specific genes which are capable of providing phenotypic selection of the transformed cells.
  • Suitable source cells for the DNA sequences and host cells for immunoglobulin expression and secretion can be obtained from a number of sources, such as the American Type Culture Collection ("Catalogue of Cell Lines and Hybridomas," Fifth edition (1985) Manassas, VA, U.S.A., and other available version, incorporated herein by reference).
  • transgenic animals for example mammals, comprising cells of the invention can be used for the large scale production of the antibody of the invention.
  • the present invention encompasses small peptides including those containing a binding molecule as described above, for example containing the CDR3 region of the variable region of any one of the mentioned antibodies, in particular CDR3 of the heavy chain since it has frequently been observed that, for certain antibodies, the heavy chain CDR3 (HCDR3) is the region having a greater degree of variability and a predominant participation in antigen- antibody interaction.
  • Such peptides can be synthesized or produced by recombinant means to produce a binding agent useful according to the invention. Such methods are known to those of ordinary skill in the art.
  • Peptides can be synthesized for example, using automated peptide synthesizers which are commercially available.
  • the peptides can also be produced by recombinant techniques by incorporating the DNA expressing the peptide into an expression vector and transforming cells with the expression vector to produce the peptide.
  • the above described fusion proteins can further comprise a cleavable linker or cleavage site for proteinases, which can be called spacer moieties. These spacer moieties, in turn, can be either insoluble or soluble (Diener et al., Science 231 (1986), 148) and can be selected to enable drug release from the antibody at the target site.
  • therapeutic agents which can be coupled to the antibodies of the present invention for immunotherapy are drugs, radioisotopes, lectins, and toxins.
  • the drugs that can be conjugated to the antibodies and antigens of the present invention include compounds which are classically referred to as drugs such as mitomycin C, daunorubicin, and vinblastine.
  • radioisotopically conjugated antibodies or antigens of the invention for, e.g., immunotherapy, certain isotopes can be more preferable than others depending on such factors as leukocyte distribution as well as isotype stability and emission. Depending on the autoimmune response, some emitters can be preferable to others. In general, alpha and beta particle emitting radioisotopes are preferred in immunotherapy. In certain preferred cases, the radioisotopes are short range, high energy alpha emitters such as 212 Bi.
  • radioisotopes which can be bound to the antibodies or antigens of the invention for therapeutic purposes are 125 l, 131 1, 90 Y, 67 Cu, 212 Bi, 212 At, 211 Pb, 47 Sc, 109 Pd and 188 Re. In certain cases, the radiolabel is 64 Cu.
  • Other therapeutic agents which can be coupled to the antibody or antigen of the invention, as well as ex vivo and in vivo therapeutic protocols, are known, or can be ascertained, by those of ordinary skill in the art. Wherever appropriate, the person skilled in the art can use a polynucleotide of the invention encoding (and as the source for) any one of the above described antibodies, antigens, or the corresponding vectors, instead of the proteinaceous material itself.
  • the invention also relates to the use of a binding molecule or an antibody, as provided herein, for the preparation of a composition for use in vivo for suppressing formation of, or for otherwise reducing the levels of, misdisordered and/or misordered tau in a subject; or for extra-corporeal extraction of pathological tau compounds or their precursors from body fluids.
  • These methods can be used for improving cognition or slowing or reversing cognitive decline associated with diseases.
  • the antibody or binding molecules provided by the invention, or chemical derivatives thereof, can be administered directly to the blood or CSF and
  • the present invention also relates to a method of treating or preventing the onset or progression of Alzheimer's disease or related tauopathies in a subject comprising removing blood or CSF from the body of the subject, subjecting the blood and CSF and returning to the subject the blood and CSF, respectively, so obtained.
  • the invention provides antibodies that recognize and distinguish distinct forms of tau protein that are present at distinct stages of Alzheimer's disease. These antibodies are capable of detecting tau (and its various conformational changes) both in vitro and in vivo.
  • the antibodies can distinguish between physiological and pathological tau in a variety of assays, including biochemical, immunoprecipitation, ELISA, Western blotting, and immunohistochemistry assays (e.g., fresh, fixed, frozen, paraffin-embeded), as well as in vivo imaging using, e.g., radiolabeled DC8E8 (including fragments of DC8E8 such as single chain DC8E8), which distinguishes physiological from pathological tau (see EXAMPLES).
  • assays including biochemical, immunoprecipitation, ELISA, Western blotting, and immunohistochemistry assays (e.g., fresh, fixed, frozen, paraffin-embeded), as well as in vivo imaging using, e.g., radiolabeled DC8
  • the antibodies of the present invention can be labeled (e.g., fluorescent, radioactive, enzyme, nuclear magnetic, heavy metal) and used to detect specific targets in vivo or in vitro including immunochemistry-like assays in vitro (see, e.g., the EXAMPLES described below). Also, in vivo, they could be used in a manner similar to nuclear medicine imaging techniques to detect tissues, cells, or other material having misdisordered tau and deposits thereof. Targeting
  • the invention provides for the use of the antibodies described herein for the preparation of a composition for, and in methods of, tau detection and/or targeting a diagnostic agent to pathological tau and neurofibrillary lesions of the brain for AD diagnosis. These compositions and methods can be used as part of a treatment protocol for AD and related tauopathies.
  • the invention provides antibodies suitable for use in immunoassays in which they can be utilized in liquid phase or bound to a solid phase carrier.
  • immunoassays which can utilize the antibodies of the invention are competitive and non-competitive immunoassays in either a direct or indirect format.
  • immunoassays are the radioimmunoassay (RIA), the sandwich (immunometric assay), flow cytometry and the Western blot assay.
  • the antibodies of the invention can be bound to one of many different carriers and used to isolate cells specifically bound thereto.
  • carriers include glass, polystyrene, polyvinyl chloride, polypropylene, polyethylene, polycarbonate, dextran, nylon, amyloses, natural and modified celluloses, polyacrylamides, agaroses, and magnetite.
  • the carrier can be either soluble or insoluble for the purposes of the invention.
  • labels There are many different labels and methods of labeling known to those of ordinary skill in the art.
  • Examples of the types of labels that can be used in the present invention include enzymes, radioisotopes and radionuclides, colloidal metals, fluorescent compounds, chemiluminescent compounds, biotinyl groups,
  • predetermined polypeptide epitopes recognized by a secondary reporter e.g., leucine zipper pair sequences, binding sites for secondary antibodies, metal binding domains, epitope tags
  • chemi/electrochemi/bioluminescent compounds include peroxidase (e.g, HRP), luciferase, alkaline phosphatase, a-D- galactosidase, glucose oxidase, glucose amylase, carbonic anhydrase, acetylcholinesterase, lysozyme, malate dehydrogenase or glucose-6 phosphate
  • the label is biotin, digoxigenin, or 5-bromo- desoxyuridine.
  • Fluorescent labels can be also combined with the antibodies and tau- binding proteins provided by the invention, including rhodamine, lanthanide phosphors, fluorescein and its derivatives, fluorochromes, rhodamine and its derivatives, green fluorescent protein (GFP), Red Fluorescent Protein (RFP) and others, dansyl, umbelliferone.
  • the antibodies/binding proteins of the invention can be prepared by methods known to a person skilled in the art.
  • Conjugates carrying fluorescein labels can be prepared by, for example, reaction with an isothiocyanate. In certain situations, the label or marker can also be therapeutic.
  • Others conjugates can include chemiluminescent labels such as luminol and dioxetane, bioluminescent labels such as luciferase and luciferin, or radioactive labels such as iodine 123 , iodine 125 , iodine 126 , iodine 133, 131 , bromine 77 , technetium” 111 , indium 111 , indium 1 13 " 1 , gallium 67 , gallium 68 , ruthenium 95 , ruthenium 97 , ruthenium 103 , ruthenium 105 , mercury 107 , mercury 203 , rhenium 99 “ 1 , rhenium 101 , rhenium 105 , scandium 47 , tellurium 121 " 1 , tellurium 122 “ 1 , tellurium 125 “ 1 , thulium 165 , thulium 167 , thulium 168
  • the invention also provides antibodies and other tau-binding molecules that can also be used in a method for the diagnosis of a disorder in an individual by obtaining a body fluid sample from the individual, which can be a blood sample, a lymph sample or any other body fluid sample and contacting the body fluid sample with an antibody of the instant invention under conditions enabling the formation of antibody-antigen complexes. The presence and/or amount of such complexes is then determined by methods known in the art, a level significantly higher than that formed in a control sample indicating the presence of disease in the tested
  • the present invention relates to an in vitro immunoassay comprising an antibody of the invention.
  • the present invention relates to in vivo imaging
  • the medical imaging technique Positron emission tomography (PET) which produces a three-dimensional image of body parts is based on the detection of radiation from the emission of positrons.
  • PET Positron emission tomography
  • a biomolecule is radioactively labeled, e.g. it incorporates a radioactive tracer isotope.
  • the radioactively labeled biomolecule becomes concentrated in tissues of interest. The subject is then placed in the imaging scanner, which detects the emission of positrons.
  • a labeled, for example 64 Cu labeled binding molecule such as an antibody is administered to a subject and detection of the binding molecule and thus misdisordered or misordered tau is performed by placing the subject in an imaging scanner and detecting the emission of positrons, thereby indicating a neurological disorder if emission is detected.
  • the present invention thus encompasses a method for PET imagining, comprising the step of administering a 64 Cu-labelled or equivalent labeled binding molecule of the present invention to a subject.
  • the present invention also provides an article of manufacture, such as pharmaceutical and diagnostic packs or kits comprising one or more containers filled with one or more of the above described ingredients, i.e. binding molecule, antibody or binding fragment thereof, polynucleotide, vector or cell, as provided by the invention.
  • Associated with such container(s) can be a notice in the form prescribed by a governmental agency regulating the manufacture, use or sale of
  • kits comprises reagents and/or instructions for use in appropriate diagnostic assays.
  • the composition or kit of the present invention is suitable for the diagnosis, prevention, and treatment of Alzheimer's disease and related tauopathies
  • binding molecules e.g., antibodies provided by the invention suggests that they have sufficient affinity to make them candidates for drug localization/drug delivery to cells or tissue.
  • the targeting and binding to misdisordered tau deposits could be useful for the delivery of
  • the invention provides for the use of the antibodies described herein for the preparation of a composition for, and in methods of, detection and/or targeting a therapeutic or diagnostic agent to pathological tau and neurofibrillary lesions of the brain.
  • compositions and methods can be used as part of a treatment protocol for AD and related tauopathies.
  • compositions comprising one or more of the aforementioned compounds, including binding molecules, antibodies, binding fragments; chemical derivatives thereof; polynucleotides, vectors, and cells.
  • Certain compositions can further comprise one or more pharmaceutically acceptable carriers and one or more pharmaceutically acceptable diluents.
  • Certain chemical derivatives comprise chemical moieties that are not normally a part of the base molecule or cell (e.g, of the antibody, binding molecule, polynucleotides, vectors, and cells) but are linked to them by routine methods. Such moieties can function to, for example, improve the solubility, half-life, visualization, detectability, and/or absorption, of the base molecule or cell. Alternatively, the moieties can attenuate undesirable side effects of the base molecule or decrease the toxicity of the base molecule.
  • the invention also provides pharmaceutical compositions comprising combinations of the antibodies provided herein with further agents, such as with interleukins or interferons, depending on the intended use of the pharmaceutical composition.
  • additional agent can be selected from the group consisting of small organic molecules, anti-tau antibodies, anti-beta-amlyoid antibodies, and combinations thereof.
  • agents include, but are not limited to, acetylcholinesterase inhibitors, NMDA receptor antagonists, transition metal chelators, growth factors, hormones, non-steroidal anti-inflammatory drugs (NSAID), antioxidants, lipid lowering agents, selective phosphodiesterase inhibitors, inhibitors of tau aggregation, inhibitors of protein kinases, inhibitors of heat shock proteins, anti-amyloid-passive and -active immunization reagents, anti-amyloid aggregation inhibitors, and secretase inhibitors.
  • NSAID non-steroidal anti-inflammatory drugs
  • the present invention relates to the use of the binding molecule, antibody or binding fragment of the present invention or of a binding molecule having substantially the same binding specificities of any one thereof, the polynucleotide, the vector or the cell of the present invention for the preparation of a pharmaceutical or diagnostic composition for treating or preventing the progression of Alzheimer's disease or related tauopathies; for the amelioration of symptoms associated with Alzheimer's disease or related tauopathies; for diagnosing or screening a subject for the presence of Alzheimer's disease or related tauopathies for determining a subject's risk for developing Alzheimer's disease or related tauopathies.
  • the present invention is based in part on the discovery that certain fragments of tau are active in inducing an immune response to pathological tau when injected into rat models of AD, and would be expected to do so in humans.
  • These immunogenic tau fragments which comprise one or more of the regions of tau identified above, through DC8E8, as promoters or at least participants in the development and progression of AD, were found capable of (i) promoting clearance of extracellular tau deposits within AD brains (rat models); (ii) inducing the production of protective antibodies against AD in an animal model; and/or (iii) slowing the progression of AD in the recipient subjects, as measured by one or more
  • the invention provides immunogens or immunogenic peptides derived from newly identified regions of the tau protein that are important for the formation of the core of PHFs and promote PHF assembly in vitro. Strategically targeting these regions ("therapeutic epitopes") can lead to the successful treatment of AD and related tauopathies. Immunogens can be screened for therapeutic efficacy in an animal model, such as the transgenic rat models described below.
  • tau peptides for example encompass one of the following amino acid sequences, within which is separetely comprised each of the four therapeutic epitopes: a) SEQ ID NO:98 tau 267- KHQPGGG-273, b) SEQ ID NO:99 tau 298-KHVPGGG-304, c) SEQ ID NO:100 tau 329-HHKPGGG-335, and d) SEQ ID NO:101 tau 361 -THVPGGG-367 (numbered according to the longest human tau isoform tau 2N4R, 441 residues-long, see SEQ ID NO:102).
  • tau peptides comprise at least one therapeutic epitope, wherein the therapeutic epitope is selected from SEQ ID NO:223 tau 268- HQPGGG-273, SEQ ID NO:154 tau 299-HVPGGG-304, SEQ ID NO:224 tau 330- HKPGGG-335, and SEQ ID NO:154 tau 362-HVPGGG-367.
  • the invention provides 30-amino acid long immunogens, such as any one of the SEQ ID NOs shown in the Table 1 .
  • Each one of the immunogens included in Table 1 is an isolated fragment of tau that contains one of the therapeutic epitopes, located within SEQ ID NO:98, SEQ ID NO:99, SEQ ID NO:100, and SEQ ID NO:101 .
  • Table 1 Tau 30-mer peptides each carrying one therapeutic epitope
  • SEQ ID NO:20 Tau257-286 KSKIGSTENLKHQPGGGKVQIINKKLDLSN
  • SEQ ID NO:28 Tau266-295 LKHQPGGGKVQIINKKLDLSNVQSKCGSKD
  • SEQ ID NO:30 Tau 276-305 QIINKKLDLSNVQSKCGSKDNIKHVPGGGS
  • SEQ ID NO:31 Tau 277-306 IINKKLDLSNVQSKCGSKDNIKHVPGGGSV
  • SEQ ID NO:32 Tau 278-307 INKKLDLSNVQSKCGSKDNIKHVPGGGSVQ
  • SEQ ID NO:33 Tau 279-308 NKKLDLSNVQSKCGSKDNIKHVPGGGSVQI
  • SEQ ID NO:34 Tau 280-309 KKLDLSNVQSKCGSKDNIKHVPGGGSVQIV
  • SEQ ID NO:35 Tau 281 -310 KLDLSNVQSKCGSKDNIKHVPGGGSVQIVY
  • SEQ ID NO:36 Tau 282-31 1 LDLSNVQSKCGSKDNIKHVPGGGSVQIVYK
  • SEQ ID NO:38 Tau 284-313 LSNVQSKCGSKDNIKHVPGGGSVQIVYKPV
  • SEQ ID NO:39 Tau 285-314 SNVQSKCGSKDNIKHVPGGGSVQIVYKPVD
  • SEQ ID NO:40 Tau 286-315 NVQSKCGSKDNIKHVPGGGSVQIVYKPVDL
  • SEQ ID NO:42 Tau 288-317 QSKCGSKDNIKHVPGGGSVQIVYKPVDLSK
  • SEQ ID NO:43 Tau 289-318 SKCGSKDNIKHVPGGGSVQIVYKPVDLSKV
  • SEQ ID NO:44 Tau 290-319 KCGSKDNIKHVPGGGSVQIVYKPVDLSKVT
  • SEQ ID NO:49 Tau 296-325 NIKHVPGGGSVQIVYKPVDLSKVTSKCGSL
  • SEQ ID NO:50 Tau 297-326 IKHVPGGGSVQIVYKPVDLSKVTSKCGSLG
  • SEQ ID NO:51 Tau 298-327 KHVPGGGSVQIVYKPVDLSKVTSKCGSLGN
  • SEQ ID NO:52 Tau 307-336 QIVYKPVDLSKVTSKCGSLGNIHHKPGGGQ
  • SEQ ID NO:53 Tau 308-337 IVYKPVDLSKVTSKCGSLGNIHHKPGGGQV
  • SEQ ID NO:54 Tau 309-338 VYKPVDLSKVTSKCGSLGNIHHKPGGGQVE
  • SEQ ID NO:55 Tau 310-339 YKPVDLSKVTSKCGSLGNIHHKPGGGQVEV
  • SEQ ID NO:56 Tau 31 1 -340 KPVDLSKVTSKCGSLGNIHHKPGGGQVEVK
  • SEQ ID NO:58 Tau 313-342 VDLSKVTSKCGSLGNIHHKPGGGQVEVKSE
  • SEQ ID NO:59 Tau 314-343 DLSKVTSKCGSLGNIHHKPGGGQVEVKSEK
  • SEQ ID NO:60 Tau 315-344 LSKVTSKCGSLGNIHHKPGGGQVEVKSEKL
  • SEQ ID NO:61 Tau 316-345 SKVTSKCGSLGNIHHKPGGGQVEVKSEKLD
  • SEQ ID NO:62 Tau 317-346 KVTSKCGSLGNIHHKPGGGQVEVKSEKLDF
  • SEQ ID NO:64 Tau 319-348 TSKCGSLGNIHHKPGGGQVEVKSEKLDFKD
  • SEQ ID NO:65 Tau 320-349 SKCGSLGNIHHKPGGGQVEVKSEKLDFKDR
  • SEQ ID NO:66 Tau 321 -350 KCGSLGNIHHKPGGGQVEVKSEKLDFKDRV
  • SEQ ID NO:68 Tau 323-352 GSLGNIHHKPGGGQVEVKSEKLDFKDRVQS
  • SEQ ID NO:69 Tau 324-353 SLGNIHHKPGGGQVEVKSEKLDFKDRVQSK
  • SEQ ID NO:70 Tau 325-354 LGNIHHKPGGGQVEVKSEKLDFKDRVQSKI
  • SEQ ID NO:71 Tau 326-355 GNIHHKPGGGQVEVKSEKLDFKDRVQSKIG
  • SEQ ID NO:72 Tau 327-356 NIHHKPGGGQVEVKSEKLDFKDRVQSKIGS
  • SEQ ID NO:74 Tau 329-358 HHKPGGGQVEVKSEKLDFKDRVQSKIGSLD
  • SEQ ID NO:84 Tau 348-377 DRVQSKIGSLDNITHVPGGGNKKIETHKLT
  • SEQ ID NO:86 Tau 350-379 VQSKIGSLDNITHVPGGGNKKIETHKLTFR
  • the immunogenic peptide is chosen from SEQ ID NO:1 tau 251 -PDLKNVKSKIGSTENLKHQPGGGKVQIINK-280; SEQ ID NO:2 tau 256-VKSKIGSTENLKHQPGGGKVQIINKKLDLS-285; SEQ ID NO:3 tau 259- KIGSTENLKHQPGGGKVQIINK KLDLSNVQ-288; and SEQ ID NO:4 tau 275- VQIINKKLDLSNVQSKCGSKDNIKHVPGGG-304.
  • the invention also provides for shorter and longer immunogenic peptides for use in the present invention that contain one or more of the amino acid sequences SEQ ID NO:98 267-KHQPGGG-273, or amino acids SEQ ID NO:99 298- KHVPGGG-304, or amino acids SEQ ID NO:100 329-HHKPGGG-335, or amino acids SEQ ID NO:101 361 -THVPGGG-367 can be derived from any one of the six isoforms of human tau protein.
  • an immunogenic peptide comprises at least one therapeutic epitope, wherein the therapeutic epitope is selected from SEQ ID NO:223 tau 268-HQPGGG-273, SEQ ID NO:154 tau 299- HVPGGG-304, SEQ ID NO:224 tau 330-HKPGGG-335, and SEQ ID NO:154 tau 362-HVPGGG-367.
  • the immunogenic peptide comprises a sequence selected from SEQ ID NO:109 Tau 314-
  • DLSKVTSKCGSLGNIHHKPGGGQVEVKSE-342 SEQ ID NO:1 10 Tau 352- SKIGSLDNITHVPGGGNKKIETHKLTFREN-380; SEQ ID NO:1 1 1 Tau 325- LGNIHHKPGGGQ-336; SEQ ID NO:1 12 Tau 357-LDNITHVPGGGN-368; SEQ ID NO:108 Tau 294-305 KDNIKHVPGGGS.
  • At least one immunogenic peptide is chosen from any one of SEQ ID NOs: 1 -4, SEQ ID NOs: 9- 101 , and SEQ ID NOs: 108-1 12, NIKAVPGGGS (SEQ ID NO: 200), NIKHVPGGGS (SEQ ID NO: 201 ), IKHVPGGGS (SEQ ID NO: 202), KHVPGGGSV (SEQ ID NO: 203), HVPGGGSVQ (SEQ ID NO: 204), VPGGGSVQ (SEQ ID NO: 205),
  • GWSIHSPGGGSC SEQ ID NO: 250
  • SVFQHLPGGGSC SEQ ID NO: 251
  • ANIKHVPGGGS SEQ ID NO: 144
  • DAIKHVPGGGS SEQ ID NO: 146
  • DNAKHVPGGGS (SEQ ID NO: 149), DNIAHVPGGGS (SEQ ID NO: 151 ),
  • DNIKAVPGGGS (SEQ ID NO: 159), DNIKHAPGGGS (SEQ ID NO: 161 ), and DNIKHVPGGGS (SEQ ID NO: 171 ).
  • the use of peptide-based vaccines to elicit immune responses in diseases for which no conventional vaccines are yet available is attractive (Brown, 1994; BenYedidia, et al., 1997).
  • small peptides are poor immunogens because they act as haptens that lack the necessary Th-cell epitopes and/or that are captured with low efficiency by antigen presenting cells (APC).
  • the immunogenic epitopes can be longer polypeptides that include a protective epitope of tau peptide, or analogue together with other amino acids.
  • Some of the agents described herein for inducing an immune response contain the appropriate epitope for inducing an immune response against
  • a peptide immunogen can be linked to a suitable carrier to help elicit an immune response.
  • suitable carriers include serum albumins, keyhole limpet hemocyanin, immunoglobulin molecules, thyroglobulin, ovalbumin, tetanus toxoid, or a toxoid from other pathogenic bacteria, such as diphtheria, E. coli, cholera, or H. pylori, or an attenuated toxin derivative.
  • cytokines such as IL-1 , IL-1 a and ⁇ peptides, IL-2, yINF, IL-10, GM-CSF, and chemokines, such as M1 P1 a and ⁇ and RANTES.
  • Immunogenic agents can also be linked to peptides that enhance transport across tissues, as described in O'Mahony, WO 97/17613 and WO
  • Immunogenic agents can be linked to carriers by chemical crosslinking.
  • Techniques for linking an immunogen to a carrier include the formation of disulfide linkages using N-succinimidyl-3-(2-pyridyl-thio) propionate (SPDP) and succinimidyl 4-(N-maleimidomethyl)cyclohexane-1 -carboxylate (SMCC) (if the peptide lacks a sulfhydryl group, this can be provided by addition of a cysteine residue).
  • SPDP N-succinimidyl-3-(2-pyridyl-thio) propionate
  • SMCC succinimidyl 4-(N-maleimidomethyl)cyclohexane-1 -carboxylate
  • Immunogenic peptides can also be expressed as fusion proteins with carriers.
  • the immunogenic peptide can be linked at the amino terminus, the carboxyl terminus, or at a site anywhere within the peptide (internally) to the carrier. In some embodiments, multiple repeats of the immunogenic peptide can be present in the fusion protein.
  • immunogens that include fusion proteins comprising a tau peptide carrying a protective B cell epitope linked to a promiscuous non-natural Pan DR Th-cell epitope that induces a B-cell response against the protective epitope.
  • the invention provides immunogens that can be designed as polymers (Jackson et a., 1997), multiple antigen peptide systems (MAP) (Tarn and Recent, 1996), immunostimulating complexes (ISCOM) (Barr, I. G. and Mitchell, 1996) and possibly other branched amphoteric polypeptides (Wilkinson et al., 1998), or chimeric peptides produced by co-linearization of the epitopes (Marussig et al., 1997).
  • MAP multiple antigen peptide systems
  • ISCOM immunostimulating complexes
  • chimeric peptides produced by co-linearization of the epitopes
  • the therapeutic peptides can be applied alone or in combination, bound or not to a pharmaceutically acceptable carrier including KLH, tetanus toxoid, albumin binding protein, bovine serum albumin, dendrimer (MAP; Biol. Chem. 358: 581 ) as well as adjuvant substances, or their combinations, described e.g. in O'Hagan et al. (2003) (in particular the endogenous
  • an immunogenic agent of the present invention can be bound or linked to a suitable carrier by chemical crosslinking to increase the immune response against pathological tau, including tau deposits.
  • the bound or linked pharmaceutically acceptable carrier is keyhole limpet hemocyanin (KLH), tetanus toxoid, bovine serum albumin (BSA), immunoglobulin (Ig) molecule, thyroglobulin, or ovoglobulin.
  • KLH keyhole limpet hemocyanin
  • BSA bovine serum albumin
  • Ig immunoglobulin
  • Other carriers for stimulation of immune response include cytokines (such as IL-1 , IL-2, IL-10 IFNy, GM-CSF) and chemokines (such as M1 P1 a and ⁇ ).
  • Tau peptides or analogs can be synthesized by solid phase peptide synthesis or recombinant expression, or can be obtained from natural sources.
  • Recombinant expression systems can include bacteria, such as E. coli, yeast, insect cells, or mammalian cells. Procedures for the manipulation of DNA and preparation DNA constructs for recombinant expression are described by Sambrook et al. (1989), methods for the production of recombinant proteins are described in detail in Current Protocols in Protein Science (Chapter 5 "Production of Recombinant Proteins", UNITS 5.1 -5.24, DOI: 10.1002/0471 140864, also available online at
  • the immunogenic agents of the present invention can be expressed by a virus or bacteria as a vector or carrier.
  • a nucleic acid encoding the immunogenic peptide is incorporated into a genome or episome of the virus or bacteria.
  • the immunogenic peptides can be expressed as a secreted protein or as a fusion protein with an outer surface protein of a virus or can be displayed as a transmembrane protein of bacteria.
  • Viruses or bacteria used in such methods are generally nonpathogenic or attenuated.
  • Suitable viruses include adenovirus, HSV, Venezuelan equine encephalitis virus and other alpha viruses, vesicular stomatitis virus, and other rhabdo viruses, vaccinia and fowl pox.
  • Suitable bacteria include Salmonella and Shigella.
  • fusion of an immunogenic peptide to HBsAg of HBV is suitable.
  • a further aspect of the present invention relates to the therapeutic agent or immunogen, which can also be an analogue of the various peptides described in the various embodiments (e.g., SEQ ID No: 1 -4; 9-97) or of fragments thereof.
  • the present invention is also based on the discovery of novel peptides, designated in this application as designer therapeutic epitopes.
  • this invention features designer therapeutic epitopes that are capable of having a shape (e.g., an intrinsically disordered structure, a tertiary structure, a conformation) that mimics that of one or more of the tau "therapeutic epitopes" described above.
  • a shape e.g., an intrinsically disordered structure, a tertiary structure, a conformation
  • these designer therapeutic epitopes can be useful to generate antibodies against them, such as antibodies that compete with DC8E8.
  • These peptides are able to compete with tau or tau fragments for binding to the DC8E8 antibody, disclosed above.
  • immunogenic designer therapeutic epitopes capable of inducing an immune response to pathological tau when injected into rat models of AD and which would be expected to do so in humans.
  • mouse antibodies/antisera produced in response to immunization with one or more designer therapeutic epitopes, and capable of (i) recognizing one or more epitopes that are or mimic those of DC8E8; (ii) discriminating between pathological tau and normal tau; and/or (iii) recognizing neurofibrillary lesions in human AD brain and/or in transgenic rat models of AD.
  • the invention also provides compositions for the prevention, treatment, and/or diagnosis of Alzheimer's disease, wherein the composition comprises (i) a means for treating Alzheimer's disease in a subject by inhibiting tau-tau aggregation; and (2) a pharmaceutically acceptable carrier and/or diluent.
  • the invention also provides compositions for the prevention, treatment, and/or diagnosis of Alzheimer's disease, wherein the composition comprises (i) a means for treating Alzheimer's disease in a subject by binding to one or more "therapeutic epitopes" in pathological tau; and (2) a pharmaceutically acceptable carrier and/or diluents.
  • the invention also provides compositions for the prevention, treatment, and/or diagnosis of Alzheimer's disease, wherein the composition comprises (i) a means for decreasing tau-tau aggregation by binding to one or more "therapeutic epitopes" in pathological tau; and (2) a pharmaceutically acceptable carrier and/or diluents.
  • Agents of the invention can be administered as pharmaceutical formulations comprising a therapeutic agent (e.g., antibody or peptide, as described above) and one or more of other pharmaceutically acceptable components. See Remington's Pharmaceutical Science (15th ed., Mack Publishing Company, Easton, Pa., 1980).
  • formulations include, for example, powders, pastes, ointments, jellies, waxes, oils, lipids, lipid (cationic or anionic) containing vesicles (such as LIPOFECTIN), DNA conjugates, anhydrous absorption pastes, oil-in-water and water-in-oil emulsions, emulsions carbowax (polyethylene glycols of various molecular weights), semi-solid gels, and semi-solid mixtures containing carbowax.
  • vesicles such as LIPOFECTIN
  • DNA conjugates such as LIPOFECTIN
  • anhydrous absorption pastes oil-in-water and water-in-oil emulsions
  • emulsions carbowax polyethylene glycols of various molecular weights
  • semi-solid gels and semi-solid mixtures containing carbowax.
  • the formulations can also include pharmaceutically-acceptable, non-toxic carriers or diluents, which are defined as vehicles commonly used to formulate pharmaceutical compositions for animal or human administration.
  • diluents are defined as vehicles commonly used to formulate pharmaceutical compositions for animal or human administration.
  • the diluent is selected so as not to affect the biological activity of the combination. Examples of such diluents are distilled water,
  • compositions or formulation can also include other carriers, adjuvants, or nontoxic, nontherapeutic, nonimmunogenic stabilizers and the like. However, some reagents suitable for administration to animals, such as Complete Freund's adjuvant are not typically included in compositions for human use.
  • Suitable pharmaceutical carriers include phosphate buffered saline solutions, water, emulsions, such as oil/water emulsions, various types of wetting agents, sterile solutions etc. Compositions comprising such carriers can be formulated by known conventional methods. More carriers are described further below.
  • Therapeutic agents, immunogens, of the invention can be administered in combination with adjuvants, i.e., substances that do not themselves cause adaptive immune responses, but amplify or modulate the response to an accompanying antigen.
  • adjuvants i.e., substances that do not themselves cause adaptive immune responses, but amplify or modulate the response to an accompanying antigen.
  • a variety of adjuvants can be used in combination with the therapeutic peptides and antibodies in the present invention, in order to elicit an immune response.
  • Preferred adjuvant(s) augment the intrinsic response to an immunogen without causing conformational changes in the immunogen that would affect the qualitative form of the response.
  • the adjuvant is an aluminum salt (alum), such as aluminum hydroxide, aluminum phosphate, and aluminum sulphate (Hunter, 2002).
  • alum aluminum hydroxide, aluminum phosphate, and aluminum sulphate
  • Such adjuvants can be used with or without other specific immunostimulating agents, such as 3 de-O-acylated monophosphoryl lipid A (MPL) or 3-DMP, polymeric or monomeric amino acids, such as polyglutamic acid or polylysine.
  • MPL 3 de-O-acylated monophosphoryl lipid A
  • 3-DMP polymeric or monomeric amino acids
  • Such adjuvants can be used with or without other specific immunostimulating agents, such as muramyl peptides (e.g., N-acetylmuramyl-L-threonyl-D-isoglutamine (thr-MDP), N- acetyl-normuramyl-L-alanyl-D-isoglutamine (nor-MDP), N-acetylmuramyl-L-alanyl-D- isoglutaminyl-L-alanine-2-(1 '-2'dipalmitoyl-sn--glycero-3-hydroxyphosphoryloxy)- ethylamine (MTP-PE), N-acetylglucsaminyl-N-acetylmuramyl-L-AI-D-isoglu-L-Ala- dipalmitoxy propylamide (DTP-DPP) theramideTM), or other bacterial cell wall components.
  • adjuvants are oil-in-water emulsions and include (a) MF59 (WO 90/14837 to Van Nest et ai, which is hereby incorporated by reference in its entirety), containing 5% Squalene, 0.5% Tween 80, and 0.5% Span 85 (optionally containing various amounts of MTP-PE) formulated into submicron particles using a microfluidizer such as Model 1 10Y microfuidizer (Microfluidics, Newton Mass.), (b) SAF, containing 10% Squalene, 0.4% Tween 80, 5% pluronic-bloeked polymer L121 , and thr-MDP, either microfluidized into a submicron emulsion or vortexed to generate a larger particle size emulsion, and (c) Ribi.TM. adjuvant system (RAS), (Ribi InunoChem, Hamilton, Mont.) containing 2% squalene, 0.2% Tween 80, and one or
  • the adjuvant is a saponin, such as StimulonTM (QS21 , Aquila, Worcester, Mass.) or particles
  • ISCOMs immunological complexes
  • ISCOMATRIX.Other adjuvants include Complete Freund's Adjuvant (CFA) and Incomplete Freund's Adjuvant (IFA), cytokines, such as interleukins (IL-1 , IL-2, and IL-12), macrophage colony stimulating factor (M-CSF), and tumor necrosis factor (TNF).
  • CFA Complete Freund's Adjuvant
  • IFA Incomplete Freund's Adjuvant
  • cytokines such as interleukins (IL-1 , IL-2, and IL-12
  • M-CSF macrophage colony stimulating factor
  • TNF tumor necrosis factor
  • tau peptides and their immunogenic analogues can be coupled to an adjuvant.
  • a lipopeptide version of a tau peptide "A” can be prepared by coupling palmitic acid or other lipids directly to the N-terminus of "A” as described for hepatitis B antigen vaccination (Livingston, J. Immunol. 159, 1383- 1392 (1997)).
  • palmitic acid or other lipids directly to the N-terminus of "A” as described for hepatitis B antigen vaccination (Livingston, J. Immunol. 159, 1383- 1392 (1997)).
  • An adjuvant can be administered with an immunogen as a single composition, or can be administered before, concurrent with, or after administration of the immunogen.
  • Immunogen and adjuvant can be packaged and supplied in the same vial or can be packaged in separate vials and mixed before use. Immunogen and adjuvant are typically packaged with a label, indicating the intended therapeutic application. If immunogen and adjuvant are packaged separately, the packaging typically includes instructions for mixing before use.
  • an adjuvant and/or carrier depends on the stability of the immunogenic formulation containing the adjuvant, the route of administration, the dosing schedule, the efficacy of the adjuvant for the species being vaccinated, and, in humans, a pharmaceutically acceptable adjuvant is one that has been approved or is approvable for human administration by pertinent regulatory bodies. For example, Complete Freund's adjuvant is not suitable for human administration. However, alum, MPL or
  • Incomplete Freund's adjuvant (Chang et al., Advanced Drug Delivery Reviews 32:173-186 (1998), which is hereby incorporated by reference in its entirety) alone or optionally in combination with any of alum, QS21 , and MPL and all combinations thereof are suitable for human administration.
  • compositions can also include large, slowly
  • metabolized macromolecules such as proteins, polysaccharides like chitosan, polylactic acids, polyglycolic acids and copolymers (e.g., latex functionalized sepharose, agarose, cellulose, and the like), polymeric amino acids, amino acid copolymers, and lipid aggregates (e.g., oil droplets or liposomes). Additionally, these carriers can function as immunostimulating agents (i.e., adjuvants).
  • the invention provides for compositions and methods of treatment that combine the antibodies and peptides described herein with other treatments for AD and related tauopathies.
  • tau-related therapeutic strategies mainly focus on the drugs that inhibit tau kinases or activate phosphatases (Iqbal and Grundke-lqbal, 2004, 2005, 2007; Noble et al. 2005), the drugs that stabilize microtubules (Zhang et al. 2005), the drugs that facilitate the proteolytic degradation of misfolded tau protein (Dickey et al. 2005; Dickey and Petrucelli, 2006; Dickey et al. 2006), compounds that prevent or reverse tau aggregation (Wischik et al. 1996; Pickhardt et al.
  • the invention provides that multiple targeting (e.g., targeting both tau and beta-amyloid) can substantially increase treatment efficiency.
  • agents of the invention can also be administered in conjunction with other agents that increase passage of the agents of the invention across the blood-brain barrier.
  • Agents for inducing an immune response can be administered by parenteral, topical, intradermal, intravenous, oral, subcutaneous, intraperitoneal, intranasal or
  • intramuscular means for prophylactic and/or therapeutic treatment.
  • a typical route of administration is subcutaneous although others can be equally effective.
  • Another typical route is intramuscular injection. This type of injection is most typically performed in the arm or leg muscles.
  • Intravenous injections as well as intraperitoneal injections, intraarterial, intracranial, or intradermal injections are also effective in generating an immune response.
  • agents are injected directly into a particular tissue where deposits have accumulated.
  • Aerosol formulations such as nasal spray formulations include purified aqueous or other solutions of the active agent with preservative agents and isotonic agents. Such formulations are for example adjusted to a pH and isotonic state compatible with the nasal mucous membranes.
  • Formulations for rectal or vaginal administration can be presented as a suppository with a suitable carrier.
  • therapeutic peptides of the present invention can be administered as injectable dosages of a solution or suspension of the substance in a physiologically acceptable diluent with a pharmaceutical carrier that can be a sterile liquid such as water, oil, saline, glycerol, or ethanol.
  • auxiliary substances such as wetting or emulsifying agents, surfactants, pH buffering substances and the like can be present in compositions.
  • Other components of pharmaceutical compositions are those of petroleum, animal, vegetable, or synthetic origin. Peanut oil, soybean oil, and mineral oil are all examples of useful materials.
  • glycols such as propylene glycol or polyethylene glycol, are preferred liquid carriers, particularly for injectable solutions.
  • Agents of the invention can also be administered in the form of a depot injection or implant preparation which can be formulated in such a manner as to permit a sustained release of the active ingredient.
  • An exemplary composition comprises monoclonal antibody at 5 mg/mL, formulated in aqueous buffer consisting of 50 mM L-histidine, 150 mM NaCI, adjusted to pH 6.0 with HCI.
  • Preparations for parenteral administration include sterile aqueous or non-aqueous solutions, suspensions, and emulsions.
  • non-aqueous solvents are propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable organic esters such as ethyl oleate.
  • Aqueous carriers include water, alcoholic/aqueous solutions, emulsions or suspensions, including saline and buffered media.
  • Parenteral vehicles include sodium chloride solution, Ringer's dextrose, dextrose and sodium chloride, lactated Ringer's, or fixed oils.
  • Intravenous vehicles include fluid and nutrient replenishers, electrolyte replenishers (such as those based on Ringer's dextrose), and the like. Preservatives and other additives can also be present such as, for example, antimicrobials, anti-oxidants, chelating agents, and inert gases and the like.
  • compositions are prepared as injectables, either as liquid solutions or suspensions; solid forms suitable for solution in, or suspension in, liquid vehicles prior to injection can also be prepared.
  • the preparation also can be emulsified or encapsulated in liposomes or micro particles such as polylactide, polyglycolide, or copolymer for enhanced adjuvant effect, as discussed above (see Langer, Science 249, 1527 (1990) and Hanes, Advanced Drug Delivery Reviews 28, 97-1 19 (1997).
  • the agents of this invention can be administered in the form of a depot injection or implant preparation which can be formulated in such a manner as to permit a sustained or pulsatile release of the active ingredient.
  • Additional formulations suitable for other modes of administration include oral, intranasal, and pulmonary formulations, suppositories, and transdermal applications.
  • binders and carriers include, for example,
  • polyalkylene glycols or triglycerides such suppositories can be formed from mixtures containing the active ingredient in the range of 0.5% to 10%, for example 1 %-2%.
  • Oral formulations include excipients, such as pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, and magnesium carbonate. These compositions take the form of solutions, suspensions, tablets, pills, capsules, sustained release formulations or powders and contain 10%-95% of active ingredient, for example 25%-70%.
  • Topical application can result in transdermal or intradermal delivery.
  • Topical administration can be facilitated by co-administration of the agent with cholera toxin or detoxified derivatives or subunits thereof or other similar bacterial toxins (See Glenn et al., Nature 391 , 851 (1998)).
  • Co-administration can be achieved by using the components as a mixture or as linked molecules obtained by chemical crossl inking or expression as a fusion protein.
  • transdermal delivery can be achieved using a skin patch or using transferosomes (Paul et al., Eur. J. Immunol. 25, 3521 -24 (1995); Cevc et ai, Biochem. Biophys. Acta 1368, 201 -15 (1998)).
  • Subcutaneous administration of a subject antibody, peptide, or compound is accomplished using standard methods and devices, e.g., needle and syringe, a subcutaneous injection port delivery system, and the like.
  • Intramuscular administration is accomplished by standard means, e.g., needle and syringe, continuous delivery system, etc.
  • a subject antibody, peptide, and/or compound is delivered by a continuous delivery system.
  • continuous delivery system is used interchangeably herein with “controlled delivery system” and encompasses continuous (e.g., controlled) delivery medical devices (e.g., pumps) in combination with catheters, injection devices, and the like, a wide variety of which are known in the art.
  • continuous delivery medical devices e.g., pumps
  • electromechanical infusion pumps can also be suitable for use with the present invention.
  • Examples of such devices include those described in, for example, U.S. Pat. Nos. 4,692,147; 4,360,019; 4,487,603; 4,360,019; 4,725,852; 5,820,589;
  • the agents can also be administered by the now standard procedure of drilling a small hole in the skull to administer a drug.
  • the binding molecule, especially antibody or antibody-based drug of the present invention can cross the blood-brain barrier, which allows for intravenous or oral administration.
  • the agents in pharmaceutical dosage forms, can be administered in the form of their pharmaceutically acceptable salts, or they can also be used alone or in appropriate association, as well as in combination, with other pharmaceutically active
  • a subject antibody, peptide, or compound can be formulated into preparations for injection by dissolving, suspending or emulsifying them in an aqueous or nonaqueous solvent, such as vegetable or other similar oils, synthetic aliphatic acid glycerides, esters of higher aliphatic acids or propylene glycol; and if desired, with conventional additives such as solubilizers, isotonic agents, suspending agents, emulsifying agents, stabilizers and preservatives.
  • Unit dosage forms for injection or intravenous administration can comprise the active agent in a composition as a solution in sterile water, normal saline or another pharmaceutically acceptable carrier.
  • unit dosage form refers to physically discrete units suitable as unitary dosages for human and animal subjects, each unit containing a predetermined quantity of a subject antibody calculated in an amount sufficient to produce the desired effect in association with a pharmaceutically acceptable diluent, carrier or vehicle.
  • dose refers to physically discrete units suitable as unitary dosages for human and animal subjects, each unit containing a predetermined quantity of a subject antibody calculated in an amount sufficient to produce the desired effect in association with a pharmaceutically acceptable diluent, carrier or vehicle.
  • the specifications for the unit dosage forms of the present invention depend on the particular compound employed and the effect to be achieved, and the pharmacodynamics associated with each compound in the host.
  • Immune responses against pathological tau proteins and tau deposits can also be induced by administration of nucleic acids encoding therapeutic tau peptides.
  • nucleic acids can be DNA or RNA.
  • a nucleic acid segment encoding the immunogen is linked to regulatory elements, such as a promoter and enhancer that allow expression of such a DNA segment in the intended target cells of a patient.
  • regulatory elements such as a promoter and enhancer that allow expression of such a DNA segment in the intended target cells of a patient.
  • promoter and enhancer elements from immunoglobulin genes (light or heavy chain) or the CMV major intermediate early promoter and enhancer are suitable to direct expression in the blood cells, which are the desirable target for induction of an immune response.
  • the linked regulatory elements and coding sequences are often cloned into a vector.
  • a number of viral vector systems are available including retroviral systems (see, e.g., Lawrie et al., Cur. Opin. Genet. Develop. 3:102-109 (1993), which is hereby incorporated by reference in its entirety); adenoviral vectors (Bett et ai, J. Virol. 67:591 1 (1993), which is hereby incorporated by reference in its entirety); adeno-associated virus vectors (Zhou et al., J. Exp. Med.
  • viral vectors from the pox family including vaccinia virus and the avian pox viruses, viral vectors from the alpha virus genus, such as those derived from Sindbis and Semliki Forest Viruses
  • DNA encoding an immunogen can be packaged into liposomes. Suitable lipids and related analogs are described by U.S. Pat. Nos. 5,208,036, 5,264,618, 5,279,833 and 5,283,185. Vectors and DNA encoding an immunogen can also be adsorbed to or associated with particulate carriers, examples of which include polymethyl methacrylate polymers and polylactides and poly(lactide-co-glycolides), see, e.g., McGee et al., J. Micro Encap. (1996).
  • Gene therapy vectors or naked DNA can be delivered in vivo by administration to an individual patient, typically by systemic administration (e.g., intravenous, intraperitoneal, nasal, gastric, intradermal, intramuscular, subdermal, or intracranial infusion) or topical application (see e.g., U.S. Pat. No. 5,399,346).
  • DNA can also be administered using a gene gun (see U.S. Pat. No. 6,436,709).
  • the DNA encoding an immunogen is precipitated onto the surface of microscopic metal beads. The microprojectiles are accelerated with a shock wave or expanding helium gas, and penetrate tissues to a depth of several cell layers
  • DNA can also be delivered by electroporation (e.g. as described in Trollet et ai, 2008 and references therein).
  • naked DNA can pass through skin into the blood stream simply by spotting the DNA onto skin with chemical or mechanical irritation (see WO 95/05853) or tattooing (e.g. as described by van den Berg et ai, 2009).
  • DNA or vectors encoding immunogens can be delivered to cells ex vivo, such as cells explanted from an individual patient (e.g., lymphocytes, bone marrow aspirates, tissue biopsy) or universal donor
  • hematopoietic stem cells followed by reimplantation of the cells into a patient, for example after verification of the expression of the immunogen and usually after selection for cells which have incorporated the vector.
  • Subjects amenable to treatment include individuals at risk of
  • Alzheimer's disease or related tauopathies but not showing symptoms, as well as patients already showing symptoms.
  • Alzheimer's disease virtually anyone is at risk of suffering from Alzheimer's disease if he or she lives long enough. Therefore, the present treatments or therapies can even be administered
  • the vaccines presented in this patent can be especially useful for individuals who have a known genetic risk of Alzheimer's disease. Such individuals include those having relatives who suffered from this disease, and those whose risk is determined by the presence of genetic or biochemical markers. Genetic markers of risk of early onset familial Alzheimer's disease include mutations in the APP gene, presenilin genes PS1 and PS2, and markers for late onset Alzheimer's disease in the ApoE4 gene (recently reviewed by Bertram and Tanzi, 2008). Additional risk factors include family history of AD, hypercholesterolemia or atherosclerosis.
  • Alzheimer's disease can be recognized from characteristic dementia, as well as the presence of the risk factors described above.
  • a number of diagnostic tests are available for identifying individuals who have AD. These include measurement of total tau, phospho-tau and amyloid ⁇ (1 -42) levels in CSF. Elevated tau and/or phospho-tau and decreased amyloid ⁇ (1 -42) levels indicate the presence of AD.
  • Individuals suffering from Alzheimer's disease can also be diagnosed by MMSE, ADRDA or other criteria.
  • treatment can begin at any age (e.g., 10, 20, 30). However, it may not be necessary to begin treatment until a patient reaches 40, 50, 60 or 70. Treatment can entail multiple dosages over a period of time. Treatment can be monitored by assaying antibody, or activated T-cell or B-cell responses to the therapeutic agent (e.g., tau peptide) over time. If the response falls, a booster dosage is indicated. In the case of potential Down's syndrome patients, who are at higher risk for AD or related tauopathies, treatment can begin pre-natally, by administering therapeutic agent to the mother, or shortly after birth.
  • therapeutic agent e.g., tau peptide
  • DC8E8 (or a chimeric, humanized, human, or other derivative/portion/fragment thereof) is the antibody or passive vaccine intended for use in aged immunosenescent Alzheimer's disease (AD) patients showing significant decrease in the levels of the co-stimulatory molecule CD28 on T-cells.
  • a decrease in co-stimulatory molecule CD28 is indicative of impaired immune response (Saurwein-Teissl et al., 2002).
  • CD8 + CD28 " T cell clones which are frequently CD45RA + (immunophenotype: CD8 + CD28 " CD45RA + ) produce large amount of pro-inflammatory cytokine IFN- ⁇ and marginal amounts of IL-5.
  • CD8 + CD28 CD45RA + T cell clones along with the dwindling population of na ' fve B cells (Siegrist and Aspinall, 2009) are the major contributors to the decline of immune functions that affects about one third of elderly population (Weng et al., 2009, Saurwein-Teissl et al., 2002).
  • passive immunotherapy e.g., with DC8E8 (or a chimeric, humanized, human, or other derivative/portion/fragment thereof) provides a means to circumvent the failing immune system of a large population of AD patients and target the pathological tau proteins causing neurofibrillary degeneration.
  • one of the tau therapeutic epitopes (or a peptide comprising one of the tau therapeutic epitopes described herein) is used as an active vaccine, intended for use in aged immunocompetent Alzheimer's disease patients.
  • the immunophenotype of immunocompetent patients is CD8 + CD28 + CD45RA + . Therefore levels of co-stimulatory molecule CD28 on CD8 + T cells will be determined and used as a selection marker of patients for active vaccination.
  • CSF and blood taken from patients will be tested for antibodies against Borrelia, Treponema, Chlamydia, Herpesvirus and other brain pathogens to exclude individuals with chronic infectious and inflammatory CNS disorders that can mimic or aggravate the symptoms of AD (Balin et al., 2008; Itzhaki and Wozniak, 2008; Miklossy, 2008; Andreasen, 2010).
  • CNS infections often compromise the function of the blood-brain barrier (BBB), especially Chlamydia infections of the brain endothelial cells, which can lead to an increased influx of monocytes into the brain parenchyma and thus can influence the local immune response (Balin et al., 2008).
  • BBB blood-brain barrier
  • Alzheimer's disease patients with CNS infections or those tested positively for antibodies against the aforementioned pathogens will be treated with a highly selective vaccine.
  • CSF and blood taken from patients can be tested for antibodies against Borrelia, Treponema, Chlamydia, Herpesvirus and other brain pathogens to exclude individuals with chronic infectious and inflammatory CNS disorders that can mimic or aggravate the symptoms of AD (Balin et al., 2008; Itzhaki and Wozniak, 2008; Miklossy, 2008; Andreasen, 2010).
  • this group of patients will be treated with a more selective antibody or therapeutic-epitope-containing vaccine.
  • the active vaccine is a designer epitope (e.g., see EXAMPLES), inducing the production of strictly selective antibodies targeting the therapeutic epitope on pathological tau proteins.
  • the vaccine does not contain any amino acid sequence shared with normal/physiological tau protein.
  • compositions or medicaments are administered to a patient susceptible to, or otherwise at risk of, a particular disease in an amount sufficient to eliminate or reduce the risk or delay the outset of the disease.
  • compositions or medicaments are administered to a patient suspected of, or already suffering from such a disease in an amount sufficient to cure, or at least partially arrest, the symptoms of the disease and its complications. An amount adequate to accomplish this is defined as a therapeutically or pharmaceutically effective dose.
  • agents are usually administered in several dosages until a sufficient immune response has been achieved. Typically, the immune response is monitored and repeated dosages are given if the immune response starts to fade.
  • Effective doses of the compositions of the present invention, for the treatment of the above described conditions vary depending upon many factors, including means of administration, target site, physiological state of the patient, whether the patient is human or an animal, other medications administered, and whether the treatment is prophylactic or therapeutic. Usually, the patient is a human. Treatment dosages need to be titrated to optimize safety and efficacy. Accordingly, treatment with an antibody or tau-binding protein will typically entail multiple dosages over a period of time. For passive immunization with an antibody, the dosage ranges from about 0.0001 to 100 mg/kg, and more usually 0.01 to 5 mg/kg of the host body weight.
  • the amount of antibody or tau-binding protein can be administered at a dosage of at least 0.1 mg/kg of body weight, at a dosage of at least 0.5 mg/kg of body weight, 1 mg/kg of body weight, or any combination of dosages between 0.1 and 10 mg/kg of body weight.
  • the antibody or tau-binding protein can be administered in multiple dosages (equal or different) over a period of at least 1 month, at least 3 months, or at least 6 months.
  • the total number of doses over any one treatment period can be, for example, between 4 and 6, although other numbers can be used depending on the factors discussed above. Treatment can be monitored by any of the methods described further below.
  • the amount of immunogen depends on whether adjuvant is also administered, with higher dosages being required in the absence of adjuvant.
  • the amount of an immunogen for administration sometimes varies from 1 g - 500 g per patient and more usually from 5-500 g per injection for human administration.
  • a higher dose of 1 -2 mg per injection is used.
  • the timing of injections can vary significantly from once a day, to once a year, to once a decade.
  • the dosage is greater than 1 g/patient and usually greater than 10 g/patient if adjuvant is also administered, and greater than 10 g/patient and usually greater than 100 g/patient in the absence of adjuvant.
  • a typical regimen consists of an immunization followed by booster injections at 6 weekly intervals.
  • Another regimen consists of an immunization followed by booster injections 1 , 2 and 12 months later.
  • Another regimen entails an injection every two months for life.
  • booster injections can be on an irregular basis as indicated by monitoring of immune response.
  • the active vaccine will be formulated with a suitable carrier, preferentially KLH, and aluminum hydroxide as an adjuvant.
  • a suitable carrier preferentially KLH, and aluminum hydroxide as an adjuvant.
  • 100 g peptide /dose/patient but also 1 g, 10 g 100 ig and 1 mg will be applied in pre-clinical phase and 10 g 100 g 200 g in Phase I toxicity studies) will be applied once in 4 weeks, 5 doses in total.
  • Doses for nucleic acids encoding immunogens range from about 10 ng to 1 g, 100 ng to 100 mg, 1 g to 10 mg, or 30-300 pg DNA per patient.
  • Doses for infectious viral vectors vary from 10-10 9 , or more, virions per dose. Treatment can be monitored by assaying antibody, or activated T-cell or B-cell responses to the therapeutic agent over time. If the response falls, a booster dose can be indicated.
  • the dosage regimen will be determined by the attending physician and by clinical factors. As is known in the medical arts, dosages for any one patient depend upon many factors, including the patient's size, body surface area, age, the particular compound to be administered, sex, time and route of administration, general health, and other drugs being administered concurrently. A typical dose can be, for example, in the range of 0.001 to 1000 mg; however, doses below or above this exemplary range are envisioned, especially considering the aforementioned factors. Generally, the regimen as a regular administration of the pharmaceutical composition should be in the range of 1 mg to 10 mg units per day. If the regimen is a continuous infusion, it should also be in the range of 1 mg to 10 mg per kilogram of body weight per minute, respectively. Progress can be monitored by periodic assessment.
  • a therapeutically effective dose or amount refers to that amount of the active ingredient sufficient to ameliorate the symptoms or condition.
  • Therapeutic efficacy and toxicity of such compounds can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., ED50 (the dose therapeutically effective in 50% of the population) and LD50 (the dose lethal to 50% of the population). The dose ratio between therapeutic and toxic effects is the therapeutic index, and it can be expressed as the ratio, LD50/ED50.
  • the therapeutic agent in the composition is present in an amount sufficient to restore normal behavior and/or cognitive properties in case of Alzheimer's disease and related tauopathies.
  • the invention provides different measures that can be relied upon for evaluation of treatment effectiveness with any of the agents provided by the invention. Examples include, but are not limited to, decreased levels of one or more pathological tau forms (e.g., within the brain), increased clearance of pathological tau from the brain and/or CSF; improved cognitive performance measures, such as cognitive functions (tested by, for example, Clinical Dementia Rating - CDR, Alzheimer's disease Assessment Scale - Cognitive Subscale - ADAS-Cog Mini Mental State Examination - MMSE); improved motor function tests (e.g., Grip strength test, Timed Up & Go (TUG) test, TUG manual, Talking while Walking test, Unified Parkinson's disease Rating Scale - UPDRS); improved performance of basic activities of daily living (ADL) tests (e.g, hygiene, dressing, continence, eating, meal preparation, telephoning, going on an outing, finance, and correspondence; Disability Assessment in Dementia tests); and lessened severity/grading of AD impaired grip strength, locomotion,
  • the levels and distribution of tau can be assayed by any of the methods described herein, and/or by any other methods available to detect tau.
  • the levels of tau could be measured in vivo (Positron emission tomography) using novel imaging radiotracer 18F-THK523, which selectively binds tau and tau pathology in vitro, ex vivo (tissue slices) and in vivo (transgenic mice) (Fodero-Tavoletti et al., 201 1 , Brain).
  • Tau could be identified in the cerebrospinal fluid and in the blood as well using ELISA kits recognizing either total tau or phospho-tau.
  • Alzheimer's disease is characterized clinically by progressive memory impairment and cognitive decline, behavioral changes and psychological symptoms
  • AD Alzheimer's disease
  • Active immunotherapy with the peptides (including therapeutic epitopes) described herein can improve motor impairment of transgenic rats expressing human pathological tau.
  • direct targeting of the brain stem pathology by active immunotherapy can prevent, slow, or delay, motor as well as cognitive impairment in human AD patients.
  • testing of motor functions can be included in the battery of tests that can be used for the evaluation of the clinical efficacy of the agents (e.g., tau clearance agents, active and passive vaccines) described herein.
  • pathological tau e.g., NFT in cortex/hippocampus
  • NFT pathology The density of pathological tau (NFT pathology) has been correlated with cognitive deficit and the severity of the
  • Pathological tau e.g., NFTs, neuropil threads
  • NFTs pathological tau
  • AD serotoninergic deficit found in AD (Duykaerts et al., 2009).
  • the extrapyramidal symptoms have been correlated with the substantia nigra tau pathology (Liu et al., 1997). Accordingly, a treatment agent that can affect one or more of these AD distribution patterns will likely have a beneficial effect in AD.
  • tau deletion mutants and tau peptides are numbered according to the longest human tau isoform 2N4R, which is 441 amino acids in length and thus is also called tau 44 i (D'Souza, 2005).
  • Tau deletion mutants and peptides derived from the isoform 2N3R are marked by "3R" to indicate that the second microtubule binding repeat (amino acids 275-305 of 2N4R) is missing.
  • tau proteins involved the following steps: a) expression of tau in bacteria; b) tau purification by ion exchange chromatography; c) tau purification by gel-filtration; d) concentration and storage of isolated tau; and e) immunoaffinity purification (this is an exception adopted only for tauA(1 -150;392-441 )/4R, which was used in the microglia uptake experiments, see Example 10, Figure 17).
  • BL21 (DE3) Bacterial cells containing the appropriate expression plasmid were cultivated and induced as described in "Molecular Cloning: A Laboratory Manual” by Sambrook and Russell (2001 ).
  • a single colony of BL21 (DE3) bacteria, transformed with pET-17b plasmid driving expression of a tau protein or its fragment, were grown at 37°C in 500 ml of Luria broth medium with 100 g/ml ampicillin at 300 rpm and induced by the addition of isopropyl- -D-1 -thiogalactopyranoside (IPTG) to a final concentration of 0.4 mM. After further incubation at 37°C for 3 hours, bacteria were collected by centrifugation at 3,000xg for 15 min at 4°C.
  • IPTG isopropyl- -D-1 -thiogalactopyranoside
  • lysis buffer 50 mM 1 ,4-piperazinediethanesulfonic acid (PIPES) pH 6.9, 50 mM sodium chloride (NaCI), 1 mM
  • EDTA ethylenediaminetetraacetic acid
  • DTT dithiothreitol
  • phenylmethylsulfonyl fluoride (PMSF), 5% (v/v) glycerol), quickly frozen in liquid nitrogen, and stored at -80°C until used for purification of tau proteins.
  • PMSF phenylmethylsulfonyl fluoride
  • glycerol 5% (v/v) glycerol
  • the frozen bacterial suspensions were quickly thawed and placed on ice.
  • Bacterial cell walls were broken by sonication on ice by using Sonopuls HD 2200, tip TT-13 (Bandelin, Germany) set to 50% duty cycle, 50 W power output, 6 times for 30 s with 30 s pauses.
  • the lysates were clarified by centrifugation
  • Bound tau proteins were eluted by a gradient (0-30% within 15 ml) of Buffer B (lysis buffer supplemented with 1 M NaCI). Individual 1 ml fractions were collected and analyzed by sodium dodecyl sulfate-polyacrylamide gel
  • Bacterial cell walls were broken by sonication on ice by using Sonopuls HD 2200, tip TT-13 (Bandelin, Germany) set to 50% duty cycle, 50 W power output, 6 times for 30 s with 30 s pauses.
  • the lysates were clarified by centrifugation (21 ,000xg for 15 min at 4°C).
  • Bacterial lysates were precipitated by 1 % streptomycin sulfate (Medexport, Russia), incubated on ice for 5 min, clarified by centrifugation (21 ,000xg for 15 min at 4°C), and filtered through a 0.45 ⁇ membrane filter.
  • the filtered streptomycin precipitated lysates were loaded at 3 ml/min flow rate onto a 5ml HiTrap
  • the buffer was exchanged to phosphate-buffered saline (PBS, 8.09 mM disodium phosphate (Na 2 HPO ), 1 .47 mM potassium dihydrogen phosphate (KH 2 PO 4 ), 136.89 mM NaCI, 2.7 mM potassium chloride (KCI)) saturated with argon, using a 5 ml HiTrap Desalting column (GE Healthcare).
  • PBS phosphate-buffered saline
  • BCA bicinchoninic acid
  • BSA bovine serum albumin
  • polyethylenimine was added while stirring. The stirring continued for another 30 min, on ice. The sample was centrifuged at 20,000xg for 15 min at 4°C. The supernate was collected and injected onto a HiLoad 26/60 Superdex 200 prep grade column (GE Healthcare) at 3 ml/min in the PIPES lysis buffer supplemented with 100 mM NaCI but lacking DTT or any other reducing agent. After gel filtration, fractions with tau protein were pooled and loaded onto an immunoaffinity column (at a flow rate of 0.5 ml/min) containing DC25 antibody (epitope 347-353 of 2N4R tau, Axon
  • Protein quantitation of purified samples was done using a bicinchoninic acid (BCA) quantitation kit (Pierce, USA), with BSA as a standard. The protein was aliquoted into working aliquots, snap-frozen in liquid nitrogen, and stored at -70°C.
  • BCA bicinchoninic acid
  • the purified DC25 antibody (Axon Neuroscience, Vienna, Austria) used for the DC25 affinity column (supra) was prepared as follows. Serum free DC25 hybridoma culture supernate was adjusted to pH 7.5 by adding 0.2 volume of PBS, precleared by centrifugation at 20,000xg for 10 minutes at 4 °C, and the supernate filtered through a 0.2 ⁇ filter. The pre-cleared DC25 hybridoma culture supernate was loaded onto a PBS-equilibrated HiTrap Protein G HP column (5 ml, GE
  • EXAMPLE 2 PREPARATION OF HYBRIDOMA CELL LINES PRODUCING MONOCLONAL ANTIBODIES AGAINST HUMAN TAU ⁇ (1 -150:392-441 )/4R, SCREENING OF MONOCLONAL ANTIBODIES BY ELISA, AND INITIAL CHARACTERIZATION OF
  • mice Six-week-old Balb/c mice were primed subcutaneously with 50 g of recombinant tauA(1 -150;392-441 )/4R (prepared as described in Example 1 ) in complete Freund ' s adjuvant (SIGMA), and boosted five times at five-week intervals with 50 g of the same antigen in incomplete Freund ' s adjuvant. Three days before the fusion, mice were injected intravenously with 50 g of the same antigen in PBS. Spleen cells from immunized mice were fused with NS/0 myeloma cells according to the method of Kontsekova et al. (1988).
  • Splenocytes (10 8 ) were mixed with 2 x 10 7 NS/0 myeloma cells (ratio 5:1 ) and fused for 1 minute in 1 ml of 50% polyethylene glycol (PEG) 1550 (Serva) in serum free Dulbecco ' s modified Eagle ' s medium (DMEM) supplemented with 10% dimethyl sulphoxide.
  • PEG polyethylene glycol
  • DMEM serum free Dulbecco ' s modified Eagle ' s medium
  • the fused cells were resuspended in DMEM containing 20% horse serum, L-glutamine (2 mM), hypoxanthine (0.1 mM), aminopterin (0.04 mM), thymidine (0.016 mM), and gentamycin (40 U/ml), at a density of 2.5 x 10 5 spleen cells per well on 96-well plates.
  • the cells were incubated for 10 days at 37°C and growing hybridomas were screened for the production of anti-tauA(1 -150;392-441 )/4R-specific monoclonal antibodies by an enzyme-linked immunosorbent assay (ELISA).
  • ELISA enzyme-linked immunosorbent assay
  • An ELISA was used to detect monoclonal antibodies in hybridoma culture supernates directed against tauA(1 -150;392-441 )/4R (a misdisordered form of tau).
  • Microtiter plates were coated overnight with tauA(1 -150;392-441 )/4R (5 g/ml, 50 ⁇ /well) at 37°C in PBS. After blocking with 1 % nonfat dried milk to reduce nonspecific binding, the plates were washed with PBS-0.05% Tween 20 and incubated with 50 ⁇ /well of hybridoma culture supernate for 1 hr at 37°C.
  • Bound monoclonal antibodies were detected with sheep anti-mouse immunoglobulin (Ig) conjugated with horse radish peroxidase (HRP, DAKO). The reaction was developed with orthophenylenediamine solution as a peroxidase substrate and stopped with 50 ⁇ of 2 M H 2 SO 4 . Absorbance at 492 nm was measured using a Multiscan MCC/340 ELISA reader (Labsystems). Readouts with an absorbance value of at least twice the value of the negative controls (PBS) were considered positive.
  • PBS negative controls
  • Positive hybridoma cultures were further tested by immunohistochemistry (accordingly to method of Zilka et al., 2003) and subcloned in soft agar according to the procedure described in Kontsekova et al. (1991 ).
  • the monoclonal antibody DC8E8 (produced by the mouse hybridoma cell line deposited with the American Type Culture Collection on July 13, 201 1 , with the ATCC Patent Deposit Designation PTA-1 1994) was identified among the positive hybridoma cultures so produced and selected. DC8E8 was further characterized as described below.
  • the antibody isotype was determined to be murine lgG1 by ELISA using a mouse Ig isotyping kit (ISO-2, SIGMA).
  • EXAMPLE 3 SEQUENCING OF VARIABLE REGIONS OF DC8E8 AND ITS
  • composition of the reagents for the 2x reverse transcription master-mix was as follows (quantities per 20 ⁇ _ reaction): 2 ⁇ _ of 10x RT buffer; 0.8 ⁇ _ of 25x dNTP Mix (100 mM); 2 ⁇ of 10x RT Random Primers (50 ⁇ ); 1 ⁇ _ of MultiScribeTM Reverse Transcriptase (50 ⁇ / ⁇ ); 4.2 ⁇ _ of nuclease-free H 2 O.
  • RNA sample 2 ⁇ g 10 ⁇ _
  • cDNA was synthesized under the following conditions: 10 min at 25°C, 120 min at 37°C, 5 min at 85°C, and final cooling to 4°C.
  • Amplification of the genes encoding the variable regions of the light and heavy chains was done by polymerase chain reaction (PCR) using Phusion® High-Fidelity DNA Polymerase (Finnzymes, Finland).
  • the forward primers (8E8L-sense 5'- ACATTGTGATGTCACAGTCTCCATCCTCC-3' (SEQ ID NO: 132) and 8E8H-sense 5'-CTCCTCCAATTGCAGCAGTCTGG-3'(SEQ ID NO: 133)) were designed according to the protein sequence of the N-terminal ends of DC8E8 light
  • DIVMSQSPSS (SEQ ID NO: 134) and heavy (QVQLQQSGPE) (SEQ ID NO: 135) chains.
  • the N-terminal protein sequences were determined using Edman
  • the reverse primers for the light and heavy chains were derived from kappa and lgG1 chains constant regions, respectively.
  • ImMunoGeneTics numbering system (see, e.g., Lefranc MP. The IMGT unique numbering for immunoglobulins, T-cell receptors, and Ig-like domains. The Immunologist 7, 132-136, 1999 (1999)).
  • lgKv4-1 * 01 was identified as the closest human germline gene for the DC8E8 light chain ( Figure 4), and IgHVI -69 * 10 was identified as the closest germline gene for the DC8E8 heavy chain ( Figure 5).
  • the following approach (Method 1 and Method 2) was designed and can be used to prepare one or more humanized versions of the DC8E8 antibody.
  • the resulting humanized, recombinant antibodies can be tested for activity (e.g., biochemical and therapeutic activity) according to any of the methods used for characterization of DC8E8's activity.
  • an appropriate antibody expression system e.g., mammalian expression vectors used for antibody expression in vitro (e.g., HEK293 cells) or in vivo (transgenic animals)
  • activity e.g., biochemical and therapeutic activity
  • Method 1 CDR grafting and mutations in the framework region (FR), if necessary (CDRs are in bold underlined, FR mutations are in bold): Heavy chain variable region (SEQ ID NOS 138-140. respectively, in order of appearance):
  • Method 2 The mouse ( Figure 3) and human ( Figures 4 and 5) germline immunoglobulins with the highest sequence identity with DC8E8 were found and aligned to the DC8E8 protein sequence.
  • the CDR regions were identified following the IMGT numbering system.
  • the most probable antigen-contacting residues within the DC8E8 combining site were identified on the basis of the work of MacCallum etal, J. Mol. Biol.1996.
  • CDRs are in
  • Heavy chain variable region (SEQ ID NOS 138. 145. 139. respectively, in order of appearance):
  • DC8E8 recognized the following human tau proteins: ⁇ 358-441 , ⁇ 421 -441 , ⁇ 134-168, ⁇ 1 -220, ⁇ 1 -126, ⁇ (1 -296;392-441 )/4R and ⁇ (1 -150;392- 441 )/4R, but failed to recognize the tau proteins with deletions ⁇ 222-427, ⁇ 306-400, ⁇ 228-441 , ⁇ 300-312, ⁇ 257-400, ⁇ 137-441 , and ⁇ 283-441 ( Figure 6B, 6C).
  • DC8E8 recognized the physiological tau isoforms 2N4R and 2N3R to a lesser extent than it recognized the pathological/misdisordered tauA(1 -296;392-441 )/4R, tauA(1 -150;392- 441 )/4R and the tau deletion mutants ( ⁇ 358-441 , ⁇ 421 -441 , ⁇ 134-168, ⁇ 1 -220, ⁇ 1 - 126) of tau 2N4R ( Figure 6C). More detailed epitope mapping, using tau peptides, revealed that DC8E8 did not recognize tau peptides 240-270, 270-300, and 301 -330 ( Figure 7A, 7B, 7C).
  • DC8E8 has four binding sites or epitopes on human tau, each of which is located in the microtubule-binding repeat domain region of the tau protein, and each of which epitopes is separately located within one of the following tau sequences: 267-KHQPGGG-273 (SEQ ID NO: 98) (1 st repeat domain of tau protein), 298-KHVPGGG-304 (SEQ ID NO: 99) (2nd repeat domain of tau protein), 329-HHKPGGG-335 (SEQ ID NO: 100) (3rd repeat domain of tau protein), and 361 -THVPGGG-367 (SEQ ID NO: 101 ) (4th repeat domain of tau protein) ( Figure 7D).
  • 267-KHQPGGG-273 SEQ ID NO: 98
  • 298-KHVPGGG-304 SEQ ID NO: 99
  • 329-HHKPGGG-335 SEQ ID NO: 100
  • 361 -THVPGGG-367 SEQ ID NO: 101
  • ELISA plates (IWAKI high bind plate, #3801 -096, Bertoni GmbH, Austria) were coated overnight at 4°C with 100 ⁇ /well of 5 g/ml of recombinant purified tauA(1 -150;392-441/4R) in PBS.
  • the IWAKI high bind plates were washed 4 times with PBS/Tween 20 (0.05% v/v), and blocked with PBS/Tween 20 for 2 h at 25°C.
  • Each of the peptides was separately dissolved in PBS at a final concentration of 5 mM.
  • Purified DC8E8 monoclonal antibody (purification was done as described below in Example 5) was diluted to a concentration of 2 ⁇ g ml in PBS/Tween 20 and 100 ⁇ of this diluted antibody was mixed with each serial dilution of peptides resulting in 200 ⁇ mixtures with 100 ng of antibody/100 ⁇ containing each respective test peptide at a concentration of 40 ⁇ , 20 ⁇ , 10 ⁇ , 5 ⁇ , 2.5 ⁇ , and 1 .25 ⁇ . The antibody/peptide mixtures were incubated for 1 hr at 25°C on a rotating platform set to 250 rpm.
  • the plates were washed 4x times with PBS/Tween.
  • the samples/plates were then incubated with 100 ⁇ of a 1 .5 mg/2ml solution of o-PDA (o-phenylenediamine, SIGMA, P1526) in 0.1 M Na-Acetate pH 6.0 (Roth, #6779) supplemented with 1 .5 ⁇ /2 ⁇ of 30% H 2 O 2 (SIGMA, H-0904) for 10 minutes at 25°C, in the dark.
  • the reaction was stopped by adding 100 ⁇ of 2 M H 2 SO 4 (Merck, 1 .00731 .1000).
  • the extent of reaction was followed by reading the absorbance of the samples/plates at 490 nm (e.g. using the Victor Multilabel Counter (Wallac).
  • Figure 8B shows the results of the competition ELISA performed with the following six peptides: NIKAVPGGGS (SEQ ID NO: 200), NIKHVPGGGS (SEQ ID NO: 201 ), IKHVPGGGS (SEQ ID NO: 202), KHVPGGGSV (SEQ ID NO: 203), HVPGGGSVQ (SEQ ID NO: 204), and VPGGGSVQ (SEQ ID NO: 205) .
  • the aforementioned mapping experiments suggested the presence of the amino acid sequence PGGG within one ore more of epitopes of the DC8E8 antibody. Furthermore, this amino acid sequence is present in all four epitopes on tau protein bound by DC8E8 (see SEQ ID NOs: 98, 99, 100, 101 ). In order to determine the residues in the N-terminal region of the DC8E8 epitopes, alanine scanning experiments were done on tau peptide 295-DNIKHVPGGGS-305, which comprises the DC8E8 epitope (within 298-KHVPGGG-304, SEQ ID NO: 99) that falls within the 2 nd repeat domain of tau.
  • DNIKAVPGGGS SEQ ID NO: 159
  • DNIKHAPGGGS SEQ ID NO: 161
  • the peptide with the original sequence DNIKHVPGGGS SEQ ID NO: 171 .
  • the competition ELISA was carried out according to the following standard protocol. ELISA plates (IWAKI high bind plate, #3801 -096, Bertoni GmbH, Austria) were coated overnight at 4°C with 100 ⁇ /well of 5 g/ml of recombinant purified tauA(1 - 150;392-441/4R) in PBS.
  • the IWAKI high bind plates were washed 4 times with PBS/Tween 20 (0.05% v/v), and blocked with PBS/Tween 20 for 2 h at 25°C.
  • Each of the peptides was separately dissolved in PBS at a final concentration of 5 mM.
  • Serial dilutions (2-fold) of the peptides in PBS/Tween 20 were prepared in
  • polypropylene plates with conical well bottom (Greiner, #651201 ) (concentration range 320 ⁇ , 160 ⁇ , 80 ⁇ , 40 ⁇ , 20 ⁇ , 10 ⁇ , 5 ⁇ , and 2.5 ⁇ ). 100 ⁇ of each dilution were added per well.
  • Purified DC8E8 monoclonal antibody (purification was done as described below in Example 5) was diluted to a concentration of 2 ⁇ g ml in PBS/Tween 20 and 100 ⁇ of this diluted antibody was mixed with each serial dilution of peptides resulting in 200 ⁇ mixtures with 100 ng of antibody/100 ⁇ containing each respective test peptide at a concentration of 160 ⁇ , 80 ⁇ , 40 ⁇ , 20 ⁇ , 10 ⁇ , 5 ⁇ , 2.5 ⁇ , and 1 .25 ⁇ .
  • the antibody/peptide mixtures were incubated for 1 hr at 25°C on a rotating platform set to 250 rpm.
  • One hundred microliters (100 ⁇ ) of antibody/peptide mixtures were transferred from the
  • the samples/plates were then incubated with 100 ⁇ of a 1 .5 mg/2ml solution of o-PDA (o-phenylenediamine, SIGMA, P1526) in 0.1 M Na-Acetate pH 6.0 (Roth, #6779) supplemented with 1 .5 ⁇ /2 ⁇ of 30% H 2 O 2 (SIGMA, H-0904) for 10 minutes at 25°C, in the dark.
  • the reaction was stopped by adding 100 ⁇ of 2 M H 2 SO 4 (Merck, 1 .00731 .1000).
  • the extent of reaction was followed by reading the absorbance of the samples/plates at 490 nm (e.g. using the Victor Multilabel Counter (Wallac).
  • Figure 8C shows the results of the competition ELISA performed with the following seven peptides: ANIKHVPGGGS (SEQ ID NO: 144), DAIKHVPGGGS (SEQ ID NO: 146), DNAKHVPGGGS (SEQ ID NO: 149), DNIAHVPGGGS (SEQ ID NO: 151 ), DNIKAVPGGGS (SEQ ID NO: 159), DNIKHAPGGGS (SEQ ID NO: 161 ), and DNIKHVPGGGS (SEQ ID NO: 171 ).
  • a point mutation changing a histidine to alanine (at corresponding tau position 299, in "epitope #2”) lead to a complete loss of competing activity with tauA(1 -150;392-441/4R) for binding to DC8E8 (peptide DNIKAVPGGGS, SEQ ID NO: 159).
  • SPR Surface plasmon resonance
  • the DC8E8 monoclonal antibody was purified from serum-free hybridoma supernate on a Protein G affinity column, as follows. The hybridoma supernate was adjusted to pH 7.5, the solution was pre- cleared by centrifugation, filtered through a 0.45 ⁇ membrane filter, and loaded onto a 5 ml Protein G Sepharose column. DC8E8 mAb was eluted from the column with 0.1 M Glycine-HCI, pH 2.7. Eluted fractions were immediately neutralized with 1 M Tris-HCI pH 9.0. Pooled fractions were dialyzed against PBS, concentrated by ultrafiltration, and stored at -70 °C. The concentration of the antibody was
  • a BIACORE3000 instrument with a CM5 sensor chip (Biacore AB, Uppsala) was used for the SPR assays.
  • Amine-coupling reagents EDC, NHS, ethanolamine pH 8.5
  • P20 detergent and 10 mM sodium acetate pH 5.0 were obtained from Biacore AB.
  • PBS-P P20
  • PBS-P P20
  • 5,000 RU (response units) of polyclonal anti-mouse antibody No. Z 0420; DakoCytomation, Glostrup, Denmark was coupled at pH 5.0 via primary amines simultaneously in two flow cells, one of which was used as a reference measurement.
  • association equilibrium binding constants K A jwere determined for DC8E8 binding to the four repeat tau protein isoform 2N4R, three repeat tau protein isoform 2N3R, as well as to misdisordered tauA(1 -150;392-441 )/4R and
  • misdisordered tauA(1 -150;392-441 )/3R All tau proteins used for SPR were prepared according to Example 1 .
  • the affinity of DC8E8 was highest for four repeat tauA(1 - 150;392-441 )/4R, followed by the full-length four repeat tau isoform 2N4R, then for three repeat tauA(1 -150;392-441 )/3R, and lastly for the three repeat full-length tau isoform 2N3R ( Figure 9A, B).
  • the sections were incubated with a biotinylated secondary antibody (Vectastain Elite ABC Kit, Vector Laboratories) at room temperature for an hour and then reacted with avidin-biotin peroxidase-complex for 60 minutes (Vectastain Elite ABC Kit, Vector Laboratories), both at room temperature (25°C).
  • a biotinylated secondary antibody Vectastain Elite ABC Kit, Vector Laboratories
  • mAb DC8E8 recognizes all developmental stages of neurofibrillary lesions in human Alzheimer's disease brain tissue, including monomeric, dimeric, early-oligomeric stage ( Figure 1 1 D1 ) and late-oligomeric pre-tangle stage (Figurel 1 D2), as well as late
  • EXAMPLE 7 DC8E8 RECOGNIZES ALL DEVELOPMENTAL STAGES OF NEUROFIBRILLARY DEGENERATION IN THE BRAIN OF TRANSGENIC RATS SHR72,
  • the SHR24 transgenic rat line expresses tauA(1 -150;392- 441 )/3R, a protein described in International Patent Application PCT WO
  • Neurofibrillary degeneration in human Alzheimer's disease including argyrophilia, Congo red birefringence, and Thioflavin S reactivity.
  • Neurofibrillary tangles were also identified with antibodies used to detect pathologic tau in the human brain, including DC1 1 , which recognizes a disease tau conformation (Vechterova et al. 2003;
  • neurofibrillary pathology - neurofibrillary tangles in the cortex.
  • the SHR72 transgenic rat line These transgenic rats express human truncated tauA(1 -150;392-441 )/4R according to International Patent Application PCT WO 2004/007547) in several brain regions and spinal cord. Generation of this rat line was described by Zilka et al., 2006, and tau pathology was described in Koson et al., 2008. The most prominent histopathological feature of these transgenic rats is extensive neurofibrillary pathology, e.g., neurofibrillary tangles. The appearance of NFTs satisfied several histological criteria used to identify neurofibrillary
  • NFTs were also identified with antibodies used to detect pathologic tau in the human brain, including DC1 1 , recognizing an abnormal tau conformation (see US Patent No. 7,446,180), and antibodies that are specific for hyperphosphorylated forms of tau protein.
  • neurofibrillary degeneration was characterized by extensive formation of sarcosyl-insoluble tau protein
  • Transgenic rat lines SHR24 (express tauA(1 -150;392-441 )/3R) and SHR72 (express tauA(1 -150;392-441 )/4R) develop extensive neurofibrillary degeneration in the brain and spinal cord.
  • Transgenic rat line SHR24 displays severe neurodegeneration in the isocortex, brainstem and spinal cord, while SHR72 transgenic rats develop NFT mainly in the brainstem and spinal cord but not in cortex. Progression of sensorimotor and neurological impairment is similar in both transgenic lines; however SHR72 transgenic rats show shorter lifespan.
  • transgenic rat studies presented in this application hemizygous transgenic rats were used (SHR24 and SHR72). All rats were housed under standard laboratory conditions with free access to water and food and were kept under diurnal lighting conditions (12 hour light/dark cycles with light starting at 7:00 a.m.). Efforts were made to minimize the number of rats utilized and to limit their discomfort, pain, and suffering.
  • Tissue sections were pre- treated for 20 min with an antigen unmasking solution (Vector laboratories, CA, USA) and for 1 min with cold (+4°C) 90% formic acid (Applichem, Germany), at room temperature (25°C). After blocking, the sections were incubated overnight with purified monoclonal antibody DC8E8 (7.8 mg/ml) that was diluted 1 :2000 in blocking solution (5% bovine serum albumin, 0.3 % Triton X 100 in 50 nM Tris-HCI). After washing, the sections were incubated with a biotinylated secondary antibody
  • mAb DC8E8 recognized all developmental stages of neurofibrillary lesions in the brain of SHR72 transgenic rats, including diseased monomeric, dimeric, and early-oligomeric stage (Figure 12C) and late-oligomeric pre tangle stage tau (Figure 12D), as well as late developmental stages of pathological tau polymers— intracellular (Figure 12E) and extracellular neurofibrillary tangles ( Figure 12F).
  • DC8E8 also recognized neurofibrillary tangles in the brain of transgenic rats expressing tauA(1 -150;392-441 )/3R) (SHR24, Figure 13A; SHR72, Figure 13B).
  • EXAMPLE 8 DC8E8 RECOGNIZES BOTH SOLUBLE MISDISORDERED TAU AND INSOLUBLE TAU SPECIES IN HUMAN ALZHEIMER'S DISEASE AND IN BRAINS OF
  • Soluble tau and insoluble tau complexes were isolated either from human AD brains or from disease tau transgenic rat brains (SHR24 and SHR72 lines described in Example 7), using the sarkosyl method (Greenberg and Davies, 1990).
  • frozen human AD brain tissues allocortex, samples of Braak stages V and VI obtained form the Netherlands brain bank
  • tissues from transgenic SHR24 rats isocortex, 10, 12 and 14 months old
  • transgenic SHR72 rats (brain stem, 7.5 months old) were homogenized in 10 volumes of cold extraction buffer (10 mM Tris pH 7.4, 0.8 M NaCI, 1 mM EGTA, and 10% sucrose). The homogenates were centrifuged for 20 min at 20,000xg and 50 ⁇ of the supernates were used for the analysis of soluble tau.
  • the resulting supernates were discarded, and the pellets comprise the sarkosyl-insoluble tau fraction.
  • Soluble tau and sarkosyl-insoluble tau fractions were analyzed by immunoblotting. Soluble tau fractions were diluted with an equal volume of 2x SDS- sample loading buffer (with ⁇ -mercaptoethanol) (Laemmli, 1970) and 15 g of proteins were loaded per lane. For sarkosyl-insoluble tau fractions, the pellets were dissolved in 1 x SDS-sample loading buffer, in 1/50 volume of the soluble fraction used for the preparation of the insoluble tau fraction.
  • PVDF polyvinylidene fluoride
  • membranes were blocked in 5% non-fat dry milk in phosphate-buffered— saline (PBS; 136.89 mM NaCI, 2.7 mM KCI, 8.09 mM Na 2 HPO 4 , 1 .47 mM KH 2 PO 4 ) for 1 h at room temperature, and then incubated for 1 h with DC8E8 hybridoma culture supernate, diluted 1 :1 with TBST-milk (20 mM Tris-HCI, pH 7.4, 150 mM NaCI, 0.1 % Tween 20, 5% non-fat dried milk), followed by three washes with large volumes of PBS.
  • PBS phosphate-buffered— saline
  • the membranes were incubated (1 h at room temperature) with HRP- conjugated goat anti-mouse Ig (DAKO, Denmark), diluted 1 :4,000 with PBS, as a secondary antibody. This incubation was followed by washing (three times) with 0.2% Igepal CA-630 (SIGMA) in PBS.
  • the blots were developed with SuperSignal West Pico Chemiluminescent Substrate (Pierce, U.S.A), and the protein signals detected using a LAS3000 imaging system (FUJI Photo Film Co., Japan).
  • the chemiluminescence signal intensities were quantified using AIDA (Advanced Image Data Analyzer, Raytest, Straubenhardt, Germany) software.
  • DC8E8 recognized both soluble human tauA(1 -150;392-441 )/3R and physiological rat tau isoforms in SHR24 transgenic rats ( Figure 14A). Moreover, DC8E8 recognized tauA(1 -150;392-441 )/3R and pathological rat tau proteins in the sarcosyl-insoluble tau fractions from SHR24 rat brains ( Figure 14B). Importantly, DC8E8 strongly recognized pathological human tau proteins in the sarcosyl-insoluble tau fraction in the human AD brains (Braak stages V and VI, Figure 14B and 14C).
  • DC8E8 recognized both soluble human tauA(1 -150;392-441 )/4R and full-length (physiological) rat tau isoforms in SHR72 transgenic rats ( Figure 14D). Significantly, DC8E8 specifically recognized pathological tauA(1 -150;392-441 )/4R and
  • the tau fibrillization assay An in vitro tau fibrillization assay was used to determine whether DC8E8 had an inhibitory effect on pathological tau-tau interactions.
  • the assay is based on an intrinsic property of tau proteins, namely their ability to undergo a conformational change upon interaction with polyanions, such as the sulfated glycosaminoglycan heparin. This altered conformation on one tau molecule further leads to its pathological interactions with another tau molecule, stabilization of the tau-tau complex through formation of cross- ⁇ sheet structures in the microtubule binding regions of the interacting tau molecules, and, lastly, formation of Alzheimer's disease-like paired helical filaments (PHFs) (Skrabana et ai, 2006).
  • PHFs Alzheimer's disease-like paired helical filaments
  • the formation of the beta-sheet-rich structures can be detected by fluorescent dyes, like Thioflavin T.
  • DC51 recognizing an envelope protein of the rabies virus; Macikova et al., 1992
  • DC1 1 recognizing certain truncated conformational ly altered forms of tau
  • DC8E8 This inhibitory activity of DC8E8 was statistically significant when analyzed by a non-parametric t-test ("DC8E8", p ⁇ 0.001 and p p ⁇ 0.01 in Figures 15A and 15B, respectively).
  • An irrelevant antibody, Rab50 Macikova et al., 1992
  • Rab50 Macikova et al., 1992
  • the antibody DC1 1 which recognizes certain pathologically altered conformations of tau (Vechterova et al., 2003 and US Patent No. 7,446,180), further promoted the formation of fibrilized tau; this effect can reflect a stabilization of the pathological conformation of tau required for the abnormal tau-tau interaction and fibril formation by DC1 1 .
  • DC8E8 also inhibited the formation of tau dimers, trimers, and oligomers by misdisordered tauA(1 -296;392-441/4R) (Figure 16).
  • Recombinant tau A(1 -296;392-441 )/4R was incubated for 1 , 4, and 20 h either in the presence or in the absence of DC8E8 as described above for the fibrillization assay.
  • the reaction was stopped by addition of SDS-sample loading buffer.
  • 10 ⁇ of each fibrillization reaction was loaded onto 5-20% gradient SDS polyacrylamide gels and electrophoresed in Tris-glycine-SDS buffer system for 40 minutes at 25 mA.
  • EXAMPLE 10 DC8E8 MEDIATES UPTAKE AND DEGRADATION OF MISDISORDERED
  • Mouse BV2 microglia cells were treated in 6-well plates for different time periods with either 1 ⁇ recombinant tauA(1 -150;392-441 )/4R alone, or with a mixture/complex of tauA(1 -150;392-441 )/4R and DC8E8.
  • the medium was collected and the cells were washed first with PBS, and then for 1 min with mild acid wash solution (0.5 M NaCI, 0.2 M acetic acid, pH 3).
  • the washed cells were then lysed in TTL buffer (20 mM Tris pH 7.4, 150 mM NaCI, 1 mM EDTA, 1 mM DTT, 0.5% Triton X-100, 50 mM NaF, 1 mM Na 3 VO , Roche - protease inhibitor complete) and quickly frozen in liquid nitrogen.
  • TTL buffer (20 mM Tris pH 7.4, 150 mM NaCI, 1 mM EDTA, 1 mM DTT, 0.5% Triton X-100, 50 mM NaF, 1 mM Na 3 VO , Roche - protease inhibitor complete
  • the proteins were transferred onto nitrocellulose membranes (Millipore, Billerica, MA, USA) and stained with Ponceau S to confirm uniform protein transfer, and then the membranes were probed with DC25 hybridoma culture supernate recognizing tau residues 347-353, and referred to as a pan-tau antibody (Axon Neuroscience, Vienna, Austria).
  • Western blotting with an anti-GADPH antibody (1 :1 ,000, Abeam) was used as a protein loading control.
  • Incubation with DC25 primary antibody was followed by washes and incubation with a polyclonal goat anti-mouse IgG secondary antibody, which was HRP-conjugated (1 :3,000; Dako, Glostrup, Denmark).
  • the blots were developed with SuperSignal West Pico Chemiluminescent Substrate (Pierce, U.S.A), and the chemiluminescence signals detected using a LAS3000 imaging system (FUJI Photo Film Co., Japan).
  • TauA(1 -150;392-441 )/4R was added to cultures of mouse BV2 cells at the concentration of 1 ⁇ either alone or with 1 ⁇ mAb DC8E8, as described in the previous paragraph. After incubation for 2, 4, 6, and 12 hours, the cellular proteins were extracted, and the levels of internalized tau were analyzed by Western blotting. Pan-tau antibody DC25 showed the presence of misdisordered tau inside the microglial cells. The western blot profile revealed that the degradation of

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Biomedical Technology (AREA)
  • Immunology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Organic Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Molecular Biology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Neurology (AREA)
  • Epidemiology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Neurosurgery (AREA)
  • Biochemistry (AREA)
  • Urology & Nephrology (AREA)
  • Microbiology (AREA)
  • Hematology (AREA)
  • Zoology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Pathology (AREA)
  • Cell Biology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Mycology (AREA)
  • General Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • Physics & Mathematics (AREA)
  • Biotechnology (AREA)
  • Food Science & Technology (AREA)
  • Toxicology (AREA)
  • Endocrinology (AREA)
PCT/IB2012/002246 2011-09-19 2012-09-14 Protein-based therapy and diagnosis of tau-mediated pathology in alzheimer's disease Ceased WO2013041962A1 (en)

Priority Applications (40)

Application Number Priority Date Filing Date Title
SM20180109T SMT201800109T1 (it) 2011-09-19 2012-09-14 Terapia a base di proteine e diagnosi di una patologia mediata da tau nella malattia di alzheimer
KR1020147010525A KR102130439B1 (ko) 2011-09-19 2012-09-14 알쯔하이머병의 타우 매개된 병리학의 단백질 기재 요법 및 진단
EP12788639.8A EP2758433B1 (en) 2011-09-19 2012-09-14 Protein-based therapy and diagnosis of tau-mediated pathology in alzheimer's disease
KR1020217024024A KR20210099167A (ko) 2011-09-19 2012-09-14 알쯔하이머병의 타우 매개된 병리학의 단백질 기재 요법 및 진단
HK14112922.2A HK1199459B (en) 2011-09-19 2012-09-14 Protein-based therapy and diagnosis of tau-mediated pathology in alzheimer's disease
AU2012311234A AU2012311234B2 (en) 2011-09-19 2012-09-14 Protein-based therapy and diagnosis of tau-mediated pathology in Alzheimer's disease
HRP20180083TT HRP20180083T8 (hr) 2011-09-19 2012-09-14 Terapija i dijagnoza tau-posredovane patologije u alzheimerovoj bolesti zasnovana na proteinu
US14/345,561 US9518101B2 (en) 2011-09-19 2012-09-14 Protein-based therapy and diagnosis of tau-mediated pathology in alzheimer's disease
SI201231187T SI2758433T1 (en) 2011-09-19 2012-09-14 PROTEINLY ESTABLISHED THERAPY AND DIAGNOSIS THIS INTERMEDIATE PATHOLOGY IN ALCHHEIMER'S DISEASES
JP2014530333A JP6253583B2 (ja) 2011-09-19 2012-09-14 アルツハイマー病におけるタウ媒介性病理のタンパク質ベースの治療および診断
MYPI2014000803A MY183989A (en) 2011-09-19 2012-09-14 Protein-based therapy and diagnosis of tau-mediated pathology in alzheimer's disease
BR112014006376-1A BR112014006376B1 (pt) 2011-09-19 2012-09-14 Anticorpo isolado que se liga a um ou mais epítopos tau, ácido nucleico, vetor, composição farmacêutica, artigo de fabricação, dispositivo médico, método in vitro para diagnosticar ou triar um indivíduo quanto à presença de doença de alzheimer ou de uma tauopatia relacionada e usos do referido anticorpo
RS20180054A RS56852B1 (sr) 2011-09-19 2012-09-14 Terapija na osnovu proteina i dijagnoza patologije u kojoj posreduje tau u alchajmerovoj bolesti
KR1020207018712A KR102285743B1 (ko) 2011-09-19 2012-09-14 알쯔하이머병의 타우 매개된 병리학의 단백질 기재 요법 및 진단
LTEP12788639.8T LT2758433T (lt) 2011-09-19 2012-09-14 Alzheimerio ligos tau-sąlygojamos patologijos terapija ir diagnostika baltymų pagrindu
MX2014003357A MX347505B (es) 2011-09-19 2012-09-14 Terapia basada en proteína y diagnóstico de patalogía mediada por tau en la enfermedad de alzheimer.
MX2017005573A MX391157B (es) 2011-09-19 2012-09-14 Terapia basada en proteina y diagnostico de patologia mediada por tau en la enfermedad de alzheimer.
CN201810662577.7A CN109265543B (zh) 2011-09-19 2012-09-14 阿尔茨海默病中的tau蛋白介导病变的基于蛋白质的疗法和诊断
MEP-2018-18A ME03008B (me) 2011-09-19 2012-09-14 Terapija na osnovu proteina i dijagnoza patologije u којој posreduje tau u alcнajмerovoj bolesti
CN202210373330.XA CN115417916B (zh) 2011-09-19 2012-09-14 阿尔茨海默病中的tau蛋白介导病变的基于蛋白质的疗法和诊断
ES12788639.8T ES2656442T3 (es) 2011-09-19 2012-09-14 Terapia basada en proteínas y diagnóstico de una patología mediada por tau en la enfermedad de Alzheimer
DK12788639.8T DK2758433T3 (en) 2011-09-19 2012-09-14 PROTEIN-BASED THERAPY AND DIAGNOSIS OF TAU-MEDIATED PATHOLOGY OF ALZHEIMER'S DISEASE
UAA201404170A UA115657C2 (uk) 2011-09-19 2012-09-14 Виділене антитіло, яке зв'язується з одним або декількома епітопами тау, фармацевтична композиція, що його містить, спосіб лікування та спосіб діагностики хвороби альцгеймера на основі виділеного антитіла
CN201280056856.XA CN104185640B (zh) 2011-09-19 2012-09-14 阿尔茨海默病中的tau蛋白介导病变的基于蛋白质的疗法和诊断
SG11201400125RA SG11201400125RA (en) 2011-09-19 2012-09-14 Protein-based therapy and diagnosis of tau-mediated pathology in alzheimer's disease
RU2014115481A RU2645259C2 (ru) 2011-09-19 2012-09-14 Терапия и диагностика на основе белков тау-опосредуемой патологии при болезни альцгеймера
CA2848346A CA2848346A1 (en) 2011-09-19 2012-09-14 Protein-based therapy and diagnosis of tau-mediated pathology in alzheimer's disease
PL12788639T PL2758433T3 (pl) 2011-09-19 2012-09-14 Oparta na białku terapia i diagnozowanie patologii zależnej od Tau w chorobie Alzheimera
ZA2014/01333A ZA201401333B (en) 2011-09-19 2014-02-21 Protein-based therapy and diagnosing of tau-mediated pathology in alzheimer's disease
IL231201A IL231201B (en) 2011-09-19 2014-02-27 An isolated antibody for the treatment and diagnosis of tau-mediated pathology in Alzheimer's disease
US15/342,629 US9828421B2 (en) 2011-09-19 2016-11-03 Protein-based therapy and diagnosis of tau-mediated pathology in Alzheimer's disease
US15/599,685 US9845352B2 (en) 2011-09-19 2017-05-19 Protein-based therapy and diagnosis of tau-mediated pathology in Alzheimer's disease
US15/801,341 US11098106B2 (en) 2011-09-19 2017-11-02 Protein-based therapy and diagnosis of tau-mediated pathology in alzheimer's disease
AU2017272259A AU2017272259B2 (en) 2011-09-19 2017-12-07 Protein-based therapy and diagnosis of tau-mediated pathology in Alzheimer's disease
CY20181100058T CY1119792T1 (el) 2011-09-19 2018-01-17 Βασισμενη σε πρωτεϊνες θεραπεια και διαγνωση tau-διαμεσολαβουμενης παθολογιας σε νοσο του alzheimer
IL259775A IL259775B (en) 2011-09-19 2018-06-03 Protein-based therapy and diagnosis of tau-mediated pathology in Alzheimer's disease
AU2020200624A AU2020200624B2 (en) 2011-09-19 2020-01-29 Protein-based therapy and diagnosis of tau-mediated pathology in Alzheimer's disease
IL274440A IL274440B (en) 2011-09-19 2020-05-04 Protein-based therapy and diagnosis of tau-mediated pathology in Alzheimer's disease
US17/443,779 US12404322B2 (en) 2011-09-19 2021-07-27 Protein-based therapy and diagnosis of tau-mediated pathology in Alzheimer's disease
IL287794A IL287794A (en) 2011-09-19 2021-11-02 Protein-based therapy and diagnosis of tau-mediated pathology in Alzheimer's disease

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201161536339P 2011-09-19 2011-09-19
US61/536,339 2011-09-19
US201261653115P 2012-05-30 2012-05-30
US61/653,115 2012-05-30

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US14/345,561 A-371-Of-International US9518101B2 (en) 2011-09-19 2012-09-14 Protein-based therapy and diagnosis of tau-mediated pathology in alzheimer's disease
US15/342,629 Division US9828421B2 (en) 2011-09-19 2016-11-03 Protein-based therapy and diagnosis of tau-mediated pathology in Alzheimer's disease

Publications (1)

Publication Number Publication Date
WO2013041962A1 true WO2013041962A1 (en) 2013-03-28

Family

ID=47216372

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/IB2012/002246 Ceased WO2013041962A1 (en) 2011-09-19 2012-09-14 Protein-based therapy and diagnosis of tau-mediated pathology in alzheimer's disease

Country Status (30)

Country Link
US (5) US9518101B2 (https=)
EP (2) EP3275461A1 (https=)
JP (7) JP6253583B2 (https=)
KR (3) KR102130439B1 (https=)
CN (3) CN109265543B (https=)
AU (3) AU2012311234B2 (https=)
BR (1) BR112014006376B1 (https=)
CA (1) CA2848346A1 (https=)
CL (3) CL2014000679A1 (https=)
CY (1) CY1119792T1 (https=)
DK (1) DK2758433T3 (https=)
ES (1) ES2656442T3 (https=)
HR (1) HRP20180083T8 (https=)
HU (1) HUE036177T2 (https=)
IL (4) IL231201B (https=)
LT (1) LT2758433T (https=)
ME (1) ME03008B (https=)
MX (2) MX391157B (https=)
MY (1) MY183989A (https=)
PL (1) PL2758433T3 (https=)
PT (1) PT2758433T (https=)
RS (1) RS56852B1 (https=)
RU (2) RU2018102103A (https=)
SG (4) SG10201703771WA (https=)
SI (1) SI2758433T1 (https=)
SM (1) SMT201800109T1 (https=)
TR (1) TR201800669T4 (https=)
UA (2) UA123390C2 (https=)
WO (1) WO2013041962A1 (https=)
ZA (1) ZA201401333B (https=)

Cited By (47)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8926974B2 (en) 2012-08-16 2015-01-06 Ipierian, Inc. Methods of treating a tauopathy
US8980271B2 (en) 2013-01-18 2015-03-17 Ipierian, Inc. Methods of treating a tauopathy
EP2670434A4 (en) * 2011-01-31 2015-11-11 Intellect Neurosciences Inc TREATMENT OF TAUOPATHIA
WO2015197820A1 (en) * 2014-06-26 2015-12-30 Crucell Holland B.V. Antibodies and antigen-binding fragments that specifically bind to microtubule-associated protein tau
WO2016079597A1 (en) 2014-11-19 2016-05-26 Axon Neuroscience Se Humanized tau antibodies in alzheimer's disease
US20160318975A1 (en) * 2013-12-26 2016-11-03 Toagosei Co., Ltd. Method for promoting expression of calreticulin, and synthetic peptide for use in method for promoting expression of calreticulin
US9527909B2 (en) 2015-02-26 2016-12-27 Eli Lilly And Company Antibodies to tau and uses thereof
JP2017504570A (ja) * 2013-11-27 2017-02-09 アイピエリアン,インコーポレイティド タウオパチーの処置方法
WO2017191561A1 (en) * 2016-05-02 2017-11-09 Prothena Biosciences Limited Antibodies recognizing tau
WO2017191559A1 (en) * 2016-05-02 2017-11-09 Prothena Biosciences Limited Tau immunotherapy
WO2017191560A1 (en) * 2016-05-02 2017-11-09 Prothena Biosciences Limited Antibodies recognizing tau
WO2018078140A1 (fr) * 2016-10-27 2018-05-03 Universite Grenoble Alpes Nanocorps anti-tau
WO2018178077A1 (en) * 2017-03-28 2018-10-04 Janssen Vaccines & Prevention B.V. Binding molecules that specifically bind to tau
RU2679059C1 (ru) * 2018-04-17 2019-02-05 Александр Олегович Морозов Пептид и способ лечения болезни альцгеймера
US10358485B2 (en) 2017-10-16 2019-07-23 Eisai R&D Management Co., Ltd. Anti-Tau antibodies and uses thereof
US10400018B2 (en) 2014-02-14 2019-09-03 Ipierian, Inc. Tau peptides, anti-tau antibodies, and methods of use thereof
WO2019203687A1 (ru) * 2018-04-17 2019-10-24 Александр Олегович МОРОЗОВ Пептид и способ лечения болезни альцгеймера
US10501531B2 (en) 2013-03-13 2019-12-10 Prothena Biosciences Limited Tau immunotherapy
US10562963B2 (en) 2014-06-26 2020-02-18 Janssen Vaccines & Prevention, B.V. Antibodies and antigen-binding fragments that specifically bind to microtubule-associated protein tau
WO2019186276A3 (en) * 2018-03-28 2020-02-27 Axon Neuroscience Se Antibody-based methods of detecting and treating alzheimer's disease
US10633436B2 (en) 2015-06-05 2020-04-28 Genentech, Inc. Anti-tau antibodies and methods of use
US10711058B2 (en) 2016-12-07 2020-07-14 Ac Immune Sa Anti-Tau antibodies and methods of use
RU2727911C2 (ru) * 2015-07-13 2020-07-24 Х. Лундбекк А/С Антитела, специфичные к гиперфосфорилированному тау-белку, и способы их применения
US10836817B2 (en) 2016-12-07 2020-11-17 Ac Immune Sa Anti-Tau antibodies and methods of use
US10906966B2 (en) 2015-07-06 2021-02-02 UCB Biopharma SRL Tau-binding antibodies
WO2021048619A2 (en) 2019-09-09 2021-03-18 Axon Neuroscience Se Biomarkers and treatments of alzheimer's disease and mild cognitive impairment
US10953082B2 (en) * 2016-06-21 2021-03-23 Joon Haeng Rhee Preparation of flagellin vaccine adjuvant-based vaccine to induce production of antibody recognizing conformation of antigens, and application thereof
US10961302B2 (en) 2019-03-03 2021-03-30 Prothena Biosciences Limited Antibodies recognizing tau
US10988529B2 (en) 2016-08-09 2021-04-27 Eli Lilly And Company Combination therapy
WO2021100041A1 (en) * 2019-11-20 2021-05-27 Yeda Research And Development Co. Ltd. Treating alzheimer's disease
EP3894438A1 (en) * 2018-12-13 2021-10-20 INSERM (Institut National de la Santé et de la Recherche Médicale) New anti tau svqivykpv epitope single domain antibody
CN113597431A (zh) * 2019-02-08 2021-11-02 普罗塞纳生物科学有限公司 识别Tau的抗体
US11279929B2 (en) 2018-07-03 2022-03-22 Hoffmann-La Roche, Inc. Oligonucleotides for modulating Tau expression
CN114599393A (zh) * 2019-10-22 2022-06-07 比奥根Ma公司 治疗阿尔茨海默病的抗β-淀粉样蛋白抗体
WO2022176959A1 (en) * 2021-02-19 2022-08-25 Eisai R&D Management Co., Ltd. Anti-pt217 tau antibody
EP3883602A4 (en) * 2018-11-19 2023-04-12 The Board Of Regents Of The University Of Texas System TAU PEPTIDE ANTIGENS AND ANTIBODIES BINDING TO THEM FOR THE TREATMENT OF TAUOPATHIES
WO2023060276A1 (en) * 2021-10-08 2023-04-13 Arbele Limited Compositions and methods for detecting cadherin-17 protein
WO2023092004A1 (en) 2021-11-17 2023-05-25 Voyager Therapeutics, Inc. Compositions and methods for the treatment of tau-related disorders
US11839654B2 (en) 2018-07-31 2023-12-12 Eli Lilly And Company Combination therapy
US11958889B2 (en) 2017-10-25 2024-04-16 Janssen Pharmaceuticals, Inc. Compositions of phosphorylated tau peptides and uses thereof
US11958896B2 (en) 2017-05-02 2024-04-16 Prothena Biosciences Limited Antibodies recognizing tau
EP4153210A4 (en) * 2020-05-19 2024-11-13 Othair Prothena Limited MULTIPLE EPITOPE VACCINES FOR THE TREATMENT OF ALZHEIMER'S DISEASE
US12291565B2 (en) 2022-09-15 2025-05-06 Voyager Therapeutics, Inc. Tau binding compounds
WO2025109524A1 (en) 2023-11-22 2025-05-30 Ac Immune Sa Assays and methods for assessing vaccine preparations
US12324855B2 (en) 2019-02-08 2025-06-10 Ac Immune Sa Method of safe administration of phosphorylated Tau peptide vaccine
WO2025122634A1 (en) 2023-12-05 2025-06-12 Voyager Therapeutics, Inc. Compositions and methods for the treatment of tau-related disorders
AU2018355574B2 (en) * 2017-10-27 2025-09-04 United Neuroscience Tau peptide immunogen constructs

Families Citing this family (52)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
ES2656442T3 (es) * 2011-09-19 2018-02-27 Axon Neuroscience Se Terapia basada en proteínas y diagnóstico de una patología mediada por tau en la enfermedad de Alzheimer
HK1209768A1 (en) 2012-07-03 2016-04-08 Washington University Antibodies to tau
TWI664190B (zh) 2014-06-27 2019-07-01 美商C2N醫療診斷有限責任公司 人類化抗-tau抗體
US9616114B1 (en) 2014-09-18 2017-04-11 David Gordon Bermudes Modified bacteria having improved pharmacokinetics and tumor colonization enhancing antitumor activity
US10830775B2 (en) 2014-09-30 2020-11-10 Washington University Tau kinetic measurements
CN119876138A (zh) 2014-11-14 2025-04-25 沃雅戈治疗公司 调节性多核苷酸
US10676723B2 (en) 2015-05-11 2020-06-09 David Gordon Bermudes Chimeric protein toxins for expression by therapeutic bacteria
KR102770650B1 (ko) * 2015-07-06 2025-02-19 유씨비 바이오파마 에스알엘 타우 결합 항체
GB201518675D0 (en) * 2015-10-21 2015-12-02 Cellcap Technologies Ltd Detection of structural forms of proteins
EP3448874A4 (en) 2016-04-29 2020-04-22 Voyager Therapeutics, Inc. COMPOSITIONS FOR TREATING A DISEASE
EP3448987A4 (en) 2016-04-29 2020-05-27 Voyager Therapeutics, Inc. COMPOSITIONS FOR TREATING A DISEASE
CA3024448C (en) 2016-05-18 2025-09-09 Voyager Therapeutics, Inc. MODULATING POLYNUCLEOTIDES
US11180535B1 (en) 2016-12-07 2021-11-23 David Gordon Bermudes Saccharide binding, tumor penetration, and cytotoxic antitumor chimeric peptides from therapeutic bacteria
US11129906B1 (en) 2016-12-07 2021-09-28 David Gordon Bermudes Chimeric protein toxins for expression by therapeutic bacteria
US11001615B2 (en) 2016-12-21 2021-05-11 Adel Inc. Mutated tau protein fragment and use thereof
BR112019017021A2 (pt) 2017-02-17 2020-04-14 Denali Therapeutics Inc anticorpos anti-tau e métodos de uso dos mesmos
WO2018195376A1 (en) * 2017-04-21 2018-10-25 Ohio University Peptide-based inhibitors of mark family proteins
AU2018308088B2 (en) 2017-07-25 2025-05-29 Truebinding, Inc. Treating cancer by blocking the interaction of TIM-3 and its ligand
JP7029718B2 (ja) * 2017-07-31 2022-03-04 国立研究開発法人量子科学技術研究開発機構 リン酸化タウタンパク質の測定方法
JP6979533B2 (ja) 2017-10-02 2021-12-15 ブラックソーン セラピューティクス インコーポレイテッド 対象における神経行動学的表現型を検知、診断、予測、予知、または処置するための方法及びツール
WO2019120527A1 (en) * 2017-12-20 2019-06-27 Michael Heneka Novel means and methods for treating neurodegenerative diseases
CN111918875A (zh) 2018-03-11 2020-11-10 库罗什·沙帕桑 构象-特异性的抗神经毒性tau蛋白的抗体
US11085935B2 (en) 2018-05-03 2021-08-10 Washington University Methods of treating based on site-specific tau phosphorylation
WO2019213612A1 (en) * 2018-05-03 2019-11-07 Washington University Methods of diagnosing and treating based on site-specific tau phosphorylation
SG11202104549TA (en) * 2018-11-08 2021-05-28 Prothena Biosciences Ltd Antibodies recognizing tau
CN113166235A (zh) * 2018-11-22 2021-07-23 富士瑞必欧株式会社 抗体偶联物
AU2020214796A1 (en) 2019-01-30 2021-07-29 Truebinding, Inc. Anti-Gal3 antibodies and uses thereof
CN113631573B (zh) * 2019-03-25 2024-06-04 国家医疗保健研究所 抗Tau抗体及其在制备用于治疗疾病的药物中的用途
EA202192891A1 (ru) * 2019-04-24 2022-02-04 Янссен Фармасьютикалз, Инк. Гетерологичное введение анти-тау вакцин
MX2021014473A (es) * 2019-05-31 2022-01-06 Lilly Co Eli Compuestos y metodos dirigidos a la tau humana.
GB201909393D0 (en) * 2019-06-28 2019-08-14 Gen2 Neuroscience Ltd Tau epitope and binding molecules
JP7181438B2 (ja) * 2019-08-06 2022-11-30 アプリノイア セラピューティクス リミテッド 病理学的タウ種に結合する抗体及びその使用
MX2022001817A (es) * 2019-08-13 2022-03-11 Washington University St Louis Metodos para detectar isoformas de la region de union a microtubulos (mtbr) tau y uso de las mismas.
CN114531877B (zh) * 2019-08-15 2024-11-15 学校法人东京医科大学 不受clsp阻碍物质影响的clsp衍生物和clsp活性的增强/保护剂
EP4028775A4 (en) 2019-09-10 2023-04-12 Washington University BLOOD-BASED TEST FOR DIAGNOSIS AND TREATMENT BASED ON SITE-SPECIFIC TAU PHOSPHORYLATION
CN110841059A (zh) * 2019-12-03 2020-02-28 南通大学 老年性痴呆小鼠模型的制备方法
WO2021157634A1 (ja) * 2020-02-05 2021-08-12 大日本住友製薬株式会社 タウオパチーおよび認知症関連疾患の判定薬および判定方法
WO2021242776A2 (en) 2020-05-26 2021-12-02 Truebinding, Inc. Methods of treating inflammatory diseases by blocking galectin-3
KR20230080397A (ko) * 2020-08-07 2023-06-07 오타이르 프로테나 리미티드 알츠하이머 질환을 치료하기 위한 멀티에피토프 백신
AU2021321206A1 (en) * 2020-08-07 2023-03-09 Othair Prothena Limited Tau vaccine for the treatment of alzheimer's disease
JP2023551542A (ja) 2020-11-30 2023-12-08 エニグマ バイオインテリジェンス,インコーポレイテッド アルツハイマー病の非侵襲的評価
US20240066146A1 (en) * 2020-12-18 2024-02-29 Sangamo Therapeutics, Inc. Improved pharmaceutical compositions containing adeno-associated viral vector
IL305161A (en) * 2021-02-14 2023-10-01 Prothena Biosciences Ltd Methods of using TAU detection antibodies
EP4297868A4 (en) 2021-02-23 2025-01-08 Hoth Therapeutics, Inc. USE OF APREPITANT TO TREAT ALZHEIMER'S
CL2021001380A1 (es) 2021-05-26 2022-01-14 Corporacion Centro Int De Biomedicina Icc Generación de un nuevo anticuerpo monoclonal sitio específico para la proteína tau y su uso como herramienta en biomarcadores específicos para la detección temprana de enfermedades neurodegenerativas y patologías involucradas con la proteína tau como alzheimer y otras demencias.
CN113430230A (zh) * 2021-06-24 2021-09-24 南通大学 tau截断体蛋白在诱导tau病理聚集中的应用
EP4115976B1 (en) * 2021-07-05 2026-04-29 Alois Data GmbH Reaction vessel
CN113861441A (zh) * 2021-10-28 2021-12-31 南开大学 一种tau蛋白特异的纳米分子伴侣的制备方法及其在抑制tau聚集中的应用
CN116554342A (zh) * 2022-01-29 2023-08-08 元本(珠海横琴)生物科技有限公司 一种融合表达Tau-4R蛋白的大肠杆菌工程菌株
WO2023161528A1 (en) 2022-02-28 2023-08-31 Tridem Bioscience Gmbh & Co Kg A CONJUGATE COMPRISING AT LEAST A ß-GLUCAN
WO2025019332A1 (en) * 2023-07-14 2025-01-23 Alzpath, Inc. Methods for remote blood collection, extraction and analysis of neuro biomarkers
CN117624354B (zh) * 2023-11-30 2024-07-12 无锡傲锐东源生物科技有限公司 一种抗人乙酰化tau281兔单克隆抗体及其应用

Citations (49)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4360019A (en) 1979-02-28 1982-11-23 Andros Incorporated Implantable infusion device
US4424200A (en) 1979-05-14 1984-01-03 Nuc Med Inc. Method for radiolabeling proteins with technetium-99m
US4479930A (en) 1982-07-26 1984-10-30 Trustees Of The University Of Massachusetts Amines coupled wth dicyclic dianhydrides capable of being radiolabeled product
US4487603A (en) 1982-11-26 1984-12-11 Cordis Corporation Implantable microinfusion pump system
US4692147A (en) 1980-04-02 1987-09-08 Medtronic, Inc. Drug administration device
US4725852A (en) 1985-05-09 1988-02-16 Burlington Industries, Inc. Random artificially perturbed liquid apparatus and method
WO1988009344A1 (en) 1987-05-21 1988-12-01 Creative Biomolecules, Inc. Targeted multifunctional proteins
WO1989009622A1 (en) 1988-04-15 1989-10-19 Protein Design Labs, Inc. Il-2 receptor-specific chimeric antibodies
EP0368684A1 (en) 1988-11-11 1990-05-16 Medical Research Council Cloning immunoglobulin variable domain sequences.
WO1990014837A1 (en) 1989-05-25 1990-12-13 Chiron Corporation Adjuvant formulation comprising a submicron oil droplet emulsion
WO1991005058A1 (en) 1989-10-05 1991-04-18 Glenn Kawasaki Cell-free synthesis and isolation of novel genes and polypeptides
EP0451216A1 (en) 1988-12-28 1991-10-16 Protein Design Labs Inc SPECIFIC CHEMICAL IMMUNOGLOBULINS AGAINST THE IL-2 RECEPTOR TAC p55 PROTEIN.
US5202238A (en) 1987-10-27 1993-04-13 Oncogen Production of chimeric antibodies by homologous recombination
US5204244A (en) 1987-10-27 1993-04-20 Oncogen Production of chimeric antibodies by homologous recombination
US5208036A (en) 1985-01-07 1993-05-04 Syntex (U.S.A.) Inc. N-(ω, (ω-1)-dialkyloxy)- and N-(ω, (ω-1)-dialkenyloxy)-alk-1-yl-N,N,N-tetrasubstituted ammonium lipids and uses therefor
EP0547201A1 (de) 1991-07-08 1993-06-23 Deutsches Krebsforschungszentrum Stiftung des öffentlichen Rechts Phagemid zum screenen von antikörpern
EP0549581A1 (en) 1990-09-17 1993-07-07 Scott David Gorman FRAME-MUTED ANTIBODIES AND THEIR PRODUCTION.
US5264618A (en) 1990-04-19 1993-11-23 Vical, Inc. Cationic lipids for intracellular delivery of biologically active molecules
US5279833A (en) 1990-04-04 1994-01-18 Yale University Liposomal transfection of nucleic acids into animal cells
US5283185A (en) 1991-08-28 1994-02-01 University Of Tennessee Research Corporation Method for delivering nucleic acids into cells
WO1994012629A1 (en) 1992-12-02 1994-06-09 Baylor College Of Medicine Episomal vectors for gene therapy
WO1995005853A1 (en) 1993-08-26 1995-03-02 The Regents Of The University Of California Method, compositions and devices for administration of naked polynucleotides which encode biologically active peptides
US5399346A (en) 1989-06-14 1995-03-21 The United States Of America As Represented By The Department Of Health And Human Services Gene therapy
WO1996013592A2 (en) * 1994-10-28 1996-05-09 MAX-PLANCK-Gesellschaft zur Förderung der Wissenschaften e.V. Protein kinase npk-110
WO1996020218A1 (en) * 1994-07-01 1996-07-04 Albert Einstein College Of Medicine Of Yeshiva University Antigen, antibodies and diagnostic assay for alzheimer's disease
WO1996030766A1 (en) * 1995-03-27 1996-10-03 F. Hoffmann-La Roche Ag Inhibition of tau-tau-association
WO1996034625A1 (en) 1995-05-04 1996-11-07 Yale University Recombinant vesiculoviruses and their uses
WO1997017614A1 (en) 1995-11-10 1997-05-15 Elan Corporation, Plc Peptides which enhance transport across tissues and methods of identifying and using the same
US5643207A (en) 1995-04-28 1997-07-01 Medtronic, Inc. Implantable techniques for infusing a therapeutic agent with endogenous bodily fluid
US5643576A (en) 1994-05-27 1997-07-01 The University Of North Carolina At Chapel Hill Method of inducing an immune response with a live Venezuelan Equine Encephalitis virus expressing a heterologous immunogen
US5820589A (en) 1996-04-30 1998-10-13 Medtronic, Inc. Implantable non-invasive rate-adjustable pump
CA1340879C (en) 1986-03-27 2000-01-25 Gregory Paul Winter Recombinant dna product and methods
WO2000030680A1 (en) 1998-11-23 2000-06-02 Idec Pharmaceuticals Corporation Tumor antigen-specific antibody-gp39 chimeric protein constructs
US6198966B1 (en) 1999-02-26 2001-03-06 Medtronic, Inc. Recirculating implantable drug delivery system
WO2001018546A2 (en) 1999-09-09 2001-03-15 MAX-PLANCK-Gesellschaft zur Förderung der Wissenschaften e.V. Screening for inhibitors of 'paired helical filaments'
US6436709B1 (en) 2001-10-19 2002-08-20 Bioware Technology Co., Ltd. Low pressure-accelerated particle gene gun
WO2003020750A2 (de) 2001-09-03 2003-03-13 Bio Life Science Forschungs- Und Entwicklungsges.M.B.H. Antigen-mimotope und vakzine gegen krebserkrankungen
US6548640B1 (en) 1986-03-27 2003-04-15 Btg International Limited Altered antibodies
WO2004007547A2 (en) 2002-07-12 2004-01-22 Axon Neuroscience Forschungs- Und Entwicklungs Gmbh Truncated tau proteins
US20050142609A1 (en) 2003-10-08 2005-06-30 Ebioscience Native immunoglobulin binding reagents and methods for making and using same
US7166697B1 (en) 1998-03-06 2007-01-23 Diatech Pty. Ltd. V-like domain binding molecules
US20080050383A1 (en) 2006-03-29 2008-02-28 New York University Immunotherapy for clearing pathological tau conformers
WO2008084483A1 (en) * 2007-01-11 2008-07-17 Ramot At Tel Aviv University Ltd. Novel therapeutics based on tau/microtubule dynamics
US7446180B2 (en) 2001-02-02 2008-11-04 Axon Neuroscience Forschungs-Und Entwicklungs Gmbh Conformationally abnormal forms of tau proteins and specific antibodies thereto
WO2009000520A1 (en) * 2007-06-25 2008-12-31 Universität Duisburg-Essen Screening-method for polymorphic markers in htra1 gene in neurodegenerative disorders
US20100316564A1 (en) 2009-06-10 2010-12-16 New York University Immunological targeting of pathological tau proteins
WO2011053565A2 (en) * 2009-10-29 2011-05-05 Biomedical Sciences Research Centre "Alexander Fleming" Compositions and methods for detecting a tauopathy
WO2011056300A1 (en) * 2009-11-06 2011-05-12 The J. David Gladstone Institutes Methods and compositions for modulating tau levels
WO2011083175A1 (en) * 2010-01-11 2011-07-14 Universidad De Chile Monoclonal antibody anti-tumor necrosis factor (tnf), which defines sequences, compositions comprising it and its applications

Family Cites Families (18)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6277969B1 (en) 1991-03-18 2001-08-21 New York University Anti-TNF antibodies and peptides of human tumor necrosis factor
ATE398176T1 (de) * 1991-12-06 2008-07-15 Max Planck Gesellschaft Phosphorylierungsepitope aus dem tau-protein zur diagnose und behandlung der alzheimer-krankheit
JP3383618B2 (ja) 1999-08-18 2003-03-04 松下電器産業株式会社 移動体通信端末装置及び受信強度検出方法
WO2001018544A1 (en) * 1999-09-09 2001-03-15 Mcgill University Diagnosis, prognosis and treatment of trinucleotide repeat-associated diseases and intranuclear inclusions-associated diseases
US6589746B1 (en) 1999-10-21 2003-07-08 University Of Cincinnati Method of detecting axonally-derived protein tau in patients with traumatic CNS injury
CA2487528A1 (en) * 2002-07-24 2004-02-12 Innogenetics N.V. Prevention, treatment and diagnosis of diseases associated with beta-amyloid formation and/or aggregation
US7521230B2 (en) * 2002-10-16 2009-04-21 Board Of Regents Of The University Of Nebraska Nucleic acid encoding a Brain Derived Tau Kinase polypeptide and methods of use thereof
EP1516930A1 (en) 2003-09-16 2005-03-23 Georg-August Universität Göttingen Cellular model of tauopathies for lead identification and drug discovery
CN1721437A (zh) * 2004-07-13 2006-01-18 中南大学 一种与Tau蛋白相关的多肽抗原及抗体
US20070280935A1 (en) 2006-04-07 2007-12-06 Bernd Bohrmann Antibody that recognizes phosphorylated peptides
GB0624500D0 (en) * 2006-12-07 2007-01-17 Istituto Superiore Di Sanito A novel passive vaccine for candida infections
EP2149584B1 (en) * 2007-04-20 2017-12-13 The Chemo-Sero-Therapeutic Research Institute Method for enhancing immune response with peptide
UA107571C2 (xx) * 2009-04-03 2015-01-26 Фармацевтична композиція
US8609097B2 (en) 2009-06-10 2013-12-17 Hoffmann-La Roche Inc. Use of an anti-Tau pS422 antibody for the treatment of brain diseases
EP2470211B1 (en) 2009-08-28 2016-01-27 The Board of Regents of The University of Texas System Antibodies that bind tau oligomers
IN2012DN05145A (https=) * 2009-11-19 2015-10-23 Solis Biodyne
ES2656442T3 (es) * 2011-09-19 2018-02-27 Axon Neuroscience Se Terapia basada en proteínas y diagnóstico de una patología mediada por tau en la enfermedad de Alzheimer
CA2874083C (en) * 2014-12-05 2024-01-02 Universite Laval Tdp-43-binding polypeptides useful for the treatment of neurodegenerative diseases

Patent Citations (54)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4360019A (en) 1979-02-28 1982-11-23 Andros Incorporated Implantable infusion device
US4424200A (en) 1979-05-14 1984-01-03 Nuc Med Inc. Method for radiolabeling proteins with technetium-99m
US4692147A (en) 1980-04-02 1987-09-08 Medtronic, Inc. Drug administration device
US4479930A (en) 1982-07-26 1984-10-30 Trustees Of The University Of Massachusetts Amines coupled wth dicyclic dianhydrides capable of being radiolabeled product
US4487603A (en) 1982-11-26 1984-12-11 Cordis Corporation Implantable microinfusion pump system
US5208036A (en) 1985-01-07 1993-05-04 Syntex (U.S.A.) Inc. N-(ω, (ω-1)-dialkyloxy)- and N-(ω, (ω-1)-dialkenyloxy)-alk-1-yl-N,N,N-tetrasubstituted ammonium lipids and uses therefor
US4725852A (en) 1985-05-09 1988-02-16 Burlington Industries, Inc. Random artificially perturbed liquid apparatus and method
US6548640B1 (en) 1986-03-27 2003-04-15 Btg International Limited Altered antibodies
CA1340879C (en) 1986-03-27 2000-01-25 Gregory Paul Winter Recombinant dna product and methods
WO1988009344A1 (en) 1987-05-21 1988-12-01 Creative Biomolecules, Inc. Targeted multifunctional proteins
US5204244A (en) 1987-10-27 1993-04-20 Oncogen Production of chimeric antibodies by homologous recombination
US5202238A (en) 1987-10-27 1993-04-13 Oncogen Production of chimeric antibodies by homologous recombination
WO1989009622A1 (en) 1988-04-15 1989-10-19 Protein Design Labs, Inc. Il-2 receptor-specific chimeric antibodies
US6248516B1 (en) 1988-11-11 2001-06-19 Medical Research Council Single domain ligands, receptors comprising said ligands methods for their production, and use of said ligands and receptors
EP0368684A1 (en) 1988-11-11 1990-05-16 Medical Research Council Cloning immunoglobulin variable domain sequences.
EP0451216A1 (en) 1988-12-28 1991-10-16 Protein Design Labs Inc SPECIFIC CHEMICAL IMMUNOGLOBULINS AGAINST THE IL-2 RECEPTOR TAC p55 PROTEIN.
WO1990014837A1 (en) 1989-05-25 1990-12-13 Chiron Corporation Adjuvant formulation comprising a submicron oil droplet emulsion
US5399346A (en) 1989-06-14 1995-03-21 The United States Of America As Represented By The Department Of Health And Human Services Gene therapy
WO1991005058A1 (en) 1989-10-05 1991-04-18 Glenn Kawasaki Cell-free synthesis and isolation of novel genes and polypeptides
US5279833A (en) 1990-04-04 1994-01-18 Yale University Liposomal transfection of nucleic acids into animal cells
US5264618A (en) 1990-04-19 1993-11-23 Vical, Inc. Cationic lipids for intracellular delivery of biologically active molecules
EP0549581A1 (en) 1990-09-17 1993-07-07 Scott David Gorman FRAME-MUTED ANTIBODIES AND THEIR PRODUCTION.
US6730483B2 (en) 1991-07-08 2004-05-04 Deutsches Krebsforschungszentrum Stiftung Des Offentlichen Rechts Phagemid for antibody screening
EP0547201A1 (de) 1991-07-08 1993-06-23 Deutsches Krebsforschungszentrum Stiftung des öffentlichen Rechts Phagemid zum screenen von antikörpern
US5283185A (en) 1991-08-28 1994-02-01 University Of Tennessee Research Corporation Method for delivering nucleic acids into cells
WO1994012629A1 (en) 1992-12-02 1994-06-09 Baylor College Of Medicine Episomal vectors for gene therapy
WO1995005853A1 (en) 1993-08-26 1995-03-02 The Regents Of The University Of California Method, compositions and devices for administration of naked polynucleotides which encode biologically active peptides
US5643576A (en) 1994-05-27 1997-07-01 The University Of North Carolina At Chapel Hill Method of inducing an immune response with a live Venezuelan Equine Encephalitis virus expressing a heterologous immunogen
WO1996020218A1 (en) * 1994-07-01 1996-07-04 Albert Einstein College Of Medicine Of Yeshiva University Antigen, antibodies and diagnostic assay for alzheimer's disease
WO1996013592A2 (en) * 1994-10-28 1996-05-09 MAX-PLANCK-Gesellschaft zur Förderung der Wissenschaften e.V. Protein kinase npk-110
WO1996030766A1 (en) * 1995-03-27 1996-10-03 F. Hoffmann-La Roche Ag Inhibition of tau-tau-association
US5643207A (en) 1995-04-28 1997-07-01 Medtronic, Inc. Implantable techniques for infusing a therapeutic agent with endogenous bodily fluid
WO1996034625A1 (en) 1995-05-04 1996-11-07 Yale University Recombinant vesiculoviruses and their uses
WO1997017613A1 (en) 1995-11-10 1997-05-15 Elan Corporation, Plc Peptides which enhance transport across tissues and methods of identifying and using the same
WO1997017614A1 (en) 1995-11-10 1997-05-15 Elan Corporation, Plc Peptides which enhance transport across tissues and methods of identifying and using the same
US5820589A (en) 1996-04-30 1998-10-13 Medtronic, Inc. Implantable non-invasive rate-adjustable pump
US7166697B1 (en) 1998-03-06 2007-01-23 Diatech Pty. Ltd. V-like domain binding molecules
WO2000030680A1 (en) 1998-11-23 2000-06-02 Idec Pharmaceuticals Corporation Tumor antigen-specific antibody-gp39 chimeric protein constructs
US6198966B1 (en) 1999-02-26 2001-03-06 Medtronic, Inc. Recirculating implantable drug delivery system
WO2001018546A2 (en) 1999-09-09 2001-03-15 MAX-PLANCK-Gesellschaft zur Förderung der Wissenschaften e.V. Screening for inhibitors of 'paired helical filaments'
EP1214598A2 (en) 1999-09-09 2002-06-19 Max-Planck-Gesellschaft zur Förderung der Wissenschaften e.V. Screening for inhibitors of "paired helical filaments"
US7446180B2 (en) 2001-02-02 2008-11-04 Axon Neuroscience Forschungs-Und Entwicklungs Gmbh Conformationally abnormal forms of tau proteins and specific antibodies thereto
WO2003020750A2 (de) 2001-09-03 2003-03-13 Bio Life Science Forschungs- Und Entwicklungsges.M.B.H. Antigen-mimotope und vakzine gegen krebserkrankungen
US6436709B1 (en) 2001-10-19 2002-08-20 Bioware Technology Co., Ltd. Low pressure-accelerated particle gene gun
WO2004007547A2 (en) 2002-07-12 2004-01-22 Axon Neuroscience Forschungs- Und Entwicklungs Gmbh Truncated tau proteins
US20050142609A1 (en) 2003-10-08 2005-06-30 Ebioscience Native immunoglobulin binding reagents and methods for making and using same
US20080050383A1 (en) 2006-03-29 2008-02-28 New York University Immunotherapy for clearing pathological tau conformers
WO2008084483A1 (en) * 2007-01-11 2008-07-17 Ramot At Tel Aviv University Ltd. Novel therapeutics based on tau/microtubule dynamics
WO2009000520A1 (en) * 2007-06-25 2008-12-31 Universität Duisburg-Essen Screening-method for polymorphic markers in htra1 gene in neurodegenerative disorders
US20100316564A1 (en) 2009-06-10 2010-12-16 New York University Immunological targeting of pathological tau proteins
WO2010144711A2 (en) * 2009-06-10 2010-12-16 New York University Immunological targeting of pathological tau proteins
WO2011053565A2 (en) * 2009-10-29 2011-05-05 Biomedical Sciences Research Centre "Alexander Fleming" Compositions and methods for detecting a tauopathy
WO2011056300A1 (en) * 2009-11-06 2011-05-12 The J. David Gladstone Institutes Methods and compositions for modulating tau levels
WO2011083175A1 (en) * 2010-01-11 2011-07-14 Universidad De Chile Monoclonal antibody anti-tumor necrosis factor (tnf), which defines sequences, compositions comprising it and its applications

Non-Patent Citations (239)

* Cited by examiner, † Cited by third party
Title
"Catalogue of Cell Lines and Hybridomas", 1985
"Current Protocols in Immunology", 1994, JOHN WILEY & SONS, INC.
"Current Protocols in Molecular Biology", 2001, JOHN WILEY & SONS, INC.
"Current Protocols in Protein Science", article "Production of Recombinant Proteins"
"Current Protocols in Protein Science", May 2001
"Fundamental Immunology", 1989, RAVEN PRESS
"Fundamental Immunology", 2008, LIPPINCOTT WILLIAMS & WILKINS
"Handbook of Pharmaceutical Excipients", 2000, AMER. PHARMACEUTICAL ASSOC.
"Immunology-A Synthesis", 1991, SINAUER ASSOCIATES
"Kabat Sequences of Proteins of Immunological Interest", 1987, NATIONAL INSTITUTES OF HEALTH
"Pharmaceutical Dosage Forms and Drug Delivery Systems", 1999, LIPPINCOTT, WILLIAMS, & WILKINS
"Remington's Pharmaceutical Science", 1980, MACK PUBLISHING COMPANY
"Science", vol. 300, 27 June 2003, CALMUNE CORPORATION, pages: 2065 - 71
A. GENNARO: "Remington: The Science and Practice of Pharmacy", 2000, LIPPINCOTT, WILLIAMS, & WILKINS
AI-LAZIKANI, B.; LESK, A.M.; CHOTHIA, C.: "Standard conformations for the canonical structures of immunoglobulins", JOURNAL OF MOLECULAR BIOLOGY, vol. 273, 1997, pages 927 - 948
ALFARO-ACHA ET AL.: "Handgrip Strength and Cognitive Decline in Older Mexican Americans", J GERONTOL A BIOL SCI MED SCI., vol. 61, no. 8, 2006, pages 859 - 865
ALONSO A; ZAIDI T; NOVAK M; GRUNDKE-LQBAL I; IQBAL K: "Hyperphosphorylation induces self-assembly of tau into tangles of paired helical filaments/straight filaments", PROC NATL ACAD SCI USA, vol. 98, 2001, pages 6923 - 6928
ANDREASEN N; BLENNOW K; ZETTERBERG H: "Neuroinflammation Screening in Immunotherapy Trials against Alzheimer's disease", INT J ALZHEIMERS DIS., 2010, pages 638379
ASUNI AA; BOUTAJANGOUT A; QUARTERMAIN D; SIGURDSSON EM: "Immunotherapy targeting pathological tau conformers in a tangle mouse model reduces brain pathology with associated functional improvements", J NEUROSCI, vol. 27, 2007, pages 9115 - 9129
BALDRICK P.: "Pharmaceutical excipient development: the need for preclinical guidance", REGUL. TOXICOL. PHARMACOL., vol. 32, no. 2, 2000, pages 210 - 8
BALIN BJ; LITTLE CS; HAMMOND CJ; APPELT DM; WHITTUM-HUDSOND JA; GERARD HC; HUDSON AP: "Chlamydophila Pneumoniae and the Etiology of Late-Onset Alzheimer's disease", J ALZHEIMER'S DIS, vol. 13, 2008, pages 371 - 380
BERG, L. ET AL.: "Clinicopathologic Studies in Cognitively Healthy Aging and Alzheimer disease", ARCH NEUROL/VOL, vol. 55, March 1998 (1998-03-01)
BERTRAM L; TANZI RE: "Thirty years of Alzheimer's disease genetics: the implications of systematic meta-analyses", NAT REV NEUROSCI, vol. 9, 2008, pages 768 - 778
BETT ET AL., J. VIROL., vol. 67, 1993, pages 5911
BEYCHOK: "Cells of Immunoglobulin Synthesis", 1979, ACADEMIC PRESS
BIERER, L.M. ET AL.: "Neocortical Neurofibrillary Tangles Correlate With Dementia Severity in Alzheimer's disease", ARCH NEURO, vol. 52, January 1995 (1995-01-01)
BOYLE, P. ET AL.: "Association of Muscle Strength With the Risk of Alzheimer disease and the Rate of Cognitive Decline in Community-Dwelling Older Persons", ARCH NEUROL, vol. 66, no. 11, November 2009 (2009-11-01)
BRAAK H; BRAAK E: "Neurodegenerative and age-related changes in structure and function of the cerebral cortex", vol. 14, 1999, KLUWER ACADEMIC/PLENUM PUBLICATIONS, article "Temporal sequence of Alzheimer's disease- related pathology", pages: 475 - 512
BRAAK, H. ET AL.: "Neuropathological stageing of Alzheimer-related changes", ACTA NEUROPATHOL, vol. 82, 1991, pages 239 - 259
BRAAK, H. ET AL.: "The pathological process underlying Alzheimer's disease in individuals under thirty", ACTA NEUROPATHOL, vol. 121, 2011, pages 171 - 181
BUCHMAN, A. ET AL.: "Frailty is Associated With Incident Alzheimer's disease and Cognitive Decline in the Elderly", PSYCHOSOMATIC MEDICINE, vol. 69, 2007, pages 483 - 489
BUCHMAN, A. ET AL.: "Grip Strength and the Risk of Incident Alzheimer's disease", NEUROEPIDEMIOLOGY, vol. 29, 2007, pages 66 - 73
BUEE, L.; BUSSIERE, T.; BUEE-SCHERRER, V.; DELACOURTE, A.; HOF, P.R.: "Tau protein isoforms, phosphorylation and role in neurodegenerative disorders. Brain Research", BRAIN RESEARCH REVIEWS, vol. 33, 2000, pages 95 - 130
BURNS, A.; ZAUDIG, M.: "Mild cognitive impairment in older people", LANCET, vol. 360, no. 9349, 2002, pages 1963 - 5
BURNS, J.M. ET AL.: "The pathology of the substantia nigra in Alzheimer disease with extrapyramidal signs", NEUROLOGY, vol. 64, 2005, pages 1397
CARTER J; LIPPA CF: "Beta-amyloid, neuronal death and Alzheimer's disease", CURR MOL MED, vol. 1, 2001, pages 733 - 737
CEVC ET AL., BIOCHEM. BIOPHYS. ACTA, vol. 1368, 1998, pages 201 - 15
CEVC G; GEBAUER D; STIEBER J; SCHATZIEIN A; BLUME G: "Ultraflexible vesicles, Transfersomes, have an extremely low pore penetration resistance and transport therapeutic amounts of insulin across the intact mammalian skin", BIOCHEM. BIOPHYS. ACTA, vol. 1368, 1998, pages 201 - 15
CHANG ET AL., ADVANCED DRUG DELIVERY REVIEWS, vol. 32, 1998, pages 173 - 186
CHARMAN W N: "Lipids, lipophilic drugs, and oral drug delivery-some emerging concepts", J. PHARM SCI., vol. 89, no. 8, 2000, pages 967 - 78
CHOTHIA ET AL., J. MOL. BIOL., vol. 196, 1987, pages 901 - 917
CHOTHIA ET AL., NATURE, vol. 342, 1989, pages 878 - 883
CHOTHIA; LESK, J. MOL. BIOL., vol. 196, 1987, pages 901 - 917
CHUI, H.C. ET AL.: "Extrapyramidal Signs and Psychiatric Symptoms Predict Faster Cognitive Decline in Alzheimer's disease", ARCH NEUROL, vol. 51, July 1994 (1994-07-01)
CITRON, M.: "Alzheimer's disease: strategies for disease modification", NATURE REV DRUG DISCOVERY, vol. 9, 2010, pages 387 - 398
CLAVAGUERA, F.; BOLMONT, T.; CROWTHER, R.A.; ABRAMOWSKI, D.; PROBST, A.; FRASER, G.; STALDER, A.K.; BEIBEL, M.; STAUFENBIEL, M.; J: "Transmission and spreading of tauopathy in transgenic mouse brain", NAT CELL BIOL, vol. 11, no. 7, 2009, pages 909 - 13
COLLIGAN ET AL.: "Current Protocols in Protein Science", 1997, JOHN WILEY & SONS
CSOKOVA N; SKRABANA R; LIEBIG HD; MEDERLYOVA A; KONTSEK P; NOVAK M: "Rapid purification of truncated tau proteins: model approach to purification of functionally active fragments of disordered proteins, implication for neurodegenerative diseases", PROTEIN EXPR PURIF, vol. 35, 2004, pages 366 - 372
DB KAAS, Q.; RUIZ, M.; LEFRANC, M.-P.: "T cell receptor and MHC structural data", NUCL. ACIDS. RES., vol. 32, 2004, pages D208 - D210
DICKEY CA; ASH P; KLOSAK N; LEE WC; PETRUCELLI L; HUTTON M; ECKMAN CB: "Pharmacologic reductions of total tau levels; implications for the role of microtubule dynamics in regulating tau expression", MOL NEURODEGENER, vol. 1, 2006, pages 6
DICKEY CA; ERIKSEN J; KAMAL A; BURROWS F; KASIBHATLA S; ECKMAN CB; HUTTON M; PETRUCELLI L: "Development of a high throughput drug screening assay for the detection of changes in tau levels -- proof of concept with HSP90 inhibitors", CURR ALZHEIMER RES, vol. 2, 2005, pages 231 - 238
DICKEY CA; PETRUCELLI L: "Current strategies for the treatment of Alzheimer's disease and other tauopathies", EXPERT OPIN THER TARGETS, vol. 10, 2006, pages 665 - 676
DIENER ET AL., SCIENCE, vol. 231, 1986, pages 148
DODART JC; BALES KR; GANNON KS; GREENE SJ; DEMATTOS RB; MATHIS C; DELONG CA; WU S; WU X; HOLTZMAN DM: "Immunization reverses memory deficits without reducing brain Abeta burden in Alzheimer's disease model", NAT NEUROSCI, vol. 5, 2002, pages 452 - 457
D'SOUZA, I.; SCHELLENBERG, G.D.: "Regulation of tau isoform expression and dementia", BIOCHIMICA ET BIOPHYSICA ACTA, vol. 1739, 2005, pages 104 - 115
DUBENSKY ET AL., J. VIROL, vol. 70, 1996, pages 508 - 519
DUYCKAERTS, C. ET AL.: "Classification and basic pathology of Alzheimer disease", ACTA NEUROPATHOL, vol. 118, 2009, pages 5 - 36
DUYCKAERTS, C. ET AL.: "Diagnosis and Staging of Alzheimer disease", NEUROBIOLOGY OF AGING, vol. 18, no. S4, 1997, pages S33 - S42
DUYCKAERTS, C. ET AL.: "The progression of the lesions in Alzheimer disease: insights from a prospective clinicopathological study", J. NEURAL TRANSM, vol. 53, 1998, pages 119 - 126
FERRI CP; PRINCE M; BRAYNE C; BRODATY H; FRATIGLIONI L; GANGULI M; HALL K; HASEGAWA K; HENDRIE H; HUANG Y: "Global prevalence of dementia: a Delphi consensus study", LANCET, vol. 366, 2005, pages 2112 - 2117
FILIPCIK P; ZILKA N; BUGOS 0; KUCERAK J; KOSON P; NOVAK P; NOVAK M: "First transgenic rat model developing progressive cortical neurofibrillary tangles", NEUROBIOL AGING, 31 December 2010 (2010-12-31)
FODERO-TAVOLETTI , M.T. ET AL.: "F-THK523: a novel in vivo tau imaging ligand for Alzheimer's disease", BRAIN, vol. 134, 2011, pages 1089 - 1100
FRENKEL D; DEWACHTER I; VAN LEUVEN F; SOLOMON B: "Reduction of beta-amyloid plaques in brain of transgenic mouse model of Alzheimer's disease by EFRH-phage immunization", VACCINE, vol. 21, 2003, pages 1060 - 1065
FROST, B.; DIAMOND, M.I.: "The expanding realm of prion phenomena in neurodegenerative disease", PRION, vol. 3, no. 2, 2009, pages 74 - 7
FROST, B.; JACKS, RL.; DIAMOND, M.I.: "Propagation of tau misfolding from the outside to the inside of a cell", J BIOL CHEM, vol. 284, no. 19, 2009, pages 12845 - 52
FURLAN R; BRAMBILLA E; SANVITO F; ROCCATAGLIATA L; OLIVIERI S; BERGAMI A; PLUCHINO S; UCCELLI A; COMI G; MARTINO G: "Vaccination with amyloid-beta peptide induces autoimmune encephalomyelitis in C57/BL6 mice", BRAIN, vol. 126, 2003, pages 285 - 291
G6MEZ-RAMOS, A.; DFAZ-HERNANDEZ, M.; CUADROS, R.; HERNÁNDEZ, F.; AVILA, J.: "Extracellular tau is toxic to neuronal cells", FEBS LETT, vol. 580, no. 20, 2006, pages 4842 - 50
G6MEZ-RAMOS, A.; DFAZ-HERNANDEZ, M.; RUBIO, A.; DÍAZ-HERNÁNDEZ, J.I.; MIRAS-PORTUGAL, M.T.; AVILA, J.: "Characteristics and consequences of muscarinic receptor activation by tau protein", EUR NEUROPSYCHOPHARMACOL, vol. 19, no. 10, 2009, pages 708 - 17
G6MEZ-RAMOS, A.; DÍAZ-HERNÁNDEZ, M.; RUBIO, A.; MIRAS-PORTUGAL, M.T.; AVILA, J.: "Extracellular tau promotes intracellular calcium increase through M1 and M3 muscarinic receptors in neuronal cells", MOL CELL NEUROSCI, vol. 37, no. 4, 2008, pages 673 - 81
GELINAS DS; DASILVA K; FENILI D; ST GEORGE-HYSLOP P; MCLAURIN J: "Immunotherapy for Alzheimer's disease", PROC NATL ACAD SCI USA, vol. 101, no. 2, 2004, pages 14657 - 14662
GIANNAKOPOULOS, P. ET AL.: "Pathologic Correlates of Apraxia in Alzheimer disease", ARCH NEUROL, vol. 55, May 1998 (1998-05-01)
GIANNAKOPOULOS, P.; HERRMANN, F.R.; BUSSIERE, T.; BOURAS, C.; KOVARI, E.; PERL, D.P.; MORRISON, J.H.; GOLD, G.; HOF, P.R.: "Tangle and neuron numbers, but not amyloid load, predict cognitive status in Alzheimer's disease", NEUROLOGY, vol. 60, 2003, pages 1495 - 500
GLENN ET AL., NATURE, vol. 391, 1998, pages 851
GLENN GM; RAO M; MATYAS GR; ALVING CR: "Skin immunization made possible by cholera toxin", NATURE, vol. 391, 1998, pages 851
GOEDERT, M.; SPILLANTINI, M.G.; JAKES, R.; RUTHERFORD, D.; CROWTHER, R.A.: "Multiple isoforms of human microtubule-associated protein tau: sequences and localization in neurofibrillary tangles of Alzheimer's disease", NEURON, vol. 3, 1989, pages 519 - 526
GOEDERT, M.; SPILLANTINI, M.G.; POTIER, M.C.; ULRICH, J.; CROWTHER, R.A.: "Cloning and sequencing of the cDNA encoding an isoform of microtubule-associated protein tau containing four tandem repeats: differential expression of tau protein mRNAs in human brain", EMBO J., vol. 8, 1989, pages 393 - 399
GOLDMAN, W.P. ET AL.: "Motor dysfunction in mildly demented AD individuals without extrapyramidal signs", NEUROLOGY, vol. 53, 1999, pages 956
GOMEZ-ISLA T; HOLLISTER R; WEST H; MUI S; GROWDON JH; PETERSEN RC; PARISI JE; HYMAN BT: "Neuronal loss correlates with but exceeds neurofibrillary tangles in Alzheimer's disease", ANN NEUROL, vol. 41, 1997, pages 17 - 24
GÓMEZ-ISLA, T.; PRICE, J.L.; MCKEEL JR, D.W.; MORRIS, J.C.; GROWDON, J.H.; HYMAN, B.T.: "Profound loss of layer II entorhinal cortex neurons occurs in very mild Alzheimer's disease", J NEUROSCI, vol. 16, no. 14, 1996, pages 4491 - 500
GOODE, B.L.; CHAU, M.; DENIS, P.E.; FEINSTEIN, S.C.: "Structural and functional differences between 3-repeat and 4-repeat tau isoforms. Implications for normal tau function and the onset of neurodegenerative disease", J BIOL CHEM, vol. 275, 2000, pages 38182 - 38189
GOODE, B.L.; FEINSTEIN, S.C.: "Identification of a novel microtubule binding and assembly domain in the developmentally regulated inter- repeat region of tau", J CELL BIOL., vol. 124, 1994, pages 769 - 782
GREENBERG SG; DAVIES P.: "A preparation of Alzheimer paired helical filaments that displays distinct tau proteins by polyacrylamide gel electrophoresis", PROC NATL ACAD SCI USA, vol. 87, 1990, pages 5827 - 5831
GREENBERG SG; DAVIES P; SCHEIN JD; BINDER LI: "Hydrofluoric acid-treated tau PHF proteins display the same biochemical properties as normal tau", THE JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 267, 1992, pages 564 - 569
GRUDEN MA; DAVUDOVA TB; MALISAUSKAS M; ZAMOTIN VV; SEWELL RD; VOSKRESENSKAYA NI; KOSTANYAN IA; SHERSTNEV VV; MOROZOVA-ROCHE LA: "Autoimmune responses to amyloid structures of Abeta(25-35) peptide and human lysozyme in the serum of patients with progressive Alzheimer's disease", DEMENT GERIATR COGN DISORD, vol. 18, 2004, pages 165 - 171
GRUDZIEN, A. ET AL.: "Locus coeruleus neurofibrillary degeneration in aging, mild cognitive impairment and early Alzheimer's disease", NEUROBIOLOGY OF AGING, vol. 28, 2007, pages 327 - 335
GRUNDKE-IQBAL I; IQBAL K; TUNG YC; QUINLAN M; WISNIEWSKI HM; BINDER LI: "Abnormal phosphorylation of the microtubule-associated protein tau (tau) in Alzheimer cytoskeletal pathology", PROC NATL ACAD SCI USA, vol. 83, 1986, pages 4913 - 4917
HAMPEL, H.; BLENNOW, K.; SHAW, L.M.; HOESSLER, Y.C.; ZETTERBERG, H.; TROJANOWSKI, J.Q.: "Total and phosphorylated tau protein as biological markers of Alzheimer's disease", EXP GERONTOL, vol. 45, no. 1, 2010, pages 30 - 40
HANES, ADVANCED DRUG DELIVERY REVIEWS, vol. 28, 1997, pages 97 - 119
HARDY J; ALLSOP D: "Amyloid deposition as the central event in the aetiology of Alzheimer's disease", TRENDS PHARMACOL SCI, vol. 12, 1991, pages 383 - 388
HARDY J; DUFF K; HARDY KG; PEREZ-TUR J; HUTTON M: "Genetic dissection of Alzheimer's disease and related dementias: amyloid and its relationship to tau", NAT NEUROSCI, vol. 1, 1998, pages 355 - 358
HARDY J; SELKOE DJ: "The amyloid hypothesis of Alzheimer's disease: progress and problems on the road to therapeutics", SCIENCE, vol. 297, 2002, pages 353 - 356
HARLOW; LANE: "Antibodies, A Laboratory Manual", 1989, COLD SPRING HARBOR
HAYNES JR; MCCABE DE; SWAIN WF; WIDERA G; FULLER JT: "Particle- mediated nucleic acid immunization", J BIOTECHNOL, vol. 44, 1996, pages 37 - 42
HERTZ, L.: "Is Alzheimer's disease an anterograde degeneration, originating in the brainstem, and disrupting metabolic and functional interactions between neurons and glial cells?", BRAIN RESEARCH REVIEWS, vol. 14, 1989, pages 335 - 353
HUNTER RL.: "Overview of vaccine adjuvants: present and future", VACCINE, vol. 20, no. 3, 2002, pages 7 - 12
HUNTER W.M.; GREENWOOD F.C., NATURE, vol. 194, 1962, pages 495
IMMUN. REV., vol. 62, 1982, pages 185
IQBAL K; GRUNDKE-LQBAL I: "Developing pharmacological therapies for Alzheimer disease", CELL MOL LIFE SCI, vol. 64, 2007, pages 2234 - 2244
IQBAL K; GRUNDKE-LQBAL I: "Inhibition of neurofibrillary degeneration: a promising approach to Alzheimer's disease and other tauopathies", CURR DRUG TARGETS, vol. 5, 2004, pages 495 - 502
IRVING ELAINE A ET AL: "Intracortical perfusion of glutamate in vivo induces alterations of tau and microtubule-associated protein 2 immunoreactivity in the rat", ACTA NEUROPATHOLOGICA, SPRINGER VERLAG, BERLIN, DE, vol. 92, no. 2, 1 July 1996 (1996-07-01), pages 186 - 196, XP008159335, ISSN: 0001-6322, [retrieved on 19960715], DOI: 10.1007/S004010050507 *
ITZHAKI RF; WOZNIAK MA: "Herpes Simplex Virus Type 1 in Alzheimer's disease: The Enemy Within", J ALZHEIMERS DIS., vol. 13, 2008, pages 393 - 405
IVANOVOVA N; HANDZUSOVA M; HANES J; KONTSEKOVA E; NOVAK M: "High- yield purification of fetal tau preserving its structure and phosphorylation pattern", J IMMUNOL METHODS, vol. 339, 2008, pages 17 - 22
JACOBSEN JS; REINHART P; PANGALOS MN: "Current concepts in therapeutic strategies targeting cognitive decline and disease modification in Alzheimer's disease", NEURORX, vol. 2, 2005, pages 612 - 626
JAKES, R.; NOVAK, M.; DAVISON, M.; WISCHIK, C.M.: "Identification of 3- and 4-repeat tau isoforms within the PHF in Alzheimer's disease", EMBO J, vol. 10, 1991, pages 2725 - 2729
JAMES SHIRVILL: "Business Insights, Preclinical Development of Monoclonal Antibodies and Related Biologicals-Emerging technologies and new therapeutic candidates", 2010
JANSEN FK; BLYTHMAN HE; CARRIERE D; CASELLAS P; GROS 0; GROS P; LAURENT JC; PAOLUCCI F; PAU B; PONCELET P: "Immunotoxins: hybrid molecules combining high specificity and potent cytotoxicity", IMMUN. REV., vol. 62, 1982, pages 185 - 216
JANUS C; PEARSON J; MCLAURIN J; MATHEWS PM; JIANG Y; SCHMIDT SD; CHISHTI MA; HORNE P; HESLIN D; FRENCH J: "A beta peptide immunization reduces behavioural impairment and plaques in a model of Alzheimer's disease", NATURE, vol. 408, 2000, pages 979 - 982
JENSEN FC; SAVARY JR; DIVELEY JP; CHANG JC: "Adjuvant activity of incomplete Freund's adjuvant", ADVANCED DRUG DELIVERY REVIEWS, vol. 32, 1998, pages 173 - 186
JICHA G A ET AL: "SEQUENCE REQUIREMENTS FOR FORMATION OF CONFORMATIONAL VARIANTS OF TAU SIMILAR TO THOSE FOUND IN ALZHEIMER'S DISEASE", JOURNAL OF NEUROSCIENCE RESEARCH, WILEY-LISS, US, vol. 55, 15 March 1999 (1999-03-15), pages 713 - 723, XP002919500, ISSN: 0360-4012, DOI: 10.1002/(SICI)1097-4547(19990315)55:6<713::AID-JNR6>3.0.CO;2-G *
JOHNSON, G.; WU, T. T., NUCLEIC ACIDS RES., vol. 28, 2000, pages 214 - 218
KAAS, Q.; LEFRANC, M.-P., CURRENT BIOINFORMATICS, vol. 2, 2007, pages 21 - 30
KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1991, PUBLIC HEALTH SERVICE, NATIONAL INSTITUTES OF HEALTH
KARLSSON; LARSSON: "Methods in Molecular Biology, Vol. 248: Antibody Engineering: Methods and Protocols", vol. 248, 2008, HUMANA PRESS INC., article "Affinity Measurement Using Surface Plasmon Resonance"
KORENOVA M; ZILKA N; STOZICKA Z; BUGOS 0; VANICKY , NOVAK M: "NeuroScale, the battery of behavioural tests with novel scoring system for phenotyping of transgenic rat model of tauopathy", J NEUROSCI METHODS, vol. 177, 2009, pages 108 - 114
KOSIK, K.S.; KOWALL, N.W.; MCKEE, A.: "Along the way to a neurofibrillary tangle: a look at the structure of tau", ANN MED., vol. 21, 1989, pages 109 - 112
KOSON P; ZILKA N; KOVAC A; KOVACECH B; KORENOVA M; FILIPCIK P; NOVAK M: "Truncated tau expression levels determine life span of a rat model of tauopathy without causing neuronal loss or correlating with terminal neurofibrillary tangle load", EUR J NEUROSCI, vol. 28, 2008, pages 239 - 246
KOSTELNY ET AL., J. IMMUNOL., vol. 148, 1992, pages 1547 - 1553
KOVAC, A.; ZILKOVA, M.; DELI, M.A.; ZILKA, N.; NOVAK, M.: "Human truncated tau is using a different mechanism from amyloid-beta to damage the blood-brain barrier", J ALZHEIMERS DIS, vol. 18, no. 4, 2009, pages 897 - 906
KOVACECH B; NOVAK M: "Tau truncation is a productive posttranslational modification of neurofibrillary degeneration in Alzheimer's disease", CURR ALZHEIMER RES, 2010, pages 7
KOVACECH B; SKRABANA R; NOVAK M: "Transition of tau protein from disordered to misordered in Alzheimer's disease", NEURODEGENER DIS, vol. 7, 2010, pages 24 - 27
KRAEMER, H.C. ET AL.: "How Far' vs 'How Fast' in Alzheimer's disease", ARCH NEUROL, vol. 51, March 1994 (1994-03-01)
KRAJCIOVA, G.; SKRABANA, R.; FILIPCIK, P.; NOVAK, M.: "Preserving free thiols of intrinsically disordered tau protein without the use of a reducing agent", ANAL BIOCHEM, vol. 383, 2008, pages 343 - 345
KREBBER A; BORNHAUSER S; BURMESTER J; HONEGGER A; WILLUDA J; BOSSHARD HR; P UCKTHUN A: "Reliable cloning of functional antibody variable domains from hybridomas and spleen cell repertoires employing a reengineered phage display system", J IMMUNOL METHODS, vol. 201, no. 1, 14 February 1997 (1997-02-14), pages 35 - 55
LAEMMLI UK: "Cleavage of structural proteins during the assembly of the head of bacteriophage T4", NATURE, vol. 227, 1970, pages 680 - 685
LANGER R: "New methods of drug delivery", SCIENCE, vol. 249, 1990, pages 1527 - 33
LANGER R; CLELAND JL; HANES J: "New advances in microsphere- based single-dose vaccines", ADVANCED DRUG DELIVERY REVIEWS, vol. 28, 1997, pages 97 - 119
LANGER, SCIENCE, vol. 249, 1990, pages 1527
LARBIG G; PICKHARDT M; LLOYD DG; SCHMIDT B; MANDELKOW E: "Screening for inhibitors of tau protein aggregation into Alzheimer paired helical filaments: a ligand based approach results in successful scaffold hopping", CURR ALZHEIMER RES, vol. 4, 2007, pages 315 - 323
LAWRIE ET AL., CUR. OPIN. GENET. DEVELOP., vol. 3, 1993, pages 102 - 109
LEE HG; PERRY G; MOREIRA PI; GARRETT MR; LIU Q; ZHU X; TAKEDA A; NUNOMURA A; SMITH MA: "Tau phosphorylation in Alzheimer's disease: pathogen or protector?", TRENDS MOL MED, vol. 11, 2005, pages 164 - 169
LEFRANC M.-P., IMMUNOLOGY TODAY, vol. 18, 1997, pages 509
LEFRANC M.-P., THE IMMUNOLOGIST, vol. 7, 1999, pages 132 - 136
LEFRANC M.P.: "The IMGT unique numbering for immunoglobulins, T-cell receptors, and Ig-like domains", THE IMMUNOLOGIST, vol. 7, 1999, pages 132 - 136
LEFRANC, M.-P.; POMMIÉ, C.; RUIZ, M.; GIUDICELLI, V.; FOULQUIER, E.; TRUONG, L.; THOUVENIN-CONTET, V.; LEFRANC, DEV., COMP. IMMUNOL., vol. 27, 2003, pages 55 - 77
LIU, Y. ET AL.: "Pathological Correlates of Extrapyramidal Signs in Alzheimer's disease", ANN NEUROL, vol. 4, no. 1, 1997, pages 368 - 374
LIVINGSTON, B.D.; CRIMI, C.; GREY, H.; ISHIOKA, G.; CHISARI, F.V.; FIKES, J.; GREY, H.; CHESNUT, R.W.; SETTE, A.: "The hepatitis B virus-specific CTL responses induced in humans by lipopeptide vaccination are comparable to those elicited by acute viral infection", J. IMMUNOL., vol. 159, 1997, pages 1383 - 1392
LIVINGSTON, J. IMMUNOL., vol. 159, 1997, pages 1383 - 1392
LOUIS, E.D. ET AL.: "Parkinsonian Signs in Older People in a Community-Based Study", ARCH NEUROL, vol. 61, August 2004 (2004-08-01)
MACCALLUM ET AL., J. MOL. BIOL., 1996
MACCALLUM RM; MARTIN AC; THORNTON JM: "Antibody-antigen interactions: contact analysis and binding site topography", J MOL BIOL., vol. 262, no. 5, 11 October 1996 (1996-10-11), pages 732 - 45
MACIKOVA I.; DEDEK L.; KONTSEKOVA E.; KONTSEK P.; CIAMPOR F; NOVAK M.; VRZAL V.: "Common and different antigenic properties of the rabies virus glycoprotein between strains SAD-Vnukovo and Pitman-Moore", ACTA VIROL., vol. 36, 1992, pages 541 - 55
MARZ W; SCHARNAGL H; KIRCA M; BOHL J; GROSS W; OHM TG: "Apolipoprotein E polymorphism is associated with both senile plaque load and Alzheimer-type neurofibrillary tangle formation", ANN N Y ACAD SCI., vol. 777, 1996, pages 276 - 80
MATSUO ES; SHIN RW; BILLINGSLEY ML; VAN DEVOORDE A; O'CONNOR M; TROJANOWSKI JQ; LEE VM: "Biopsy-derived adult human brain tau is phosphorylated at many of the same sites as Alzheimer's disease paired helical filament tau", NEURON, vol. 13, 1994, pages 989 - 1002
MCGEE ET AL., J. MICRO ENCAP., 1996
MIKLOSSY J.: "Chronic Inflammation and Amyloidogenesis in Alzheimer's disease - Role of Spirochetes", J ALZHEIMER'S DIS, vol. 13, 2008, pages 381 - 391
MOE, J.G.; CHATTERJEE, I.; DAVIDOWITZ, E.J.; ARANCIO, O.: "Modulation of synaptic function by extracellular tau enriched in oligomers", ALZHEIMER DEM, vol. 5, no. 4, 2009, pages 499
MORGAN D.: "Immunotherapy for Alzheimer's disease", J INTERN MED., vol. 269, no. 1, 2011, pages 54 - 63
MORGAN D; DIAMOND DM; GOTTSCHALL PE; UGEN KE; DICKEY C; HARDY J; DUFF K; JANTZEN P; DICARLO G; WILCOCK D: "A beta peptide vaccination prevents memory loss in an animal model of Alzheimer's disease", NATURE, vol. 408, 2000, pages 982 - 985
MORRIS, J.C. ET AL.: "Clinical and Pathological Aspects of Parkinsonism in Alzheimer's disease", ARCH NEUROL, vol. 46, June 1989 (1989-06-01)
MORRISON, S. L. ET AL., PROC. NATL. ACAD SCI. USA, vol. 81, 1984, pages 6851 - 6855
MOURI A; NODA Y; HARA H; MIZOGUCHI H; TABIRA T; NABESHIMA T: "Oral vaccination with a viral vector containing Abeta cDNA attenuates age-related Abeta accumulation and memory deficits without causing inflammation in a mouse Alzheimer model", FASEB J, vol. 21, 2007, pages 2135 - 2148
MYSZKA, D.G.: "Improving biosensor analysis", J. MOL. RECOGNIT., vol. 12, 1999, pages 279 - 84
MYSZKA, J MOL REC, 1999
NECULA M; CHIRITA CN; KURET J: "Cyanine dye N744 inhibits tau fibrillization by blocking filament extension: implications for the treatment of tauopathic neurodegenerative diseases", BIOCHEMISTRY, vol. 44, 2005, pages 10227 - 10237
NEDDLEMAN; WUNSCH, J. MOL. BIOL., vol. 48, 1970, pages 443
NEUBERGER, M. S. ET AL., NATURE, vol. 314, 1985, pages 268 - 270
NICOLAU C; GREFERATH R; BALABAN TS; LAZARTE JE; HOPKINS RJ: "A liposome-based therapeutic vaccine against beta -amyloid plaques on the pancreas of transgenic NORBA mice", PROC NATL ACAD SCI USA, vol. 99, 2002, pages 2332 - 2337
NOBLE W; PLANEL E; ZEHR C; OLM V; MEYERSON J; SULEMAN F; GAYNOR K; WANG L; LAFRANCOIS J; FEINSTEIN B: "Inhibition of glycogen synthase kinase-3 by lithium correlates with reduced tauopathy and degeneration in vivo", PROC NATL ACAD SCI U S A, vol. 102, 2005, pages 6990 - 6995
NOVAK, M.; KABAT, J.; WISCHIK, C.M.: "Molecular characterization of the minimal protease resistant tau unit of the Alzheimer's disease paired helical filament", EMBO J, vol. 12, 1993, pages 365 - 70
ODDO S; BILLINGS L; KESSLAK JP; CRIBBS DH; LAFERLA FM: "Abeta immunotherapy leads to clearance of early, but not late, hyperphosphorylated tau aggregates via the proteasome", NEURON, vol. 43, 2004, pages 321 - 332
ODDO S; CACCAMO A; SHEPHERD JD; MURPHY MP; GOLDE TE; KAYED R; METHERATE R; MATTSON MP; AKBARI Y; LAFERLA FM: "Triple-transgenic model of Alzheimer's disease with plaques and tangles: intracellular Abeta and synaptic dysfunction", NEURON, vol. 39, 2003, pages 409 - 421
O'HAGAN DT; VALIANTE NM: "Recent advances in the discovery and delivery of vaccine adjuvants", NAT REV DRUG DISCOV, vol. 2, 2003, pages 727 - 735
OHE ET AL., HUMAN GENE THERAPY, vol. 6, 1995, pages 325 - 333
OTVOS L, JR.; FEINER L; LANG E; SZENDREI GI; GOEDERT M; LEE VM: "Monoclonal antibody PHF-1 recognizes tau protein phosphorylated at serine residues 396 and 404", JOURNAL OF NEUROSCIENCE RESEARCH, vol. 39, 1994, pages 669 - 673
PAUL A; CEVC G; BACHHAWAT BK: "Transdermal immunization with large proteins by means of ultradeformable drug carriers", EUR J IMMUNOL., vol. 25, no. 12, December 1995 (1995-12-01), pages 3521 - 4
PAUL ET AL., EUR. J. IMMUNOL., vol. 25, 1995, pages 3521 - 24
PEARSON; LIPMAN, PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 2444
PÉREZ M ET AL: "In vitro assembly of tau protein: mapping the regions involved in filament formation.", BIOCHEMISTRY 22 MAY 2001, vol. 40, no. 20, 22 May 2001 (2001-05-22), pages 5983 - 5991, XP002690620, ISSN: 0006-2960 *
PETTERSSON, A.F. ET AL.: "Motor Function in Subjects with Mild Cognitive Impairment and Early Alzheimer's disease", DEMENT GERIATR COGN DISORD, vol. 19, 2005, pages 299 - 304
PICKHARDT M; VON BERGEN M; GAZOVA Z; HASCHER A; BIERNAT J; MANDELKOW EM; MANDELKOW E: "Screening for inhibitors of tau polymerization", CURR ALZHEIMER RES, vol. 2, 2005, pages 219 - 226
POPE ME; SOSTE MV; EYFORD BA; ANDERSON NL; PEARSON TW, J IMMUNOL METHODS, vol. 341, no. 1-2, 2009, pages 86 - 96
POWELL ET AL.: "Compendium of excipients for parenteral formulations", PDA J PHARM SCI TECHNOL., vol. 52, 1998, pages 238 - 311
PRICE JL; MORRIS JC: "Tangles and plaques in nondemented aging and ''preclinical'' Alzheimer's disease", ANN NEUROL, vol. 45, 1999, pages 358 - 368
RAPOPORT M; DAWSON HN; BINDER LI; VITEK MP: "Ferreira A Tau is essential to beta -amyloid-induced neurotoxicity", PROC NATL ACAD SCI USA, vol. 99, 2002, pages 6364 - 6369
REICHERT, J.M.: "Antibody-based therapeutics to watch in 2011", MABS, vol. 3, no. 1, 2011, pages 76 - 99
REITZ, C. ET AL.: "Memory performance is related to amyloid and tau pathology in the hippocampus", J. NEUROL. NEUROSURG. PSYCHIATRY 2009, vol. 80, March 2009 (2009-03-01), pages 715 - 721
RIECHMANN, L. ET AL., NATURE, vol. 332, 1988, pages 323 - 327
ROBERSON ED; SCEARCE-LEVIE K; PALOP JJ; YAN F; CHENG IH; WU T; GERSTEIN H; YU GQ; MUCKE L: "Reducing endogenous tau ameliorates amyloid beta- induced deficits in an Alzheimer's disease mouse model", SCIENCE, vol. 316, 2007, pages 750 - 754
RUIZ, M.; LEFRANC, M.-P., IMMUNOGENETICS, vol. 53, 2002, pages 857 - 883
SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", 1989, COLD SPRING HARBOR
SAMBROOK ET AL.: "Molecular cloning: a laboratory manual", 2001, COLD SPRING HARBOR LABORATORY
SAMBROOK ET AL.: "Molecular Cloning--A Laboratory Manual", vol. 1-3, 2000, COLD SPRING HARBOR LABORATORY
SAMBROOK J; RUSSELL D: "Moleclular cloning: A laboratory manual", 2001, COLD SPRING HARBOR LABORATORY PRESS
SAMBROOK; RUSSELL: "Molecular Cloning: A Laboratory manual", 2001
SANTACRUZ K; LEWIS J; SPIRES T; PAULSON J; KOTILINEK L; INGELSSON M; GUIMARAES A; DETURE M; RAMSDEN M; MCGOWAN E: "Tau suppression in a neurodegenerative mouse model improves memory function", SCIENCE, vol. 309, 2005, pages 476 - 481
SAURWEIN-TEISSL M; LUNG TL; MARX F; GSCHOSSER C; ASCH E; BLASKO , PARSON W; BOCK G; SCHONITZER D; TRANNOY E; GRUBECK-LOEBENSTEIN B: "Lack of antibody production following immunization in old age: association with CD8(+)CD28(-) T cell clonal expansions and an imbalance in the production of Th1 and Th2 cytokines", J IMMUNOL., vol. 168, no. 11, 2002, pages 5893 - 9
SCARMEAS, N. ET AL.: "Motor signs during the course of Alzheimer disease", NEUROLOGY, vol. 63, no. 6, 2004, pages 975 - 982
SCARMEAS, N. ET AL.: "Motor signs predict poor outcomes in Alzheimer disease", NEUROLOGY, vol. 64, no. 10, 2005, pages 1696 - 1703
SCHENK D; BARBOUR R; DUNN W; GORDON G; GRAJEDA H; GUIDO T; HU K; HUANG J; JOHNSON-WOOD K; KHAN K: "Immunization with amyloid-beta attenuates Alzheimer-disease-like pathology in the PDAPP mouse", NATURE, vol. 400, 1999, pages 173 - 177
SCHENK D; HAGEN M; SEUBERT P: "Current progress in beta-amyloid immunotherapy", CURR OPIN LMMUNOL, vol. 16, 2004, pages 599 - 606
SCHNEIDER, A.; MANDELKOW, E.: "Tau-based treatment strategies in neurodegenerative diseases", NEUROTHERAPEUTICS, vol. 5, no. 3, 2008, pages 443 - 57
SCOPES: "Protein Purification", 1982, SPRINGER VERLAG
SEABROOK GR; RAY WJ; SHEARMAN M; HUTTON M: "Beyond amyloid: the next generation of Alzheimer's disease therapeutics", MOL INTERV, vol. 7, 2007, pages 261 - 270
SELKOE DJ: "Alzheimer's disease: a central role for amyloid", J NEUROPATHOL EXP NEUROL, vol. 53, 1994, pages 438 - 447
SHIPTON OA; LEITZ JR; DWORZAK J; ACTON CE; TUNBRIDGE EM; DENK F; DAWSON HN; VITEK MP; WADE-MARTINS R; PAULSEN 0: "Tau Protein Is Required for Amyloid {beta}-nduced Impairment of Hippocampal Long-Term Potentiation", J NEUROSCI, vol. 31, 2011, pages 1688 - 1692
SIEGRIST CA; ASPINALL R: "B-cell responses to vaccination at the extremes of age", NAT REV IMMUNOL., vol. 9, no. 3, 2009, pages 185 - 94
SIGURDSSON EM; KNUDSEN E; ASUNI A; FITZER-ATTAS C; SAGE D; QUARTERMAIN D; GONI F; FRANGIONE B; WISNIEWSKI T: "An attenuated immune response is sufficient to enhance cognition in an Alzheimer's disease mouse model immunized with amyloid-beta derivatives", J NEUROSCI, vol. 24, 2004, pages 6277 - 6282
SIGURDSSON EM; SCHOLTZOVA H; MEHTA PD; FRANGIONE B; WISNIEWSKI T: "Immunization with a nontoxic/nonfibrillar amyloid-beta homologous peptide reduces Alzheimer's disease-associated pathology in transgenic mice", AM J PATHOL, vol. 159, 2001, pages 439 - 447
SIMIC, G. ET AL.: "Annotation - Does Alzheimer's disease begin in the brainstem?", NEUROPATHOL APPL NEUROBIOL., vol. 35, no. 6, December 2009 (2009-12-01), pages 532 - 554
SKRABANA, R.; M. SKRABANOVA-KHUEBACHOVA ET AL.: "Alzheimer's-disease-associated conformation of intrinsically disordered tau protein studied by intrinsically disordered protein liquid-phase competitive enzyme-linked immunosorbent assay", ANAL BIOCHEM, vol. 359, no. 2, 2006, pages 230 - 7
SKRABANA, R.; SEVCIK, I.; NOVAK, M.: "Intrinsically disordered proteins in the neurodegenerative processes: formation of tau protein paired helical filaments and their analysis", CELL MOL NEUROBIOL, vol. 26, 2006, pages 1085 - 1097
SLOANE PD; ZIMMERMAN S; SUCHINDRAN C; REED P; WANG L; BOUSTANI M; SUDHA S: "The public health impact of Alzheimer's disease, 2000-2050: potential implication of treatment advances", ANNU REV PUBLIC HEALTH, vol. 23, 2002, pages 213 - 231
SMITH; WATERMAN, AD. APP. MATH., vol. 2, 1981, pages 482
SOININEN, H. ET AL.: "Extrapyramidal signs in Alzheimer's disease: a 3- year follow-up study", J NEURAL TRANSM, vol. 4, 1992, pages 107 - 119
SONGSIVILAI; LACHMANN, CLIN. EXP. IMMUNOL., vol. 79, 1990, pages 315 - 321
STEINHILB ML; DIAS-SANTAGATA D; FULGA TA; FELCH DL; FEANY MB: "Tau phosphorylation sites work in concert to promote neurotoxicity in vivo", MOL BIOL CELL, vol. 18, 2007, pages 5060 - 5068
STEINHILB ML; DIAS-SANTAGATA D; MULKEARNS EE; SHULMAN JM; BIERNAT J; MANDELKOW EM; FEANY MB: "S/P and T/P phosphorylation is critical for tau neurotoxicity in Drosophila", J NEUROSCI RES, vol. 85, 2007, pages 1271 - 1278
TABIRA, T.: "Immunization Therapy for Alzheimer disease: A Comprehensive Review of Active Immunization Strategies", TOHOKU J. EXP. MED., vol. 220, 2010, pages 95 - 106
TANIGUCHI S; SUZUKI N; MASUDA M; HISANAGA S; IWATSUBO T; GOEDERT M; HASEGAWA M: "Inhibition of heparin-induced tau filament formation by phenothiazines, polyphenols, and porphyrins", J BIOL CHEM, vol. 280, 2005, pages 7614 - 7623
TANIGUCHI T ET AL: "Effects of different anti-tau antibodies on tau fibrillogenesis: RTA-1 and RTA-2 counteract tau aggregation", FEBS LETTERS, ELSEVIER, AMSTERDAM, NL, vol. 579, no. 6, 28 February 2005 (2005-02-28), pages 1399 - 1404, XP027696628, ISSN: 0014-5793, [retrieved on 20050228] *
TANIGUCHI T; SUMIDA M; HIRAOKA S; TOMOO K; KAKEHI T; MINOURA K; SUGIYAMA S; INAKA K; ISHIDA T; SAITO N: "Effects of different anti-tau antibodies on tau fibrillogenesis: RTA-1 and RTA-2 counteract tau aggregation", FEBS LETT, vol. 579, 2005, pages 1399 - 1404
TATUSOVA ET AL.: "Blast 2 sequences - a new tool for comparing protein and nucleotide sequences", FEMS MICROBIOL., 1999, LETT., vol. 174, 1999, pages 247 - 250
TROLLET C; SCHERMAN D: "Bigey P Delivery of DNA into muscle for treating systemic diseases: advantages and challenges", METHODS MOL BIOL, vol. 423, 2008, pages 199 - 214
UENO H ET AL: "Novel conformation-sensitive antibodies specific to three- and four-repeat tau", BIOCHEMICAL AND BIOPHYSICAL RESEARCH COMMUNICATIONS, ACADEMIC PRESS INC. ORLANDO, FL, US, vol. 358, no. 2, 29 June 2007 (2007-06-29), pages 602 - 607, XP026422486, ISSN: 0006-291X, [retrieved on 20070629], DOI: 10.1016/J.BBRC.2007.04.176 *
VAN DEN BERG JH; NUJIEN B; BEIJNEN JH; VINCENT A; VAN TINTEREN H; KLUGE J; WOERDEMAN LA; HENNINK WE; STORM G; SCHUMACHER TN: "Optimization of intradermal vaccination by DNA tattooing in human skin", HUM GENE THER, vol. 20, 2009, pages 181 - 189
VECHTEROVA L; KONTSEKOVA E; ZILKA N; FERENCIK M; RAVID R; NOVAK M: "DC11: a novel monoclonal antibody revealing Alzheimer's disease-specific tau epitope", NEUROREPORT, vol. 14, 2003, pages 87 - 91
WAI, M. ET AL.: "Co-localization of hyperphosphorylated tau and caspases in the brainstem of Alzheimer's disease patients", BIOGERONTOLOGY, vol. 10, 2009, pages 457 - 469
WAITE, L.M. ET AL.: "Gait slowing as a predictor of incident dementia: 6- year longitudinal data from the Sydney Older Persons Study", JOURNAL OF THE NEUROLOGICAL SCIENCES, vol. 229- 230, 2005, pages 89 - 93
WALSH DM; SELKOE DJ: "Deciphering the molecular basis of memory failure in Alzheimer's disease", NEURON, vol. 44, 2004, pages 181 - 193
WANG W.: "Lyophilization and development of solid protein pharmaceuticals", LNT. J. PHARM., vol. 203, no. 1-2, 2000, pages 1 - 60
WANG, LI ET AL.: "Performance-Based Physical Function and Future Dementia in Older People", ARCH INTERN MED, vol. 166, 22 May 2006 (2006-05-22)
WEINER HL; LEMERE CA; MARON R; SPOONER ET; GRENFELL TJ; MORI C; ISSAZADEH S; HANCOCK WW; SELKOE DJ: "Nasal administration of amyloid-beta peptide decreases cerebral amyloid burden in a mouse model of Alzheimer's disease", ANN NEUROL, vol. 48, 2000, pages 567 - 579
WENG NP; AKBAR AN; GORONZY J: "CD28(-) T cells: their role in the age-associated decline of immune function", TRENDS IMMUNOL., vol. 30, no. 7, 2009, pages 306 - 12
WEST, M.J.; COLEMAN, P.D.; FLOOD, D.G.; TRONCOSO, J.C.: "Differences in the pattern of hippocampal neuronal loss in normal ageing and Alzheimer's disease", LANCET, vol. 344, 1994, pages 769 - 72
WILSON, R.S. ET AL.: "Parkinsonian-like Signs and Risk of Incident Alzheimer disease in Older Persons", ARCH NEUROL, vol. 60, April 2003 (2003-04-01)
WILSON-WELDER JH; TORRES MP; KIPPER MJ; MALLAPRAGADA SK; WANNEMUEHLER MJ; NARASIMHAN B: "Vaccine adjuvants: current challenges and future approaches", J PHARM SCI, vol. 98, 2009, pages 1278 - 1316
WISCHIK CM; EDWARDS PC; LAI RY; ROTH M; HARRINGTON CR: "Selective inhibition of Alzheimer disease-like tau aggregation by phenothiazines", PROC NATL ACAD SCI USA, vol. 93, 1996, pages 11213 - 11218
WISCHIK, C.M.; NOVAK, M.; EDWARDS, P.C.; KLUG, A.; TICHELAAR, W.; CROWTHER, R.A.: "Structural characterization of the core of the paired helical filament of Alzheimer disease", PROC NATL ACAD SCI USA, vol. 85, 1988, pages 4884 - 8
WISCHIK, C.M.; NOVAK, M.; THOGERSEN, H.C.; EDWARDS, P.C.; RUNSWICK, M.J.; JAKES, R.; WALKER, J.E.; MILSTEIN, C.; ROTH, M.; KLUG, A: "Isolation of a fragment of tau derived from the core of the paired helical filament of Alzheimer disease", PROC NATL ACAD SCI USA, vol. 85, 1988, pages 4506 - 10
XIAO; BRANDSMA, NUCLEIC ACIDS. RES., vol. 24, 1996, pages 2630 - 2622
XING Z; SANTOSUOSSO M; MCCORMICK S; YANG TC; MILLAR J; HITT M; WAN Y; BRAMSON J; VORDERMEIER HM: "Recent advances in the development of adenovirus-and poxvirus-vectored tuberculosis vaccines", CURR GENE THER, vol. 5, 2005, pages 485 - 492
ZAROW, C. ET AL.: "Neuronal Loss Is Greater in the Locus Coeruleus Than Nucleus Basalis and Substantia Nigra in Alzheimer and Parkinson diseases", ARCH NEUROL, vol. 60, March 2003 (2003-03-01)
ZHANG B; MAITI A; SHIVELY S; LAKHANI F; MCDONALD-JONES G; BRUCE J; LEE EB; XIE SX; JOYCE S; LI C: "Microtubule-binding drugs offset tau sequestration by stabilizing microtubules and reversing fast axonal transport deficits in a tauopathy model", PROC NATL ACAD SCI USA, vol. 102, 2005, pages 227 - 231
ZHANG J; WU X; QIN C; QI J; MA S; ZHANG H; KONG Q; CHEN D; BA D; HE W: "A novel recombinant adeno-associated virus vaccine reduces behavioural impairment and beta-amyloid plaques in a mouse model of Alzheimer's disease", NEUROBIOL DIS, vol. 14, 2003, pages 365 - 379
ZHOU ET AL., J. EXP. MED., vol. 179, 1994, pages 1867
ZILKA N; FILIPCIK P; KOSON P; FIALOVA L; SKRABANA R; ZILKOVA M; ROLKOVA G; KONTSEKOVA E; NOVAK M: "Truncated tau from sporadic Alzheimer's disease suffices to drive neurofibrillary degeneration in vivo", FEBS LETT, vol. 580, 2006, pages 3582 - 3588
ZILKA N; VECHTEROVA L; KONTSEKOVA E; NOVAK M: "A rapid immunohistochemical primary screening assay for hybridomas", J IMMUNOL METHODS, vol. 272, no. 1-2, 2003, pages 49 - 53
ZILKA, N. ET AL.: "Chaperone-like Antibodies Targeting Misfolded Tau Protein: New Vistas in the Immunotherapy of Neurodegenerative Foldopathies", JOURNAL OF ALZHEIMER'S DISEASE, vol. 15, 2008, pages 169 - 179
ZILKOVA, M.; KOSON, P.; ZILKA, N.: "The hunt for dying neurons: insight into the neuronal loss in Alzheimer's disease", BRATISL LEK LISTY, vol. 107, no. 9-10, 2006, pages 366 - 73

Cited By (110)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2670434A4 (en) * 2011-01-31 2015-11-11 Intellect Neurosciences Inc TREATMENT OF TAUOPATHIA
US10040847B2 (en) 2012-08-16 2018-08-07 Ipierian, Inc. Methods of treating a tauopathy
US9567395B2 (en) 2012-08-16 2017-02-14 Ipierian, Inc. Methods of treating a tauopathy
US8926974B2 (en) 2012-08-16 2015-01-06 Ipierian, Inc. Methods of treating a tauopathy
US9051367B2 (en) 2013-01-18 2015-06-09 Ipierian, Inc. Methods of treating a tauopathy
US8980271B2 (en) 2013-01-18 2015-03-17 Ipierian, Inc. Methods of treating a tauopathy
US9777058B2 (en) 2013-01-18 2017-10-03 Ipierian, Inc. Methods of treating a tauopathy
US9447180B2 (en) 2013-01-18 2016-09-20 Ipierian, Inc. Methods of treating a tauopathy
US8980270B2 (en) 2013-01-18 2015-03-17 Ipierian, Inc. Methods of treating a tauopathy
US10501531B2 (en) 2013-03-13 2019-12-10 Prothena Biosciences Limited Tau immunotherapy
US11643457B2 (en) 2013-03-13 2023-05-09 Prothena Biosciences Limited Tau immunotherapy
JP2017504570A (ja) * 2013-11-27 2017-02-09 アイピエリアン,インコーポレイティド タウオパチーの処置方法
US20160318975A1 (en) * 2013-12-26 2016-11-03 Toagosei Co., Ltd. Method for promoting expression of calreticulin, and synthetic peptide for use in method for promoting expression of calreticulin
US10981953B2 (en) * 2013-12-26 2021-04-20 Toagosei Co, Ltd. Method for promoting expression of calreticulin, and synthetic peptide for use in method for promoting expression of calreticulin
US10400018B2 (en) 2014-02-14 2019-09-03 Ipierian, Inc. Tau peptides, anti-tau antibodies, and methods of use thereof
US10562963B2 (en) 2014-06-26 2020-02-18 Janssen Vaccines & Prevention, B.V. Antibodies and antigen-binding fragments that specifically bind to microtubule-associated protein tau
US10400034B2 (en) 2014-06-26 2019-09-03 Janssen Vaccines & Prevention, B.V. Antibodies and antigen-binding fragments that specifically bind to microtubule-associated protein tau
EA036307B1 (ru) * 2014-06-26 2020-10-23 Янссен Вэксинс Энд Превеншн Б.В. Антитела и антигенсвязывающие фрагменты, которые специфично связываются с белком тау, ассоциированным с микротрубочками
AU2015279086B2 (en) * 2014-06-26 2021-01-28 Janssen Vaccines & Prevention B.V. Antibodies and antigen-binding fragments that specifically bind to microtubule-associated protein tau
WO2015197820A1 (en) * 2014-06-26 2015-12-30 Crucell Holland B.V. Antibodies and antigen-binding fragments that specifically bind to microtubule-associated protein tau
US11472869B2 (en) 2014-06-26 2022-10-18 Janssen Vaccines & Prevention B.V. Antibodies and antigen-binding fragments that specifically bind to microtubule-associated protein tau
CN107074965B (zh) * 2014-06-26 2021-08-03 扬森疫苗与预防公司 特异性结合微管相关蛋白tau的抗体和抗原结合片段
US10301379B2 (en) 2014-06-26 2019-05-28 Janssen Vaccines & Prevention B.V. Antibodies and antigen-binding fragments that specifically bind to microtubule-associated protein tau
CN107074965A (zh) * 2014-06-26 2017-08-18 扬森疫苗与预防公司 特异性结合微管相关蛋白tau的抗体和抗原结合片段
AU2015348012B2 (en) * 2014-11-19 2020-07-02 Axon Neuroscience Se Humanized tau antibodies in Alzheimer's disease
JP2018502558A (ja) * 2014-11-19 2018-02-01 アクソン ニューロサイエンス エスエー アルツハイマー病におけるヒト化タウ抗体
US11319363B2 (en) 2014-11-19 2022-05-03 Axon Neuroscience Se Humanized tau antibodies in Alzheimer's disease
JP2020141669A (ja) * 2014-11-19 2020-09-10 アクソン ニューロサイエンス エスエー アルツハイマー病におけるヒト化タウ抗体
CN107428820B (zh) * 2014-11-19 2022-03-22 阿克松神经系统科学公司 在阿尔茨海默氏病中的人源化tau抗体
CN107428820A (zh) * 2014-11-19 2017-12-01 阿克松神经系统科学公司 在阿尔茨海默氏病中的人源化tau抗体
US10160799B2 (en) 2014-11-19 2018-12-25 Axon Neuroscience Se Humanized tau antibodies in a alzheimer's disease
JP2021119774A (ja) * 2014-11-19 2021-08-19 アクソン ニューロサイエンス エスエー アルツハイマー病におけるヒト化タウ抗体
RU2730668C2 (ru) * 2014-11-19 2020-08-24 Аксон Ньюросайенс Се Гуманизированные тау-антитела при болезни альцгеймера
EP3786182A1 (en) 2014-11-19 2021-03-03 Axon Neuroscience SE Humanized tau antibodies in alzheimer's disease
US10745469B2 (en) 2014-11-19 2020-08-18 Axon Neuroscience Se Humanized tau antibodies in alzheimer's disease
AU2020227007B2 (en) * 2014-11-19 2024-05-30 Axon Neuroscience Se Humanized tau antibodies in Alzheimer's disease
WO2016079597A1 (en) 2014-11-19 2016-05-26 Axon Neuroscience Se Humanized tau antibodies in alzheimer's disease
US10011653B2 (en) 2015-02-26 2018-07-03 Eli Lilly And Company Antibodies to tau and methods of treatment therewith
US9527909B2 (en) 2015-02-26 2016-12-27 Eli Lilly And Company Antibodies to tau and uses thereof
US10808027B2 (en) 2015-02-26 2020-10-20 Eli Lilly And Company DNA molecules encoding antibodies to tau and methods of making thereof
US10633436B2 (en) 2015-06-05 2020-04-28 Genentech, Inc. Anti-tau antibodies and methods of use
US11555065B2 (en) 2015-06-05 2023-01-17 Ac Immune Sa Anti-Tau antibodies and methods of use
US12486319B2 (en) 2015-06-05 2025-12-02 Ac Immune Sa Anti-tau antibodies and methods of use
US10906966B2 (en) 2015-07-06 2021-02-02 UCB Biopharma SRL Tau-binding antibodies
US11746145B2 (en) 2015-07-06 2023-09-05 UCB Biopharma SRL Tau-binding antibodies
RU2727911C2 (ru) * 2015-07-13 2020-07-24 Х. Лундбекк А/С Антитела, специфичные к гиперфосфорилированному тау-белку, и способы их применения
US11584791B2 (en) 2016-05-02 2023-02-21 Prothena Biosciences Limited Antibodies recognizing tau
WO2017191559A1 (en) * 2016-05-02 2017-11-09 Prothena Biosciences Limited Tau immunotherapy
US11492393B2 (en) 2016-05-02 2022-11-08 Prothena Biosciences Limited Tau immunotherapy
KR20190003647A (ko) * 2016-05-02 2019-01-09 프로테나 바이오사이언시즈 리미티드 타우 인식 항체
US10889638B2 (en) 2016-05-02 2021-01-12 Prothena Biosciences Limited Antibodies recognizing tau
WO2017191560A1 (en) * 2016-05-02 2017-11-09 Prothena Biosciences Limited Antibodies recognizing tau
IL262726B1 (en) * 2016-05-02 2024-03-01 Prothena Biosciences Ltd Antibodies recognizing tau
US10906964B2 (en) 2016-05-02 2021-02-02 Prothena Biosciences Limited Antibodies recognizing tau
WO2017191561A1 (en) * 2016-05-02 2017-11-09 Prothena Biosciences Limited Antibodies recognizing tau
US10752679B2 (en) 2016-05-02 2020-08-25 Prothena Biosciences Limited Tau immunotherapy
AU2017259038B2 (en) * 2016-05-02 2024-05-23 Prothena Biosciences Limited Antibodies recognizing Tau
US12195525B2 (en) 2016-05-02 2025-01-14 Prothena Biosciences Limited Tau immunotherapy
KR102471787B1 (ko) * 2016-05-02 2022-11-29 프로테나 바이오사이언시즈 리미티드 타우 인식 항체
IL262726B2 (en) * 2016-05-02 2024-07-01 Prothena Biosciences Ltd Antibodies recognizing tau
US10953082B2 (en) * 2016-06-21 2021-03-23 Joon Haeng Rhee Preparation of flagellin vaccine adjuvant-based vaccine to induce production of antibody recognizing conformation of antigens, and application thereof
US11771753B2 (en) 2016-06-21 2023-10-03 Joon Haeng Rhee Preparation of flagellin vaccine adjuvant-based vaccine to induce production of antibody recognizing conformation of antigens, and application thereof
US10988529B2 (en) 2016-08-09 2021-04-27 Eli Lilly And Company Combination therapy
US10590191B2 (en) 2016-10-27 2020-03-17 Universite Grenoble Alpes Anti-tau nanobodies
WO2018078140A1 (fr) * 2016-10-27 2018-05-03 Universite Grenoble Alpes Nanocorps anti-tau
FR3058143A1 (fr) * 2016-10-27 2018-05-04 Universite Grenoble Alpes Nanocorps anti-tau
US11427629B2 (en) 2016-12-07 2022-08-30 Ac Immune Sa Anti-Tau antibodies and methods of use
US10711058B2 (en) 2016-12-07 2020-07-14 Ac Immune Sa Anti-Tau antibodies and methods of use
US10836817B2 (en) 2016-12-07 2020-11-17 Ac Immune Sa Anti-Tau antibodies and methods of use
US11352419B2 (en) 2016-12-07 2022-06-07 Ac Immune Sa Anti-tau antibodies and methods of use
US11028157B2 (en) 2017-03-28 2021-06-08 Janssen Vaccines & Prevention B.V. Binding molecules that specifically bind to tau
CN110418804A (zh) * 2017-03-28 2019-11-05 扬森疫苗与预防公司 与tau特异性地结合的结合分子
WO2018178077A1 (en) * 2017-03-28 2018-10-04 Janssen Vaccines & Prevention B.V. Binding molecules that specifically bind to tau
US11958896B2 (en) 2017-05-02 2024-04-16 Prothena Biosciences Limited Antibodies recognizing tau
US12479910B2 (en) 2017-05-02 2025-11-25 Prothena Biosciences Limited Antibodies recognizing tau
US10358485B2 (en) 2017-10-16 2019-07-23 Eisai R&D Management Co., Ltd. Anti-Tau antibodies and uses thereof
US11578120B2 (en) 2017-10-16 2023-02-14 Eisai R&D Management Co., Ltd. Anti-Tau antibodies and uses thereof
US10829547B2 (en) 2017-10-16 2020-11-10 Eisai R&D Management Co., Ltd. Anti-tau antibodies and uses thereof
US11958889B2 (en) 2017-10-25 2024-04-16 Janssen Pharmaceuticals, Inc. Compositions of phosphorylated tau peptides and uses thereof
AU2018355574B2 (en) * 2017-10-27 2025-09-04 United Neuroscience Tau peptide immunogen constructs
WO2019186276A3 (en) * 2018-03-28 2020-02-27 Axon Neuroscience Se Antibody-based methods of detecting and treating alzheimer's disease
WO2019203686A1 (ru) * 2018-04-17 2019-10-24 Александр Олегович МОРОЗОВ Пептид и способ лечения болезни альцгеймера
RU2679059C1 (ru) * 2018-04-17 2019-02-05 Александр Олегович Морозов Пептид и способ лечения болезни альцгеймера
WO2019203687A1 (ru) * 2018-04-17 2019-10-24 Александр Олегович МОРОЗОВ Пептид и способ лечения болезни альцгеймера
US11753640B2 (en) 2018-07-03 2023-09-12 Hoffmann-La Roche Inc. Oligonucleotides for modulating Tau expression
US12163131B2 (en) 2018-07-03 2024-12-10 Hoffmann-La Roche Inc. Oligonucleotides for modulating Tau expression
US11279929B2 (en) 2018-07-03 2022-03-22 Hoffmann-La Roche, Inc. Oligonucleotides for modulating Tau expression
US11839654B2 (en) 2018-07-31 2023-12-12 Eli Lilly And Company Combination therapy
EP3883602A4 (en) * 2018-11-19 2023-04-12 The Board Of Regents Of The University Of Texas System TAU PEPTIDE ANTIGENS AND ANTIBODIES BINDING TO THEM FOR THE TREATMENT OF TAUOPATHIES
US20220017611A1 (en) * 2018-12-13 2022-01-20 INSERM (Institut National de la Santé et de la Recherche Médicale) New anti tau svqivykpv epitope single domain antibody
EP3894438A1 (en) * 2018-12-13 2021-10-20 INSERM (Institut National de la Santé et de la Recherche Médicale) New anti tau svqivykpv epitope single domain antibody
US12509505B2 (en) * 2018-12-13 2025-12-30 INSERM (Institute National de la Santé et de la Recherche Médicale) Anti Tau SVQIVYKPV epitope single domain antibody
EP3921343A4 (en) * 2019-02-08 2022-12-14 Prothena Biosciences Limited ANTIBODIES FOR DETECTING TAU
CN113597431A (zh) * 2019-02-08 2021-11-02 普罗塞纳生物科学有限公司 识别Tau的抗体
US12324855B2 (en) 2019-02-08 2025-06-10 Ac Immune Sa Method of safe administration of phosphorylated Tau peptide vaccine
US10961302B2 (en) 2019-03-03 2021-03-30 Prothena Biosciences Limited Antibodies recognizing tau
US11926659B2 (en) 2019-03-03 2024-03-12 Prothena Biosciences Limited Antibodies recognizing tau
WO2021048619A3 (en) * 2019-09-09 2021-06-03 Axon Neuroscience Se Biomarkers and treatments of alzheimer's disease and mild cognitive impairment
WO2021048619A2 (en) 2019-09-09 2021-03-18 Axon Neuroscience Se Biomarkers and treatments of alzheimer's disease and mild cognitive impairment
CN114340654A (zh) * 2019-09-09 2022-04-12 阿克松神经系统科学公司 阿尔茨海默病和轻度认知障碍的生物标志物和治疗
CN114599393A (zh) * 2019-10-22 2022-06-07 比奥根Ma公司 治疗阿尔茨海默病的抗β-淀粉样蛋白抗体
WO2021100041A1 (en) * 2019-11-20 2021-05-27 Yeda Research And Development Co. Ltd. Treating alzheimer's disease
EP4153210A4 (en) * 2020-05-19 2024-11-13 Othair Prothena Limited MULTIPLE EPITOPE VACCINES FOR THE TREATMENT OF ALZHEIMER'S DISEASE
WO2022176959A1 (en) * 2021-02-19 2022-08-25 Eisai R&D Management Co., Ltd. Anti-pt217 tau antibody
EP4413363A4 (en) * 2021-10-08 2025-07-30 Arbele Ltd COMPOSITIONS AND METHODS FOR DETECTING CADHERIN-17 PROTEIN
WO2023060276A1 (en) * 2021-10-08 2023-04-13 Arbele Limited Compositions and methods for detecting cadherin-17 protein
WO2023092004A1 (en) 2021-11-17 2023-05-25 Voyager Therapeutics, Inc. Compositions and methods for the treatment of tau-related disorders
US12291565B2 (en) 2022-09-15 2025-05-06 Voyager Therapeutics, Inc. Tau binding compounds
WO2025109524A1 (en) 2023-11-22 2025-05-30 Ac Immune Sa Assays and methods for assessing vaccine preparations
WO2025122634A1 (en) 2023-12-05 2025-06-12 Voyager Therapeutics, Inc. Compositions and methods for the treatment of tau-related disorders

Also Published As

Publication number Publication date
SMT201800109T1 (it) 2018-05-02
EP2758433A1 (en) 2014-07-30
SG10201912964PA (en) 2020-02-27
SG10201912955PA (en) 2020-02-27
RU2014115481A (ru) 2015-10-27
KR102130439B1 (ko) 2020-07-07
EP2758433B1 (en) 2017-10-18
AU2020200624B2 (en) 2021-12-23
CN109265543B (zh) 2022-04-26
US20170145082A1 (en) 2017-05-25
HUE036177T2 (hu) 2018-06-28
IL287794A (en) 2022-01-01
HRP20180083T1 (hr) 2018-02-23
US20220010004A1 (en) 2022-01-13
JP6286590B2 (ja) 2018-02-28
RU2018102103A3 (https=) 2021-05-31
HRP20180083T8 (hr) 2018-07-27
CL2014000679A1 (es) 2014-11-21
AU2012311234A1 (en) 2014-05-01
HK1199459A1 (en) 2015-07-03
ES2656442T3 (es) 2018-02-27
JP6637124B2 (ja) 2020-01-29
KR20200084362A (ko) 2020-07-10
AU2020200624A9 (en) 2021-12-23
RU2018102103A (ru) 2019-02-21
JP6499345B2 (ja) 2019-04-10
JP2020072675A (ja) 2020-05-14
BR112014006376A2 (pt) 2017-06-13
CY1119792T1 (el) 2018-06-27
US12404322B2 (en) 2025-09-02
MX347505B (es) 2017-04-28
MX391157B (es) 2025-03-21
IL231201A0 (en) 2014-04-30
TR201800669T4 (tr) 2018-03-21
US9518101B2 (en) 2016-12-13
JP2017042172A (ja) 2017-03-02
KR20210099167A (ko) 2021-08-11
US11098106B2 (en) 2021-08-24
KR102285743B1 (ko) 2021-08-06
LT2758433T (lt) 2018-02-12
RS56852B1 (sr) 2018-04-30
JP6253583B2 (ja) 2017-12-27
CA2848346A1 (en) 2013-03-28
BR112014006376B1 (pt) 2021-07-27
EP3275461A1 (en) 2018-01-31
MY183989A (en) 2021-03-17
US9845352B2 (en) 2017-12-19
UA115657C2 (uk) 2017-12-11
SG10201703771WA (en) 2017-06-29
CN115417916A (zh) 2022-12-02
DK2758433T3 (en) 2018-01-15
CN104185640B (zh) 2018-07-20
JP6950981B2 (ja) 2021-10-20
IL231201B (en) 2018-06-28
CN104185640A (zh) 2014-12-03
CL2016000215A1 (es) 2017-08-18
JP2014530597A (ja) 2014-11-20
ZA201401333B (en) 2015-09-30
JP2018183160A (ja) 2018-11-22
JP2017093470A (ja) 2017-06-01
MX2014003357A (es) 2015-03-20
AU2017272259A1 (en) 2018-01-04
AU2020200624A1 (en) 2020-02-20
CN115417916B (zh) 2025-12-30
KR20140063853A (ko) 2014-05-27
IL274440A (en) 2020-06-30
IL259775A (en) 2018-07-31
PT2758433T (pt) 2018-01-19
JP2022031631A (ja) 2022-02-22
AU2017272259B2 (en) 2019-11-14
SI2758433T1 (en) 2018-02-28
PL2758433T3 (pl) 2018-06-29
AU2012311234B2 (en) 2017-09-28
SG11201400125RA (en) 2014-03-28
CL2015001314A1 (es) 2015-09-21
IL259775B (en) 2020-05-31
US20170260263A1 (en) 2017-09-14
JP6360869B2 (ja) 2018-07-18
JP7182316B2 (ja) 2022-12-02
CN109265543A (zh) 2019-01-25
US20150050215A1 (en) 2015-02-19
US9828421B2 (en) 2017-11-28
IL274440B (en) 2021-12-01
UA123390C2 (uk) 2021-03-31
ME03008B (me) 2018-10-20
US20180282401A1 (en) 2018-10-04
JP2018117631A (ja) 2018-08-02
RU2645259C2 (ru) 2018-02-19

Similar Documents

Publication Publication Date Title
US12404322B2 (en) Protein-based therapy and diagnosis of tau-mediated pathology in Alzheimer&#39;s disease
HK1199459B (en) Protein-based therapy and diagnosis of tau-mediated pathology in alzheimer&#39;s disease

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 12788639

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 231201

Country of ref document: IL

REEP Request for entry into the european phase

Ref document number: 2012788639

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2848346

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2014530333

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 14055475

Country of ref document: CO

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2014000679

Country of ref document: CL

Ref document number: MX/A/2014/003357

Country of ref document: MX

WWE Wipo information: entry into national phase

Ref document number: A201404170

Country of ref document: UA

WWE Wipo information: entry into national phase

Ref document number: A20140223

Country of ref document: BY

ENP Entry into the national phase

Ref document number: 2014115481

Country of ref document: RU

Kind code of ref document: A

Ref document number: 20147010525

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2012311234

Country of ref document: AU

Date of ref document: 20120914

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112014006376

Country of ref document: BR

WWE Wipo information: entry into national phase

Ref document number: 14345561

Country of ref document: US

ENP Entry into the national phase

Ref document number: 112014006376

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20140317