WO2010151426A1 - Truncated actriib-fc fusion proteins - Google Patents
Truncated actriib-fc fusion proteins Download PDFInfo
- Publication number
- WO2010151426A1 WO2010151426A1 PCT/US2010/037787 US2010037787W WO2010151426A1 WO 2010151426 A1 WO2010151426 A1 WO 2010151426A1 US 2010037787 W US2010037787 W US 2010037787W WO 2010151426 A1 WO2010151426 A1 WO 2010151426A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- polypeptide
- actriib
- seq
- fat
- sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/10—Transferases (2.)
- C12N9/12—Transferases (2.) transferring phosphorus containing groups, e.g. kinases (2.7)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/62—DNA sequences coding for fusion proteins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/16—Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P15/00—Drugs for genital or sexual disorders; Contraceptives
- A61P15/10—Drugs for genital or sexual disorders; Contraceptives for impotence
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
- A61P17/02—Drugs for dermatological disorders for treating wounds, ulcers, burns, scars, keloids, or the like
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/08—Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
- A61P19/10—Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease for osteoporosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P21/00—Drugs for disorders of the muscular or neuromuscular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P21/00—Drugs for disorders of the muscular or neuromuscular system
- A61P21/02—Muscle relaxants, e.g. for tetanus or cramps
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P21/00—Drugs for disorders of the muscular or neuromuscular system
- A61P21/04—Drugs for disorders of the muscular or neuromuscular system for myasthenia gravis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/02—Nutrients, e.g. vitamins, minerals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/04—Anorexiants; Antiobesity agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/06—Antihyperlipidemics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P5/00—Drugs for disorders of the endocrine system
- A61P5/24—Drugs for disorders of the endocrine system of the sex hormones
- A61P5/26—Androgens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P5/00—Drugs for disorders of the endocrine system
- A61P5/48—Drugs for disorders of the endocrine system of the pancreatic hormones
- A61P5/50—Drugs for disorders of the endocrine system of the pancreatic hormones for increasing or potentiating the activity of insulin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/12—Antihypertensives
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/475—Growth factors; Growth regulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/71—Receptors; Cell surface antigens; Cell surface determinants for growth factors; for growth regulators
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0681—Cells of the genital tract; Non-germinal cells from gonads
- C12N5/0682—Cells of the female genital tract, e.g. endometrium; Non-germinal cells from ovaries, e.g. ovarian follicle cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07H—SUGARS; DERIVATIVES THEREOF; NUCLEOSIDES; NUCLEOTIDES; NUCLEIC ACIDS
- C07H21/00—Compounds containing two or more mononucleotide units having separate phosphate or polyphosphate groups linked by saccharide radicals of nucleoside groups, e.g. nucleic acids
- C07H21/04—Compounds containing two or more mononucleotide units having separate phosphate or polyphosphate groups linked by saccharide radicals of nucleoside groups, e.g. nucleic acids with deoxyribosyl as saccharide radical
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2510/00—Genetically modified cells
- C12N2510/02—Cells for production
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y207/00—Transferases transferring phosphorus-containing groups (2.7)
- C12Y207/11—Protein-serine/threonine kinases (2.7.11)
- C12Y207/1103—Receptor protein serine/threonine kinase (2.7.11.30)
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/04—Endocrine or metabolic disorders
- G01N2800/042—Disorders of carbohydrate metabolism, e.g. diabetes, glucose metabolism
Definitions
- TGF-beta The transforming growth factor-beta (TGF-beta) superfamily contains a variety of growth factors that share common sequence elements and structural motifs. These proteins are known to exert biological effects on a large variety of cell types in both vertebrates and invertebrates. Members of the superfamily perform important functions during embryonic development in pattern formation and tissue specification and can influence a variety of differentiation processes, including adipogenesis, myogenesis, chondrogenesis, cardiogenesis, hematopoiesis, neurogenesis, and epithelial cell differentiation. The family is represented by proteins named, variously, the activins and inhibins, TGF-beta, Growth and Differentiation Factors (GDFs) and Bone Morphogenetic Factors (BMPs).
- GDFs Growth and Differentiation Factors
- BMPs Bone Morphogenetic Factors
- Changes in muscle, bone, fat, cartilage and other tissues may be achieved by agonizing or antagonizing signaling that is mediated by an appropriate TGF-beta family member.
- agonizing or antagonizing signaling that is mediated by an appropriate TGF-beta family member.
- an appropriate TGF-beta family member there is a need for agents that function as potent regulators of signaling by members of the TGF-beta superfamily.
- the present disclosure provides novel ActRIIB polypeptides, particularly amino- and carboxy-terminal truncations and sequence alterations.
- polypeptides including amino acids 25-131 of human ActRIIB (SEQ ID NO:1) or variants thereof are described.
- Such polypeptides are demonstrated to have surprising efficacy in the treatment of a variety of disorders, but particularly disorders associated with obesity, insulin resistance and other metabolic disorders.
- ActRIIB polypeptides disclosed herein can be used to have a variety of desirable effects in patients, including, for example, increasing lean body mass, decreasing white fat mass, increasing brown fat mass, decreasing serum triglycerides, decreasing serum insulin levels or decreasing serum free fatty acid levels.
- ActRIIB polypeptides disclosed herein may be used for the treatment of a variety of disorders or conditions, including muscle and neuromuscular disorders (e.g., muscular dystrophy, amyotrophic lateral sclerosis (ALS), and muscle atrophy), adipose tissue disorders (e.g., obesity, fatty liver disease), metabolic disorders (e.g., type 2 diabetes, insulin resistance, metabolic syndrome), neurodegenerative disorders, and muscle wasting associated with old age (sarcopenia), prostate cancer therapy (e.g., androgen deprivation therapy), and cachexia associated with a variety of cancers.
- Examples of ActRIIB polypeptides include a human ActRIIB-Fc fusion protein set forth in SEQ ID NO: 8 and described herein as ActRIIB(25- 131)-hFc.
- a polypeptide may be selected from the group consisting of: a polypeptide comprising an amino acid sequence wherein the amino acid sequence consists of the sequence of SEQ ID NO: 8 or an amino acid sequence that differs from SEQ ID NO: 8 at no more than one, two, three, four or five amino acid positions; a polypeptide produced by the expression in a mammalian cell of the nucleic acid of SEQ ID NO: 4 or a nucleic acid that hybridizes under stringent condition to the complement thereof; a polypeptide produced by the expression in a mammalian cell of the nucleic acid of SEQ ID NO: 6 or a nucleic acid that hybridizes under stringent conditions to the complement thereof.
- a polypeptide disclosed herein may comprise a portion derived from ActRIIB and one or more heterologous portions, wherein the portion derived from ActRIIB may comprise an amino acid sequence consisting of the sequence of amino acids 25- 131 of SEQ ID NO:1 or an amino acid sequence that differs the sequence of amino acids 25- 131 of SEQ ID NO: 1 at no more than one, two, three, four or five amino acid positions.
- the heterologous portion may comprise a constant domain of an immunoglobulin, an Fc domain of an immunoglobulin or, particularly, an Fc domain of a human IgGl (the term "human IgGl shall be understood to include variants of such Fc that are compatible with use in humans).
- ActRIIB polypeptides may include a portion derived from ActRIIB that comprises an amino acid sequence consisting of the sequence of amino acids 25-131 of SEQ ID NO:1.
- An ActRIIB polypeptide disclosed herein may be such that the amino terminus has the sequence ETR.
- An ActRIIB polypeptide disclosed herein may cause a statistically significant increase in lean body mass in a mouse after four weeks of treatment twice per week at a dose level of 10 mg/kg.
- the mean increase of lean tissue mass may be at least 1, 2, 3, 4 or 5 or more grams.
- An ActRIIB polypeptide disclosed herein may cause a statistically significant decrease in fat mass in a mouse fed a high fat diet after four weeks of treatment twice per week at a dose level of 10 mg/kg.
- the mean decrease in fat mass may be 5, 7, 10, 15 or more grams.
- An ActRIIB polypeptide disclosed herein may cause a statistically significant decrease in serum triglyceride levels in a mouse fed a high fat diet after four weeks of treatment twice per week at a dose level of 10 mg/kg.
- the mean decrease in serum triglycerides may be at least 50, 75, 100, 125 or 150 or more mg/dl.
- An ActRIIB polypeptide disclosed herein may cause a statistically significant decrease in serum free fatty acid levels in a mouse fed a high fat diet after four weeks of treatment twice per week at a dose level of 10 mg/kg.
- the mean decrease in free fatty acids may be at least 500, 750, 1000 or more micromoles/dl free fatty acids.
- An ActRIIB polypeptide disclosed herein may cause a statistically significant decrease in serum insulin levels in a mouse fed a high fat diet after four weeks of treatment twice per week at a dose level of 10 mg/kg.
- the mean decrease in serum insulin may be at least 0.5, 1, 1.5, 2 or more ng/ml insulin.
- the term “statistically significant” generally refers to a p value or >0.05, but other measures of significance may be recognized for different types of statistical tests, and in such cases, the term “statistically significant” should use the most widely used formula for assessing the significance of the data.
- ActRIIB polypeptides may comprise at least one N-linked sugar, and may include two, three or more N-linked sugars.
- Such polypeptides may also comprise O-linked sugars.
- ActRIIB polypeptides may be produced in a variety of cell lines that glycosylate the protein in a manner that is suitable for patient use, including engineered insect or yeast cells, and mammalian cells such as COS cells, CHO cells, HEK cells and NSO cells. ActRIIB polypeptides may form covalent or non-covalent dimers, including homodimers. Generally, Fc fusion proteins tend to form homodimers that are covalently linked. Any of the foregoing polypeptides may be incorporated into a pharmaceutical preparation.
- the ActRIIB polypeptides disclosed herein bind to an ActRIIB ligand such as GDF8, GDFl 1, activin, BMP7, GDF3 or nodal.
- an ActRIIB polypeptide binds to an ActRIIB ligand with a Kd less than 10 micromolar or less than 1 micromolar, 100, 10, 1 or 0.1 nanomolar.
- An ActRIIB polypeptide disclosed herein may include one, two, three, four, five or more alterations in the amino acid sequence (e.g., in the ligand-binding domain) relative to a naturally occurring ActRIIB polypeptide.
- the alteration in the amino acid sequence may, for example, alter glycosylation of the polypeptide when produced in a mammalian, insect or other eukaryotic cell or alter proteolytic cleavage of the polypeptide relative to the naturally occurring ActRIIB polypeptide.
- An ActRIIB polypeptide may be a fusion protein that has, as one domain, an amino acid sequence derived from ActRIIB (e.g., a ligand-binding domain of an ActRIIB or a variant thereof) and one or more additional domains that provide a desirable property, such as improved pharmacokinetics, easier purification, targeting to particular tissues, etc.
- a domain of a fusion protein may enhance one or more of in vivo stability, in vivo half life, uptake/administration, tissue localization or distribution, formation of protein complexes, multimerization of the fusion protein, and/or purification.
- An ActRIIB fusion protein may include an immunoglobulin Fc domain (wild-type or mutant) or a serum albumin.
- an ActRIIB-Fc fusion comprises a relatively unstructured linker positioned between the Fc domain and the extracellular ActRIIB domain.
- This unstructured linker may correspond to the roughly 15 amino acid unstructured region at the C-terminal end of the extracellular domain of ActRIIB (the "tail"), or it may be an artificial sequence of between 5 and 15, 20, 30, 50 or more amino acids that are relatively free of secondary structure.
- a linker may be rich in glycine and proline residues and may, for example, contain repeating sequences of threonine/serine and glycines (e.g., TG 4 or SG 4 repeats).
- a fusion protein may include a purification subsequence, such as an epitope tag, a FLAG tag, a polyhistidine sequence, and a GST fusion.
- an ActRIIB polypeptide includes one or more modified amino acid residues selected from: a glycosylated amino acid, a PEGylated amino acid, a farnesylated amino acid, an acetylated amino acid, a biotinylated amino acid, an amino acid conjugated to a lipid moiety, and an amino acid conjugated to an organic derivatizing agent.
- an ActRIIB polypeptide may be formulated as a pharmaceutical preparation.
- a pharmaceutical preparation will preferably be pyrogen free (meaning pyrogen free to the extent required by regulations governing the quality of products for therapeutic use).
- a pharmaceutical preparation may also include one or more additional compounds such as a compound that is used to treat an ActRIIB-associated disorder.
- nucleic acids encoding an ActRIIB polypeptide.
- a nucleic acid may comprises a nucleic acid sequence of 73-396 of SEQ ID NO:4 or one that hybridizes under stringent conditions to the complement of nucleotides 73-396 of SEQ ID NO:4.
- a nucleic acid may one that comprises the sequence of SEQ ID NO:4.
- Such a nucleic acid may comprises a nucleic acid sequence of 73-396 of SEQ ID NO:6 or one that hybridizes under stringent conditions to the complement of nucleotides 73-396 of SEQ ID NO:6.
- a nucleic acid may one that comprises the sequence of SEQ ID NO:6.
- an ActRIIB protein may be expressed in a mammalian cell line that mediates suitably natural glycosylation of the ActRIIB protein so as to diminish the likelihood of an unfavorable immune response in a patient (including the possibility of veterinary patients).
- Human and CHO cell lines have been used successfully, and it is expected that other common mammalian expression vectors will be useful.
- cultured cells comprising any of the nucleic acids disclosed herein.
- Such cells may be mammalian cells, including CHO cells, NSO cells, HEK cells and COS cells. Other cells may be chosen depending on the species of the intended patient. Other cells are disclosed herein. Cultured cells are understood to mean cells maintained in laboratory or other man-made conditions (e.g., frozen, or in media) and not part of a living organism.
- the disclosure provides methods for making a ActRIIB polypeptide.
- Such a method may include expressing any of the nucleic acids (e.g., SEQ ID NO: 4 or 6, and nucleic acids that hybridize thereto under stringent conditions) disclosed herein in a suitable cell, such as a Chinese hamster ovary (CHO) cell.
- a suitable cell such as a Chinese hamster ovary (CHO) cell.
- Such a method may comprise: a) culturing a cell under conditions suitable for expression of the ActRIIB polypeptide, wherein said cell is transformed with an ActRIIB expression construct; and b) recovering the ActRIIB polypeptide so expressed.
- ActRIIB polypeptides may be recovered as crude, partially purified or highly purified fractions using any of the well known techniques for obtaining protein from cell cultures as well as techniques described herein.
- the disclosure provides methods for treating a subject having a disorder associated with muscle loss or insufficient muscle growth. Such a method may comprise administering to the subject an effective amount of any of the foregoing ActRIIB polypeptides or pharmaceutical preparations thereof. In certain aspects the disclosure provides methods for increasing the lean mass or reducing the rate of loss of lean mass in a subject in need thereof. Such a method may comprise administering to the subject an effective amount of any of the foregoing ActRIIB polypeptides or pharmaceutical preparations thereof. In certain aspects, the disclosure provides methods for decreasing the body fat content or reducing the rate of increase in body fat content in a subject. Such a method may comprise administering to the subject an effective amount of any of the foregoing ActRIIB polypeptides or pharmaceutical preparations thereof.
- the disclosure provides methods for treating a disorder associated with undesirable body weight gain in a subject.
- Such a method may comprise administering to the subject an effective amount of any of the foregoing ActRIIB polypeptides or pharmaceutical preparations thereof.
- the disclosure provides methods for treating a metabolic disorder in a subject.
- Such a method may comprise administering to the subject an effective amount of any of the foregoing ActRIIB polypeptides or pharmaceutical preparations thereof.
- a patient eligible for treatment may have one or more of the following characteristics: elevated serum triglyceride levels; elevated free fatty acid levels; or elevated serum insulin levels. Examples of metabolic disorders include type 2 diabetes, metabolic syndrome, insulin resistance and obesity.
- an ActRIIB polypeptide disclosed herein may be used in a method for treating a subject having a disorder associated with muscle loss or insufficient muscle growth.
- Such disorders include muscle atrophy, muscular dystrophy, amyotrophic lateral sclerosis (ALS), and a muscle wasting disorder (e.g., cachexia, anorexia, DMD syndrome, BMD syndrome, AIDS wasting syndrome, muscular dystrophies, neuromuscular diseases, motor neuron diseases, diseases of the neuromuscular junction, and inflammatory myopathies).
- a method may comprise administering to a subject in need thereof an effective amount of an ActRIIB polypeptide.
- an ActRIIB polypeptide disclosed herein may be used in a method for decreasing the body fat content or reducing the rate of increase in body fat content, and for treating a disorder associated with undesirable body weight gain, such as obesity, non- insulin dependent diabetes mellitus (NIDDM), cardiovascular disease, cancer, hypertension, osteoarthritis, stroke, respiratory problems, and gall bladder disease. These methods may comprise administering to a subject in need thereof an effective amount of an ActRIIB polypeptide.
- NIDDM non- insulin dependent diabetes mellitus
- an ActRIIB polypeptide disclosed herein may be used in a method for treating a disorder associated with abnormal activity of GDF8.
- disorders include metabolic disorders such as type 2 diabetes, impaired glucose tolerance, metabolic syndrome (e.g., syndrome X), and insulin resistance induced by trauma (e.g., burns or nitrogen imbalance); adipose tissue disorders (e.g., obesity); muscular dystrophy (including Duchenne muscular dystrophy); amyotrophic lateral sclerosis (ALS); muscle atrophy; organ atrophy; frailty; carpal tunnel syndrome; congestive obstructive pulmonary disease; sarcopenia, cachexia and other muscle wasting syndromes; osteoporosis; glucocorticoid- induced osteoporosis; osteopenia; osteoarthritis; osteoporosis-related fractures; low bone mass due to chronic glucocorticoid therapy, premature gonadal failure, androgen suppression, vitamin D deficiency, secondary hyperparathyroidis
- the disclosure provides a method for identifying an agent that stimulates growth of a tissue such as bone, cartilage, muscle and fat,.
- the method comprises: a) identifying a test agent that binds to a ligand-binding domain of an ActRIIB polypeptide competitively with an ActRIIB polypeptide; and b) evaluating the effect of the agent on growth of the tissue.
- the disclosure provides methods for antagonizing activity of an ActRIIB polypeptide or an ActRIIB ligand (e.g., GDF8, GDFl 1, activin, GDF3, BMP7, and Nodal) in a cell.
- the methods comprise contacting the cell with an ActRIIB polypeptide.
- the activity of the ActRIIB polypeptide or the ActRIIB ligand is monitored by a signaling transduction mediated by the ActRIIB/ActRIIB ligand complex, for example, by monitoring cell proliferation.
- the cells of the methods include an osteoblast, a chondrocyte, a myocyte, an adipocyte and a muscle cell.
- the disclosure provides uses of an ActRIIB polypeptide for making a medicament for the treatment of a disorder or condition as described herein.
- Figure 1 shows the full, unprocessed amino acid sequence for ActRIIB(25-131)-hFc (SEQ ID NO:3).
- the TPA leader (residues 1-22) and double-truncated ActRIIB extracellular domain (residues 24-131, using numbering based on the native sequence in SEQ ID NO:1) are each underlined.
- Highlighted is the glutamate revealed by sequencing to be the N- terminal amino acid of the mature fusion protein, which is at position 25 relative to SEQ ID NO:1.
- Figure 2 shows a nucleotide sequence encoding ActRIIB(25-131)-hFc (the coding strand is shown at top, SEQ ID NO:4, and the complement shown at bottom 3 '-5', SEQ ID NO:5). Sequences encoding the TPA leader (nucleotides 1-66) and ActRIIB extracellular domain (nucleotides 73-396) are underlined. The corresponding amino acid sequence for ActRIIB(25-131) is also shown.
- Figure 3 shows an alternative nucleotide sequence encoding ActRIIB(25-131)-hFc (the coding strand is shown at top, SEQ ID NO:6, and the complement shown at bottom 3'- 5', SEQ ID NO: 7).
- This sequence confers a greater level of protein expression in initial transformants, making cell line development a more rapid process.
- Sequences encoding the TPA leader (nucleotides 1-66) and ActRIIB extracellular domain (nucleotides 73-396) are underlined, and substitutions in the wild type nucleotide sequence of the ECD (see Figure 2) are highlighted.
- the corresponding amino acid sequence for ActRIIB(25-131) is also shown.
- Figure 4 shows the effect of four weeks treatment with ActRIIB(25 - 131 )-hFc on lean tissue mass in mouse.
- Vehicle was Tris-buffered saline (TBS).
- ActRIIB(25-131)-hFc treatment increased lean tissue mass in a clear dose-dependent manner.
- Figure 5 shows the effect of four weeks treatment with ActRIIB(25-131)-hFc on pectoralis muscle mass in mouse.
- Vehicle was Tris-buffered saline (TBS).
- ActRIIB(25-131)-hFc treatment increased pectoralis muscle mass in a clear dose-dependent manner.
- FIG. 6 shows the effect of ActRIIB(25-131)-hFc treatment on grip strength in mouse.
- Vehicle was Tris-buffered saline (TBS).
- ActRIIB(25-131)-hFc treatment increased grip strength in a dose-dependent manner.
- Figure 7 shows the effect of four weeks treatment with ActRIIB(25-131)-hFc on lean tissue mass in a mouse model of androgen deprivation.
- Vehicle was Tris-buffered saline (TBS).
- ActRIIB(25-131)-hFc increased lean tissue
- Figure 8 shows the effect of ActRIIB(25-131)-hFc on lean tissue mass in a mouse model of diet-induced obesity.
- Vehicle was Tris-buffered saline (TBS).
- ActRIIB(25-131)-hFc increased lean tissue mass effectively in mice fed a high fat diet.
- FIG. 9 shows the effect of ActRIIB(25-13 l)-hFc on fat mass in a mouse model of diet-induced obesity.
- Vehicle was Tris-buffered saline (TBS).
- ActRIIB(25- 131)-hFc treatment for 12 weeks reduced fat mass by approximately half in mice fed a high fat diet.
- ActRIIB(25-131)-hFc treatment for 60 days Data are means ⁇ SEM. ***, P ⁇ 0.001.
- ActRIIB(25-131)-hFc reduced triglyceride concentrations by more than 50%, thereby normalizing triglycerides to levels observed in standard-diet controls.
- FIG 11 depicts serum free fatty acid (FFA) concentrations in mice as a function of :0 diet and ActRIIB(25-13 l)-hFc treatment for 60 days. Data are means ⁇ SEM. ***, P ⁇ 0.001. In mice fed a high- fat diet, ActRIIB(25-13 l)-hFc reduced FFA concentrations by nearly 55%, thereby normalizing FFA to levels observed in standard-diet controls.
- FFA serum free fatty acid
- Figure 12 depicts serum high-density lipoprotein (HDL) concentrations in mice as a function of diet and ActRIIB(25-131)-hFc treatment for 60 days. Data are means ⁇ SEM. !5 ***, P ⁇ 0.001. In mice fed a high-fat diet, ActRIIB(25-13 l)-hFc reduced HDL concentrations by nearly 50%, thereby normalizing HDL to levels observed in standard-diet controls.
- HDL serum high-density lipoprotein
- Figure 13 depicts serum low-density lipoprotein (LDL) concentrations in mice as a function of diet and ActRIIB(25-131)-hFc treatment for 60 days. Data are means ⁇ SEM. *, 10 P ⁇ 0.05. In mice fed a high-fat diet, ActRIIB(25-13 l)-hFc reduced LDL concentrations by more than 40%.
- Figure 14 depicts serum insulin concentrations in mice as a function of diet and ActRIIB(25-131)-hFc treatment for 60 days. Data are means ⁇ SEM. **, P ⁇ 0.01. In mice fed a high- fat diet, ActRIIB(25-131)-hFc reduced insulin concentrations by more than 60%, thereby normalizing insulin to levels observed in standard-diet controls.
- LDL low-density lipoprotein
- ActRIIB(25-131)-hFc treatment for 60 days ELISA measurements detect all main oligomeric isoforms (total adiponectin), and data are means ⁇ SEM. **, P ⁇ 0.01; ***, P ⁇ 0.001.
- ActRIIB(25-13 l)-hFc increased adiponectin concentrations by more than 75% and even boosted adiponectin significantly above the levels
- Figure 16 shows thermogenic histological changes induced within epididymal white adipose tissue by ActRIIB(25-131)-hFc treatment for 60 days in a mouse model of diet- induced obesity. All microscopic images shown at the same magnification. Hematoxylin and eosin (H&E) staining indicates the ability of ActRIIB(25-131)-hFc to reduce lipid droplet 5 size and induce clusters of multilocular adipocytes (arrows) characteristic of brown fat.
- H&E Hematoxylin and eosin
- Figure 17 shows the effect of ActRIIB(25-131)-hFc treatment for 60 days on UCPl mRNA levels in epididymal white fat in a mouse model of diet-induced obesity.
- ActRIIB(25-131)-hFc caused a 60-fold increase in mRNA encoding this selective marker for brown fat, thus indicating upregulation of thermogenic capability within this white fat depot.
- Figure 18 shows levels of adiponectin mRNA in epididymal white fat of mice as a 15 function of diet and ActRIIB(25-131)-hFc treatment for 60 days.
- ActRIIB(25-131)-hFc increased adiponectin mRNA levels by more than 60%, thus contributing to elevated concentrations of circulating adiponectin in these mice.
- Figure 19 shows the effect of ActRIIB(25-131)-hFc treatment for 60 days on fatty 10 liver deposits (hepatic steatosis) in a mouse model of diet-induced obesity.
- Liver sections (all shown at the same magnification) stained with Oil Red O reveal pronounced lipid deposition under high-fat dietary conditions but not control conditions.
- Arrows indicate several of many densely packed lipid droplets, which are stained bright red but difficult to discern in black- and-white images. ActRIIB(25-131)-hFc inhibited formation of such lipid droplets and largely restored the appearance of liver tissue to that of mice fed the standard diet.
- microCT micro-computed tomography
- FIG. 23 shows photographs of bilateral pairs of interscapular brown fat depots as a function of diet and ActRIIB(25-131)-mFc treatment for 60 days in a mouse model of diet- induced obesity.
- High- fat diet increased the size and lightened the color of the depots, whereas ActRIIB(25-131)-mFc largely reversed these changes.
- Figure 24 depicts the effect of ActRIIB(25-131)-mFc treatment for 60 days on the !5 mass of interscapular brown fat in a mouse model of diet-induced obesity. Data are means ⁇ SEM for combined left and right depots; ***, p ⁇ 0.001. ActRIIB(25-13 l)-mFc reversed the effect of high- fat diet on the mass of this brown fat depot.
- Figure 25 depicts the effect of ActRIIB(25-131)-mFc treatment for 60 days on the density of interscapular brown fat as determined by microCT in a mouse model of diet- 10 induced obesity.
- Data (means ⁇ SEM) are expressed in standardized units based on a positive value for the bone mineral hydroxyapatite (HA) and a value of zero for water; therefore, fat values are negative, with values for white fat typically close to -120. **, p ⁇ 0.01. ActRIIB(25-131)-mFc completely reversed the effect of high-fat diet on the density of this brown fat depot.
- Figure 26 depicts the effect of ActRIIB(25-131)-mFc treatment on lean tissue mass as determined in a mouse model of aging by nuclear magnetic resonance (NMR) analysis at multiple time points. Data are means of 10-15 mice per group per time point; ***, P ⁇ 0.001 vs. vehicle at same time point. After 7 weeks of dosing, lean tissue mass in aged mice treated with ActRIIB(25-131)-mFc increased nearly 20% from baseline, in contrast to essentially unchanged values in vehicle-treated controls.
- NMR nuclear magnetic resonance
- Figure 27 depicts the effect of ActRIIB(25-131)-mFc treatment on forelimb grip strength as determined at multiple time points in a mouse model of aging. Data are means of 13-15 mice per group per time point; **, P ⁇ 0.01 vs. vehicle at same time point. Mice treated with ActRIIB(25-131)-mFc displayed an overall trend of increasing grip strength across the study, in contrast to the decline in grip strength observed in vehicle controls over the same interval.
- Figure 28 depicts the effect of ActRIIB(25-13 l)-mFc treatment for 8 weeks on bone mineral density as determined in a mouse model of aging by dual energy x-ray absorptiometry (DEXA). Data are means ⁇ SEM; *, P ⁇ 0.05.
- Figure 29 depicts the effect of ActRIIB(25-13 l)-mFc treatment on whole -body fat mass as determined in a mouse model of aging by NMR analysis at multiple time points. Data are means of 10-15 mice per group per time point. ***, P ⁇ 0.001 vs. vehicle at same time point. After 7 weeks of dosing, fat mass in aged mice treated with ActRIIB(25-131)- mFc exhibited a percent decrease from baseline more than twice the magnitude of that in vehicle-treated controls.
- ActRIIB refers to a family of activin receptor type HB (ActRIIB) proteins and ActRIIB-related proteins, derived from any species.
- ActRIIB activin receptor type HB
- ActRIIB-related proteins derived from any species.
- Members of the ActRIIB family are generally all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine kinase specificity.
- ActRIIB polypeptide is used to refer to polypeptides comprising any naturally occurring polypeptide of an ActRIIB family member as well as any variants thereof (including mutants, fragments, fusions, and peptidomimetic forms) that retain a useful activity.
- ActRIIB polypeptides include polypeptides derived from the sequence of any known ActRIIB having a sequence at least about 80% identical to the sequence of an ActRIIB polypeptide, and preferably at least 85%, 90%, 95%, 97%, 99% or greater identity.
- the human ActRIIB precursor has the following amino acid sequence, with the signal peptide underlined, the extracellular domain indicated in bold, and the potential N-linked glycosylation sites boxed (SEQ ID NO: 1) (NM OOl 106, 512 aa).
- PGMKHENLLQFIAAEKRGSNLEVELWLITAFHDKGSLTDYLKGNIITWNELCHVAETMS RGLSYLHEDVPWCRGEGHKPSIAHRDFKSKNVLLKSDLTAVLADFGLAVRFEPGKPPGD THGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELVSRCKAADGPVDEYMLP FEEEIGQHPSLEELQEWVHKKMRPTIKDHWLKHPGLAQLCVTIEECWDHDAEARLSAG CVEERVSLIRRSVNGTTSDCLVSLVTSVTNVDLPPKESSI ActRIIB polypeptides may include any naturally occurring extracellular domain of an
- the signal sequence can be a native signal sequence of an ActRIIB, or a signal sequence from another protein, such as a tissue plasminogen activator (TPA) signal sequence or a honey bee melatin (HBM) signal sequence.
- TPA tissue plasminogen activator
- HBM honey bee melatin
- the disclosure provides a novel ActRIIB polypeptide that is truncated, such that the portion derived from ActRIIB is from amino acids 25-131 of SEQ ID NO: 1.
- polypeptides of this type when administered as an Fc construct, ActRIIB(25- 131 )-hFc, promote the formation of lean body mass (primarily muscle) and the loss of fat mass, while also having marked desirable effects on metabolic parameters such as serum triglycerides, serum free fatty acids and serum insulin levels.
- ActRIIB(25-131)- hFc has a much greater effect on these metabolic parameters than does a related protein, ActRIIB(20-134).
- TGF- ⁇ signals are mediated by heteromeric complexes of type I and type II serine/ threonine kinase receptors, which phosphorylate and activate downstream Smad proteins upon ligand stimulation (Massague, 2000, Nat. Rev. MoI. Cell Biol. 1 :169-178).
- type I and type II receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity.
- Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors.
- Type I and II activin receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors.
- ActRIIA and ActRIIB Two related type II receptors, ActRIIA and ActRIIB, have been identified as the type II receptors for activins (Mathews and Vale, 1991, Cell 65:973-982; Attisano et al, 1992, Cell 68: 97-108). Besides activins, ActRIIA and ActRIIB can biochemically interact with several other TGF- ⁇ family proteins, including BMP7, Nodal, GDF8, and GDFl 1 (Yamashita et al., 1995, J. Cell Biol. 130:217-226; Lee and McPherron, 2001, Proc. Natl. Acad. Sci. 98:9306-9311; Yeo and Whitman, 2001, MoL Cell 7: 949-957; Oh et al, 2002, Genes Dev. 16:2749-54).
- BMP7, Nodal, GDF8, and GDFl 1 Yamashita et al., 1995
- the present invention relates to antagonizing a ligand of ActRIIB receptors (also referred to as an ActRIIB ligand) with a subject ActRIIB polypeptide (e.g., an ActRIIB-Fc polypeptide).
- a ligand of ActRIIB receptors also referred to as an ActRIIB ligand
- a subject ActRIIB polypeptide e.g., an ActRIIB-Fc polypeptide.
- compositions and methods of the present invention are useful for treating disorders associated with abnormal activity of one or more ligands of ActRIIB receptors.
- Exemplary ligands of ActRIIB receptors include some TGF- ⁇ family members, such as activin, Nodal, GDF3, GDF8, GDFl 1, and BMP7.
- Activins are dimeric polypeptide growth factors and belong to the TGF -beta superfamily. There are three activins (A, B, and AB) that are homo/heterodimers of two closely related ⁇ subunits (PAPA, PBPB, and PAPB). In the TGF-beta superfamily, activins are unique and multifunctional factors that can stimulate hormone production in ovarian and placental cells, support neuronal cell survival, influence cell-cycle progress positively or negatively depending on cell type, and induce mesodermal differentiation at least in amphibian embryos (DePaolo et al., 1991, Proc SocEp Biol Med. 198:500-512; Dyson et al., 1997, Curr Biol.
- erythroid differentiation factor isolated from the stimulated human monocytic leukemic cells was found to be identical to activin A (Murata et al., 1988, PNAS, 85:2434). It was suggested that activin A acts as a natural regulator of erythropoiesis in the bone marrow. In several tissues, activin signaling is antagonized by its related heterodimer, inhibin. For example, during the release of follicle-stimulating hormone (FSH) from the pituitary, activin promotes FSH secretion and synthesis, while inhibin prevents FSH secretion and synthesis.
- FSH follicle-stimulating hormone
- Other proteins that may regulate activin bioactivity and/or bind to activin include follistatin (FS), follistatin-related protein (FSRP), ⁇ 2-macroglobulin, Cerberus, and endoglin, which are described below.
- Bone morphogenetic protein 7 also called osteogenic protein- 1 (OP-I)
- BMP7 regulates a wide array of physiological processes.
- BMP7 has recently been identified as a key promoter of brown adipocyte differentiation (Tseng et al., 2008, Nature 454:1000-1004).
- genetic ablation of BMP7 led to scarcity of brown fat and nearly complete absence of UCPl in murine embryos.
- upregulation of BMP7 expression in mice by adenovirus administration increased brown fat mass and energy expenditure.
- BMP7 binds to type II receptors, ActRIIA and ActRIIB.
- BMP7 and activin recruit distinct type I receptors into heteromeric receptor complexes.
- the major BMP7 type I receptor observed was ALK2, while activin bound exclusively to ALK4 (ActRIIB).
- BMP7 and activin elicited distinct biological responses and activated different Smad pathways (Macias-Silva et al, 1998, J Biol Chem. 273:25628-36).
- GDF3 Growth-and-Differentiation Factor-3
- VgI -related 2 plays an important role in embryonic development and has also been implicated in adipogenesis during adulthood.
- expression of GDF3 in white adipose tissue is correlated with body mass or obesity (Weisberg et al., 2003, J Clin Invest 112:1796-1808), and adenovirus- mediated overexpression of GDF3 exaggerates the increase in adiposity observed under high-
- mice with genetic ablation of GDF3 are healthy and essentially normal when maintained on a standard diet but are protected from obesity, and display an increased basal metabolic rate, when maintained on a high-fat diet (Shen et al., 2009, MoI Endocrinol 23:113-123).
- Nodal proteins have functions in mesoderm and endoderm induction and formation, as well as subsequent organization of axial structures such as heart and stomach in early embryogenesis. It has been demonstrated that dorsal tissue in a developing vertebrate
- !5 ligands interact with their co-factors (e.g., cripto) to activate activin type I and type II receptors, which phosphorylate Smad2.
- Nodal proteins are implicated in many events critical to the early vertebrate embryo, including mesoderm formation, anterior patterning, and left- right axis specification. Experimental evidence has demonstrated that Nodal signaling activates pAR3-Lux, a luciferase reporter previously shown to respond specifically to activin i0 and TGF -beta. However, Nodal is unable to induce pTlx2-Lux, a reporter specifically responsive to bone morphogenetic proteins.
- GDF8 Growth and Differentiation Factor-8
- GDF8 is a negative regulator of skeletal muscle mass. GDF8 is highly expressed in the developing and adult skeletal muscle. The GDF8 null mutation in transgenic mice is characterized by a marked hypertrophy and hyperplasia of the skeletal muscle (McPherron et al., Nature, 1997,
- GDF8 can modulate the production of muscle-specific enzymes (e.g., creatine kinase) and modulate myoblast cell proliferation (WO 00/43781).
- the GDF8 propeptide can noncovalently bind to the mature GDF8 domain dimer, inactivating its biological activity
- GDFl 1 Growth and Differentiation Factor- 11 (GDFl 1), also known as BMPl 1, is a secreted protein (McPherron et al., 1999, Nat. Genet. 22: 260-264). GDFl 1 is expressed in the tail bud, limb bud, maxillary and mandibular arches, and dorsal root ganglia during mouse development (Nakashima et al., 1999, Mech. Dev. 80: 185-189). GDFl 1 plays a unique role in patterning both mesodermal and neural tissues (Gamer et al., 1999, Dev Biol., 208:222-
- GDFl 1 was shown to be a negative regulator of chondrogenesis and myogenesis in developing chick limb (Gamer et al., 2001, Dev Biol. 229:407-20).
- the expression of GDFl 1 in muscle also suggests its role in regulating muscle growth in a similar way to GDF8.
- the expression of GDFl 1 in brain suggests that GDFl 1 may also possess activities that relate to the function of the nervous system.
- GDFl 1 was found i0 to inhibit neurogenesis in the olfactory epithelium (Wu et al., 2003, Neuron. 37: 197-207).
- GDFl 1 may have in vitro and in vivo applications in the treatment of diseases such as muscle diseases and neurodegenerative diseases (e.g., amyotrophic lateral sclerosis).
- the present invention relates to the use of certain ActRIIB polypeptides to antagonize the signaling of ActRIIB ligands generally, in any process associated with ActRIIB activity.
- ActRIIB polypeptides of the invention may antagonize one or more ligands of ActRIIB receptors, such as activin, Nodal, GDF8, GDFl 1, and BMP7, and may therefore be useful in the treatment of additional disorders.
- the present invention contemplates using ActRIIB polypeptides in treating or preventing diseases or conditions that are associated with abnormal activity of an ActRIIB or an ActRIIB ligand.
- ActRIIB or ActRIIB ligands are involved in the regulation of many critical biological processes. Due to their key functions in these processes, they may be desirable targets for therapeutic intervention.
- ActRIIB polypeptides e.g., ActRIIB-Fc polypeptides
- Example of such disorders or conditions include, but are not limited to, metabolic disorders such as type 2 diabetes, impaired glucose tolerance, metabolic syndrome (e.g., syndrome X), and insulin resistance induced by trauma (e.g., burns or nitrogen imbalance); adipose tissue disorders (e.g., obesity); muscle and neuromuscular disorders such as muscular dystrophy (including Duchenne muscular dystrophy); amyotrophic lateral sclerosis (ALS); muscle atrophy; organ atrophy; frailty; carpal tunnel syndrome; congestive obstructive pulmonary disease; and sarcopenia, cachexia and other muscle wasting syndromes.
- metabolic disorders such as type 2 diabetes, impaired glucose tolerance, metabolic syndrome (e.g., syndrome X), and insulin resistance induced by trauma (e.g., burns or nitrogen imbalance); adipose tissue disorders (e.g., obesity); muscle and neuromuscular disorders such as muscular dystrophy (including Duchenne muscular dystrophy); amyotrophic lateral sclerosis (ALS); muscle at
- osteoporosis especially in the elderly and/or postmenopausal women; glucocorticoid-induced osteoporosis; osteopenia; osteoarthritis; and osteoporosis-related fractures.
- Yet further examples include low bone mass due to chronic glucocorticoid therapy, premature gonadal failure, androgen suppression, vitamin D deficiency, secondary hyperparathyroidism, nutritional deficiencies, and anorexia nervosa. These disorders and conditions are discussed below under “Exemplary Therapeutic Uses.”
- the truncated ActRIIB polypeptides disclosed herein appear to have particularly beneficial effects on metabolic parameters.
- the methods of the invention may include steps of comparing sequences to each other, including wild-type sequence to one or more mutants (sequence variants). Such comparisons typically comprise alignments of polymer sequences, e.g., using sequence alignment programs and/or algorithms that are well known in the art (for example, BLAST, FASTA and MEGALIGN, to name a few).
- sequence alignment will introduce a "gap" (typically represented by a dash, or "A") in the polymer sequence not containing the inserted or deleted residue.
- sequence similarity in all its grammatical forms, refers to the degree of identity or correspondence between nucleic acid or amino acid sequences that may or may not share a common evolutionary origin.
- the invention relates to ActRIIB polypeptides (e.g., ActRIIB-Fc polypeptides), and particularly truncated forms exemplified by polypeptides comprising amino acids 25-131 of SEQ ID NO:1, and variants thereof.
- an ActRIIB variant of the invention may bind to and inhibit function of an ActRIIB ligand (e.g., activin A, activin AB, activin B, Nodal, GDF8, GDFl 1 or BMP7).
- an ActRIIB polypeptide modulates growth of tissues such as bone, cartilage, muscle or fat or metabolic parameters such as
- ActRIIB polypeptides include human ActRIIB precursor polypeptide (SEQ ID NO: 1), and Fc fusion proteins, e.g., SEQ ID Nos. 3 and 8. Variations on these polypeptides may be prepared according to the following guidance. The numbering of amino acids in the ActRIIB polypeptides is based on the sequence of SEQ ID NO:1, regardless of whether the native leader sequence is used.
- the disclosure identifies functionally active portions and variants of ActRIIB.
- an Fc fusion protein having the sequence disclosed by Hilden et al. (Blood. 1994 Apr 15;83(8):2163-70), which has an Alanine at the position corresponding to amino acid 64 of SEQ ID NO: 1 (A64), has a relatively low affinity for activin and GDF-11.
- R64 has an affinity for activin and GDF-11 in the low nanomolar to high picomolar range. Therefore, a sequence with an R64 is used as the wild-type reference sequence for human ActRIIB in this disclosure.
- Attisano et al. (Cell. 1992 Jan 10;68(l):97-108) showed that a deletion of the proline knot at the C-terminus of the extracellular domain of ActRIIB reduced the affinity of the !5 receptor for activin. Mutations of P 129 and P 130 do not substantially decrease ligand binding.
- the ActRIIB ligand binding pocket is defined by residues Y31, N33, N35, L38 through T41, E47, E50, Q53 through K55, L57, H58, Y60, S62, K74, W78 through N83, Y85, R87, A92, and E94 through FlOl .
- R40A, K55A, F82A and mutations at position L79 are conservative iO mutations.
- R40 is a K in Xenopus, indicating that basic amino acids at this position will be tolerated.
- an ActRIIB protein may be one that comprises amino acids 25-131 and comprising no more than 1, 2, 5, 10 or 15 conservative amino acid changes in the ligand binding pocket, and zero, one or more non-conservative alterations at positions 40, 53, 55, 74, 79 and/or 82 in the ligand binding pocket. Such a protein may retain greater than 80%, 90%, 95% or 99% sequence identity to the sequence of amino acids 25-131 of SEQ ID NO:1.
- Sites outside the binding pocket include the amino and carboxy termini of the extracellular domain (as noted above), and positions 42-46 and 65-73.
- An asparagine to alanine alteration at position 65 actually improves ligand binding in the A64 background, and is thus expected to have no detrimental effect on ligand binding in the R64 background. This change probably eliminates glycosylation at N65 in the A64 background, thus demonstrating that a significant change in this region is likely to be tolerated. While an R64A change is poorly tolerated, R64K is well-tolerated, and thus another basic residue, such as H may be tolerated at position 64.
- ActRIIB is well-conserved across nearly all vertebrates, with large stretches of the extracellular domain conserved completely. Many of the ligands that bind to ActRIIB are also highly conserverd. Accordingly, comparisons of ActRIIB sequences from various vertebrate organisms provide insights into residues that may be altered. Therefore, an active, human ActRIIB may include one or more amino acids at corresponding positions from the sequence of another vertebrate ActRIIB, or may include a residue that is similar to that in the human or other vertebrate sequence. The following examples illustrate this approach to defining an active ActRIIB variant.
- L46 is a valine in Xenopus ActRIIB, and so this position may be altered, and optionally may be altered to another hydrophobic residue, such as V, I or F, or a non-polar residue such as A.
- E52 is a K in Xenopus, indicating that this site may be tolerant of a wide variety of changes, including polar residues, such as E, D, K, R, H, S, T, P, G, Y and probably A.
- T93 is a K in Xenopus, indicating that a wide structural variation is tolerated at this position, with polar residues favored, such as S, K, R, E, D, H, G, P, G and Y.
- F 108 is a Y in Xenopus, and therefore Y or other hydrophobic group, such as I, V or L should be tolerated.
- El I l is K in Xenopus, indicating that charged residues will be tolerated at this position, including D, R, K and H, as well as Q and N.
- Rl 12 is K in Xenopus, indicating that basic residues are tolerated at this position, including R and H.
- a at position 119 is relatively poorly conserved, and appears as P in rodents and V in Xenopus, thus essentially any amino acid should be tolerated at this position.
- N-linked glycosylation sites may be added to an ActRIIB polypeptide, and may increase the serum half- life of an ActRIIB-Fc fusion protein, relative to the ActRIIB(R64)-Fc form.
- NX(IYS) sequences are found at 42-44 (NQS) and 65-67 (NSS), although the latter may not be efficiently glycosylated with the R at position 64.
- N-X-S/T sequences may be generally introduced at positions outside the ligand binding pocket. Particularly suitable sites for the introduction of non-endogenous N-X-S/T sequences include amino acids 20-29, 20-24, 22-25, 109-134, 120-134 or 129-134. N-X-S/T sequences may also be introduced into the linker between the ActRIIB sequence and the Fc or other fusion component. Such a site may be introduced with minimal effort by introducing an N in
- N-linked glycosylation site A24N, R64N, S67N (possibly combined with an N65A alteration), E106N, Rl 12N, G120N, E123N, P129N, A132N, Rl 12S and Rl 12T. Any S that is predicted to be glycosylated may be altered to a T without creating an immunogenic site,
- an ActRIIB variant may include one or more additional, non-endogenous N-linked glycosylation consensus sequences.
- positions that may be desirable to conserve are as follows: position 52 (acidic amino acid), position 55 (basic amino acid), position 81 (acidic), 98 (polar or charged, particularly E, D, R or K).
- the present invention contemplates making functional variants by modifying the structure of an ActRIIB polypeptide for such purposes as i0 enhancing therapeutic efficacy, or stability (e.g., ex vivo shelf life and resistance to proteolytic degradation in vivo).
- Modified ActRIIB polypeptides can also be produced, for instance, by amino acid substitution, deletion, or addition.
- Whether a change in the amino acid sequence of an ActRIIB polypeptide results in a functional homo log can be readily determined by assessing the ability of the variant ActRIIB polypeptide to produce a response in cells in a fashion similar to the wild-type ActRIIB polypeptide, or to bind to one or more ligands, such as activin, GDF-11 or myostatin in a fashion similar to wild type.
- the present invention contemplates making mutations in the extracellular domain (also referred to as ligand-binding domain) of an ActRIIB polypeptide such that the variant (or mutant) ActRIIB polypeptide has altered ligand-binding activities (e.g., binding affinity or binding specificity).
- such variant ActRIIB polypeptides have altered (elevated or reduced) binding affinity for a specific ligand.
- the variant ActRIIB polypeptides have altered binding specificity for their ligands.
- the present invention contemplates specific mutations of the ActRIIB polypeptides so as to alter the glycosylation of the polypeptide.
- Such mutations may be selected so as to introduce or eliminate one or more glycosylation sites, such as O- linked or N-linked glycosylation sites.
- Asparagine-linked glycosylation recognition sites generally comprise a tripeptide sequence, asparagine-X-threonine (where "X" is any amino acid) which is specifically recognized by appropriate cellular glycosylation enzymes.
- the alteration may also be made by the addition of, or substitution by, one or more serine or threonine residues to the sequence of the wild-type ActRIIB polypeptide (for O-linked glycosylation sites).
- a variety of amino acid substitutions or deletions at one or both of the first or third amino acid positions of a glycosylation recognition site (and/or amino acid deletion at the second position) results in non-glycosylation at the modified tripeptide sequence.
- Another means of increasing the number of carbohydrate moieties on an ActRIIB polypeptide is by chemical or enzymatic coupling of glycosides to the ActRIIB polypeptide.
- the sugar(s) may be attached to (a) arginine and histidine; (b) free carboxyl groups; (c) free sulfhydryl groups such as those of cysteine; (d) free hydroxyl groups such as those of serine, threonine, or hydroxyproline; (e) aromatic residues such as those of phenylalanine, tyrosine, or tryptophan; or (f) the amide group of glutamine.
- arginine and histidine free carboxyl groups
- free sulfhydryl groups such as those of cysteine
- free hydroxyl groups such as those of serine, threonine, or hydroxyproline
- aromatic residues such as those of phenylalanine, tyrosine, or tryptophan
- the amide group of glutamine are described in WO 87/05330 published Sep. 11, 1987, and in Aplin and Wriston (1981) CRC Crit. Rev. Biochem., pp. 259
- Enzymatic cleavage of carbohydrate moieties on ActRIIB polypeptides can be achieved by the use of a variety of endo- and exo-glycosidases as described by Thotakura et al. (1987) Meth. Enzymol. 138:350.
- the sequence of an ActRIIB polypeptide may be adjusted, as appropriate, depending on the type of expression system used, as mammalian, yeast, insect and plant cells may all introduce
- ActRIIB proteins for use in humans will be expressed in a mammalian cell line that provides proper glycosylation, such as HEK293 or CHO cell lines, although other mammalian expression cell lines are expected to be useful as well.
- This disclosure further contemplates a method of generating variants, particularly sets !0 of combinatorial variants of an ActRIIB polypeptide, including, optionally, truncation variants; pools of combinatorial mutants are especially useful for identifying functional variant sequences.
- the purpose of screening such combinatorial libraries may be to generate, for example, ActRIIB polypeptide variants which have altered properties, such as altered pharmacokinetics, or altered ligand binding.
- a variety of screening assays are provided !5 below, and such assays may be used to evaluate variants.
- an ActRIIB polypeptide variant may be screened for ability to bind to an ActRIIB polypeptide, to prevent binding of an ActRIIB ligand to an ActRIIB polypeptide.
- an ActRIIB polypeptide or its variants may also be tested in a cell- based or in vivo assay.
- the effect of an ActRIIB polypeptide variant on the 10 expression of genes involved in bone production in an osteoblast or precursor may be assessed. This may, as needed, be performed in the presence of one or more recombinant ActRIIB ligand protein (e.g., BMP7), and cells may be transfected so as to produce an ActRIIB polypeptide and/or variants thereof, and optionally, an ActRIIB ligand.
- an ActRIIB polypeptide may be administered to a mouse or other animal, and one or more bone properties, such as density or volume may be assessed.
- the healing rate for bone fractures may also be evaluated.
- the activity of an ActRIIB polypeptide or its variants may be tested in muscle cells, adipocytes, and neuronal cells for any effect on growth of these cells, for example, by the assays as described below.
- Such assays are well known and routine in the art.
- a SMAD-responsive reporter gene may be used in such cell lines to monitor effects on downstream signaling.
- Combinatorially-derived variants can be generated which have a selective potency relative to a naturally occurring ActRIIB polypeptide.
- Such variant proteins when expressed from recombinant DNA constructs, can be used in gene therapy protocols.
- mutagenesis can give rise to variants which have intracellular half-lives dramatically different than the corresponding a wild-type ActRIIB polypeptide.
- the altered protein can be rendered either more stable or less stable to proteolytic degradation or other processes which result in destruction of, or otherwise inactivation of a native ActRIIB polypeptide.
- Such variants, and the genes which encode them can be utilized to alter ActRIIB polypeptide levels by modulating the half-life of the ActRIIB polypeptides. For instance, a short half- life can give rise to more transient biological effects and, when part of an inducible expression system, can allow tighter control of recombinant ActRIIB polypeptide levels within the cell.
- the ActRIIB polypeptides of the invention may further comprise post-translational modifications in addition to any that are naturally present in the ActRIIB polypeptides.
- modifications include, but are not limited to, acetylation, carboxylation, glycosylation, phosphorylation, lipidation, and acylation.
- the modified ActRIIB polypeptides may contain non-amino acid elements, such as polyethylene glycols, lipids, poly- or mono-saccharide, and phosphates. Effects of such non-amino acid elements on the functionality of a ActRIIB polypeptide may be tested as described herein for other ActRIIB polypeptide variants.
- an ActRIIB polypeptide When an ActRIIB polypeptide is produced in cells by cleaving a nascent form of the ActRIIB polypeptide, post-translational processing may also be important for correct folding and/or function of the protein.
- Different cells such as CHO, HeLa, MDCK, 293, WI38, NIH-3T3 or HEK293 have specific cellular machinery and characteristic mechanisms for such post-translational activities and may be chosen to ensure the correct modification and processing of the ActRIIB polypeptides.
- fusion proteins having at least a portion of the ActRIIB polypeptides and one or more fusion domains.
- fusion domains include, but are not limited to, polyhistidine, Glu-Glu, glutathione S transferase (GST), thioredoxin, protein A, protein G, an immunoglobulin heavy chain constant region (e.g., an Fc), maltose binding protein (MBP), or human serum albumin.
- GST glutathione S transferase
- a fusion domain may be selected so as to confer a desired property. For example, some fusion domains are particularly useful for isolation of the fusion proteins by affinity chromatography.
- matrices for affinity chromatography such as glutathione-, amylase-, and nickel- or cobalt- conjugated resins are used.
- Many of such matrices are available in "kit” form, such as the Pharmacia GST purification system and the QIAexpressTM system (Qiagen) useful with (HIS 6 ) fusion partners.
- a fusion domain may be selected so as to facilitate detection of the ActRIIB polypeptides. Examples of such detection domains include the various fluorescent proteins (e.g., GFP) as well as "epitope tags," which are usually short peptide sequences for which a specific antibody is available.
- fusion domains have a protease cleavage site, such as for Factor Xa or Thrombin, which allows the relevant protease to partially digest the fusion proteins and thereby liberate the recombinant proteins therefrom. The liberated proteins can then be isolated from the fusion domain by subsequent chromatographic separation.
- an ActRIIB polypeptide is fused with a domain that stabilizes the ActRIIB polypeptide in vivo (a "stabilizer" domain).
- stabilizing is meant anything that increases serum half life, regardless of whether this is because of decreased destruction, decreased clearance by the kidney, or other pharmacokinetic effect. Fusions with the Fc portion of an immunoglobulin are known to confer desirable pharmacokinetic properties on a wide range of proteins. Likewise, fusions to human serum albumin can confer desirable properties. Other types of fusion domains that may be selected include multimerizing (e.g., dimerizing, tetramerizing) domains and functional domains (that confer an additional biological function, such as further stimulation of muscle growth).
- the present invention provides a fusion protein as a GDF8 antagonist which comprises an extracellular (e.g., GDF8-binding) domain fused to an Fc domain (e.g., SEQ ID NO: 9).
- the Fc domain has one or more mutations at residues such as Asp-265, lysine 322, and Asn-434.
- the mutant Fc domain having one or more of these mutations e.g., Asp-265 mutation
- the mutant Fc domain having one or more of these mutations has increased ability of binding to the MHC class I- related Fc-receptor (FcRN) relative to a wildtype Fc domain.
- an ActRIIB polypeptide may be placed C-terminal to a heterologous domain, or, alternatively, a heterologous domain may be placed C-terminal to an ActRIIB polypeptide.
- the ActRIIB polypeptide domain and the heterologous domain need not be adjacent in a fusion protein, and additional domains or amino acid sequences may be included C- or N-terminal to either domain or between the domains.
- the ActRIIB polypeptides of the present invention contain one or more modifications that are capable of stabilizing the ActRIIB polypeptides.
- modifications enhance the in vitro half life of the ActRIIB polypeptides, enhance circulatory half life of the ActRIIB polypeptides or reducing proteolytic degradation of the ActRIIB polypeptides.
- Such stabilizing modifications include, but are not limited to, fusion proteins (including, for example, fusion proteins comprising an ActRIIB polypeptide and a stabilizer domain), modifications of a glycosylation site (including, for example, addition of a glycosylation site to an ActRIIB polypeptide), and modifications of carbohydrate moiety (including, for example, removal of carbohydrate moieties from an ActRIIB polypeptide).
- fusion proteins including, for example, fusion proteins comprising an ActRIIB polypeptide and a stabilizer domain
- modifications of a glycosylation site including, for example, addition of a glycosylation site to an ActRIIB polypeptide
- modifications of carbohydrate moiety including, for example, removal of carbohydrate moieties from an ActRIIB polypeptide.
- an ActRIIB polypeptide is fused to a stabilizer domain such as an IgG molecule (e.g., an Fc domain).
- the term "stabilizer domain” not only refers to a fusion domain (e.g., Fc) as in the case of fusion proteins, but also includes nonproteinaceous modifications such as a carbohydrate moiety, or nonproteinaceous polymer, such as polyethylene glycol.
- the present invention makes available isolated and/or purified forms of the ActRIIB polypeptides, which are isolated from, or otherwise substantially free of, other proteins.
- ActRIIB polypeptides (unmodified or modified) of the invention can be produced by a variety of art-known techniques. For example, such ActRIIB polypeptides can be synthesized using standard protein chemistry techniques such as those described in Bodansky, M.
- the modified or unmodified ActRIIB polypeptides may be produced by digestion of naturally occurring or recombinantly produced full-length ActRIIB polypeptides by using, for example, a protease, e.g., trypsin, thermolysin, chymotrypsin, pepsin, or paired basic amino acid converting enzyme (PACE).
- a protease e.g., trypsin, thermolysin, chymotrypsin, pepsin, or paired basic amino acid converting enzyme (PACE).
- PACE paired basic amino acid converting enzyme
- ActRIIB polypeptides may be produced from naturally occurring or recombinantly produced full-length ActRIIB polypeptides such as standard techniques known in the art, such as by chemical cleavage (e.g., cyanogen bromide, hydroxylamine).
- the invention provides isolated and/or recombinant nucleic acids encoding any of the ActRIIB polypeptides disclosed herein.
- SEQ ID NO: 4 encodes an ActRIIB(25-131)-hFc precursor polypeptide
- SEQ ID NO: 6 encodes a the same protein but with an alternative sequence
- nucleotides 73-396 of each of SEQ ID Nos. 4 and 6 encode the ActRIIB-derived portion of the encoded proteins.
- the subject nucleic acids may be single-stranded or double stranded.
- Such nucleic acids may be DNA or RNA molecules. These nucleic acids are may be used, for example, in methods for making ActRIIB polypeptides.
- the following sequence encodes a naturally occurring human ActRIIB precursor polypeptide (SEQ ID NO: 2) (nucleotides 5-1543 of NM OOl 106, 1539 bp): atgacggcgccctgggtggccctcgccctcctctggggatcgctgtggcccggctct gggcgtggggaggctgagacacgggagtgcatctactacaacgccaactgggagctg gagcgcaccaaccagagcggcctggagcgctgcgaaggcgagcaggacaagcggctg cactgctacgcctctggcgcaacagctctggcaccatcgagctcgtgaagaagggc tggctagatgacttcaactgctacgataggcaggag
- Variant nucleotide sequences include sequences that differ by one or more nucleotide substitutions, additions or deletions, such as allelic variants; and will, therefore, include coding sequences that differ from the nucleotide sequence of the coding sequence designated in SEQ ID NO: 4 or 6.
- the invention provides isolated or recombinant nucleic acid sequences that are at least 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 4 or 6, and particularly those portions thereof that are derived from ActRIIB (nucleotides 73-396).
- SEQ ID NO: 4 or 6 nucleic acid sequences complementary to SEQ ID NO: 4 or 6, and variants of SEQ ID NO: 4 are also within the scope of this invention.
- the nucleic acid sequences of the invention can be isolated, recombinant, and/or fused with a heterologous nucleotide sequence, or in a DNA library.
- nucleic acids of the invention also include nucleotide sequences that hybridize under highly stringent conditions to the nucleotide sequence designated in SEQ ID NO: 4 or 6, complement sequence of SEQ ID NO: 4 or 6, or fragments thereof (e.g., nucleotides 73-396).
- appropriate stringency conditions which promote DNA hybridization can be varied.
- appropriate stringency conditions which promote DNA hybridization can be varied. For example, one could perform the hybridization at 6.0 x sodium chloride/sodium citrate (SSC) at about 45 0 C, followed by a wash of 2.0 x SSC at 50 0 C.
- SSC sodium chloride/sodium citrate
- the salt concentration in the wash step can be selected from a low stringency of about 2.0 x SSC at 50 0 C to a high stringency of about 0.2 x SSC at 50 0 C.
- the temperature in the wash step can be increased from low stringency conditions at room temperature, about 22 0 C, to high stringency conditions at about 65 0 C. Both temperature and salt may be varied, or temperature or salt concentration may be held constant while the other variable is changed.
- the invention provides nucleic acids which hybridize under low stringency conditions of 6 x SSC at room temperature followed by a wash at 2 x SSC at room temperature.
- Isolated nucleic acids which differ from the nucleic acids as set forth in SEQ ID NO: 4 or 6 due to degeneracy in the genetic code are also within the scope of the invention.
- a number of amino acids are designated by more than one triplet. Codons that specify the same amino acid, or synonyms (for example, CAU and CAC are synonyms for histidine) may result in "silent" mutations which do not affect the amino acid sequence of the protein.
- CAU and CAC are synonyms for histidine
- nucleotides up to about 3-5% of the nucleotides
- nucleic acids encoding a particular protein may exist among individuals of a given species due to natural allelic variation. Any and all such nucleotide variations and resulting amino acid polymorphisms are within the scope of this invention.
- the recombinant nucleic acids of the invention may be operably linked to one or more regulatory nucleotide sequences in an expression construct. Regulatory nucleotide sequences will generally be appropriate to the host cell used for expression. Numerous types of appropriate expression vectors and suitable regulatory sequences are known in the art for a variety of host cells.
- said one or more regulatory nucleotide sequences may include, but are not limited to, promoter sequences, leader or signal sequences, ribosomal binding sites, transcriptional start and termination sequences, translational start and termination sequences, and enhancer or activator sequences. Constitutive or inducible promoters as known in the art are contemplated by the invention.
- the promoters may be either naturally occurring promoters, or hybrid promoters that combine elements of more than one promoter.
- An expression construct may be present in a cell on an episome, such as a plasmid, or the expression construct may be inserted in a chromosome.
- the expression vector contains a selectable marker gene to allow the selection of transformed host cells.
- the subject nucleic acid is provided in an expression vector comprising a nucleotide sequence encoding an ActRIIB polypeptide and operably linked to at least one regulatory sequence.
- Regulatory sequences are art-recognized and are selected to direct expression of the ActRIIB polypeptide. Accordingly, the term regulatory sequence includes promoters, enhancers, and other expression control elements. Exemplary regulatory sequences are described in Goeddel; Gene Expression Technology:
- any of a wide variety of expression control sequences that control the expression of a DNA sequence when operatively linked to it may be used in these vectors to express DNA sequences encoding an ActRIIB polypeptide.
- Such useful expression control sequences include, for example, the early and late promoters of SV40, tet promoter, adenovirus or cytomegalovirus immediate early promoter, RSV promoters, the lac system, the trp system, the TAC or TRC system, T7 promoter whose expression is directed by T7 RNA polymerase, the major operator and promoter regions of phage lambda , the control regions for fd coat protein, the promoter for 3-phosphoglycerate kinase or other glycolytic enzymes, the promoters of acid phosphatase, e.g., Pho5, the promoters of the yeast ⁇ -mating factors, the polyhedron promoter of the baculovirus system and other sequences known to control the expression of genes of prokaryotic or eukaryotic cells or their viruses, and various combinations thereof.
- a recombinant nucleic acid of the invention can be produced by ligating the cloned gene, or a portion thereof, into a vector suitable for expression in either prokaryotic cells, eukaryotic cells (yeast, avian, insect or mammalian), or both.
- Expression vehicles for production of a recombinant ActRIIB polypeptide include plasmids and other vectors.
- suitable vectors include plasmids of the types: pBR322-derived plasmids, pEMBL- derived plasmids, pEX-derived plasmids, pBTac-derived plasmids and pUC-derived plasmids for expression in prokaryotic cells, such as E. coli.
- Some mammalian expression vectors contain both prokaryotic sequences to facilitate the propagation of the vector in bacteria, and one or more eukaryotic transcription units that are expressed in eukaryotic cells.
- the pcDNAI/amp, pcDNAI/neo, pRc/CMV, pSV2gpt, pSV2neo, pSV2-dhfr, pTk2, pRSVneo, pMSG, pSVT7, pko-neo and pHyg derived vectors are examples of mammalian expression vectors suitable for trans fection of eukaryotic cells.
- vectors are modified with sequences from bacterial plasmids, such as pBR322, to facilitate replication and drug resistance selection in both prokaryotic and eukaryotic cells.
- bacterial plasmids such as pBR322
- derivatives of viruses such as the bovine papilloma virus (BPV-I), or Epstein- Barr virus (pHEBo, pREP-derived and p205) can be used for transient expression of proteins in eukaryotic cells.
- BBV-I bovine papilloma virus
- pHEBo Epstein- Barr virus
- examples of other viral (including retroviral) expression systems can be found below in the description of gene therapy delivery systems.
- the various methods employed in the preparation of the plasmids and in transformation of host organisms are well known in the art.
- baculovirus expression systems include pVL-derived vectors (such as pVL1392, pVL1393 and pVL941), pAcUW-derived vectors (such as pAcUWl), and pBlueBac-derived vectors (such as the ⁇ -gal containing pBlueBac III).
- pVL-derived vectors such as pVL1392, pVL1393 and pVL941
- pAcUW-derived vectors such as pAcUWl
- pBlueBac-derived vectors such as the ⁇ -gal containing pBlueBac III.
- a vector will be designed for production of the subject ActRIIB polypeptides in CHO cells, such as a Pcmv-Script vector (Stratagene, La Jolla, Calif), pcDNA4 vectors (Invitrogen, Carlsbad, Calif.) and pCI-neo vectors (Promega, Madison, Wise).
- a vector will be designed for production of the subject ActRIIB polypeptides in CHO cells, such as a Pcmv-Script vector (Stratagene, La Jolla, Calif), pcDNA4 vectors (Invitrogen, Carlsbad, Calif.) and pCI-neo vectors (Promega, Madison, Wise).
- the subject gene constructs can be used to cause expression of the subject ActRIIB polypeptides in cells propagated in culture, e.g., to produce proteins, including fusion proteins or variant proteins, for purification.
- This invention also pertains to a host cell transfected with a recombinant gene including a coding sequence (e.g., SEQ ID NO: 4 or 6) for one or more of the subject ActRIIB polypeptide.
- the host cell may be any prokaryotic or eukaryotic cell.
- an ActRIIB polypeptide of the invention may be expressed in bacterial cells such as E. coli, insect cells (e.g., using a baculovirus expression system), yeast, or mammalian cells. Other suitable host cells are known to those skilled in the art.
- the present invention further pertains to methods of producing the subject ActRIIB polypeptides.
- a host cell transfected with an expression vector encoding an ActRIIB polypeptide can be cultured under appropriate conditions to allow expression of the ActRIIB polypeptide to occur.
- the ActRIIB polypeptide may be secreted and isolated from a mixture of cells and medium containing the ActRIIB polypeptide.
- the ActRIIB polypeptide may be retained cytoplasmically or in a membrane fraction and the cells harvested, lysed and the protein isolated.
- a cell culture includes host cells, media and other byproducts. Suitable media for cell culture are well known in the art.
- the subject ActRIIB polypeptides can be isolated from cell culture medium, host cells, or both, using techniques known in the art for purifying proteins, including ion-exchange chromatography, gel filtration chromatography, ultrafiltration, electrophoresis, and immunoaffmity purification with antibodies specific for particular epitopes of the ActRIIB polypeptides.
- the ActRIIB polypeptide is a fusion protein containing a domain which facilitates its purification.
- a fusion gene coding for a purification leader sequence such as a poly-(His)/enterokinase cleavage site sequence at the N-terminus of the desired portion of the recombinant ActRIIB polypeptide, can allow purification of the expressed fusion protein by affinity chromatography using a Ni 2+ metal resin.
- the purification leader sequence can then be subsequently removed by treatment with enterokinase to provide the purified ActRIIB polypeptide (e.g., see Hochuli et al, (1987) J. Chromatography 411 : 177; and Janknecht et al., PNAS USA 88:8972). Techniques for making fusion genes are well known.
- the joining of various DNA fragments coding for different polypeptide sequences is performed in accordance with conventional techniques, employing blunt-ended or stagger-ended termini for ligation, restriction enzyme digestion to provide for appropriate termini, filling-in of cohesive ends as appropriate, alkaline phosphatase treatment to avoid undesirable joining, and enzymatic ligation.
- the fusion gene can be synthesized by conventional techniques including automated DNA synthesizers.
- PCR amplification of gene fragments can be carried out using anchor primers which give rise to complementary overhangs between two consecutive gene fragments which can subsequently be annealed to generate a chimeric gene sequence (see, for example, Current Protocols in Molecular Biology, eds. Ausubel et al., John Wiley & Sons: 1992).
- compositions (e.g., ActRIIB polypeptides) of the present invention can be used for treating or preventing a disease or condition that is associated with abnormal activity of an ActRIIB polypeptide and/or an ActRIIB ligand (e.g., GDF8).
- ActRIIB-associated conditions e.g., GDF8
- the present invention provides methods of treating or preventing an individual in need thereof through administering to the individual a therapeutically effective amount of an ActRIIB polypeptide as described above. These methods are particularly aimed at therapeutic and prophylactic treatments of animals, and more particularly, humans.
- a therapeutic that "prevents" a disorder or condition refers to a compound that, in a statistical sample, reduces the occurrence of the disorder or condition in the treated sample relative to an untreated control sample, or delays the onset or reduces the severity of one or more symptoms of the disorder or condition relative to the untreated control sample.
- treating includes prophylaxis of the named condition or amelioration or elimination of the condition once it has been established.
- ActRIIB/ActRIIB ligand complexes play essential roles in tissue growth as well as early developmental processes such as the correct formation of various structures or in one or more post-developmental capacities including sexual development, pituitary hormone production, and creation of bone and cartilage.
- ActRIIB-associated conditions include abnormal tissue growth and developmental defects.
- ActRIIB-associated conditions include, but are not limited to, disorders of cell growth and differentiation such as inflammation, allergy, autoimmune diseases, infectious diseases, and tumors.
- Exemplary conditions for treatment include neuromuscular disorders (e.g., muscular dystrophy and muscle atrophy), congestive obstructive pulmonary disease (and muscle wasting associated with COPD), muscle wasting syndrome, sarcopenia, cachexia, adipose tissue disorders (e.g., obesity), type 2 diabetes, and bone degenerative disease (e.g., osteoporosis).
- Other exemplary conditions include musculodegenerative and neuromuscular disorders, tissue repair (e.g., wound healing), neurodegenerative diseases (e.g., amyotrophic lateral sclerosis), immunologic disorders (e.g., disorders related to abnormal proliferation or function of lymphocytes), and obesity or disorders related to abnormal proliferation of adipocytes.
- compositions (e.g., ActRIIB-Fc polypeptides) of the invention are used as part of a treatment for a muscular dystrophy.
- muscle dystrophy refers to a group of degenerative muscle diseases characterized by gradual weakening and deterioration of skeletal muscles and sometimes the heart and respiratory muscles. Muscular dystrophies are genetic disorders characterized by progressive muscle wasting and weakness that begin with microscopic changes in the muscle. As muscles degenerate over time, the person's muscle strength declines.
- Exemplary muscular dystrophies that can be treated with a regimen including the subject ActRIIB polypeptides include: Duchenne Muscular Dystrophy (DMD), Becker Muscular Dystrophy (BMD), Emery-Dreifuss Muscular Dystrophy (EDMD), Limb-Girdle Muscular Dystrophy (LGMD), Facioscapulohumeral Muscular Dystrophy (FSH or FSHD) (also known as Landouzy- Dejerine), Myotonic Dystrophy (MMD) (also known as Steinert's Disease), Oculopharyngeal Muscular Dystrophy (OPMD), Distal Muscular Dystrophy (DD), Congenital Muscular Dystrophy (CMD).
- DMD Duchenne Muscular Dystrophy
- BMD Becker Muscular Dystrophy
- EDMD Emery-Dreifuss Muscular Dystrophy
- LGMD Limb-Girdle Muscular Dystrophy
- DMD Duchenne Muscular Dystrophy
- BMD Becker Muscular Dystrophy
- DMD is one of the most frequent inherited diseases in males, affecting one in 3,500 boys.
- DMD occurs when the dystrophin gene, located on the short arm of the X chromosome, is broken. Since males only carry one copy of the X chromosome, they only have one copy of the dystrophin gene. Without the dystrophin protein, muscle is easily damaged during cycles of contraction and relaxation. While early in the disease muscle compensates by regeneration, later on muscle progenitor cells cannot keep up with the ongoing damage and healthy muscle is replaced by non-functional fibro-fatty tissue.
- BMD results from different mutations in the dystrophin gene.
- BMD patients have some dystrophin, but it is either insufficient in quantity or poor in quality. Having some dystrophin protects the muscles of those with BMD from degenerating as badly or as quickly as those of people with DMD.
- GDF8 an ActRIIB ligand
- the subject ActRIIB polypeptides may act as GDF8 inhibitors (antagonists), and constitute an alternative means of blocking the functions of GDF8 and/or ActRIIB in vivo in DMD and BMD patients.
- GDF8 inhibitors antagonists
- This approach is confirmed and supported by the data shown herein, whereby an ActRIIB-Fc protein was shown to increase muscle mass in a mouse model of muscular dystrophy.
- the subject ActRIIB polypeptides provide an effective means to increase muscle mass in other disease conditions that are in need of muscle growth.
- ALS also called Lou Gehrig's disease (motor neuron disease) is a chronic, incurable, and unstoppable CNS disorder that attacks the motor neurons, components of the CNS that connect the brain to the skeletal muscles.
- the motor neurons deteriorate and eventually die, and though a person's brain normally remains fully functioning and alert, the command to move never reaches the muscles.
- Most people who get ALS are between 40 and 70 years old.
- the first motor neurons that weaken are those leading to the arms or legs. Those with ALS may have trouble walking, they may drop things, fall, slur their speech, and laugh or cry uncontrollably. Eventually the muscles in the limbs begin to atrophy from disuse.
- ActRIIB polypeptide-induced increased muscle mass might also benefit those 0 suffering from muscle wasting diseases.
- Gonzalez-Cadavid et al. reported that that GDF8 expression correlates inversely with fat-free mass in humans and that increased expression of the GDF8 gene is associated with weight loss in men with AIDS wasting syndrome.
- GDF8 expression correlates inversely with fat-free mass in humans and that increased expression of the GDF8 gene is associated with weight loss in men with AIDS wasting syndrome.
- the subject ActRIIB polypeptides may further be used as a therapeutic agent for slowing or preventing the development of obesity and type II diabetes. This approach is confirmed and !0 supported by the data shown herein, whereby an ActRIIB-Fc protein was shown to improve metabolic status in obese mice.
- compositions (e.g., ActRIIB polypeptides) of the invention are used as part of a treatment for metabolic syndrome (also known as syndrome X and insulin resistance syndrome), which is a combination of disorders and risk factors that !5 increase the risk of developing cardiovascular disease and diabetes mellitus type II.
- metabolic syndrome also known as syndrome X and insulin resistance syndrome
- Most patients are older, obese, sedentary, and have some degree of insulin resistance.
- Central (abdominal or visceral) adiposity is a significant feature of the syndrome.
- ActRIIB polypeptides and other compositions of the invention can be used as part of a treatment for diabetes mellitus type II (also known as non- 10 insulin-dependent diabetes mellitus or adult-onset diabetes), which is characterized by elevated blood glucose in the context of insulin resistance and relative insulin deficiency. Complex and multifactorial metabolic changes in diabetes often lead to damage and functional impairment of many organs, most importantly the cardiovascular system. Diabetes mellitus type II is often associated with obesity (abdominal or visceral adiposity), hypertension, elevated cholesterol, and metabolic syndrome. Important risk factors for diabetes mellitus type II include aging, high-fat diets, and a sedentary lifestyle.
- ActRIIB polypeptides and other compositions of the invention can be used as part of a treatment for atherosclerosis, a chronic inflammatory condition in which artery walls thicken due to the accumulation of fatty deposits, often referred to as plaques.
- Risk factors for atherosclerosis include aging, diabetes mellitus, dyslipoproteinemia, obesity (abdominal or visceral adiposity), and a sedentary lifestyle.
- ActRIIB polypeptides can also be used for lipodystrophy disorders, which tend to be associated with metabolic syndrome. Severe insulin resistance can result from both genetic and acquired forms of lipodystrophy, including in the latter case human immunodeficiency virus (H ⁇ V)-related lipodystrophy in patients treated with antiretroviral therapy.
- H ⁇ V human immunodeficiency virus
- the cancer anorexia-cachexia syndrome is among the most debilitating and life- threatening aspects of cancer. Progressive weight loss in cancer anorexia-cachexia syndrome is a common feature of many types of cancer and is responsible not only for a poor quality of life and poor response to chemotherapy, but also a shorter survival time than is found in patients with comparable tumors without weight loss. Associated with anorexia, fat and muscle tissue wasting, psychological distress, and a lower quality of life, cachexia arises from a complex interaction between the cancer and the host. It is one of the most common causes of death among cancer patients and is present in 80% at death. It is a complex example of metabolic chaos effecting protein, carbohydrate, and fat metabolism.
- anorexia-cachexia syndrome affects cytokine production, release of lipid-mobilizing and proteo lysis-inducing factors, and alterations in intermediary metabolism.
- anorexia is common, a decreased food intake alone is unable to account for the changes in body composition seen in cancer patients, and increasing nutrient intake is unable to reverse the wasting syndrome.
- Cachexia should be suspected in patients with cancer if an involuntary weight loss of greater than five percent of premorbid weight occurs within a six-month period.
- the subject ActRIIB polypeptides as pharmaceutical compositions can be beneficially used to prevent, treat, or alleviate the symptoms of the cachexia syndrome, where muscle growth is desired.
- the present invention provides methods of inducing bone and/or cartilage formation, preventing bone loss, increasing bone mineralization or preventing the demineralization of bone.
- the subject ActRIIB polypeptides and compounds identified in the present invention have application in treating osteoporosis and the healing of bone fractures and cartilage defects in humans and other animals. ActRIIB polypeptides may be useful in patients that are diagnosed with subclinical low bone density, as a protective measure against the development of osteoporosis.
- methods and compositions of the present invention may find medical utility in the healing of bone fractures and cartilage defects in humans and other animals.
- the subject methods and compositions may also have prophylactic use in closed as well as open fracture reduction and also in the improved fixation of artificial joints.
- De novo bone formation induced by an osteogenic agent contributes to the repair of congenital, trauma-induced, or oncologic resection induced craniofacial defects, and also is useful in cosmetic plastic surgery.
- methods and compositions of the invention may be used in the treatment of periodontal disease, and in other tooth repair processes.
- the subject ActRIIB polypeptides may provide an environment to attract bone-forming cells, stimulate growth of bone-forming cells or induce differentiation of progenitors of bone- forming cells.
- ActRIIB polypeptides of the invention may also be useful in the treatment of osteoporosis. Further, ActRIIB polypeptides may be used in cartilage defect repair and prevention/reversal of osteoarthritis.
- the invention provides a therapeutic method and composition for repairing fractures and other conditions related to cartilage and/or bone defects or periodontal diseases.
- the invention further provides therapeutic methods and compositions for wound healing and tissue repair.
- the types of wounds include, but are not limited to, burns, incisions and ulcers. See e.g., PCT Publication No. WO84/01106.
- Such compositions comprise a therapeutically effective amount of at least one of the ActRIIB polypeptides of the invention in admixture with a pharmaceutically acceptable vehicle, carrier or matrix.
- methods and compositions of the invention can be applied to conditions causing bone loss such as osteoporosis, hyperparathyroidism, Cushing's disease, thyrotoxicosis, chronic diarrheal state or malabsorption, renal tubular acidosis, chronic renal failure or anorexia nervosa.
- bone loss such as osteoporosis, hyperparathyroidism, Cushing's disease, thyrotoxicosis, chronic diarrheal state or malabsorption, renal tubular acidosis, chronic renal failure or anorexia nervosa.
- osteoporosis loss of bone mineral density, leading to fracture risk.
- osteoporosis can also result from the long-term use of certain medications. Osteoporosis resulting from drugs or another medical condition is known as secondary osteoporosis.
- phenytoin Dioxyribonucleic acid
- barbiturates that are used to prevent seizures
- methotrexate Renidextrin
- cyclosporine Session, Neoral
- luteinizing hormone-releasing hormone agonists Liupron, Zoladex
- heparin Calciparine, Liquaemin
- cholestyramine Questran
- colestipol colestipol
- the present invention provides compositions and methods for regulating body fat content in an animal and for treating or preventing conditions related thereto, and particularly, health-compromising conditions related thereto.
- to regulate (control) body weight can refer to reducing or increasing body weight, reducing or increasing the rate of weight gain, or increasing or reducing the rate of weight loss, and also includes actively maintaining, or not significantly changing body weight (e.g., against external or internal influences which may otherwise increase or decrease body weight).
- One embodiment of the present invention relates to regulating body weight by administering to an animal (e.g., a human) in need thereof an ActRIIB polypeptide.
- the present invention relates to methods and compounds for reducing fat mass and/or reducing gain of fat mass in an animal, and more particularly, for treating or ameliorating obesity in patients at risk for or suffering from obesity.
- the present invention is directed to methods and compounds for treating an animal that is unable to gain or retain weight (e.g., an animal with a wasting syndrome). Such methods are effective to increase body weight and/or mass, or to reduce weight and/or mass loss, or to improve conditions associated with or caused by undesirably low (e.g., unhealthy) body weight and/or mass.
- compounds (e.g., ActRIIB polypeptides) of the present invention are formulated with a pharmaceutically acceptable carrier.
- an ActRIIB polypeptide can be administered alone or as a component of a pharmaceutical formulation (therapeutic composition).
- the subject compounds may be formulated for administration in any convenient way for use in human or veterinary medicine.
- the therapeutic method of the invention includes administering the composition topically, systemically, or locally as an implant or device.
- the therapeutic composition for use in this invention is, of course, in a pyrogen- free, physiologically acceptable form.
- the composition may desirably be encapsulated or injected in a viscous form for delivery to a target tissue site (e.g., bone, cartilage, muscle, fat or neurons), for example, a site having a tissue damage.
- Topical administration may be suitable for wound healing and tissue repair.
- Therapeutically useful agents other than the ActRIIB polypeptides which may also optionally be included in the composition as described above, may alternatively or additionally, be administered simultaneously or sequentially with the subject compounds (e.g., ActRIIB polypeptides) in the methods of the invention.
- compositions of the present invention may include a matrix capable of delivering one or more therapeutic compounds (e.g., ActRIIB polypeptides) to a target tissue site, providing a structure for the developing tissue and optimally capable of being resorbed into the body.
- the matrix may provide slow release of the ActRIIB polypeptides.
- Such matrices may be formed of materials presently in use for other implanted medical applications.
- matrix material is based on biocompatibility, biodegradability, mechanical properties, cosmetic appearance and interface properties.
- Potential matrices for the compositions may be biodegradable and chemically defined calcium sulfate, tricalciumphosphate, hydroxyapatite, polylactic acid and polyanhydrides.
- Other potential materials are biodegradable and biologically well defined, such as bone or dermal collagen.
- Further matrices are comprised of pure proteins or extracellular matrix components.
- Other potential matrices are non-biodegradable and chemically defined, such as sintered hydroxyapatite, bioglass, aluminates, or other ceramics.
- Matrices may be comprised of combinations of any of the above mentioned types of material, such as polylactic acid and hydroxyapatite or collagen and tricalciumphosphate.
- the bioceramics may be altered in composition, such as in calcium-aluminate -phosphate and processing to alter pore size, particle size, particle shape, and biodegradability.
- methods of the invention can be administered for orally, e.g., in the form of capsules, cachets, pills, tablets, lozenges (using a flavored basis, usually sucrose and acacia or tragacanth), powders, granules, or as a solution or a suspension in an aqueous or non-aqueous liquid, or as an oil-in- water or water-in-oil liquid emulsion, or as an elixir or syrup, or as pastilles (using an inert base, such as gelatin and glycerin, or sucrose and acacia) and/or as mouth washes and the like, each containing a predetermined amount of an agent as an active ingredient.
- An agent may also be administered as a bolus, electuary or paste.
- one or more therapeutic compounds of the present invention may be mixed with one or more pharmaceutically acceptable carriers, such as sodium citrate or dicalcium phosphate, and/or any of the following: (1) fillers or extenders, such as starches, lactose, sucrose, glucose, mannitol, and/or silicic acid; (2) binders, such as, for example, carboxymethylcellulose, alginates, gelatin, polyvinyl pyrrolidone, sucrose, and/or acacia; (3) humectants, such as glycerol; (4) disintegrating agents, such as agar-agar, calcium carbonate, potato or tapioca starch, alginic acid, certain silicates, and sodium carbonate; (5) solution retarding agents, such as paraffin; (6) absorption accelerators, such as quaternary ammonium compounds; (7) wetting agents, such as
- compositions may also comprise buffering agents.
- Solid compositions of a similar type may also be employed as fillers in soft and hard- filled gelatin capsules using such excipients as lactose or milk sugars, as well as high molecular weight polyethylene glycols and the like.
- Liquid dosage forms for oral administration include pharmaceutically acceptable emulsions, microemulsions, solutions, suspensions, syrups, and elixirs.
- the liquid dosage forms may contain inert diluents commonly used in the art, such as water or other solvents, solubilizing agents and emulsifiers, such as ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, 1,3-butylene glycol, oils (in particular, cottonseed, groundnut, corn, germ, olive, castor, and sesame oils), glycerol, tetrahydrofuryl alcohol, polyethylene glycols and fatty acid esters of sorbitan, and mixtures thereof.
- the oral compositions can also include adjuvants such as wetting agents, emulsifying and suspending agents,
- Suspensions in addition to the active compounds, may contain suspending agents such as ethoxylated isostearyl alcohols, polyoxyethylene sorbitol, and sorbitan esters, microcrystalline cellulose, aluminum metahydroxide, bentonite, agar-agar and tragacanth, and mixtures thereof.
- suspending agents such as ethoxylated isostearyl alcohols, polyoxyethylene sorbitol, and sorbitan esters, microcrystalline cellulose, aluminum metahydroxide, bentonite, agar-agar and tragacanth, and mixtures thereof.
- compositions disclosed herein may be administered topically, either to skin or to mucosal membranes.
- the topical formulations may further include one or more of the wide variety of agents known to be effective as skin or stratum corneum penetration enhancers. Examples of these are 2-pyrrolidone, N-methyl-2-pyrrolidone, dimethylacetamide, dimethylformamide, propylene glycol, methyl or isopropyl alcohol, dimethyl sulfoxide, and azone. Additional agents may further be included to make the formulation cosmetically acceptable. Examples of these are fats, waxes, oils, dyes, fragrances, preservatives, stabilizers, and surface active agents. Keratolytic agents such as those known in the art may also be included. Examples are salicylic acid and sulfur.
- Dosage forms for the topical or transdermal administration include powders, sprays, ointments, pastes, creams, lotions, gels, solutions, patches, and inhalants.
- the active compound may be mixed under sterile conditions with a pharmaceutically acceptable carrier, and with any preservatives, buffers, or propellants which may be required.
- the ointments, pastes, creams and gels may contain, in addition to a subject compound of the invention (e.g., an ActRIIB polypeptide), excipients, such as animal and vegetable fats, oils, waxes, paraffins, starch, tragacanth, cellulose derivatives, polyethylene glycols, silicones, bentonites, silicic acid, talc and zinc oxide, or mixtures thereof.
- excipients such as animal and vegetable fats, oils, waxes, paraffins, starch, tragacanth, cellulose derivatives, polyethylene glycols, silicones, bentonites, silicic acid, talc and zinc oxide, or mixtures thereof.
- Powders and sprays can contain, in addition to a subject compound, excipients such as lactose, talc, silicic acid, aluminum hydroxide, calcium silicates, and polyamide powder, or mixtures of these substances.
- Sprays can additionally contain customary propellants, such as chlorofluorohydrocarbons and volatile unsubstituted hydrocarbons, such as butane and propane.
- compositions suitable for parenteral administration may comprise one or more ActRIIB polypeptides in combination with one or more pharmaceutically acceptable sterile isotonic aqueous or nonaqueous solutions, dispersions, suspensions or emulsions, or sterile powders which may be reconstituted into sterile injectable solutions or dispersions just prior to use, which may contain antioxidants, buffers, bacteriostats, solutes which render the formulation isotonic with the blood of the intended recipient or suspending or thickening agents.
- aqueous and nonaqueous carriers examples include water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as ethyl oleate.
- polyols such as glycerol, propylene glycol, polyethylene glycol, and the like
- vegetable oils such as olive oil
- injectable organic esters such as ethyl oleate.
- Proper fluidity can be maintained, for example, by the use of coating materials, such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants.
- the compositions of the invention may also contain adjuvants, such as preservatives, wetting agents, emulsifying agents and dispersing agents.
- microorganisms Prevention of the action of microorganisms may be ensured by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutanol, phenol sorbic acid, and the like. It may also be desirable to include isotonic agents, such as sugars, sodium chloride, and the like into the compositions. In addition, prolonged absorption of the injectable pharmaceutical form may be brought about by the inclusion of agents which delay absorption, such as aluminum monostearate and gelatin. It is understood that the dosage regimen will be determined by the attending physician considering various factors which modify the action of the subject compounds of the invention (e.g., ActRIIB polypeptides). The various factors will depend upon the disease to be treated.
- various antibacterial and antifungal agents for example, paraben, chlorobutanol, phenol sorbic acid, and the like. It may also be desirable to include isotonic agents, such as sugars, sodium chloride, and the like into the compositions. In addition, prolonged absorption of the injectable
- the present invention also provides gene therapy for the in vivo production of ActRIIB polypeptides or other compounds disclosed herein. Such therapy would achieve its therapeutic effect by introduction of the ActRIIB polynucleotide sequences into cells or tissues having the disorders as listed above. Delivery of ActRIIB polynucleotide sequences can be achieved using a recombinant expression vector such as a chimeric virus or a colloidal dispersion system. Preferred for therapeutic delivery of ActRIIB polynucleotide sequences is the use of targeted liposomes.
- RNA virus such as a retrovirus
- retroviral vector is a derivative of a murine or avian retrovirus.
- retroviral vectors in which a single foreign gene can be inserted include, but are not limited to: Moloney murine leukemia virus (MoMuLV), Harvey murine sarcoma virus (HaMuSV), murine mammary tumor virus (MuMTV), and Rous Sarcoma Virus (RSV).
- MoMuLV Moloney murine leukemia virus
- HaMuSV Harvey murine sarcoma virus
- MuMTV murine mammary tumor virus
- RSV Rous Sarcoma Virus
- Retroviral vectors can be made target-specific by attaching, for example, a sugar, a glycolipid, or a protein. Preferred targeting is accomplished by using an antibody.
- specific polynucleotide sequences can be inserted into the retroviral genome or attached to a viral envelope to allow target specific delivery of the retroviral vector containing the ActRIIB polynucleotide.
- the vector is targeted to bone, cartilage, muscle or neuron cells/tissues.
- tissue culture cells can be directly transfected with plasmids encoding the retroviral structural genes gag, pol and env, by conventional calcium phosphate transfection. These cells are then transfected with the vector plasmid containing the genes of interest. The resulting cells release the retroviral vector into the culture medium.
- Another targeted delivery system for ActRIIB polynucleotides is a colloidal dispersion system. Colloidal dispersion systems include macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes. The preferred colloidal system of this invention is a liposome.
- Liposomes are artificial membrane vesicles which are useful as delivery vehicles in vitro and in vivo.
- RNA, DNA and intact virions can be encapsulated within the aqueous interior and be delivered to cells in a biologically active form (see e.g., Fraley, et al., Trends
- the composition of the liposome is usually a combination of phospholipids, usually in combination with steroids, especially cholesterol. Other phospholipids or other lipids may also be used.
- the physical characteristics of liposomes depend on pH, ionic strength, and the presence of divalent
- lipids useful in liposome production include phosphatidyl compounds, such as phosphatidylglycerol, phosphatidylcholine, phosphatidylserine, phosphatidylethanolamine, sphingolipids, cerebrosides, and gangliosides.
- Illustrative phospholipids include egg phosphatidylcholine, dipalmitoylphosphatidylcholine, and 5 distearoylphosphatidylcholine.
- the targeting of liposomes is also possible based on, for example, organ-specificity, cell-specificity, and organelle-specificity and is known in the art.
- VSLTCLVKGF YPSDIAVEWE SNGQPENNYK TTPPVLDSDG SFFLYSKLTV
- DKSRWQQGNV FSCSVMHEAL HNHYTQKSLS LSPGK Amino acids 1-107 are derived from ActRIIB.
- the expressed molecule was purified using a series of column chromatography steps, including for example, three or more of the following, in any order: Protein A chromatography, Q sepharose chromatography, phenylsepharose chromatography, size exclusion chromatography and cation exchange chromatography.
- the purification could be completed with viral filtration and buffer exchange.
- ActRIIB(25-131)-hFc can be used to improve body composition in vivo under a variety of conditions, including androgen deprivation and high fat intake.
- Example 6 ActRIIB(25-131)-hFc Normalizes Serum Lipids, Insulin, and Adiponectin in Mouse Model of Diet-Induced Obesity Applicants investigated the effects of ActRIIB(25- 131 )-hFc on serum concentrations of clinically important lipids, insulin, adiponectin, and on other metabolic endpoints in male mice fed a high-fat diet.
- ActRIIB(25-131)-hFc treatment caused a constellation of noteworthy metabolic effects.
- ActRIIB(25-13 l)-hFc reduced the pathologically elevated serum concentrations of triglycerides, free fatty acids, high-density lipoprotein (HDL), and low-density lipoprotein (LDL) (Figure 10-13), in most cases normalizing these parameters to levels observed in mice fed a standard diet.
- ActRIIB(25-13 l)-hFc treatment also normalized insulin concentrations in high-fat-diet mice ( Figure 14) and increased concentrations of adiponectin significantly above even those in mice fed a standard diet ( Figure 15).
- Adiponectin is a key biomarker of body composition, as circulating adiponectin levels are known to vary inversely with fat mass/obesity, and adiponectin enhances insulin sensitivity in target tissues. ActRIIB(25-13 l)-hFc also reduced serum concentrations of leptin, another major indicator of adipocyte status, by nearly 50% (P ⁇ 0.05). Finally, the aforementioned effects were accompanied by beneficial changes in body composition, as determined by nuclear magnetic resonance (NMR) at baseline and Day 48. Under high- fat dietary conditions, total fat mass in vehicle-treated controls tripled during this 48-day period, and ActRIIB(25-13 l)-hFc treatment cut this increase by nearly 40%.
- NMR nuclear magnetic resonance
- ActRIIB(25-131)-hFc consistently outperformed ActRIIB(20-134)-hFc, which was also evaluated in this same study.
- ActRIIB(25-131)- hFc improved triglyceride levels nearly 6 times as much, FFA levels nearly twice as much, HDL levels nearly 4 times as much, insulin levels more than twice as much, and adiponectin levels nearly 1.5 times as much as ActRIIB(20-134)-hFc did at the same dose.
- Example 7 ActRIIB(25-13 l)-hFc Induces Thermogenic Properties in White Fat in Mouse Model of Diet-Induced Obesity
- sirtuin SIRT-I sirtuin information regulator two, homo log 1
- an energy-sensitive master regulator deacetylase
- ActRIIB(25-131)-hFc treatment also increased levels of mRNA encoding PGC- l ⁇ (peroxisome proliferator-activated receptor gamma coactivator- l ⁇ ), a well-documented target of SIRT-I that, in turn, controls expression of many genes necessary for mitochondrial biogenesis and thermogenic capability in brown adiopose tissue
- ActRIIB(25-131)-hFc increased levels of mRNA encoding Foxo-1 (forkhead box-containing, protein O subfamily- 1), a transcription factor that
- Nonalcoholic fatty liver disease is a spectrum of increasingly common hepatic disorders widely considered to be the hepatic manifestation of metabolic syndrome and characterized by fat accumulation in the liver (steatosis), often with deleterious effects. 10
- a subset of NAFLD patients develop an inflammatory condition referred to as nonalcoholic steatohepatitis (NASH), which can progress further to hepatic fibrosis, cirrhosis, and hepatocellular carcinoma (Perlemuter et al., 2007, Nat Clin Pract Endocrinol Metab 3:458- 469).
- ActRIIB(25-131)-hFc treatment also increased muscle mass in this model of diet- induced obesity, consistent with findings in other models (Examples 3-5). Specifically, ActRIIB(25-131)-hFc increased pectoralis mass by more than 70% (P ⁇ 0.001), gastrocnemius mass by nearly 40% (P ⁇ 0.001), and rectus femoris mass by more than 25% (P ⁇ 0.001) compared to high-fat diet controls. These changes in muscle mass were accompanied by changes in muscle gene expression, as determined in gastrocnemius tissue by RT-PCR. Compared to high-fat diet controls, ActRIIB(25-13 l)-hFc increased PGC-l ⁇ mRNA levels and Foxo-1 mRNA levels by approximately 50% each (P ⁇ 0.05) in gastrocnemius.
- NMR nuclear magnetic resonance
- Visceral fat and abdominal subcutaneous fat both varied markedly in size with diet and ActRIIB(25-13 l)-mFc treatment.
- Three-dimensional reconstruction of microCT images obtained partway through the study (35 days) demonstrates that the depots of visceral fat and subcutaneous fat both expanded as a result of the high-fat diet and that ActRIIB(25-131)-mFc largely reversed those increases ( Figure 20).
- ActRIIB(25-131)-mFc When analyzed quantitatively at study conclusion (60 days), the effect of ActRIIB(25-131)-mFc compared to high-fat diet alone was highly significant for both visceral fat (Figure 21) and abdominal subcutaneous fat (Figure 22).
- Body composition changes with aging in a predictable manner. Normal age-dependent decline in muscle mass and strength, known as sarcopenia, begins around age 30 and accelerates after age 60 (Stenholm et al, 2008, Curr Opin Clin Nutr Metab Care 11 :693- 700). Bone mass and strength exhibit a similar decline with age, leading to an increased risk
- mice 5 C57BL/6 mice were given unlimited access to a standard chow diet and treated with
- median life expectancy in this mouse strain was previously found to be approximately 27 months under standard dietary condtions (Turturro et al., 2002, J Gerontol A Biol Sci Med Sci 57:B379-389).
- ActRIIB(25-13 l)-mFc treatment generated a series of notable changes in body composition and metabolic hormone effects in these aged mice. As determined by whole-body NMR analysis, lean tissue mass was essentially unchanged in control mice over the course of the study, whereas in ActRIIB(24-131)-mFc-treated mice it increased progressively to almost 20% above baseline by 7 weeks (Figure 26). Consistent with this whole-body effect,
- ActRIIB(25-13 l)-mFc also significantly increased the mass of individual muscle groups, including the pectoralis (increased 55%), rectus femoris (40%), triceps (40%), and gastrocnemius (28%), compared to vehicle-treated controls at 8 weeks.
- ActRIIB(25-131)-mFc treatment improved neuromuscular function, as determined by forelimb grip strength testing according to an established protocol
- ActRIIB(25-13 l)-mFc treatment also reduced the mass of the interscapular brown fat depots by nearly 45% (P ⁇ 0.05), similar to results obtained for this tissue in the mouse model of dietary obesity (Example 10).
- ActRIIB(25-131)-mFc reduced the volume of the visceral component of abdominal fat by 65% (P ⁇ 0.01) and the subcutaneous component of abdominal fat by 49% (P ⁇ 0.01).
- the critical visceral fat compartment was strongly targeted by ActRIIB(25-131)-mFc in this model of aging.
- ActRIIB(25-13 l)-mFc also produced beneficial changes in important metabolic hormones in aged mice. Eight weeks of treatment with ActRIIB(25-13 l)-mFc nearly doubled circulating adiponectin concentrations (P ⁇ 0.001) and reduced circulating insulin concentrations by more than 40% (Figure 30).
- An elevated fasting insulin concentration (hyperinsulinemia) is a widely accepted surrogate measure of insulin resistance (Weyer et al., 2000, Diabetes 49:2094-2101), and increased adiponectin concentrations are likely contributing to improved insulin sensitivity in the present study.
- Cachexia is undesired weight loss resulting from loss of muscle and adipose tissue. Many tumors are associated with loss of appetite and severe muscle loss, and patients
- mice treated with ActRIIB(25-13 l)-hFc exhibited a 27% increase in lean mass from baseline ( Figure 32). Fat mass did not differ significantly between the groups.
- ActRIIB(25-13 l)-hFc fusion protein can be used as an antagonist of signaling by TGF-family ligands to reverse many pathological metabolic changes associated with diet-induced obesity, and thereby, to treat metabolic conditions exacerbated by high caloric intake.
- ActRIIB(25-131)-hFc can be used to treat pathologic metabolic changes associated with aging or cancer cachexia.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Medicinal Chemistry (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Genetics & Genomics (AREA)
- Zoology (AREA)
- Diabetes (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Wood Science & Technology (AREA)
- Biomedical Technology (AREA)
- Physical Education & Sports Medicine (AREA)
- Gastroenterology & Hepatology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Obesity (AREA)
- Hematology (AREA)
- Biophysics (AREA)
- Toxicology (AREA)
- General Engineering & Computer Science (AREA)
- Biotechnology (AREA)
- Immunology (AREA)
- Endocrinology (AREA)
- Neurology (AREA)
- Rheumatology (AREA)
- Microbiology (AREA)
- Cell Biology (AREA)
- Heart & Thoracic Surgery (AREA)
- Neurosurgery (AREA)
Priority Applications (21)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP2012515067A JP2012529294A (ja) | 2009-06-12 | 2010-06-08 | 切断型ActRIIB−Fc融合タンパク質 |
| CA2765108A CA2765108C (en) | 2009-06-12 | 2010-06-08 | Truncated actriib-fc fusion proteins |
| KR1020217036389A KR20210136174A (ko) | 2009-06-12 | 2010-06-08 | 절두된 ActRIIB-FC 융합 단백질 |
| BRPI1010704-5A BRPI1010704B1 (pt) | 2009-06-12 | 2010-06-08 | Polipeptídeo recombinante, proteína de fusão recombinante, preparação farmacêutica e uso da mesma |
| BR122021017187-4A BR122021017187B1 (pt) | 2009-06-12 | 2010-06-08 | Ácido nucléico e polipeptídeo recombinante, preparação farmacêutica compreendendo o dito polipeptídeo e usos terapêuticos da mesma |
| EP10792510A EP2440577A4 (en) | 2009-06-12 | 2010-06-08 | SHORTEN ACTRIIB FC FUSION PROTEINS |
| KR1020217008368A KR20210034684A (ko) | 2009-06-12 | 2010-06-08 | 절두된 ActRIIB-FC 융합 단백질 |
| EP20193499.9A EP3805259A1 (en) | 2009-06-12 | 2010-06-08 | Truncated actriib-fc fusion proteins |
| MX2011013364A MX2011013364A (es) | 2009-06-12 | 2010-06-08 | Proteinas de fusion actriib-fc truncadas. |
| EP17166621.7A EP3290439B1 (en) | 2009-06-12 | 2010-06-08 | Truncated actriib-fc fusion proteins |
| MX2017012938A MX387164B (es) | 2009-06-12 | 2010-06-08 | Proteínas de fusión actriib-fc truncadas. |
| AU2010263182A AU2010263182B2 (en) | 2009-06-12 | 2010-06-08 | Truncated ActRIIB-Fc fusion proteins |
| CN2010800359601A CN102656187A (zh) | 2009-06-12 | 2010-06-08 | 截短的actriib-fc融合蛋白 |
| MX2015011708A MX351286B (es) | 2009-06-12 | 2010-06-08 | Proteinas de fusion actriib-fc truncadas. |
| KR1020187005897A KR20180026795A (ko) | 2009-06-12 | 2010-06-08 | 절두된 ActRIIB-FC 융합 단백질 |
| KR1020197021378A KR20190090049A (ko) | 2009-06-12 | 2010-06-08 | 절두된 ActRIIB-FC 융합 단백질 |
| IL216861A IL216861A (en) | 2009-06-12 | 2011-12-08 | Nucleic Acids Encoded by Activin Binding Polypeptides, gdf8 or gdf11 |
| AU2016213725A AU2016213725B2 (en) | 2009-06-12 | 2016-08-09 | Truncated ActRIIB-FC fusion proteins |
| IL252450A IL252450B (en) | 2009-06-12 | 2017-05-23 | Actriib–fc truncated fusion proteins |
| IL275846A IL275846A (en) | 2009-06-12 | 2020-07-05 | ACTRIIB–FC truncated fusion proteins |
| CY20201101127T CY1123580T1 (el) | 2009-06-12 | 2020-11-26 | Συντετμημενες πρωτεϊνες συγχωνευσης actriib-fc |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US26842009P | 2009-06-12 | 2009-06-12 | |
| US61/268,420 | 2009-06-12 | ||
| US28054309P | 2009-11-03 | 2009-11-03 | |
| US61/280,543 | 2009-11-03 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2010151426A1 true WO2010151426A1 (en) | 2010-12-29 |
Family
ID=43306633
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2010/037787 Ceased WO2010151426A1 (en) | 2009-06-12 | 2010-06-08 | Truncated actriib-fc fusion proteins |
Country Status (15)
| Country | Link |
|---|---|
| US (6) | US8293881B2 (enExample) |
| EP (3) | EP2440577A4 (enExample) |
| JP (5) | JP2012529294A (enExample) |
| KR (5) | KR20210136174A (enExample) |
| CN (3) | CN104805105A (enExample) |
| AU (5) | AU2010263182B2 (enExample) |
| BR (2) | BR122021017187B1 (enExample) |
| CA (1) | CA2765108C (enExample) |
| CO (1) | CO6491031A2 (enExample) |
| CY (1) | CY1123580T1 (enExample) |
| ES (1) | ES2836534T3 (enExample) |
| HK (2) | HK1213013A1 (enExample) |
| IL (3) | IL216861A (enExample) |
| MX (3) | MX387164B (enExample) |
| WO (1) | WO2010151426A1 (enExample) |
Cited By (39)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2011068993A1 (en) * | 2009-12-02 | 2011-06-09 | Acceleron Pharma Inc. | Compositions and methods for increasing serum half-life of fc fusion proteins. |
| WO2012170938A1 (en) * | 2011-06-08 | 2012-12-13 | Acceleron Pharma Inc. | Compositions and methods for increasing serum half-life |
| EP2475427A4 (en) * | 2009-09-09 | 2013-06-26 | Acceleron Pharma Inc | ACTRIIB ANTAGONISTS, THEIR DOSAGE AND APPLICATIONS THEREOF |
| US8486403B2 (en) | 2005-11-23 | 2013-07-16 | Acceleron Pharma, Inc. | Method of promoting bone growth by an anti-activin A antibody |
| US8629109B2 (en) | 2005-11-23 | 2014-01-14 | Acceleron Pharma Inc. | Method for promoting bone growth using activin-actriia antagonists |
| US8703927B2 (en) | 2008-08-14 | 2014-04-22 | Acceleron Pharma Inc. | Isolated nucleotide sequences encoding GDF traps |
| US8703694B2 (en) | 2009-06-08 | 2014-04-22 | Acceleron Pharma, Inc. | Methods for increasing thermogenic adipocytes |
| US8710016B2 (en) | 2009-11-17 | 2014-04-29 | Acceleron Pharma, Inc. | ActRIIB proteins and variants and uses therefore relating to utrophin induction for muscular dystrophy therapy |
| US8765663B2 (en) | 2009-01-13 | 2014-07-01 | Acceleron Pharma Inc. | Methods for increasing adiponectin |
| US8895016B2 (en) | 2006-12-18 | 2014-11-25 | Acceleron Pharma, Inc. | Antagonists of activin-actriia and uses for increasing red blood cell levels |
| US9138459B2 (en) | 2004-07-23 | 2015-09-22 | Acceleron Pharma Inc. | ACTRIIB-FC polynucleotides, polypeptides, and compositions |
| US9181533B2 (en) | 2009-06-12 | 2015-11-10 | Acceleron Pharma, Inc. | Truncated ACTRIIB-FC fusion protein |
| US9353356B2 (en) | 2007-09-18 | 2016-05-31 | Acceleron Pharma Inc. | Activin-actriia antagonists for treating a follicle-stimulating horomone-secreting pituitary tumor |
| US9399669B2 (en) | 2007-02-02 | 2016-07-26 | Acceleron Pharma Inc. | Variants derived from ActRIIB |
| WO2016164497A1 (en) | 2015-04-06 | 2016-10-13 | Acceleron Pharma Inc. | Alk4:actriib heteromultimers and uses thereof |
| WO2016164089A2 (en) | 2015-04-06 | 2016-10-13 | Acceleron Pharma Inc. | Tgf-beta superfamily type i and type ii receptor heteromultimers and uses thereof |
| AU2010315245B2 (en) * | 2009-11-03 | 2016-11-03 | Acceleron Pharma Inc. | Methods for treating fatty liver disease |
| US9493556B2 (en) | 2010-11-08 | 2016-11-15 | Acceleron Pharma Inc. | Actriia binding agents and uses thereof |
| US9505813B2 (en) | 2008-08-14 | 2016-11-29 | Acceleron Pharma Inc. | Use of GDF traps to treat anemia |
| US9526759B2 (en) | 2007-02-01 | 2016-12-27 | Acceleron Pharma Inc. | Activin-actriia antagonists and uses for treating or preventing breast cancer |
| US9572865B2 (en) | 2005-11-23 | 2017-02-21 | Acceleron Pharma Inc. | Activin-actriia antagonists and uses for treating multiple myeloma |
| WO2017177013A1 (en) | 2016-04-06 | 2017-10-12 | Acceleron Pharma Inc. | Alk7 antagonists and uses thereof |
| US9850298B2 (en) | 2014-06-13 | 2017-12-26 | Acceleron Pharma Inc. | Methods for treating ulcers in thalassemia syndrome with an ActRIIB polypeptide |
| WO2018013936A1 (en) | 2016-07-15 | 2018-01-18 | Acceleron Pharma Inc. | Compositions and methods for treating pulmonary hypertension |
| WO2018067874A1 (en) | 2016-10-05 | 2018-04-12 | Acceleron Pharma Inc. | Variant actriib proteins and uses thereof |
| EP3351260A1 (en) | 2012-04-06 | 2018-07-25 | Acceleron Pharma Inc. | Methods and compositions for increasing red blood cells |
| JP2018168176A (ja) * | 2012-11-02 | 2018-11-01 | セルジーン コーポレイション | アクチビン−ActRIIアンタゴニスト並びに骨障害及び他の障害の治療に対する使用 |
| US10548976B2 (en) | 2015-05-20 | 2020-02-04 | Celgene Corporation | In vitro cell culture methods for beta-thalassemia using activin type II receptor ligand traps |
| US10934532B2 (en) | 2016-10-05 | 2021-03-02 | Acceleron Pharma Inc. | ALK4.ActRIIB heteromultimers |
| US11013785B2 (en) | 2016-11-10 | 2021-05-25 | Keros Therapeutics, Inc. | Activin receptor type IIA variants and methods of use thereof |
| EP4026556A1 (en) | 2016-10-05 | 2022-07-13 | Acceleron Pharma Inc. | Compositions and method for treating kidney disease |
| US11471510B2 (en) | 2014-12-03 | 2022-10-18 | Celgene Corporation | Activin-ActRII antagonists and uses for treating anemia |
| US11484573B2 (en) | 2017-11-09 | 2022-11-01 | Keros Therapeutics, Inc. | Activin receptor type IIa variants and methods of use thereof |
| US11813308B2 (en) | 2014-10-09 | 2023-11-14 | Celgene Corporation | Treatment of cardiovascular disease using ActRII ligand traps |
| US11884715B2 (en) | 2018-01-12 | 2024-01-30 | Keros Therapeutics, Inc. | Activin receptor type IIB variants and methods of use thereof |
| US12186370B1 (en) | 2020-11-05 | 2025-01-07 | Celgene Corporation | ACTRIIB ligand trap compositions and uses thereof |
| US12338273B2 (en) | 2015-04-06 | 2025-06-24 | Accerelon Pharma Inc. | Single-arm type I and type II receptor fusion proteins and uses thereof |
| US12364737B2 (en) | 2018-05-09 | 2025-07-22 | Keros Therapeutics, Inc. | Activin receptor type IIA variants and methods of use thereof |
| US12440539B2 (en) | 2020-03-20 | 2025-10-14 | Keros Therapeutics, Inc. | Methods of using activin receptor type IIB variants |
Families Citing this family (14)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20110104133A1 (en) * | 2008-05-06 | 2011-05-05 | Joslin Diabetes Center, Inc. | Methods and compositions for inducing brown adipogenesis |
| CA2729096C (en) * | 2008-06-26 | 2020-04-28 | Acceleron Pharma Inc. | Methods for dosing an actriib antagonist and monitoring of treated patients |
| PT3286206T (pt) | 2015-04-22 | 2021-04-01 | Biogen Ma Inc | Novas proteínas híbridas bloqueadoras de ligando actriib para tratar doenças de desgaste muscular |
| US11185569B2 (en) | 2016-05-04 | 2021-11-30 | University Of Cincinnati | ActRIIB:Fc to treat infertility in females |
| JOP20190085A1 (ar) | 2016-10-20 | 2019-04-17 | Biogen Ma Inc | طرق علاج الضمور العضلي ومرض العظام باستخدام بروتينات احتجاز مركب ترابطي actriib هجين حديثة |
| GB201620119D0 (en) | 2016-11-29 | 2017-01-11 | Pharmafox Therapeutics Ag | Compounds |
| JOP20190152A1 (ar) * | 2016-12-21 | 2019-06-20 | Novartis Ag | مضادات الميوستاتين، الآكتيفين أو مستقبلات الآكتيفين للاستخدام في علاج السمنة والحالات ذات الصلة |
| CN107011430B (zh) * | 2017-04-07 | 2020-09-01 | 哈尔滨医科大学 | 一种具有生物学活性的截短的生长分化因子11及其制备方法 |
| EP3641780B1 (en) | 2017-06-20 | 2025-09-10 | Corcept Therapeutics Incorporated | Treatment of neuroepithelial tumors using selective glucocorticoid receptor modulators |
| GB201821269D0 (en) * | 2018-12-28 | 2019-02-13 | Nippon Shinyaku Co Ltd | Myostatin signal inhibitor |
| CN114761013A (zh) | 2019-09-27 | 2022-07-15 | 迪斯克医药公司 | 治疗骨髓纤维化和相关病症的方法 |
| CN110590961B (zh) * | 2019-10-08 | 2020-12-08 | 徐州医科大学 | 一种具有抗癌作用的多肽及其应用 |
| KR20230012539A (ko) | 2020-05-13 | 2023-01-26 | 디스크 메디슨, 인크. | 골수섬유증을 치료하기 위한 항-헤모주벨린 (hjv) 항체 |
| WO2022146837A1 (en) * | 2020-12-28 | 2022-07-07 | Chan Zuckerberg Biohub, Inc. | Autoantibodies as biomarkers for lipodystrophy |
Citations (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20010039036A1 (en) * | 1991-05-10 | 2001-11-08 | The Salk Institute For Biological Studies. | Cloning and recombinant production of receptor(s) of the activin/TGF-beta superfamily |
| WO2006012627A2 (en) * | 2004-07-23 | 2006-02-02 | Acceleron Pharma Inc. | Actrii receptor polypeptides, methods and compositions |
| WO2006020884A2 (en) * | 2004-08-12 | 2006-02-23 | Wyeth | Combination therapy for diabetes, obesity, and cardiovascular diseases using gdf-8 inhibitors |
| WO2008076437A2 (en) * | 2006-12-18 | 2008-06-26 | Acceleron Pharma Inc. | Activin-actrii antagonists and uses for increasing red blood cell levels |
| WO2008097541A2 (en) * | 2007-02-02 | 2008-08-14 | Acceleron Pharma Inc. | Variants derived from actriib and uses therefor |
| WO2008109167A2 (en) * | 2007-03-06 | 2008-09-12 | Amgen Inc. | Variant activin receptor polypeptides and uses thereof |
| WO2008151078A1 (en) * | 2007-06-01 | 2008-12-11 | Wyeth | Methods and compositions for modulating bmp-10 activity |
| US20100068215A1 (en) * | 2008-08-14 | 2010-03-18 | Acceleron Pharma Inc. | Use of GDF traps to increase red blood cell levels |
| US20100183624A1 (en) * | 2009-01-13 | 2010-07-22 | Jasbir Seehra | Methods for increasing adiponectin |
Family Cites Families (186)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP0105014B1 (en) | 1982-09-24 | 1992-05-20 | THE UNITED STATES OF AMERICA as represented by the Secretary United States Department of Commerce | Repair of tissue in animals |
| JPH0637520B2 (ja) | 1985-07-03 | 1994-05-18 | 味の素株式会社 | ポリペプチド |
| WO1987005330A1 (en) | 1986-03-07 | 1987-09-11 | Michel Louis Eugene Bergh | Method for enhancing glycoprotein stability |
| US4973577A (en) | 1986-04-04 | 1990-11-27 | The Salk Institute For Biological Studies | FSH-releasing peptides |
| AU8761391A (en) | 1990-09-13 | 1992-04-15 | Children's Hospital Medical Center Of Northern California | Method for increasing red blood cell production by treatment with activin or activin-related peptides |
| US5118667A (en) | 1991-05-03 | 1992-06-02 | Celtrix Pharmaceuticals, Inc. | Bone growth factors and inhibitors of bone resorption for promoting bone formation |
| US20050186593A1 (en) | 1991-05-10 | 2005-08-25 | The Salk Institute For Biological Studies | Cloning and recombinant production of CRF receptor(s) |
| US5885794A (en) | 1991-05-10 | 1999-03-23 | The Salk Institute For Biological Studies | Recombinant production of vertebrate activin receptor polypeptides and identification of receptor DNAs in the activin/TGF-β superfamily |
| CA2086327A1 (en) | 1991-05-10 | 1992-11-11 | Lawrence S. Mathews | Cloning and recombinant production of receptor(s) of the activin/tgf- .beta. superfamily |
| US6287816B1 (en) | 1991-06-25 | 2001-09-11 | Genetics Institute, Inc. | BMP-9 compositions |
| KR100255415B1 (ko) | 1991-06-25 | 2000-05-01 | 브루스 엠. 에이센 | 비엠피-9 조성물 |
| US6692925B1 (en) | 1992-11-17 | 2004-02-17 | Ludwig Institute For Cancer Research | Proteins having serine/threonine kinase domains, corresponding nucleic acid molecules, and their use |
| EP0679163A4 (en) | 1993-01-12 | 1997-07-16 | Univ Johns Hopkins Med | GROWTH DIFFERENTIATION FACTOR-3. |
| US5637480A (en) | 1993-05-12 | 1997-06-10 | Genetics Institute, Inc. | DNA molecules encoding bone morphogenetic protein-10 |
| JPH09501305A (ja) | 1993-05-12 | 1997-02-10 | ジェネティックス・インスティテュート・インコーポレイテッド | Bmp−10組成物 |
| US5831050A (en) | 1993-06-07 | 1998-11-03 | Creative Biomolecules, Inc. | Morphogen cell surface receptor |
| CA2174098C (en) | 1993-10-14 | 2011-01-25 | Douglas A. Melton | Method of inducing and maintaining neuronal cells |
| US5658876A (en) | 1994-04-28 | 1997-08-19 | The General Hospital Corporation | Activin antagonists as novel contraceptives |
| DK0776337T3 (da) | 1994-07-08 | 2005-12-12 | Univ Johns Hopkins Med | Vækstdifferentieringsfaktor-11 |
| US5760010A (en) | 1995-01-01 | 1998-06-02 | Klein; Ira | Method of treating liver disorders with a macrolide antibiotic |
| US6132988A (en) | 1995-10-27 | 2000-10-17 | Takeda Chemical Industries, Ltd. | DNA encoding a neuronal cell-specific receptor protein |
| GB9526131D0 (en) | 1995-12-21 | 1996-02-21 | Celltech Therapeutics Ltd | Recombinant chimeric receptors |
| US6004780A (en) * | 1996-03-26 | 1999-12-21 | Human Genome Sciences, Inc. | Growth factor HTTER36 |
| US20050244867A1 (en) * | 1996-03-26 | 2005-11-03 | Human Genome Sciences, Inc. | Growth factor HTTER36 |
| CZ130199A3 (cs) | 1996-10-25 | 1999-07-14 | G. D. Searle & Co. | Cirkulárně permutovaní agonisté receptoru erythropoietinu |
| US6605699B1 (en) | 1997-01-21 | 2003-08-12 | Human Genome Sciences, Inc. | Galectin-11 polypeptides |
| US6034062A (en) | 1997-03-13 | 2000-03-07 | Genetics Institute, Inc. | Bone morphogenetic protein (BMP)-9 compositions and their uses |
| US7041641B2 (en) | 1997-03-20 | 2006-05-09 | Stryker Corporation | Osteogenic devices and methods of use thereof for repair of endochondral bone and osteochondral defects |
| US6426411B1 (en) | 1997-05-30 | 2002-07-30 | Dana-Farber Cancer Institute | PGC-1, a novel brown fat pparγ coactivator |
| US6231880B1 (en) | 1997-05-30 | 2001-05-15 | Susan P. Perrine | Compositions and administration of compositions for the treatment of blood disorders |
| US6696260B1 (en) | 1997-08-01 | 2004-02-24 | The Johns Hopkins University School Of Medicine | Methods to identify growth differentiation factor (GDF) binding proteins |
| US6891082B2 (en) | 1997-08-01 | 2005-05-10 | The Johns Hopkins University School Of Medicine | Transgenic non-human animals expressing a truncated activintype II receptor |
| US6656475B1 (en) | 1997-08-01 | 2003-12-02 | The Johns Hopkins University School Of Medicine | Growth differentiation factor receptors, agonists and antagonists thereof, and methods of using same |
| WO1999006559A1 (en) | 1997-08-01 | 1999-02-11 | The Johns Hopkins University School Of Medicine | Methods to identify growth differentiation factor (gdf) receptors |
| WO1999010364A1 (en) | 1997-08-29 | 1999-03-04 | Human Genome Sciences, Inc. | Follistatin-3 |
| US6953662B2 (en) | 1997-08-29 | 2005-10-11 | Human Genome Sciences, Inc. | Follistatin-3 |
| CN1277632A (zh) | 1997-10-03 | 2000-12-20 | 中外制药株式会社 | 天然人源化抗体 |
| US6696411B1 (en) * | 1998-04-22 | 2004-02-24 | Cornell Research Foundation, Inc. | Canine erythropoietin gene and recombinant protein |
| EP1113799A4 (en) | 1998-09-17 | 2004-06-09 | Lilly Co Eli | PROTEIN-BASED PREPARATION |
| WO2000017350A1 (fr) * | 1998-09-22 | 2000-03-30 | Long Yu | Sequence codante pour un nouveau facteur de differenciation de la croissance d'origine humaine et polypeptide code par cette sequence d'adn, et methode de production correspondante |
| US6472179B2 (en) | 1998-09-25 | 2002-10-29 | Regeneron Pharmaceuticals, Inc. | Receptor based antagonists and methods of making and using |
| US6548634B1 (en) | 1998-09-30 | 2003-04-15 | Chiron Corporation | Synthetic peptides having FGF receptor affinity |
| US6238860B1 (en) | 1998-11-05 | 2001-05-29 | Dyax Corp. | Binding moieties for human parvovirus B19 |
| US6777205B1 (en) * | 1998-11-06 | 2004-08-17 | Sterrenbeld Biotechnologie North America, Inc. | Host cells expressing recombinant human erythropoietin |
| US20040009535A1 (en) | 1998-11-27 | 2004-01-15 | Celltech R&D, Inc. | Compositions and methods for increasing bone mineralization |
| ATE322681T1 (de) | 1999-01-21 | 2006-04-15 | Metamorphix Inc | Inhibitoren für wachstumdifferenzierungsfaktor und ihre anwendungen |
| US6914128B1 (en) | 1999-03-25 | 2005-07-05 | Abbott Gmbh & Co. Kg | Human antibodies that bind human IL-12 and methods for producing |
| EP1174149A1 (en) | 1999-04-19 | 2002-01-23 | Kyowa Hakko Kogyo Co., Ltd. | Proliferation inhibitor for androgen-independent tumor |
| US6468543B1 (en) | 1999-05-03 | 2002-10-22 | Zymogenetics, Inc. | Methods for promoting growth of bone using ZVEGF4 |
| HUP0203409A3 (en) | 1999-11-12 | 2005-06-28 | Maxygen Holdings Ltd Redwood C | Interferon gamma conjugates |
| ATE319470T1 (de) | 1999-12-15 | 2006-03-15 | Res Dev Foundation | Betaglycan als ein inhibin rezeptor und dessen verwendung |
| US20030224501A1 (en) | 2000-03-17 | 2003-12-04 | Young Paul E. | Bone morphogenic protein polynucleotides, polypeptides, and antibodies |
| JP4487376B2 (ja) | 2000-03-31 | 2010-06-23 | 味の素株式会社 | 腎疾患治療剤 |
| PL219131B1 (pl) | 2000-05-15 | 2015-03-31 | Hoffmann La Roche | Ciekła kompozycja farmaceutyczna, sposób jej wytwarzania oraz jej zastosowanie |
| US6627424B1 (en) | 2000-05-26 | 2003-09-30 | Mj Bioworks, Inc. | Nucleic acid modifying enzymes |
| AU2001269709A1 (en) | 2000-07-19 | 2002-02-05 | Eli Lilly And Company | Nucleic acids, vectors, host cells, polypeptides, and uses thereof |
| US6632180B1 (en) | 2000-09-07 | 2003-10-14 | John H. Laragh | Method for evaluating and treating hypertension |
| DE10045591A1 (de) | 2000-09-15 | 2002-04-04 | Klaus Pfizenmaier | Ortsspezifische, antikörpervermittelte Aktivierung proapoptotischer Zytokine - AMAIZe (Antibody-Mediated Apoptosis Inducing Zytokine) |
| US7087224B2 (en) | 2000-10-31 | 2006-08-08 | Amgen Inc. | Method of treating anemia by administering IL-1ra |
| CA2429473C (en) | 2000-11-20 | 2011-02-15 | The Board Of Trustees Of The University Of Illinois | Membrane scaffold proteins |
| US20030082233A1 (en) | 2000-12-01 | 2003-05-01 | Lyons Karen M. | Method and composition for modulating bone growth |
| EP1370287A2 (en) | 2000-12-01 | 2003-12-17 | Wyeth | Method and composition for modulating bone growth |
| TW200526779A (en) | 2001-02-08 | 2005-08-16 | Wyeth Corp | Modified and stabilized GDF propeptides and uses thereof |
| US20040132675A1 (en) * | 2002-02-08 | 2004-07-08 | Calvin Kuo | Method for treating cancer and increasing hematocrit levels |
| US7294472B2 (en) | 2001-03-14 | 2007-11-13 | Caden Biosciences | Method for identifying modulators of G protein coupled receptor signaling |
| WO2002074340A1 (fr) | 2001-03-16 | 2002-09-26 | Takeda Chemical Industries, Ltd. | Procede de fabrication d'une preparation a liberation continue |
| ATE446771T1 (de) | 2001-05-24 | 2009-11-15 | Zymogenetics Inc | Taci-immunoglobulin-fusionsproteine |
| JP2005508141A (ja) | 2001-05-25 | 2005-03-31 | セローノ ジェネティクス インスティテュート ソシエテ アニニム | ヒトcDNAおよびタンパク質、ならびにそれらの使用 |
| AUPR638101A0 (en) | 2001-07-13 | 2001-08-09 | Bioa Pty Limited | Composition and method for treatment of disease |
| KR100912852B1 (ko) | 2001-07-17 | 2009-08-18 | 데이진 가부시키가이샤 | PPAR δ활성화 작용을 측정하는 것을 특징으로 하는물질의 선택방법 및 약제 |
| US6855344B2 (en) | 2001-07-17 | 2005-02-15 | Integrated Chinese Medicine Holdings, Ltd. | Compositions and methods for prostate and kidney health and disorders, an herbal preparation |
| KR100453877B1 (ko) | 2001-07-26 | 2004-10-20 | 메덱스젠 주식회사 | 연쇄체화에 의한 면역 글로블린 융합 단백질의 제조 방법 및 이 방법에 의해 제조된 TNFR/Fc 융합 단백질, 상기 단백질을 코딩하는 DNA, 상기 DNA를 포함하는벡터, 및 상기 벡터에 의한 형질전환체 |
| US7320789B2 (en) | 2001-09-26 | 2008-01-22 | Wyeth | Antibody inhibitors of GDF-8 and uses thereof |
| US6784154B2 (en) | 2001-11-01 | 2004-08-31 | University Of Utah Research Foundation | Method of use of erythropoietin to treat ischemic acute renal failure |
| JP2005524612A (ja) | 2001-12-06 | 2005-08-18 | ファイブローゲン、インコーポレーテッド | 内因性エリスロポエチン(epo)を増加させる方法 |
| US20060234918A1 (en) | 2001-12-19 | 2006-10-19 | Voyager Pharmaceutical Corporation | Methods for treating and preventing cancers that express the hypothalamic-pituitary-gonadal axis of hormones and receptors |
| US20030144203A1 (en) | 2001-12-19 | 2003-07-31 | Voyager Pharmaceutical Corporation | Methods for slowing senescence and treating and preventing diseases associated with senescence |
| US6998118B2 (en) | 2001-12-21 | 2006-02-14 | The Salk Institute For Biological Studies | Targeted retrograde gene delivery for neuronal protection |
| KR20040082421A (ko) | 2002-02-11 | 2004-09-24 | 제넨테크, 인크. | 빠른 항원 결합 속도를 갖는 항체 변이체 |
| AU2003217612A1 (en) | 2002-02-21 | 2003-09-09 | Wyeth | GASP1: a follistatin domain containing protein |
| US20030219846A1 (en) | 2002-02-28 | 2003-11-27 | Pfizer Inc. | Assay for activity of the ActRIIB kinase |
| WO2003087162A2 (en) | 2002-04-18 | 2003-10-23 | Mtm Laboratories Ag | Neopeptides and methods useful for detection and treatment of cancer |
| US7632679B2 (en) | 2002-07-16 | 2009-12-15 | The Trustees Of Columbia University In The City Of New York | Systems and methods for screening for modulators of neural differentiation |
| DE10234192B4 (de) | 2002-07-26 | 2009-11-26 | Epoplus Gmbh Co.Kg | Verwendung von Erythropoetin |
| WO2004016639A1 (en) | 2002-08-16 | 2004-02-26 | Wyeth | Bmp-2 estrogen responsive element and methods of using the same |
| US7261893B2 (en) | 2002-10-22 | 2007-08-28 | Wyeth | Neutralizing antibodies against GDF-8 and uses therefor |
| US20040223966A1 (en) | 2002-10-25 | 2004-11-11 | Wolfman Neil M. | ActRIIB fusion polypeptides and uses therefor |
| AU2002953327A0 (en) | 2002-12-12 | 2003-01-09 | Monash University | Methods of diagnosing prognosing and treating activin associated diseases and conditions |
| CN100427081C (zh) | 2003-02-07 | 2008-10-22 | 普罗米蒂克生物科学公司 | 作为红细胞生成刺激剂的中链长脂肪酸类、甘油酯类和类似物 |
| US20040197828A1 (en) | 2003-03-26 | 2004-10-07 | Gaddy Dana P. | Method for diagnosis and treatment of bone turnover |
| WO2005028517A2 (en) | 2003-05-09 | 2005-03-31 | The General Hospital Corporation | SOLUBLE TGF-β TYPE III RECEPTOR FUSION PROTEINS |
| JP5110877B2 (ja) | 2003-06-02 | 2012-12-26 | ワイス・エルエルシー | 神経筋障害を処置するための、コルチコステロイドと組み合わせたミオスタチン(gdf8)インヒビターの使用 |
| EA015166B1 (ru) | 2003-06-16 | 2011-06-30 | Ю-Си-Би Мэньюфэкчуринг, Инк. | Иммуногенные пептиды склеростина (sost), индуцирующие образование специфических антител |
| WO2005009460A2 (en) | 2003-07-25 | 2005-02-03 | Medexis, S.A. | Pharmaceutical composition comprising activin a, alk-4 or derivatives thereof for the treatment of ophthalmic disorders or cancer |
| US8895540B2 (en) | 2003-11-26 | 2014-11-25 | DePuy Synthes Products, LLC | Local intraosseous administration of bone forming agents and anti-resorptive agents, and devices therefor |
| DK1706428T3 (da) | 2004-01-22 | 2009-11-30 | Merck Patent Gmbh | Anti-cancer-antistoffer med reduceret komplementfiksering |
| US20050197292A1 (en) * | 2004-01-30 | 2005-09-08 | Glennda Smithson | Compositions and methods for treating T-cell mediated pathological conditions |
| WO2005094871A2 (en) | 2004-03-26 | 2005-10-13 | Acceleron Pharma Inc. | Bmp-3 propeptides and related methods |
| JP2008500816A (ja) | 2004-03-31 | 2008-01-17 | ゼンコー・インコーポレイテッド | 改善された性質を有するbmp−7変異体 |
| US7741284B2 (en) | 2004-05-12 | 2010-06-22 | Acceleron Pharma Inc. | BMP10 propeptides and related methods |
| AU2005258286A1 (en) | 2004-06-24 | 2006-01-05 | Acceleron Pharma Inc. | GDF3 propeptides and related methods |
| EP1794191B1 (en) | 2004-08-05 | 2016-05-18 | The Regents of The University of California | Molecules with effects on cellular development and function |
| WO2006039400A2 (en) | 2004-09-29 | 2006-04-13 | Mount Sinai School Of Medicine Of New York University | Fsh and fsh receptor modulator compositions and methods for inhibiting osteoclastic bone resorption and bone loss in osteoporosis |
| NZ538097A (en) | 2005-02-07 | 2006-07-28 | Ovita Ltd | Method and compositions for improving wound healing |
| ES2547866T3 (es) | 2005-02-16 | 2015-10-09 | The General Hospital Corporation | Uso de proteínas de fusión de hemojuvelina para regular el metabolismo del hierro mediado por hepcidina |
| CN101198321A (zh) | 2005-04-26 | 2008-06-11 | 味之素株式会社 | 骨髓祖红细胞分化诱导剂 |
| JP2007099764A (ja) | 2005-09-09 | 2007-04-19 | Ajinomoto Co Inc | 血糖低下剤 |
| DK1931697T3 (da) | 2005-09-28 | 2010-11-08 | Zymogenetics Inc | IL-17A og IL-17F-antagonister og fremgangsmåder til anvendelse af disse |
| US8067562B2 (en) | 2005-11-01 | 2011-11-29 | Amgen Inc. | Isolated nucleic acid molecule comprising the amino acid sequence of SEQ ID NO:1 |
| EP3811965A1 (en) | 2005-11-23 | 2021-04-28 | Acceleron Pharma, Inc. | Activin-actriia antagonists in use for promoting bone growth |
| US8128933B2 (en) | 2005-11-23 | 2012-03-06 | Acceleron Pharma, Inc. | Method of promoting bone growth by an anti-activin B antibody |
| AU2006321906C1 (en) | 2005-12-06 | 2014-01-16 | Amgen Inc. | Uses of myostatin antagonists |
| EP1966183A4 (en) | 2005-12-20 | 2010-12-29 | Merck Frosst Canada Ltd | HETEROAROMATIC COMPOUNDS AS INHIBITORS OF STEAROYL-COENZYME A-DELTA-9-DESATURASE |
| AU2006331770A1 (en) | 2005-12-21 | 2007-07-05 | Schering Corporation | Treatment of nonalcoholic fatty liver disease using cholesterol lowering agents and H3 receptor antagonist/inverse agonist |
| EP1973909A2 (en) | 2005-12-22 | 2008-10-01 | Biogen Idec MA Inc. | Transforming growth factor modulators |
| US7361510B2 (en) | 2006-01-20 | 2008-04-22 | Beckman Coulter, Inc. | Methods of detection of iron deficiency |
| CA2637375A1 (en) | 2006-01-25 | 2007-08-02 | Wellstat Therapeutics Corporation | Compounds for the treatment of metabolic disorders |
| WO2007101060A2 (en) | 2006-02-28 | 2007-09-07 | Wellstat Therapeutics Corporation | Compounds for the treatment of metabolic disorders |
| EP2007813A2 (en) * | 2006-04-14 | 2008-12-31 | Amgen Inc. | Agonist erythropoietin receptor antibodies |
| WO2007123391A1 (en) | 2006-04-20 | 2007-11-01 | Academisch Ziekenhuis Leiden | Therapeutic intervention in a genetic disease in an individual by modifying expression of an aberrantly expressed gene. |
| US20080075692A1 (en) | 2006-05-09 | 2008-03-27 | Perrine Susan P | Methods for treating blood disorders |
| CN101522021B (zh) | 2006-07-21 | 2014-07-30 | 莱因实验室 | 醋酸钙的液体组合物 |
| GB0615129D0 (en) | 2006-07-29 | 2006-09-06 | Univ Cardiff | Anti-cancer activity of BMP-9 and BMP-10 and their use in cancer therapies |
| CL2007002567A1 (es) | 2006-09-08 | 2008-02-01 | Amgen Inc | Proteinas aisladas de enlace a activina a humana. |
| US7547781B2 (en) | 2006-09-11 | 2009-06-16 | Curis, Inc. | Quinazoline based EGFR inhibitors containing a zinc binding moiety |
| WO2008060139A1 (en) | 2006-11-17 | 2008-05-22 | Erasmus University Medical Center Rotterdam | Methods for controlling mineralization of extracellular matrix, therapeutic methods based thereon and medicaments for use therein |
| US20100003190A1 (en) | 2006-12-08 | 2010-01-07 | Caritas St. Elizabeth's Medical Center Of Boston, Inc. | Method for protecting renal tubular epithelial cells from radiocontrast nephropathy (RCN) |
| AU2007332473B2 (en) | 2006-12-14 | 2012-09-27 | Forerunner Pharma Research Co., Ltd. | Anti-Claudin-3 monoclonal antibody, and treatment and diagnosis of cancer using the same |
| US20100028332A1 (en) | 2006-12-18 | 2010-02-04 | Acceleron Pharma Inc. | Antagonists of actriib and uses for increasing red blood cell levels |
| US8895016B2 (en) | 2006-12-18 | 2014-11-25 | Acceleron Pharma, Inc. | Antagonists of activin-actriia and uses for increasing red blood cell levels |
| EP2599495A1 (en) | 2007-02-01 | 2013-06-05 | Acceleron Pharma, Inc. | Activin-ActRIIa Antagonists and Uses for Treating or Preventing Breast Cancer |
| KR20200054317A (ko) | 2007-02-09 | 2020-05-19 | 악셀레론 파마 인코포레이티드 | 액티빈-ActRⅡA 길항제 및 암 환자에서 골 생장을 촉진시키기 위한 이의 용도 |
| US8501678B2 (en) | 2007-03-06 | 2013-08-06 | Atara Biotherapeutics, Inc. | Variant activin receptor polypeptides and uses thereof |
| WO2009009059A1 (en) | 2007-07-09 | 2009-01-15 | Biogen Idec Ma Inc. | Spiro compounds as antagonists of tgf-beta |
| GB0715087D0 (en) | 2007-08-03 | 2007-09-12 | Summit Corp Plc | Drug combinations for the treatment of duchenne muscular dystrophy |
| PT2170396T (pt) | 2007-08-03 | 2017-03-31 | Summit Corp Plc | Combinação de fármacos para o tratamento da distrofia muscular de duchenne |
| GB0715938D0 (en) | 2007-08-15 | 2007-09-26 | Vastox Plc | Method of treatment of duchenne muscular dystrophy |
| WO2009025651A1 (en) | 2007-08-17 | 2009-02-26 | University Of Maine System Board Of Trustees | Biologically active peptide and method of using the same |
| US20100279409A1 (en) | 2007-09-13 | 2010-11-04 | Neil Robson | Method for modifying celluar immune resonse by modulating activin activity |
| CA2699936A1 (en) | 2007-09-18 | 2009-03-26 | Acceleron Pharma Inc. | Activin-actriia antagonists and uses for decreasing or inhibiting fsh secretion |
| PE20091163A1 (es) | 2007-11-01 | 2009-08-09 | Wyeth Corp | Anticuerpos para gdf8 |
| US8043620B2 (en) | 2007-11-21 | 2011-10-25 | Amgen Inc. | Wise binding agents and epitopes |
| JP5638961B2 (ja) | 2008-03-13 | 2014-12-10 | ザ ジェネラル ホスピタル コーポレイション | Bmpシグナル伝達経路のインヒビター |
| WO2009137075A1 (en) | 2008-05-06 | 2009-11-12 | Acceleron Pharma Inc. | Anti-activin antibodies and uses for promoting bone growth |
| US20110104133A1 (en) | 2008-05-06 | 2011-05-05 | Joslin Diabetes Center, Inc. | Methods and compositions for inducing brown adipogenesis |
| CA2729096C (en) | 2008-06-26 | 2020-04-28 | Acceleron Pharma Inc. | Methods for dosing an actriib antagonist and monitoring of treated patients |
| EP2318028B1 (en) | 2008-06-26 | 2020-02-19 | Acceleron Pharma Inc. | Antagonists of soluble activin-actriia and uses for increasing red blood cell levels |
| US8216997B2 (en) | 2008-08-14 | 2012-07-10 | Acceleron Pharma, Inc. | Methods for increasing red blood cell levels and treating anemia using a combination of GDF traps and erythropoietin receptor activators |
| US20110293526A1 (en) | 2008-11-20 | 2011-12-01 | University Of Southern California | Compositions and methods to modulate hair growth |
| CA2997971A1 (en) | 2008-11-26 | 2010-06-03 | Amgen Inc. | Variants of activin iib receptor polypeptides and uses thereof |
| US8110355B2 (en) | 2009-02-20 | 2012-02-07 | GenRemedy, LLC | Methods for identifying agents that inhibit cell migration, promote cell adhesion and prevent metastasis |
| ES2655877T3 (es) | 2009-04-27 | 2018-02-22 | Novartis Ag | Composiciones y métodos para aumentar el crecimiento muscular |
| US8178488B2 (en) | 2009-06-08 | 2012-05-15 | Acceleron Pharma, Inc. | Methods for increasing thermogenic adipocytes |
| EP2440577A4 (en) | 2009-06-12 | 2013-01-23 | Acceleron Pharma Inc | SHORTEN ACTRIIB FC FUSION PROTEINS |
| ES2844123T3 (es) * | 2009-08-13 | 2021-07-21 | Acceleron Pharma Inc | Uso combinado de trampas de GDF y activadores del receptor de la eritropoyetina para aumentar los niveles de glóbulos rojos |
| MX340451B (es) | 2009-09-09 | 2016-07-08 | Acceleron Pharma Inc | Antagonistas de actriib y dosificacion y usos de los mismos. |
| EP3260130B1 (en) | 2009-11-03 | 2021-03-10 | Acceleron Pharma Inc. | Methods for treating fatty liver disease |
| US8710016B2 (en) | 2009-11-17 | 2014-04-29 | Acceleron Pharma, Inc. | ActRIIB proteins and variants and uses therefore relating to utrophin induction for muscular dystrophy therapy |
| US8580922B2 (en) | 2011-03-04 | 2013-11-12 | Shire Human Genetic Therapies, Inc. | Peptide linkers for polypeptide compositions and methods for using same |
| DK2726099T3 (en) | 2011-07-01 | 2018-11-05 | Novartis Ag | Method of treating metabolic disorders |
| CN107837390A (zh) | 2011-10-17 | 2018-03-27 | 阿塞勒隆制药公司 | 用于治疗无效性红细胞生成的方法和组合物 |
| WO2013063536A1 (en) | 2011-10-27 | 2013-05-02 | Acceleron Pharma, Inc. | Actriib binding agents and uses thereof |
| US8765385B2 (en) | 2011-10-27 | 2014-07-01 | Ravindra Kumar | Method of detection of neutralizing anti-actriib antibodies |
| EP2771017A4 (en) | 2011-10-28 | 2015-04-01 | Paranta Biosciences Ltd | METHOD FOR THE TREATMENT OF SLIP SEED SECRETION |
| AU2012364736A1 (en) | 2011-12-19 | 2014-07-24 | Amgen Inc. | Variant activin receptor polypeptides, alone or in combination with chemotherapy, and uses thereof |
| US10501512B2 (en) | 2012-04-02 | 2019-12-10 | Modernatx, Inc. | Modified polynucleotides |
| EP3521310A1 (en) | 2012-06-14 | 2019-08-07 | The Medical Research, Infrastructure, And Health Services Fund Of The Tel Aviv Medical Center | Use of blocking agents of bone morphogenic protein (bmp) signaling for the treatment of neuroinflammatory and neurodegenerative diseases |
| CA2874117C (en) | 2012-07-02 | 2021-10-12 | Kyowa Hakko Kirin Co., Ltd. | Pharmaceutical agent comprising anti-bmp9 antibody as active ingredient for treatment of anemia such as renal anemia and cancer anemia |
| EP2911682A4 (en) | 2012-10-24 | 2016-03-23 | Celgene Corp | METHOD FOR TREATING ANEMIA |
| EP2912462B1 (en) | 2012-10-24 | 2019-08-07 | Celgene Corporation | Biomarker for use in treating anemia |
| WO2014064292A1 (en) | 2012-10-26 | 2014-05-01 | Universite Pierre Et Marie Curie (Paris 6) | A method for preventing or treating atrial fibrillation |
| US10195249B2 (en) | 2012-11-02 | 2019-02-05 | Celgene Corporation | Activin-ActRII antagonists and uses for treating bone and other disorders |
| ES3023054T3 (en) | 2012-11-08 | 2025-05-29 | Clearside Biomedical Inc | Methods for the treatment of ocular disease in human subjects |
| US20150328249A1 (en) | 2012-12-11 | 2015-11-19 | Los Angeles Biomedical Research Institute At Harbor-Ucla Medical Center | Modulation of myofiber repair by anti-myostatin strategies and/or ppar gamma ligands, alone or in combination with stem cells, for the therapy of critical limb ischemia and other ischemic processes affecting the skeletal muscle |
| US20140220033A1 (en) | 2013-02-01 | 2014-08-07 | Santa Maria Biotherapeutics, Inc. | Administration of an Anti-Activin-A Compound to a Subject |
| EP3431592A1 (en) | 2013-03-14 | 2019-01-23 | Translate Bio, Inc. | Mrna therapeutic compositions and use to treat diseases and disorders |
| TWI655207B (zh) | 2013-07-30 | 2019-04-01 | 再生元醫藥公司 | 抗活化素a之抗體及其用途 |
| AU2014307589A1 (en) | 2013-08-14 | 2016-02-11 | Novartis Ag | Methods of treating sporadic inclusion body myositis |
| WO2015089575A1 (en) | 2013-12-16 | 2015-06-25 | Paranta Biosciences Limited | Method of diagnosis and treatment |
| EP3094751A4 (en) | 2014-01-14 | 2017-06-07 | Santa Maria Biotherapeutics, Inc. | Activin inhibitor response prediction and uses for treatment |
| JP2017510622A (ja) | 2014-01-27 | 2017-04-13 | ノバルティス アーゲー | 筋萎縮を予測するバイオマーカー、方法および使用 |
| WO2015152183A1 (ja) | 2014-03-31 | 2015-10-08 | 大日本住友製薬株式会社 | 進行性骨化性線維異形成症の予防剤及び治療剤 |
| EP3808778A1 (en) | 2014-04-18 | 2021-04-21 | Acceleron Pharma Inc. | Methods for increasing red blood cell levels and treating sickle-cell disease |
| TW201622746A (zh) | 2014-04-24 | 2016-07-01 | 諾華公司 | 改善或加速髖部骨折術後身體復原之方法 |
| KR20170035891A (ko) | 2014-06-13 | 2017-03-31 | 산타 마리아 바이오테라퓨틱스, 인코포레이티드 | 제형화된 수용체 폴리펩타이드 및 관련 방법 |
| AU2016261913B2 (en) | 2015-05-13 | 2021-08-12 | Acceleron Pharma Inc. | Treatment of beta-thalassemia using ActRII ligand traps |
-
2010
- 2010-06-08 EP EP10792510A patent/EP2440577A4/en not_active Withdrawn
- 2010-06-08 CN CN201510192573.3A patent/CN104805105A/zh active Pending
- 2010-06-08 KR KR1020217036389A patent/KR20210136174A/ko not_active Ceased
- 2010-06-08 JP JP2012515067A patent/JP2012529294A/ja not_active Withdrawn
- 2010-06-08 KR KR1020217008368A patent/KR20210034684A/ko not_active Ceased
- 2010-06-08 EP EP17166621.7A patent/EP3290439B1/en active Active
- 2010-06-08 MX MX2017012938A patent/MX387164B/es unknown
- 2010-06-08 MX MX2015011708A patent/MX351286B/es unknown
- 2010-06-08 CA CA2765108A patent/CA2765108C/en active Active
- 2010-06-08 KR KR1020187005897A patent/KR20180026795A/ko not_active Ceased
- 2010-06-08 MX MX2011013364A patent/MX2011013364A/es active IP Right Grant
- 2010-06-08 BR BR122021017187-4A patent/BR122021017187B1/pt active IP Right Grant
- 2010-06-08 CN CN2010800359601A patent/CN102656187A/zh active Pending
- 2010-06-08 ES ES17166621T patent/ES2836534T3/es active Active
- 2010-06-08 CN CN201710382876.0A patent/CN107267520A/zh active Pending
- 2010-06-08 US US12/796,307 patent/US8293881B2/en active Active
- 2010-06-08 KR KR1020127000112A patent/KR20120028358A/ko not_active Ceased
- 2010-06-08 WO PCT/US2010/037787 patent/WO2010151426A1/en not_active Ceased
- 2010-06-08 EP EP20193499.9A patent/EP3805259A1/en not_active Withdrawn
- 2010-06-08 BR BRPI1010704-5A patent/BRPI1010704B1/pt active IP Right Grant
- 2010-06-08 KR KR1020197021378A patent/KR20190090049A/ko not_active Ceased
- 2010-06-08 AU AU2010263182A patent/AU2010263182B2/en active Active
-
2011
- 2011-12-08 IL IL216861A patent/IL216861A/en active IP Right Grant
-
2012
- 2012-01-12 CO CO12004167A patent/CO6491031A2/es not_active Application Discontinuation
- 2012-10-22 US US13/657,649 patent/US9181533B2/en active Active
-
2015
- 2015-03-30 JP JP2015068127A patent/JP2015119733A/ja not_active Withdrawn
- 2015-07-30 US US14/814,040 patent/US9745559B2/en active Active
-
2016
- 2016-01-28 HK HK16100919.0A patent/HK1213013A1/zh unknown
- 2016-08-09 AU AU2016213725A patent/AU2016213725B2/en active Active
-
2017
- 2017-04-14 JP JP2017080470A patent/JP2017121260A/ja not_active Withdrawn
- 2017-05-23 IL IL252450A patent/IL252450B/en active IP Right Grant
- 2017-07-31 US US15/664,172 patent/US10358633B2/en active Active
-
2018
- 2018-01-18 AU AU2018200418A patent/AU2018200418A1/en not_active Abandoned
- 2018-04-19 HK HK18105081.9A patent/HK1245824A1/zh unknown
-
2019
- 2019-04-26 JP JP2019085497A patent/JP2019141085A/ja not_active Withdrawn
- 2019-06-07 US US16/434,841 patent/US11066654B2/en active Active
- 2019-10-21 AU AU2019253782A patent/AU2019253782A1/en not_active Abandoned
-
2020
- 2020-07-05 IL IL275846A patent/IL275846A/en unknown
- 2020-11-26 CY CY20201101127T patent/CY1123580T1/el unknown
-
2021
- 2021-04-21 AU AU2021202419A patent/AU2021202419A1/en not_active Abandoned
- 2021-06-25 US US17/358,540 patent/US20220169996A1/en not_active Abandoned
- 2021-07-05 JP JP2021111376A patent/JP2021164472A/ja active Pending
Patent Citations (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20010039036A1 (en) * | 1991-05-10 | 2001-11-08 | The Salk Institute For Biological Studies. | Cloning and recombinant production of receptor(s) of the activin/TGF-beta superfamily |
| WO2006012627A2 (en) * | 2004-07-23 | 2006-02-02 | Acceleron Pharma Inc. | Actrii receptor polypeptides, methods and compositions |
| WO2006020884A2 (en) * | 2004-08-12 | 2006-02-23 | Wyeth | Combination therapy for diabetes, obesity, and cardiovascular diseases using gdf-8 inhibitors |
| WO2008076437A2 (en) * | 2006-12-18 | 2008-06-26 | Acceleron Pharma Inc. | Activin-actrii antagonists and uses for increasing red blood cell levels |
| WO2008097541A2 (en) * | 2007-02-02 | 2008-08-14 | Acceleron Pharma Inc. | Variants derived from actriib and uses therefor |
| WO2008109167A2 (en) * | 2007-03-06 | 2008-09-12 | Amgen Inc. | Variant activin receptor polypeptides and uses thereof |
| WO2008151078A1 (en) * | 2007-06-01 | 2008-12-11 | Wyeth | Methods and compositions for modulating bmp-10 activity |
| US20100068215A1 (en) * | 2008-08-14 | 2010-03-18 | Acceleron Pharma Inc. | Use of GDF traps to increase red blood cell levels |
| US20100183624A1 (en) * | 2009-01-13 | 2010-07-22 | Jasbir Seehra | Methods for increasing adiponectin |
Non-Patent Citations (2)
| Title |
|---|
| CADENA S.M. ET AL.: "Administration of a Soluble Activin Type IIB Receptor Promotes Skeletal Muscle Growth Independent of Fiber Type", JOURNAL OF APPLIED PHYSIOLOGY, May 2010 (2010-05-01), pages 1 - 25, XP008148636 * |
| SAKO D. ET AL.: "Characterization of the Ligand Binding Functionality of the Extracellular Domain of Activin Receptor Type IIB", THE JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 285, no. 27, April 2010 (2010-04-01), pages 21037 - 21048, XP008148640 * |
Cited By (97)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9138459B2 (en) | 2004-07-23 | 2015-09-22 | Acceleron Pharma Inc. | ACTRIIB-FC polynucleotides, polypeptides, and compositions |
| US9480742B2 (en) | 2005-11-23 | 2016-11-01 | Acceleron Pharma Inc. | Method of promoting bone growth by an anti-actriia antibody |
| US11129873B2 (en) | 2005-11-23 | 2021-09-28 | Acceleron Pharma Inc. | Method for promoting bone growth using activin-actriia antagonists |
| US9163075B2 (en) | 2005-11-23 | 2015-10-20 | Acceleron Pharma Inc. | Isolated polynucleotide that encodes an ActRIIa-Fc fusion polypeptide |
| US8486403B2 (en) | 2005-11-23 | 2013-07-16 | Acceleron Pharma, Inc. | Method of promoting bone growth by an anti-activin A antibody |
| US8629109B2 (en) | 2005-11-23 | 2014-01-14 | Acceleron Pharma Inc. | Method for promoting bone growth using activin-actriia antagonists |
| US10239940B2 (en) | 2005-11-23 | 2019-03-26 | Acceleron Pharma Inc. | Method of promoting bone growth by an anti-actriia antibody |
| US10071135B2 (en) | 2005-11-23 | 2018-09-11 | Acceleron Pharma Inc. | Method of identifying an agent that promotes bone growth or increases bone density |
| US9572865B2 (en) | 2005-11-23 | 2017-02-21 | Acceleron Pharma Inc. | Activin-actriia antagonists and uses for treating multiple myeloma |
| US10093707B2 (en) | 2006-12-18 | 2018-10-09 | Acceleron Pharma Inc. | Antagonists of activin-ActRIIa and uses for increasing red blood cell levels |
| US8895016B2 (en) | 2006-12-18 | 2014-11-25 | Acceleron Pharma, Inc. | Antagonists of activin-actriia and uses for increasing red blood cell levels |
| US9526759B2 (en) | 2007-02-01 | 2016-12-27 | Acceleron Pharma Inc. | Activin-actriia antagonists and uses for treating or preventing breast cancer |
| US9399669B2 (en) | 2007-02-02 | 2016-07-26 | Acceleron Pharma Inc. | Variants derived from ActRIIB |
| US10259861B2 (en) | 2007-02-02 | 2019-04-16 | Acceleron Pharma Inc. | Variants derived from ActRIIB and uses therefor |
| US9353356B2 (en) | 2007-09-18 | 2016-05-31 | Acceleron Pharma Inc. | Activin-actriia antagonists for treating a follicle-stimulating horomone-secreting pituitary tumor |
| US11162085B2 (en) | 2008-08-14 | 2021-11-02 | Acceleron Pharma Inc. | Methods for treating anemia in a subject in need thereof |
| US8703927B2 (en) | 2008-08-14 | 2014-04-22 | Acceleron Pharma Inc. | Isolated nucleotide sequences encoding GDF traps |
| US10829533B2 (en) | 2008-08-14 | 2020-11-10 | Acceleron Pharma Inc. | Combined use of GDF traps and erythropoietin receptor activators to increase red blood cell levels |
| US9439945B2 (en) | 2008-08-14 | 2016-09-13 | Acceleron Pharma Inc. | Isolated nucleotide sequences encoding GDF traps |
| US10889626B2 (en) | 2008-08-14 | 2021-01-12 | Acceleron Pharma Inc. | Combined use of GDF traps and erythropoietin receptor activators to increase red blood cell levels |
| US10689427B2 (en) | 2008-08-14 | 2020-06-23 | Acceleron Pharma Inc. | Combined use of GDF traps and erythropoietin receptor activators to increase red blood cell levels |
| US10377996B2 (en) | 2008-08-14 | 2019-08-13 | Acceleron Pharma Inc. | Methods of identifying ActRIIB variants |
| US10829532B2 (en) | 2008-08-14 | 2020-11-10 | Acceleron Pharma Inc. | Combined use of gdf traps and erythropoietin receptor activators to increase red blood cell levels |
| US11155791B2 (en) | 2008-08-14 | 2021-10-26 | Acceleron Pharma Inc. | Methods for treating anemia in a subject in need thereof |
| US9932379B2 (en) | 2008-08-14 | 2018-04-03 | Acceleron Pharma Inc. | Isolated nucleotide sequences encoding GDF traps |
| US9505813B2 (en) | 2008-08-14 | 2016-11-29 | Acceleron Pharma Inc. | Use of GDF traps to treat anemia |
| US11168311B2 (en) | 2008-08-14 | 2021-11-09 | Acceleron Pharma Inc. | Methods for treating anemia in a subject in need thereof |
| US8765663B2 (en) | 2009-01-13 | 2014-07-01 | Acceleron Pharma Inc. | Methods for increasing adiponectin |
| US8703694B2 (en) | 2009-06-08 | 2014-04-22 | Acceleron Pharma, Inc. | Methods for increasing thermogenic adipocytes |
| US9790284B2 (en) | 2009-06-08 | 2017-10-17 | Acceleron Pharma Inc. | Methods for increasing thermogenic adipocytes |
| US10968282B2 (en) | 2009-06-08 | 2021-04-06 | Acceleron Pharma Inc. | Methods for screening compounds for increasing thermogenic adipocytes |
| US10358633B2 (en) | 2009-06-12 | 2019-07-23 | Acceleron Pharma Inc. | Method for producing an ActRIIB-Fc fusion polypeptide |
| US9745559B2 (en) | 2009-06-12 | 2017-08-29 | Acceleron Pharma Inc. | Method for decreasing the body fat content in a subject by administering an ActRIIB protein |
| US9181533B2 (en) | 2009-06-12 | 2015-11-10 | Acceleron Pharma, Inc. | Truncated ACTRIIB-FC fusion protein |
| US11066654B2 (en) | 2009-06-12 | 2021-07-20 | Acceleron Pharma Inc. | Methods and compositions for reducing serum lipids |
| EP3202459A1 (en) * | 2009-09-09 | 2017-08-09 | Acceleron Pharma Inc. | Actriib antagonists and dosing and uses thereof for regulating body fat content |
| AU2016201712B2 (en) * | 2009-09-09 | 2017-10-26 | Acceleron Pharma Inc. | ActRIIb antagonists and dosing and uses thereof |
| EP2475427A4 (en) * | 2009-09-09 | 2013-06-26 | Acceleron Pharma Inc | ACTRIIB ANTAGONISTS, THEIR DOSAGE AND APPLICATIONS THEREOF |
| AU2018200463B2 (en) * | 2009-09-09 | 2020-07-09 | Acceleron Pharma Inc. | ActRIIb antagonists and dosing and uses thereof |
| AU2010315245B2 (en) * | 2009-11-03 | 2016-11-03 | Acceleron Pharma Inc. | Methods for treating fatty liver disease |
| US8710016B2 (en) | 2009-11-17 | 2014-04-29 | Acceleron Pharma, Inc. | ActRIIB proteins and variants and uses therefore relating to utrophin induction for muscular dystrophy therapy |
| US9617319B2 (en) | 2009-11-17 | 2017-04-11 | Acceleron Pharma Inc. | ActRIIB proteins and variants and uses therefore relating to utrophin induction for muscular dystrophy therapy |
| US10968262B2 (en) | 2009-11-17 | 2021-04-06 | Acceleron Pharma Inc. | Methods of increasing sarcolemmal utrophin |
| US8722615B2 (en) | 2009-12-02 | 2014-05-13 | Acceleron Pharma, Inc. | Compositions and methods for increasing serum half-life |
| WO2011068993A1 (en) * | 2009-12-02 | 2011-06-09 | Acceleron Pharma Inc. | Compositions and methods for increasing serum half-life of fc fusion proteins. |
| US9493556B2 (en) | 2010-11-08 | 2016-11-15 | Acceleron Pharma Inc. | Actriia binding agents and uses thereof |
| WO2012170938A1 (en) * | 2011-06-08 | 2012-12-13 | Acceleron Pharma Inc. | Compositions and methods for increasing serum half-life |
| US8883982B2 (en) | 2011-06-08 | 2014-11-11 | Acceleron Pharma, Inc. | Compositions and methods for increasing serum half-life |
| EP2718328A4 (en) * | 2011-06-08 | 2014-12-24 | Acceleron Pharma Inc | COMPOSITIONS AND METHODS FOR INCREASING THE HALF TIME OF SERUM |
| EP3351260A1 (en) | 2012-04-06 | 2018-07-25 | Acceleron Pharma Inc. | Methods and compositions for increasing red blood cells |
| JP2018168176A (ja) * | 2012-11-02 | 2018-11-01 | セルジーン コーポレイション | アクチビン−ActRIIアンタゴニスト並びに骨障害及び他の障害の治療に対する使用 |
| US10195249B2 (en) | 2012-11-02 | 2019-02-05 | Celgene Corporation | Activin-ActRII antagonists and uses for treating bone and other disorders |
| US10487144B2 (en) | 2014-06-13 | 2019-11-26 | Acceleron Pharma Inc. | Methods for treating ulcers in a hemoglobinopathy anemia with a soluble actRIIB polypeptide |
| US11260107B2 (en) | 2014-06-13 | 2022-03-01 | Acceleron Pharma Inc. | Methods and compositions for treating ulcers |
| US9850298B2 (en) | 2014-06-13 | 2017-12-26 | Acceleron Pharma Inc. | Methods for treating ulcers in thalassemia syndrome with an ActRIIB polypeptide |
| US11813308B2 (en) | 2014-10-09 | 2023-11-14 | Celgene Corporation | Treatment of cardiovascular disease using ActRII ligand traps |
| US11471510B2 (en) | 2014-12-03 | 2022-10-18 | Celgene Corporation | Activin-ActRII antagonists and uses for treating anemia |
| EP3929211A1 (en) | 2015-04-06 | 2021-12-29 | Acceleron Pharma Inc. | Alk4:actriib heteromultimers and uses thereof |
| WO2016164503A1 (en) | 2015-04-06 | 2016-10-13 | Acceleron Pharma Inc. | Alk7:actriib heteromultimers and uses thereof |
| US10738098B2 (en) | 2015-04-06 | 2020-08-11 | Acceleron Pharma Inc. | ALK4:ActRIIB heteromultimers and uses thereof |
| US10906958B2 (en) | 2015-04-06 | 2021-02-02 | Acceleron Pharma Inc. | TGF-beta superfamily type I and type II receptor heteromultimers and uses thereof |
| EP4599888A2 (en) | 2015-04-06 | 2025-08-13 | Acceleron Pharma Inc. | Tgf-beta superfamily type i and type ii receptor heteromultimers and uses thereof |
| US12338273B2 (en) | 2015-04-06 | 2025-06-24 | Accerelon Pharma Inc. | Single-arm type I and type II receptor fusion proteins and uses thereof |
| US12258380B2 (en) | 2015-04-06 | 2025-03-25 | Acceleron Pharma Inc. | ALK4:actriib heteromultimers and uses thereof |
| US11827689B2 (en) | 2015-04-06 | 2023-11-28 | Acceleron Pharma Inc. | ALK7:ActRIIB heteromultimers and uses thereof |
| EP3828199A1 (en) | 2015-04-06 | 2021-06-02 | Acceleron Pharma Inc. | Alk7: actriib heteromultimers and uses thereof |
| US11028145B2 (en) | 2015-04-06 | 2021-06-08 | Acceleron Pharma Inc. | ALK7:actriib heteromultimers and uses thereof |
| US10227393B2 (en) | 2015-04-06 | 2019-03-12 | Acceleron Pharma Inc. | TGF-beta superfamily type I and type II receptor heteromultimers and uses thereof |
| WO2016164497A1 (en) | 2015-04-06 | 2016-10-13 | Acceleron Pharma Inc. | Alk4:actriib heteromultimers and uses thereof |
| US10227392B2 (en) | 2015-04-06 | 2019-03-12 | Acceleron Pharma Inc. | ALK7:ActRIIB heteromultimers and uses thereof |
| EP3889171A1 (en) | 2015-04-06 | 2021-10-06 | Acceleron Pharma Inc. | Tgf-beta superfamily type i and type ii receptor heteromultimers and uses thereof |
| US10196434B2 (en) | 2015-04-06 | 2019-02-05 | Acceleron Pharma Inc. | ALK4:ActRIIB heteromultimers and uses thereof |
| WO2016164089A2 (en) | 2015-04-06 | 2016-10-13 | Acceleron Pharma Inc. | Tgf-beta superfamily type i and type ii receptor heteromultimers and uses thereof |
| US11279746B2 (en) | 2015-04-06 | 2022-03-22 | Acceleron Pharma Inc. | ALK4:ActRIIB heteromultimers and uses thereof |
| AU2016246708B2 (en) * | 2015-04-06 | 2020-12-24 | Acceleron Pharma Inc. | ALK7:actRIIB heteromultimers and uses thereof |
| US10548976B2 (en) | 2015-05-20 | 2020-02-04 | Celgene Corporation | In vitro cell culture methods for beta-thalassemia using activin type II receptor ligand traps |
| WO2017177013A1 (en) | 2016-04-06 | 2017-10-12 | Acceleron Pharma Inc. | Alk7 antagonists and uses thereof |
| US12024563B2 (en) | 2016-04-06 | 2024-07-02 | Acceleron Pharma Inc. | ALK7 antagonists and uses thereof |
| EP3928784A1 (en) | 2016-07-15 | 2021-12-29 | Acceleron Pharma Inc. | Compositions comprising actriia polypeptides for use in treating pulmonary hypertension |
| WO2018013936A1 (en) | 2016-07-15 | 2018-01-18 | Acceleron Pharma Inc. | Compositions and methods for treating pulmonary hypertension |
| WO2018067874A1 (en) | 2016-10-05 | 2018-04-12 | Acceleron Pharma Inc. | Variant actriib proteins and uses thereof |
| US12054753B2 (en) | 2016-10-05 | 2024-08-06 | Acceleron Pharma Inc. | Methods of treatment of muscular dystrophy with ALK4:ActRIIB heteromultimers |
| US10934532B2 (en) | 2016-10-05 | 2021-03-02 | Acceleron Pharma Inc. | ALK4.ActRIIB heteromultimers |
| EP3523328A4 (en) * | 2016-10-05 | 2020-04-01 | Acceleron Pharma Inc. | VARIANT ACTRIIB PROTEINS AND USES THEREOF |
| US11267865B2 (en) | 2016-10-05 | 2022-03-08 | Acceleron Pharma Inc. | Variant ActRIIB proteins and uses thereof |
| US12240887B2 (en) | 2016-10-05 | 2025-03-04 | Acceleron Pharma Inc. | Variant ActRIIB proteins and uses thereof |
| EP4026556A1 (en) | 2016-10-05 | 2022-07-13 | Acceleron Pharma Inc. | Compositions and method for treating kidney disease |
| US12350313B2 (en) | 2016-11-10 | 2025-07-08 | Keros Therapeutics, Inc. | Activin receptor type IIa variants and methods of use thereof |
| US11013785B2 (en) | 2016-11-10 | 2021-05-25 | Keros Therapeutics, Inc. | Activin receptor type IIA variants and methods of use thereof |
| US11090361B2 (en) | 2016-11-10 | 2021-08-17 | Keros Therapeutics, Inc. | Activin receptor type IIa variants and methods of use thereof |
| US11717558B2 (en) | 2016-11-10 | 2023-08-08 | Keros Therapeutics, Inc. | Nucleic acid molecules encoding activin receptor type IIA variants |
| US11484573B2 (en) | 2017-11-09 | 2022-11-01 | Keros Therapeutics, Inc. | Activin receptor type IIa variants and methods of use thereof |
| US11884715B2 (en) | 2018-01-12 | 2024-01-30 | Keros Therapeutics, Inc. | Activin receptor type IIB variants and methods of use thereof |
| US12269858B2 (en) | 2018-01-12 | 2025-04-08 | Keros Therapeutics, Inc. | Activin receptor type IIB variants and methods of use thereof |
| US12364737B2 (en) | 2018-05-09 | 2025-07-22 | Keros Therapeutics, Inc. | Activin receptor type IIA variants and methods of use thereof |
| US12440539B2 (en) | 2020-03-20 | 2025-10-14 | Keros Therapeutics, Inc. | Methods of using activin receptor type IIB variants |
| US12186370B1 (en) | 2020-11-05 | 2025-01-07 | Celgene Corporation | ACTRIIB ligand trap compositions and uses thereof |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11066654B2 (en) | Methods and compositions for reducing serum lipids | |
| EP3293198B1 (en) | Variants derived from actriib and uses therefor | |
| HK40036911A (en) | Variants derived from actriib and uses thereof | |
| HK1227889A1 (en) | Variants derived from actriib and uses therefor | |
| HK1227889B (en) | Variants derived from actriib and uses therefor | |
| HK1186477B (en) | Variants derived from actriib and uses therefor | |
| HK1203530B (en) | Variants derived from actriib and uses therefor |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 201080035960.1 Country of ref document: CN |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 10792510 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2012515067 Country of ref document: JP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2765108 Country of ref document: CA |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2011/013364 Country of ref document: MX |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2010263182 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 10247/DELNP/2011 Country of ref document: IN |
|
| ENP | Entry into the national phase |
Ref document number: 20127000112 Country of ref document: KR Kind code of ref document: A |
|
| REEP | Request for entry into the european phase |
Ref document number: 2010792510 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 12004167 Country of ref document: CO Ref document number: 2010792510 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2010263182 Country of ref document: AU Date of ref document: 20100608 Kind code of ref document: A |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: PI1010704 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: PI1010704 Country of ref document: BR Kind code of ref document: A2 Effective date: 20111212 |