WO2005086900A2 - Phospholipases, nucleic acids encoding them and methods for making and using them - Google Patents

Phospholipases, nucleic acids encoding them and methods for making and using them Download PDF

Info

Publication number
WO2005086900A2
WO2005086900A2 PCT/US2005/007908 US2005007908W WO2005086900A2 WO 2005086900 A2 WO2005086900 A2 WO 2005086900A2 US 2005007908 W US2005007908 W US 2005007908W WO 2005086900 A2 WO2005086900 A2 WO 2005086900A2
Authority
WO
WIPO (PCT)
Prior art keywords
seq
polypeptide
phospholipase
nucleic acid
sequence
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2005/007908
Other languages
English (en)
French (fr)
Other versions
WO2005086900A3 (en
Inventor
Svetlana Gramatikova
Geoff Hazlewood
David Lam
Nelson R. Barton
Blake G. Sturgis
Dan E. Robertson
Jincai Li
Joel A. Kreps
Roderick Fielding
Robert C. Brown
Amit Vasavada
Xuqiu Tan
Adrian Badillo
Wilhelmus P. Van Hoek
Giselle Janssen
Charles Isaac
Mark J. Burk
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
BASF Enzymes LLC
Original Assignee
Diversa Corp
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to CA2559060A priority Critical patent/CA2559060C/en
Priority to US10/592,450 priority patent/US7977080B2/en
Priority to ES05727242.9T priority patent/ES2601431T3/es
Priority to EP05727242.9A priority patent/EP1748954B1/en
Priority to BRPI0508559-4 priority patent/BRPI0508559B1/pt
Priority to AU2005221136A priority patent/AU2005221136B2/en
Priority to CN2005800146676A priority patent/CN101426918B/zh
Priority to JP2007502990A priority patent/JP2007531516A/ja
Application filed by Diversa Corp filed Critical Diversa Corp
Publication of WO2005086900A2 publication Critical patent/WO2005086900A2/en
Anticipated expiration legal-status Critical
Priority to US11/625,765 priority patent/US7943360B2/en
Publication of WO2005086900A3 publication Critical patent/WO2005086900A3/en
Priority to US13/090,682 priority patent/US20120100581A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/82Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
    • C12N15/8241Phenotypically and genetically modified plants via recombinant DNA technology
    • C12N15/8242Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/06Antihyperlipidemics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/82Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
    • C12N15/8241Phenotypically and genetically modified plants via recombinant DNA technology
    • C12N15/8242Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits
    • C12N15/8243Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits involving biosynthetic or metabolic pathways, i.e. metabolic engineering, e.g. nicotine, caffeine
    • C12N15/8247Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits involving biosynthetic or metabolic pathways, i.e. metabolic engineering, e.g. nicotine, caffeine involving modified lipid metabolism, e.g. seed oil composition
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/16Hydrolases (3) acting on ester bonds (3.1)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/16Hydrolases (3) acting on ester bonds (3.1)
    • C12N9/18Carboxylic ester hydrolases (3.1.1)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/16Hydrolases (3) acting on ester bonds (3.1)
    • C12N9/18Carboxylic ester hydrolases (3.1.1)
    • C12N9/20Triglyceride splitting, e.g. by means of lipase
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12PFERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
    • C12P7/00Preparation of oxygen-containing organic compounds
    • C12P7/64Fats; Fatty oils; Ester-type waxes; Higher fatty acids, i.e. having at least seven carbon atoms in an unbroken chain bound to a carboxyl group; Oxidised oils or fats
    • C12P7/6409Fatty acids
    • C12P7/6418Fatty acids by hydrolysis of fatty acid esters
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12PFERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
    • C12P7/00Preparation of oxygen-containing organic compounds
    • C12P7/64Fats; Fatty oils; Ester-type waxes; Higher fatty acids, i.e. having at least seven carbon atoms in an unbroken chain bound to a carboxyl group; Oxidised oils or fats
    • C12P7/6436Fatty acid esters
    • C12P7/6445Glycerides
    • C12P7/6458Glycerides by transesterification, e.g. interesterification, ester interchange, alcoholysis or acidolysis
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12PFERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
    • C12P7/00Preparation of oxygen-containing organic compounds
    • C12P7/64Fats; Fatty oils; Ester-type waxes; Higher fatty acids, i.e. having at least seven carbon atoms in an unbroken chain bound to a carboxyl group; Oxidised oils or fats
    • C12P7/6436Fatty acid esters
    • C12P7/6445Glycerides
    • C12P7/6481Phosphoglycerides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide

Definitions

  • This invention relates generally to phospholipase enzymes, polynucleotides encoding the enzymes, methods of making and using these polynucleotides and polypeptides.
  • the invention provides novel polypeptides having phospholipase activity, nucleic acids encoding them and antibodies that bind to them.
  • Industrial methods and products comprising use of these phospholipases are also provided.
  • BACKGROUND Phospholipases are enzymes that hydrolyze the ester bonds of phospholipids. Corresponding to their importance in the metabolism of phospholipids, these enzymes are widespread among prokaryotes and eukaryotes.
  • PLC Phospholipase C
  • PPD Phospholipase D
  • PLC and PLD are important in cell function and signaling. PLD had been the dominant phospholipase in biocatalysis (see, e.g., Godfrey, T. and West S. (1996) Industrial enzymology, 299-300, Stockton Press, New York).
  • Patatins are another type of phospholipase, thought to work as a PLA (see for example, Hirschberg HJ, et al., (2001), Eur J Biochem 268(19):5037-44).
  • Common oilseeds such as soybeans, rapeseed, sunflower seeds, rice bran oil, sesame and peanuts are used as sources of oils and feedstock.
  • the seeds are mechanically and thermally treated.
  • the oil is separated and divided from the meal by a solvent. Using distillation, the solvent is then separated from the oil and recovered. The oil is "degummed” and refined.
  • the solvent content in the meal can be evaporated by thermal treatment in a "desolventizer toaster,” followed by meal drying and cooling.
  • the produced raw oil is processed into edible oil, using special degumming procedures and physical refining. It can also be utilized as feedstock for the production of fatty acids and methyl ester.
  • the meal can be used for animal rations.
  • Degumming is the first step in vegetable oil refining and it is designed to remove contaminating phosphatides that are extracted with the oil but interfere with the subsequent oil processing. These phosphatides are soluble in the vegetable oil only in an anhydrous form and can be precipitated and removed if they are simply hydrated. Hydration is usually accomplished by mixing a small proportion of water continuously with substantially dry oil. Typically, the amount of water is 75% of the phosphatides content, which is typically 1 to 1.5 %.
  • the temperature is not highly critical, although separation of the hydrated gums is better when the viscosity of the oil is reduced at 50°C to 80°C.
  • Many methods for oil degumming are currently used.
  • the process of oil degumming can be enzymatically assisted by using phospholipase enzymes.
  • Phospholipases Al and A2 have been used for oil degumming in various commercial processes, e.g., "ENZY?MAXTM degumming" (Lurgi Life Science Technologies GmbH, Germany).
  • Phospholipase C also has been considered for oil degumming because the phosphate moiety generated by its action on phospholipids is very water soluble and easy to remove and the diglyceride would stay with the oil and reduce losses; see e.g., Godfrey, T. and West S. (1996) Industrial Enzymology, pp.299-300, Stockton Press, New York; Dahlke (1998) “An enzymatic process for the physical refining of seed oils," Chem. Eng. Technol. 21:278-281; Clausen (2001) "Enzymatic oil degumming by a novel microbial phospholipase," Eur. J. Lipid Sci. Technol. 103:333-340.
  • High phosphatide oils such as soy, canola and sunflower are processed differently than other oils such as palm. Unlike the steam or "physical refining" process for low phosphatide oils, these high phosphorus oils require special chemical and mechanical treatments to remove the phosphorus-containing phospholipids. These oils are typically refined chemically in a process that entails neutralizing the free fatty acids to form soap and an insoluble gum fraction. The neutralization process is highly effective in removing free fatty acids and phospholipids but this process also results in significant yield losses and sacrifices in quality. In some cases, the high phosphatide crude oil is degummed in a step preceding caustic neutralization. This is the case for soy oil utilized for lecithin wherein the oil is first water or acid degummed.
  • Phytosterols are members of the "triterpene" family of natural products, which includes more than 100 different phytosterols and more than 4000 other types of triterpenes. In general, phytosterols are thought to stabilize plant membranes, with an increase in the sterol/phospholipid ration leading to membrane rigidification. Chemically, phytosterols closely resemble cholesterol in structure and are thought to regulate membrane fluidity in plant membranes, as does cholesterol in animal membranes. The major phytosterols are ⁇ -sitosterol, campesterol and stigmasterol.
  • Soybean oil is widely used and is an important foodstuff, accounting for ⁇ 30% of the oil production from seeds and fruits. Soybeans contain only 20% oil, and the extraction is usually done by using a solvent such as hexane on a commercial scale. The recognized quality of its oil and the nutritive value of the meal protein make soya bean a primary oilseed. Before extraction, soybeans must be cleaned, cracked and flaked as efficient solvent extraction of oil requires that every oil cell is broken to improve the mass transfer.
  • DAG oil is an edible oil containing 80% or greater amount of DAG than natural fatty acids. It has been shown in humans that postprandial elevation of triglyceride in chylomicrons is markedly smaller after ingestion of a DAG oil emulsion compared to a TAG oil with a similar fatty acid composition. In studies using Japanese men and American men and women, long-term DAG oil consumption promoted weight loss and body fat reduction. One study showed that substitution of DAG oil for ordinary cooking oil reduces the incidence of obesity and other risk factors.
  • sequence identities are determined by analysis with a sequence comparison algorithm or by a visual inspection.
  • the invention provides isolated or recombinant nucleic acids comprising a nucleic acid sequence having at least 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%,
  • nucleic acid encodes at least one polypeptide having a phospholipase (PL) activity, e.g., a phospholipase A, C or D activity, or any combination of phospholipase activity, for example, a PLA, PL C and/or PL D activity - as a multifunctional activity.
  • PL phospholipase
  • sequence identities are determined by analysis with a sequence comparison algorithm or by a visual inspection.
  • the invention provides isolated or recombinant nucleic acids comprising a nucleic acid sequence having at least 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, or complete (100%) sequence identity to SEQ ID NO:7 over a region of at least about 10, 15, 20, 25, 30, 35, 40, 45, 50, 75, 100, 150, 200, 250, 300, 350, 400, 450, 500,
  • sequence identities are determined by analysis with a sequence comparison algorithm or by a visual inspection.
  • the isolated or recombinant nucleic acid encodes a polypeptide comprising a sequence as set forth in SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO: 10, SEQ ID NO:12, SEQ ID NO: 14, SEQ ID NO: 16, SEQ ID NO: 18, SEQ ID NO:20, SEQ ID NO:22, SEQ ID NO:24, SEQ ID NO:26, SEQ ID NO:28, SEQ ID NO:30, SEQ ID NO:32, SEQ ID NO:34, SEQ ID NO:36, SEQ ID NO:38, SEQ ID NO:40, SEQ ID NO:42, SEQ ID NO:44, SEQ ID NO:46, SEQ ID NO:48, SEQ ID NO:50, SEQ ID NO:52, SEQ ID NO:54, SEQ ID NO:56, SEQ ID NO:58, SEQ ID NO
  • these polypeptides have a phospholipase, e.g., a phospholipase A, B, C or D activity, or any combination of phospholipase activity, for example, a PLA, PL C and/or PL D activity - as a multifunctional activity.
  • the sequence comparison algorithm is a BLAST algorithm, such as a BLAST version 2.2.2 algorithm.
  • the filtering setting is set to blastall -p blastp -d "nr pataa" -F F and all other options are set to default.
  • the phospholipase activity can comprise a phospholipase C (PLC) activity; a phospholipase A (PLA) activity, such as a phospholipase Al or phospholipase A2 activity; a phospholipase D (PLD) activity, such as a phospholipase DI or a phospholipase D2 activity; a phospholipase B (PLB) activity, e.g., a phospholipase and a lysophospholipase (LPL) activity or a phospholipase and a lysophospholipase- transacylase (LPT A) activity or a phospholipase and a lysophospholipase (LPL) activity and lysophospholipase-transacylase (LPT A) activity; or patatin activity, or a combination thereof.
  • PLC phospholipase C
  • PLA phospholip
  • the phospholipase activity can comprise hydrolysis of a glycoprotein, e.g., as a glycoprotein found in a potato tuber.
  • the phospholipase activity can comprise a patatin enzymatic activity.
  • the phospholipase activity can comprise a lipid acyl hydrolase (LAH) activity.
  • LAH lipid acyl hydrolase
  • the isolated or recombinant nucleic acid encodes a polypeptide having a phospholipase activity which is thermostable.
  • the polypeptide can retain a phospholipase activity under conditions comprising a temperature range of between about 20°C to about 30°C, between about 25°C to about 40°C, between about 37°C to about 95°C; between about 55°C to about 85°C, between about 70°C to about 95°C, or, between about 90°C to about 95°C.
  • the isolated or recombinant nucleic acid encodes a polypeptide having a phospholipase activity which is thermotolerant.
  • the polypeptide can retain a phospholipase activity after exposure to a temperature in the range from greater than 37°C to about 95°C or anywhere in the range from greater than 55°C to about 85°C. In one aspect, the polypeptide retains a phospholipase activity after exposure to a temperature in the range from greater than 90°C to about 95°C at pH 4.5.
  • the polypeptide can retain a phospholipase activity under conditions comprising about pH 8, pH 7.5, pH 7, pH 6.5, pH 6.0, pH 5.5, pH 5, or pH 4.5.
  • the polypeptide can retain a phospholipase activity under conditions comprising a temperature range of between about 40°C to about 70°C.
  • the isolated or recombinant nucleic acid comprises a sequence that hybridizes under stringent conditions to a sequence as set forth in SEQ ID NO:l, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:ll, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, SEQ ID NO:23, SEQ ID NO:25, SEQ ID NO:27, SEQ ID NO:29, SEQ ID NO:31, SEQ ID NO:33, SEQ ID NO:35, SEQ ID NO:37, SEQ ID NO:39, SEQ ID NO:41, SEQ ID NO:43, SEQ ID NO:45, SEQ ID NO:47, SEQ ID NO:49, SEQ ID NO:51, SEQ ID NO:53, SEQ ID NO:55, SEQ ID NO:57, SEQ ID NO:59, SEQ ID NO:61, SEQ ID NO:13,
  • the nucleic acid can at least about 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850 or residues in length or the full length of the gene or transcript, with or without a signal sequence, as described herein.
  • the stringent conditions can be highly stringent, moderately stringent or of low stringency, as described herein.
  • the stringent conditions can include a wash step, e.g., a wash step comprising a wash in 0.2X SSC at a temperature of about 65°C for about 15 minutes.
  • the invention provides a nucleic acid probe for identifying a nucleic acid encoding a polypeptide with a phospholipase, e.g., a phospholipase, activity, wherein the probe comprises at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, or more, consecutive bases of a sequence of the invention, e.g., a sequence as set forth in SEQ ID NO:l, SEQ ID NO:3, SEQ ID NO:5, or SEQ ID NO:7, and the probe identifies the nucleic acid by binding or hybridization.
  • a phospholipase e.g., a phospholipase, activity
  • the probe comprises at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600
  • the invention provides an amplification primer sequence pair for amplifying a nucleic acid encoding a polypeptide having a phospholipase activity, wherein the primer pair is capable of amplifying a nucleic acid comprising a sequence of the invention, or fragments or subsequences thereof.
  • One or each member of the amplification primer sequence pair can comprise an oligonucleotide comprising at least about 10 to 50 consecutive bases of the sequence, or about 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 or more consecutive bases of the sequence.
  • the invention provides amplification primer pairs, wherein the primer pair comprises a first member having a sequence as set forth by about the first (the 5') 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 or more residues of a nucleic acid of the invention, and a second member having a sequence as set forth by about the first (the 5') 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 or more residues of the complementary strand of the first member.
  • the invention provides phospholipases generated by amplification, e.g., polymerase chain reaction (PCR), using an amplification primer pair of the invention.
  • PCR polymerase chain reaction
  • the invention provides methods of making a phospholipase by amplification, e.g., polymerase chain reaction (PCR), using an amplification primer pair of the invention.
  • the amplification primer pair amplifies a nucleic acid from a library, e.g., a gene library, such as an environmental library.
  • the invention provides methods of amplifying a nucleic acid encoding a polypeptide having a phospholipase activity comprising amplification of a template nucleic acid with an amplification primer sequence pair capable of amplifying a nucleic acid sequence of the invention, or fragments or subsequences thereof.
  • the amplification primer pair can be an amplification primer pair of the invention.
  • the promoter can be, e.g., a seed-specific, a leaf-specific, a root-specific, a stem-specific or an abscission-induced promoter.
  • the expression cassette can further comprise a plant or plant virus expression vector.
  • the invention provides cloning vehicles comprising an expression cassette (e.g., a vector) of the invention or a nucleic acid of the invention.
  • the cloning vehicle can be a viral vector, a plasmid, a phage, a phagemid, a cosmid, a fosmid, a bacteriophage or an artificial chromosome.
  • the viral vector can comprise an adenovirus vector, a retroviral vector or an adeno-associated viral vector.
  • the cloning vehicle can comprise a bacterial artificial chromosome (BAC), a plasmid, a bacteriophage PI -derived vector (PAC), a yeast artificial chromosome (YAC), or a mammalian artificial chromosome (MAC).
  • the mvention provides transformed cell comprising a nucleic acid of the invention or an expression cassette (e.g., a vector) of the invention, or a cloning vehicle of the invention.
  • the transformed cell can be a bacterial cell, a mammalian cell, a fungal cell, a yeast cell, an insect cell or a plant cell.
  • the invention provides transgenic seeds comprising a nucleic acid of the invention or an expression cassette (e.g., a vector) of the invention.
  • the transgenic seed can be a corn seed, a wheat kernel, an oilseed, a rapeseed (a canola plant), a soybean seed, a palm kernel, a sunflower seed, a sesame seed, a peanut, rice or a tobacco plant seed.
  • the mvention provides an antisense oligonucleotide comprising a nucleic acid sequence complementary to or capable of hybridizing under stringent conditions to a nucleic acid of the invention.
  • the invention provides methods of inhibiting the translation of a phospholipase message in a cell comprising administering to the cell or expressing in the cell an antisense oligonucleotide comprising a nucleic acid sequence complementary to or capable of hybridizing under stringent conditions to a nucleic acid of the invention.
  • the invention provides an antisense oligonucleotide comprising a nucleic acid sequence complementary to or capable of hybridizing under stringent conditions to a nucleic acid of the invention.
  • the invention provides methods of inhibiting the translation of a phospholipase message in a cell comprising administering to the cell or expressing in the cell an antisense oligonucleotide comprising a nucleic acid sequence complementary to or capable of hybridizing under stringent conditions to a nucleic acid of the invention.
  • the antisense oligonucleotide can be between about 10 to 50, about 20 to 60, about 30 to 70, about 40 to 80, about 60 to 100, about 70 to 110, or about 80 to 120 bases in length.
  • the invention provides methods of inhibiting the translation of a phospholipase, e.g., a phospholipase, message in a cell comprising administering to the cell or expressing in the cell an antisense oligonucleotide comprising a nucleic acid sequence complementary to or capable of hybridizing under stringent conditions to a nucleic acid of the invention.
  • the invention provides double-stranded inhibitory RNA (RNAi) molecules comprising a subsequence of a sequence of the invention.
  • RNAi double-stranded inhibitory RNA
  • the RNAi is about 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25 or more duplex nucleotides in length.
  • the invention provides methods of inhibiting the expression of a phospholipase, e.g., a phospholipase, in a cell comprising administering to the cell or expressing in the cell a double-stranded inhibitory RNA (iRNA), wherein the RNA comprises a subsequence of a sequence of the invention.
  • a phospholipase e.g., a phospholipase
  • iRNA double-stranded inhibitory RNA
  • the invention provides an isolated or recombinant polypeptide comprising an amino acid sequence having at least about 50%, 51%, 52%, 53%, 54%>, 55%), 56%>, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%, or more, or complete (100%) sequence identity to an exemplary polypeptide or peptide of the invention (e.g., SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO:10, SEQ ID NO:12, SEQ ID NO:14, SEQ ID NO:16
  • the invention provides an isolated or recombinant polypeptide comprising an amino acid sequence having at least about 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, or complete (100%) sequence identity to SEQ ID NO:4.
  • the invention provides an isolated or recombinant polypeptide comprising an amino acid sequence having at least about 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, or complete (100%)) sequence identity to SEQ ID NO:6.
  • the polypeptide can have a phospholipase activity, e.g., a phospholipase A, B, C or D activity, or any combination of phospholipase activity, for example, a PLA, PL C and/or PL D activity - as a multifunctional activity.
  • a polypeptide of the invention is enzymatically active, but lacks a lipase activity, e.g., lacks any enzymatic activity that affects a neutral oil (triglyceride) fraction.
  • a phospholipase comprises a combination of one or more of the enzyme activities described herein, for example, an phospholipase can have PLC and PLA activity; PLB and PLA activity; PLC and PLD activity; PLC and PLB activity; PLB and patatin activity; PLC and patatin activity; PLD and PLA; PLD, PLA, PLB and PLC activity; or PLD, PLA, PLB, PLC and patatin activity; or, a phospholipase and a lysophospholipase (LPL) activity or a phospholipase and a lysophospholipase- transacylase (LPTA) activity or a phospholipase and a lysophospholipase (LPL) activity and lysophospholipase-transacylase (LPTA) activity, or any combination thereof.
  • an phospholipase can have PLC and PLA activity; PLB and PLA activity; PLC and PLD activity; PLC and P
  • the phospholipase activity can comprise hydrolysis of a glycoprotein, e.g., as a glycoprotein found in a potato tuber.
  • the phospholipase activity can comprise a patatin enzymatic activity.
  • the phospholipase activity can comprise a lipid acyl hydrolase (LAH) activity.
  • LAH lipid acyl hydrolase
  • the phospholipase activity is thermostable.
  • the polypeptide can retain a phospholipase activity under conditions comprising a temperature range of between about 20 to about 30°C, between about 25°C to about 40°C, between about 37°C to about 95°C, between about 55°C to about 85°C, between about 70°C to about 95°C, or between about 90°C to about 95°C.
  • the polypeptide can retain a phospholipase activity under conditions comprising about pH 7, pH 7.5 pH 8.0, pH 8.5, pH 9, pH 9.5, pH 10, pH 10.5 or pH 11 or more (more basic).
  • the isolated or recombinant polypeptide can comprise the polypeptide of the invention that lacks a signal sequence.
  • the isolated or recombinant polypeptide can comprise the polypeptide of the invention comprising a heterologous signal sequence, such as a heterologous phospholipase or non-phospholipase signal sequence.
  • the invention provides isolated or recombinant peptides comprising an amino acid sequence having at least 95%, 96%, 97%, 98%>, 99%>, or more sequence identity to residues 1 to 29 of SEQ ID NO:2, at least 95%, 96%, 97%, 98%, 99%, or more sequence identity to residues 1 to 24 of SEQ ID NO:4, at least 95%, 96%, 97%, 98%,
  • the invention provides chimeric proteins comprising a first domain comprising a signal sequence of the invention and at least a second domain.
  • the protein can be a fusion protein.
  • the second domain can comprise an enzyme.
  • the enzyme can be a phospholipase.
  • the invention provides chimeric polypeptides comprising at least a first domain comprising signal peptide (SP) of the invention or a catalytic domain (CD), or active site, of a phospholipase of the invention and at least a second domain comprising a heterologous polypeptide or peptide, wherein the heterologous polypeptide or peptide is not naturally associated with the signal peptide (SP) or catalytic domain (CD).
  • the heterologous polypeptide or peptide is not a phospholipase.
  • the heterologous polypeptide or peptide can be amino terminal to, carboxy terminal to or on both ends of the signal peptide (SP) or catalytic domain (CD).
  • the invention also provides isolated, synthetic or recombinant phospholipases encoded by a sequence made by this method.
  • the invention provides methods for making a variant phospholipase coding sequence encoding a phospholipase having decreased resistance to a protease comprising modifying an amino acid equivalent to position 131 of SEQ ID NO:2 to one, several or all of the following residues: Tryptophan (W); Glutamate (E); Tyrosine (Y), including variants to SEQ ID NO:2 (and the nucleic acid that encode them) having these exemplary modifications.
  • the invention also provides isolated, synthetic or recombinant phospholipases encoded by a sequence made by this method.
  • the invention provides protein preparations comprising a polypeptide of the invention, wherein the protein preparation comprises a liquid, a solid or a gel.
  • the invention provides heterodimers comprising a polypeptide of the invention and a second protein or domain.
  • the second member of the heterodimer can be a different phospholipase, a different enzyme or another protein.
  • the second domain can be a polypeptide and the heterodimer can be a fusion protein.
  • the second domain can be an epitope or a tag.
  • the invention provides homodimers comprising a polypeptide of the invention.
  • the invention provides immobilized polypeptides having a phospholipase activity, wherein the polypeptide comprises a polypeptide of the invention, a polypeptide encoded by a nucleic acid of the invention, or a polypeptide comprising a polypeptide of the invention and a second domain (e.g., a fusion protein).
  • the polypeptide comprises a polypeptide of the invention, a polypeptide encoded by a nucleic acid of the invention, or a polypeptide comprising a polypeptide of the invention and a second domain (e.g., a fusion protein).
  • a polypeptide of the invention is immobilized on a cell, a vesicle, a liposome, a film, a membrane, a metal, a resin, a polymer, a ceramic, a glass, a microelectrode, a graphitic particle, a bead, a gel, a plate, crystals, a tablet, a pill, a capsule, a powder, an agglomerate, a surface, a porous structure, an array or a capillary tube.
  • a polypeptide of the invention is immobilized on materials such as grains, husks, bark, skin, hair, enamel, bone, shell and materials deriving from them, or animal feed materials, or a combination thereof.
  • Polypeptides of the invention e.g., phospholipases
  • phospholipases can be also present alone or as mixture of phospholipases or phospholipases and other hydrolytic enzymes such as cellulases, xylanases, proteases, lipases, amylases, or redox enzymes such as laccases, peroxidases, catalases, oxidases, or reductases.
  • a solid form such as a powder, lyophilized preparations, granules, tablets, bars, crystals, capsules, pills, pellets, or in a liquid form such as an aqueous solution, an aerosol, a gel, a paste, a slurry, an aqueous/oil emulsion, a cream, a capsule, vesicular, or micellar suspension.
  • these formulations of the invention can comprise any or a combination of the following ingredients: polyols such as polyethylene glycols, polyvinylalcohols, glycerol, sugars such as sucrose, sorbitol, trehalose, glucose, fructose, maltose, gelling agents such as guar gums, carageenans, alginates, dextrans, cellulosic derivatives, pectins, salts such as sodium chloride, sodium sulfate, ammonium sulfate, calcium chloride, magnesium chloride, zinc chloride, zinc sulfate, salts of fatty acids and their derivatives, metal chelators such as EDTA, EGTA, sodium citrate, antimicrobial agents such as fatty acids, derivatives thereof, parabens, sorbates, benzoates, additionally compounds to block the impact of proteases such as bulk proteins such as BSA, wheat hydrolysates, borate compounds, emulsifiers such as non-
  • cross-linking and protein modification such as pegylation, fatty acid modification and glycosylation are used to improve the stability of a polypeptide of the invention (e.g., enzyme stability).
  • polyols and/or sugars comprise from about 5%> to about 60%, or more, of the formulation, from about
  • zinc chloride is present in the formulation at concentrations comprising from about 0.1 mM to about 20 mM, from about 0.5 mM to about 10 mM, from about 1 mM to about 5 mM, or from about 0.1 mM to about 5 mM).
  • zinc sulfate is present in the formulation at concentrations comprising from about 0.1 mM to about 20 mM, from about 0.5 mM to about 10 mM, from about 1 mM to about 5 mM, or from about 0.1 mM to about 5 mM).
  • salts of fatty acids and/or their derivatives comprise from about 5% to about 40%> of the formulation, from about 10% to about 30% of the formulation, from about 15% to about 25% of the formulation, or from about 5%> to about 20%> of the formulation.
  • metal chelators such as EDTA, EGTA, and/or sodium citrate are present in the formulation at concentrations comprising from 0.1 mM to about 10 mM), from about 0.5 mM to about 8 mM, from about 1 mM to about 5 mM, or from about 0.1 mM to about 1 mM.
  • antimicrobials such as parabens, sorbates, and/or benzoates comprise from about 0.01% to about 10% of the formulation, from about
  • bulk proteins such as BSA and/or wheat hydrolysates comprise from about 1% to about 20% of the formulation, from about 5% to about 15% of the formulation, from about 2.5% to about 7.5%) of the formulation, or from about 1%> to about 5%> of the formulation.
  • emulsifiers such as non-ionic and/or ionic detergents are present in the formulation at concentrations comprising from about IX critical micelle concentration (CMC) to about 10X CMC, from about 2.5X CMC to about 7.5X CMC, from about IX CMC to about 5X CMC, or from about 3X CMC to about 6X CMC.
  • vitamins, amino acids, reducing agents and or antioxidant compounds comprise from about O.P/o to about 5% of the formulation, from about 0.5%> to about 4%> of the formulation, from about 1%> to about 2.5% of the formulation, or from about 0.1%> to about 1%) of the formulation.
  • the invention provides arrays comprising an immobilized polypeptide, wherein the polypeptide is a phospholipase of the invention or is a polypeptide encoded by a nucleic acid of the invention.
  • the invention provides arrays comprising an immobilized nucleic acid of the invention.
  • the invention provides an array comprising an immobilized antibody of the invention.
  • the invention provides isolated or recombinant antibodies that specifically bind to a polypeptide of the invention or to a polypeptide encoded by a nucleic acid of the invention.
  • the antibody can be a monoclonal or a polyclonal antibody.
  • the invention provides hybridomas comprising an antibody of the invention.
  • the invention provides methods of isolating or identifying a polypeptide with a phospholipase activity comprising the steps of: (a) providing an antibody of the invention; (b) providing a sample comprising polypeptides; and, (c) contacting the sample of step (b) with the antibody of step (a) under conditions wherein the antibody can specifically bind to the polypeptide, thereby isolating or identifying a phospholipase.
  • the invention provides methods of making an anti-phospholipase antibody comprising administering to a non-human animal a nucleic acid of the invention, or a polypeptide of the invention, in an amount sufficient to generate a humoral immune response, thereby making an anti-phospholipase antibody.
  • the invention provides methods of producing a recombinant polypeptide comprising the steps of: (a) providing a nucleic acid of the invention operably linked to a promoter; and, (b) expressing the nucleic acid of step (a) under conditions that allow expression of the polypeptide, thereby producing a recombinant polypeptide.
  • the nucleic acid can comprise a sequence having at least 85%> sequence identity to SEQ ID NO: 1 over a region of at least about 100 residues, having at least 80% sequence identity to SEQ
  • the nucleic acid can comprise a nucleic acid that hybridizes under stringent conditions to a nucleic acid as set forth in SEQ ID NO: 1, or a subsequence thereof; a sequence as set forth in SEQ ID NO: 3, or a subsequence thereof; a sequence as set forth in SEQ ID NO: 5, or a subsequence thereof; or, a sequence as set forth in SEQ ID NO: 7, or a subsequence thereof.
  • the method can further comprise transforming a host cell with the nucleic acid of step (a) followed by expressing the nucleic acid of step (a), thereby producing a recombinant polypeptide in a transformed cell.
  • the method can further comprise inserting into a host non-human animal the nucleic acid of step (a) followed by expressing the nucleic acid of step (a), thereby producing a recombinant polypeptide in the host non-human animal.
  • the invention provides methods for identifying a polypeptide having a phospholipase activity comprising the following steps: (a) providing a polypeptide of the invention or a polypeptide encoded by a nucleic acid of the invention, or a fragment or variant thereof, (b) providing a phospholipase substrate; and, (c) contacting the polypeptide or a fragment or variant thereof of step (a) with the substrate of step (b) and detecting an increase in the amount of substrate or a decrease in the amount of reaction product, wherein a decrease in the amount of the substrate or an increase in the amount of the reaction product detects a polypeptide having a phospholipase activity.
  • the nucleic acid comprises a sequence having at least 85%> sequence identity to SEQ ID NO: 1 over a region of at least about 100 residues, having at least 80%> sequence identity to SEQ ID NO:3 over a region of at least about 100 residues, having at least 80%> sequence identity to SEQ ID NO:5 over a region of at least about 100 residues, or having at least 70%> sequence identity to SEQ ID NO: 7 over a region of at least about 100 residues, wherein the sequence identities are determined by analysis with a sequence comparison algorithm or by visual inspection.
  • the invention provides methods for identifying a phospholipase substrate comprising the following steps: (a) providing a polypeptide of the invention or a polypeptide encoded by a nucleic acid of the invention; (b) providing a test substrate; and, (c) contacting the polypeptide of step (a) with the test substrate of step (b) and detecting an increase in the amount of substrate or a decrease in the amount of reaction product, wherein a decrease in the amount of the substrate or an increase in the amount of the reaction product identifies the test substrate as a phospholipase substrate.
  • the nucleic acid can have at least 85%> sequence identity to SEQ ID NO: 1 over a region of at least about 100 residues, at least 80% sequence identity to SEQ ID NO: 3 over a region of at least about 100 residues, at least 80%> sequence identity to SEQ ID NO: 5 over a region of at least about 100 residues, or, at least 70%> sequence identity to SEQ ID NO:7 over a region of at least about 100 residues, wherein the sequence identities are determined by analysis with a sequence comparison algorithm or by visual inspection.
  • the invention provides methods of determining whether a compound specifically binds to a phospholipase comprising the following steps: (a) expressing a nucleic acid or a vector comprising the nucleic acid under conditions permissive for translation of the nucleic acid to a polypeptide, wherein the nucleic acid and vector comprise a nucleic acid or vector of the invention; or, providing a polypeptide of the invention (b) contacting the polypeptide with the test compound; and, (c) determining whether the test compound specifically binds to the polypeptide, thereby determining that the compound specifically binds to the phospholipase.
  • the nucleic acid sequence has at least 85%> sequence identity to SEQ ID NO:l over a region of at least about 100 residues, at least 80% sequence identity to SEQ ID NO:3 over a region of at least about 100 residues, least 80% sequence identity to SEQ ID NO:5 over a region of at least about 100 residues, or, at least 70% sequence identity to SEQ ID NO:7 over a region of at least about 100 residues, wherein the sequence identities are determined by analysis with a sequence comparison algorithm or by visual inspection.
  • the nucleic acid hybridizes under stringent conditions to a sequence as set forth in SEQ ID NO: 1, or a subsequence thereof; a sequence as set forth in SEQ ID NO:3, or a subsequence thereof; a sequence as set forth in SEQ ID NO:5, or a subsequence thereof; or, a sequence as set forth in SEQ ID NO:7, or a subsequence thereof.
  • the invention provides methods for identifying a modulator of a phospholipase activity comprising the following steps: (a) providing a polypeptide of the invention or a polypeptide encoded by a nucleic acid of the invention; (b) providing a test compound; (c) contacting the polypeptide of step (a) with the test compound of step (b); and, measuring an activity of the phospholipase, wherein a change in the phospholipase activity measured in the presence of the test compound compared to the activity in the absence of the test compound provides a determination that the test compound modulates the phospholipase activity.
  • the nucleic acid can have at least 85%) sequence identity to SEQ ID NO: 1 over a region of at least about 100 residues, at least 80%> sequence identity to SEQ ID NO: 3 over a region of at least about 100 residues, at least 80% sequence identity to SEQ ID NO: 5 over a region of at least about 100 residues, or, at least 70%> sequence identity to SEQ ID NO:7 over a region of at least about 100 residues, wherein the sequence identities are determined by analysis with a sequence comparison algorithm or by visual inspection.
  • the nucleic acid can hybridize under stringent conditions to a nucleic acid sequence selected from the group consisting of a sequence as set forth in SEQ ID NO:l, or a subsequence thereof; a sequence as set forth in SEQ ID NO:3, or a subsequence thereof; a sequence as set forth in SEQ ID NO:5, or a subsequence thereof; and, a sequence as set forth in SEQ ID NO: 7, or a subsequence thereof.
  • the phospholipase activity is measured by providing a phospholipase substrate and detecting an increase in the amount of the substrate or a decrease in the amount of a reaction product.
  • the decrease in the amount of the substrate or the increase in the amount of the reaction product with the test compound as compared to the amount of substrate or reaction product without the test compound identifies the test compound as an activator of phospholipase activity.
  • the increase in the amount of the substrate or the decrease in the amount of the reaction product with the test compound as compared to the amount of substrate or reaction product without the test compound identifies the test compound as an inhibitor of phospholipase activity.
  • the invention provides computer systems comprising a processor and a data storage device wherein said data storage device has stored thereon a polypeptide sequence of the invention or a nucleic acid sequence of the invention.
  • the computer system can further comprise a sequence comparison algorithm and a data storage device having at least one reference sequence stored thereon.
  • the sequence comparison algorithm can comprise a computer program that indicates polymorphisms.
  • the computer system can further comprising an identifier that identifies one or more features in said sequence.
  • the invention provides computer readable mediums having stored thereon a sequence comprising a polypeptide sequence of the invention or a nucleic acid sequence of the invention.
  • the invention provides methods for identifying a feature in a sequence comprising the steps of: (a) reading the sequence using a computer program which identifies one or more features in a sequence, wherein the sequence comprises a polypeptide sequence of the invention or a nucleic acid sequence of the invention; and, (b) identifying one or more features in the sequence with the computer program.
  • the invention provides methods for comparing a first sequence to a second sequence comprising the steps of: (a) reading the first sequence and the second sequence through use of a computer program which compares sequences, wherein the first sequence comprises a polypeptide sequence of the invention or a nucleic acid sequence of the invention; and, (b) determining differences between the first sequence and the second sequence with the computer program.
  • the step of determining differences between the first sequence and the second sequence further comprises the step of identifying polymorphisms.
  • the method further comprises an identifier (and use of the identifier) that identifies one or more features in a sequence.
  • the method comprises reading the first sequence using a computer program and identifying one or more features in the sequence.
  • the invention provides methods for isolating or recovering a nucleic acid encoding a polypeptide with a phospholipase activity from an environmental sample comprising the steps of: (a) providing an amplification primer sequence pair for amplifying a nucleic acid encoding a polypeptide with a phospholipase activity, wherein the primer pair is capable of amplifying a nucleic acid of the invention (e.g., SEQ ID NO:l, or a subsequence thereof; SEQ ID NO:3, or a subsequence thereof; SEQ ID NO:5, or a subsequence thereof; or SEQ ID NO:7, or a subsequence thereof, etc.); (b) isolating a nucleic acid from the environmental sample or treating the environmental sample such that nucleic acid in the sample is accessible for hybridization to the amplification primer pair; and, (c) combining the nucleic acid of step (b) with the amplification primer pair of step (a)
  • each member of the amplification primer sequence pair comprises an oligonucleotide comprising at least about 10 to 50 consecutive bases of a nucleic acid sequence of the invention. In one aspect, the amplification primer sequence pair is an amplification pair of the invention.
  • the invention provides methods for isolating or recovering a nucleic acid encoding a polypeptide with a phospholipase activity from an environmental sample comprising the steps of: (a) providing a polynucleotide probe comprising a nucleic acid sequence of the invention, or a subsequence thereof; (b) isolating a nucleic acid from the environmental sample or treating the environmental sample such that nucleic acid in the sample is accessible for hybridization to a polynucleotide probe of step (a); (c) combining the isolated nucleic acid or the treated environmental sample of step (b) with the polynucleotide probe of step (a); and, (d) isolating a nucleic acid that specifically hybridizes with the polynucleotide probe of step (a), thereby isolating or recovering a nucleic acid encoding a polypeptide with a phospholipase activity from the environmental sample.
  • the environmental sample comprises a water sample, a liquid sample, a soil sample, an air sample or a biological sample.
  • the biological sample is derived from a bacterial cell, a protozoan cell, an insect cell, a yeast cell, a plant cell, a fungal cell, an algal (algae) cell, a lichen, or a mammalian cell.
  • the invention provides methods of generating a variant of a nucleic acid encoding a phospholipase comprising the steps of: (a) providing a template nucleic acid comprising a nucleic acid of the invention; (b) modifying, deleting or adding one or more nucleotides in the template sequence, or a combination thereof, to generate a variant of the template nucleic acid.
  • the method further comprises expressing the variant nucleic acid to generate a variant phospholipase polypeptide.
  • the modifications, additions or deletions are introduced by a method selected from the group consisting of recombination, recursive sequence recombination, phosphothioate-modified DNA mutagenesis, uracil-containing template mutagenesis, gapped duplex mutagenesis, point mismatch repair mutagenesis, repair- deficient host strain mutagenesis, chemical mutagenesis, radiogenic mutagenesis, deletion mutagenesis, restriction-selection mutagenesis, restriction-purification mutagenesis, artificial gene synthesis, ensemble mutagenesis, chimeric nucleic acid multimer creation and/or a combination thereof.
  • the method is iteratively repeated until a phospholipase coding sequence having an altered codon usage from that of the template nucleic acid is produced.
  • the method can be iteratively repeated until a phospholipase gene having higher or lower level of message expression or stability from that of the template nucleic acid is produced.
  • the invention provides methods for modifying codons in a nucleic acid encoding a phospholipase to increase its expression in a host cell, the method comprising (a) providing a nucleic acid of the invention encoding a phospholipase; and, (b) identifying a non-prefened or a less prefened codon in the nucleic acid of step (a) and replacing it with a prefened or neutrally used codon encoding the same amino acid as the replaced codon, wherein a prefened codon is a codon over-represented in coding sequences in genes in the host cell and a non-prefened or less prefened codon is a codon under-represented in coding sequences in genes in the host cell, thereby modifying the nucleic acid to increase its expression in a host cell.
  • the invention provides methods for modifying codons in a nucleic acid encoding a phospholipase, the method comprising (a) providing a nucleic acid of the invention encoding a phospholipase; and, (b) identifying a codon in the nucleic acid of step (a) and replacing it with a different codon encoding the same amino acid as the replaced codon, thereby modifying codons in a nucleic acid encoding a phospholipase.
  • the mvention provides methods for modifying a codon in a nucleic acid encoding a phosphohpase to decrease its expression in a host cell, the method comprising (a) providing a nucleic acid of the invention encoding a phospholipase; and, (b) identifying at least one prefened codon in the nucleic acid of step (a) and replacing it with a non-prefened or less prefened codon encoding the same amino acid as the replaced codon, wherein a prefened codon is a codon over-represented in coding sequences in genes in a host cell and a non-prefened or less prefened codon is a codon under- represented in coding sequences in genes in the host cell, thereby modifying the nucleic acid to decrease its expression in a host cell.
  • the host cell is a bacterial cell, a fungal cell, an insect cell, a yeast cell, a plant cell, an algal (algae) cell, a lichen, or a mammalian cell.
  • the invention provides methods for producing a library of nucleic acids encoding a plurality of modified phospholipase active sites or substrate binding sites, wherein the modified active sites or substrate binding sites are derived from a first nucleic acid comprising a sequence encoding a first active site or a first substrate binding site the method comprising: (a) providing a first nucleic acid encoding a first active site or first substrate binding site, wherein the first nucleic acid sequence comprises a nucleic acid of the invention; (b) providing a set of mutagenic oligonucleotides that encode naturally- occurring amino acid variants at a plurality of targeted codons in the first nucleic acid; and, (c) using the set of mutagenic oligonucleotides to
  • the method comprises mutagenizing the first nucleic acid of step (a) by a method comprising an optimized directed evolution system, Gene Site Saturation MutagenesisTM (GSSMTM), and synthetic ligation reassembly (SLR).
  • the method can further comprise mutagenizing the first nucleic acid of step (a) or variants by a method comprising enor-prone PCR, shuffling, oligonucleotide-directed mutagenesis, assembly PCR, sexual PCR mutagenesis, in vivo mutagenesis, cassette mutagenesis, recursive ensemble mutagenesis, exponential ensemble mutagenesis, site-specific mutagenesis, gene reassembly, Gene Site Saturation MutagenesisTM (GSSMTM), synthetic ligation reassembly (SLR) and a combination thereof.
  • GSSMTM Gene Site Saturation MutagenesisTM
  • SLR synthetic ligation reassembly
  • the method can further comprise mutagenizing the first nucleic acid of step (a) or variants by a method comprising recombination, recursive sequence recombination, phosphothioate-modified DNA mutagenesis, uracil-containing template mutagenesis, gapped duplex mutagenesis, point mismatch repair mutagenesis, repair-deficient host strain mutagenesis, chemical mutagenesis, radiogenic mutagenesis, deletion mutagenesis, restriction-selection mutagenesis, restriction-purification mutagenesis, artificial gene synthesis, ensemble mutagenesis, chimeric nucleic acid multimer creation and a combination thereof.
  • the mvention provides methods for making a small molecule comprising the steps of: (a) providing a plurality of biosynthetic enzymes capable of synthesizing or modifying a small molecule, wherein one of the enzymes comprises a phospholipase enzyme encoded by a nucleic acid of the invention; (b) providing a substrate for at least one of the enzymes of step (a); and, (c) reacting the substrate of step (b) with the enzymes under conditions that facilitate a plurality of biocatalytic reactions to generate a small molecule by a series of biocatalytic reactions.
  • the invention provides methods for modifying a small molecule comprising the steps: (a) providing a phospholipase enzyme encoded by a nucleic acid of the invention; (b) providing a small molecule; and, (c) reacting the enzyme of step
  • the method comprises providing a plurality of small molecule substrates for the enzyme of step (a), thereby generating a library of modified small molecules produced by at least one enzymatic reaction catalyzed by the phospholipase enzyme.
  • the method further comprises a plurality of additional enzymes under conditions that facilitate a plurality of biocatalytic reactions by the enzymes to form a library of modified small molecules produced by the plurality of enzymatic reactions.
  • the method further comprises the step of testing the library to determine if a particular modified small molecule that exhibits a desired activity is present within the library.
  • the step of testing the library can further comprises the steps of systematically eliminating all but one of the biocatalytic reactions used to produce a portion of the plurality of the modified small molecules within the library by testing the portion of the modified small molecule for the presence or absence of the particular modified small molecule with a desired activity, and identifying at least one specific biocatalytic reaction that produces the particular modified small molecule of desired activity.
  • the invention provides methods for determining a functional fragment of a phospholipase enzyme comprising the steps of: (a) providing a phospholipase enzyme comprising an amino acid sequence of the invention; and, (b) deleting a plurality of amino acid residues from the sequence of step (a) and testing the remaining subsequence for a phospholipase activity, thereby determining a functional fragment of a phospholipase enzyme.
  • the phospholipase activity is measured by providing a phospholipase substrate and detecting an increase in the amount of the substrate or a decrease in the amount of a reaction product.
  • a decrease in the amount of an enzyme substrate or an increase in the amount of the reaction product with the test compound as compared to the amount of substrate or reaction product without the test compound identifies the test compound as an activator of phospholipase activity.
  • the invention provides methods for cleaving a glycerolphosphate ester linkage comprising the following steps: (a) providing a polypeptide having a phospholipase activity, wherein the polypeptide comprises an amino acid sequence of the invention, or the polypeptide is encoded by a nucleic acid of the invention; (b) providing a composition comprising a glycerolphosphate ester linkage; and, (c) contacting the polypeptide of step (a) with the composition of step (b) under conditions wherein the polypeptide cleaves the glycerolphosphate ester linkage.
  • the conditions comprise between about pH 5 to about 8.5, or, between about pH 4.5 (or more acidic, i.e., pH ⁇ 4.5) to about 9.0 (or more alkaline (i.e., pH > 9). In one aspect, the conditions comprise a temperature of between about 40°C and about 70°C.
  • the composition comprises a vegetable oil. In one aspect, the composition comprises an oilseed phosphohpid. In one aspect, the cleavage reaction can generate a water extractable phosphorylated base and a diglyceride.
  • the invention provides methods hydrolyzing, breaking up or disrupting a phospholipid-comprising composition
  • the method comprises use of high shear mixing of the composition, followed by no or low shear mixing with the at least one polypeptide of the invention having a phospholipase activity to allow adequate "contacting" of the phosphohpid substrate with the phospholipase.
  • the at least one polypeptide having a phospholipase activity can also be present in the high shear mixing step.
  • the process can be practiced at any scale, e.g., at a scale comprising about 1 gram (g) to about 500, 1000, 2000, 2500, 5000 g, or more, or any amount in this range.
  • the invention provides methods for oil degumming comprising the following steps: (a) providing at least one polypeptide having a phospholipase activity, wherein the polypeptide comprises an amino acid sequence of the invention, or the polypeptide is encoded by a nucleic acid of the invention; (b) providing a composition comprising a vegetable oil; and, (c) contacting the polypeptide of step (a) and the vegetable oil of step (b) under conditions wherein the polypeptide can cleave ester linkages in the vegetable oil, thereby degumming the oil.
  • the vegetable oil comprises oilseed.
  • the vegetable oil can comprise rice bran oils, palm oil, rapeseed oil, corn oil, soybean oil, canola oil, sesame oil, peanut oil or sunflower oil.
  • the method further comprises addition of a phospholipase of the invention, another phospholipase or a combination thereof.
  • more than one polypeptide having a phospholipase activity is added to the process, wherein at least one polypeptide is an enzyme of the invention.
  • the enzymes are added in a specific order, e.g., PLCs with differing specificities in are added in a specific order, for example, an enzyme with PC and PE activity is added first (or two enzymes are added together, one with PC and the other with PE activity), then an enzyme with PI PLC activity is added, or any combination thereof.
  • the polypeptide has a phospholipase C activity. In one aspect, the polypeptide is a phospholipase D and a phosphatase enzyme is also added.
  • the contacting comprises hydrolysis of a hydrated phosphohpid in an oil.
  • the hydrolysis conditions can comprise alkaline conditions, e.g., in one aspect, the conditions comprise a temperature of about 20°C to 40°C at the alkaline pH.
  • the alkaline conditions can comprise a pH of about pH 8 to pH 10, or more.
  • the hydrolysis conditions can be made alkaline at any time in the process, e.g., in one aspect, a phospholipase, such as a PLC, is added before the conditions are made alkaline (e.g., a "caustic neutralization" of an acid-comprising oil, such as phosphatidic acid).
  • a phospholipase such as a PLC
  • the base causes the isomerization of 1,2-DAG, produced by PLC, into 1,3 -DAG which provides a nutritional health benefit over 1,2-DAG, e.g., the 1,3-DAG is burned as energy instead of being stored as fat (as is 1,2-DAG).
  • the invention also provides methods for converting a non-hydratable phosphohpid to a hydratable fo ⁇ n comprising the following steps: (a) providing a polypeptide having a phospholipase activity, wherein the polypeptide comprises an amino acid sequence of the invention, or the polypeptide is encoded by a nucleic acid of the invention; (b) providing a composition comprising a non-hydratable phosphohpid; and, (c) contacting the polypeptide of step (a) and the non-hydratable phosphohpid of step (b) under conditions wherein the polypeptide can cleave ester linkages in the non-hydratable phosphohpid, thereby converting a non-hydratable phosphohpid to a hydratable form.
  • the invention provides methods for degumming an oil comprising the following steps: (a) providing a composition comprising a polypeptide of the invention having a phospholipase activity or a polypeptide encoded by a nucleic acid of the invention; (b) providing an composition comprising a fat or an oil comprising a phosphohpid; and (c) contacting the polypeptide of step (a) and the composition of step (b) under conditions wherein the polypeptide can degum the phospholipid-comprising composition (under conditions wherein the polypeptide of the invention can catalyze the hydrolysis of a phosphohpid).
  • the oil-comprising composition comprises a plant, an animal, an algae or a fish oil.
  • a phospholipase D activity and a phosphatase enzyme are added.
  • the contacting can comprise hydrolysis of a hydrated phosphohpid in an oil.
  • the hydrolysis conditions of can comprise a temperature of about 20°C to 40°C at an alkaline pH.
  • the alkaline conditions can comprise a pH of about pH 8 to pH 10.
  • the hydrolysis conditions can comprise a reaction time of about 3 to 10 minutes.
  • the hydrolysis conditions can comprise hydrolysis of hydratable and non- hydratable phospholipids in oil at a temperature of about 50°C to 60°C, at a pH of about pH 5 to pH 6.5 using a reaction time of about 30 to 60 minutes.
  • the polypeptide can be bound to a filter and the phospholipid-containing fat or oil is passed through the filter.
  • the polypeptide can be added to a solution comprising the phospholipid-containing fat or oil and then the solution is passed through a filter.
  • the invention provides methods for converting a non-hydratable phosphohpid to a hydratable form comprising the following steps: (a) providing a composition comprising a polypeptide having a phospholipase activity of the invention, or a polypeptide encoded by a nucleic acid of the invention; (b) providing an composition comprising a non-hydratable phospholipid; and (c) contacting the polypeptide of step (a) and the composition of step (b) under conditions wherein the polypeptide converts the non-hydratable phospholipid to a hydratable form.
  • the enzyme used in this caustic refining process of the invention has both very good activity on phosphatidylcholine (PC) and phosphatidylethanolamine (PE), is active between a pH of about pH 6 to pH 9, is active up to 75°C, and is active in low water in oil, e.g., about 2% to 5% water, e.g., the enzyme encoded by the sequence of SEQ ID NO:2, encoded e.g., by SEQ ID NO: 1.
  • PC phosphatidylcholine
  • PE phosphatidylethanolamine
  • a Pi-specific PLC hydrolyzes PI
  • a PC-PLC that hydrolyzes PC, PE and PA.
  • the invention provides methods for purification of a phytosterol or a triterpene comprising the following steps: (a) providing a composition comprising a polypeptide of the invention having a phospholipase activity, or a polypeptide encoded by a nucleic acid of the invention; (b) providing an composition comprising a phytosterol or a triterpene; and (c) contacting the polypeptide of step (a) with the composition of step (b) under conditions wherein the polypeptide can catalyze the hydrolysis of a phospholipid in the composition.
  • the polypeptide can have a phospholipase C activity.
  • the phytosterol or a triterpene can comprise a plant sterol.
  • the plant sterol can be derived from a vegetable oil.
  • the vegetable oil can comprise a rice bran oil, a coconut oil, canola oil, cocoa butter oil, corn oil, cottonseed oil, linseed oil, olive oil, palm oil, peanut oil, oil derived from a rice bran, safflower oil, sesame oil, soybean oil or a sunflower oil.
  • the method can comprise use of nonpolar solvents to quantitatively extract free phytosterols and phytosteryl fatty-acid esters.
  • the phytosterol or a triterpene can comprise a ⁇ - sitosterol, a campesterol, a stigmasterol, a stigmastanol, a ⁇ -sitostanol, a sitostanol, a desmosterol, a chalinasterol, a poriferasterol, a clionasterol or a brassicasterol.
  • the invention provides methods for refining a crude oil comprising the following steps: (a) providing a composition comprising a polypeptide of the invention having a phospholipase activity, or a polypeptide encoded by a nucleic acid of the invention; (b) providing a composition comprising an oil comprising a phospholipid; and (c) contacting the polypeptide of step (a) with the composition of step (b) under conditions wherein the polypeptide can catalyze the hydrolysis of a phospholipid in the composition.
  • the polypeptide can have a phospholipase C activity.
  • the polypeptide can have a phospholipase activity is in a water solution that is added to the composition. The water level can be between about 0.5 to 5%.
  • the process time can be less than about 2 hours, less than about 60 minutes, less than about 30 minutes, less than 15 minutes, or less than 5 minutes.
  • the hydrolysis conditions can comprise a temperature of between about 25°C-70°C.
  • the hydrolysis conditions can comprise use of caustics. Concentrated solutions of caustic, e.g., more concentrated than the industrial standard of 11%, to decrease mass of gum can be used. In alternative aspects, the concentrated solution of caustic is between about 12% and 50% concentrated, e.g., about 20%, 30%, 40%, 50%, or 60% or more concentrated.
  • the hydrolysis conditions can comprise a pH of between about pH 3 and pH 10, between about pH 4 and pH 9, or between about pH 5 and pH 8.
  • the methods can comprise addition of acid to promote hydration of non-hydratable phospholipids. In one aspect, addition of acid promotes lowering of the calcium and magnesium metal content.
  • the invention provides a method for ameliorating or preventing lipopolysaccharide (LPS)-mediated toxicity comprising administering to a patient a pharmaceutical composition comprising a polypeptide of the invention.
  • the invention provides a method for detoxifying an endotoxin comprising contacting the endotoxin with a polypeptide of the invention.
  • the invention provides a method for deacylating a 2' or a 3' fatty acid chain from a lipid A comprising contacting the lipid A with a polypeptide of the invention.
  • the invention provides a method for refining a lubricant comprising the following steps: (a) providing a composition comprising an enzyme of the invention; (b) providing a lubricant; and (c) treating the lubricant with an enzyme under conditions wherein the enzyme can selective hydrolyze oils in the lubricant, thereby refining it.
  • the lubricant can be a hydraulic oil.
  • the invention provides a method of treating a fabric comprising the following steps: (a) providing a composition comprising an enzyme of the invention, (b) providing a fabric; and (c) treating the fabric with the enzyme.
  • the treatment of the fabric can comprise improvement of the hand and drape of the final fabric, dyeing, obtaining flame retardancy, obtaining water repellency, obtaining optical brightness, or obtaining resin finishing.
  • the fabric can comprise cotton, viscose, rayon, lyocell, flax, linen, ramie, all blends thereof, or blends thereof with polyesters, wool, polyamides acrylics or polyacrylics.
  • the invention provides a fabric, yarn or fiber comprising an enzyme of the invention. The enzyme can be adsorbed, absorbed or immobilized on the surface of the fabric, yarn or fiber.
  • the invention provides methods for expressing phospholipase C comprising providing a Pichia strain with a Mut phenotype; inserting a heterologous phospholipase C-encoding nucleic acid in the Pichia strain; and, culturing the Pichia strain under conditions whereby the phospholipase C is expressed.
  • the method can further comprise supplementing the culture conditions with zinc.
  • the invention also provides cell systems, isolated cells and cell lines for expressing phospholipase C comprising a Mut + phenotype Pichia strain comprising a heterologous phospholipase C- encoding nucleic acid operably linked to a promoter operable in the Pichia strain.
  • Figure 1 is a block diagram of a computer system, as described in detail, below.
  • Figure 2 is a flow diagram illustrating one aspect of a process 200 for comparing a new nucleotide or protein sequence with a database of sequences in order to determine the homology levels between the new sequence and the sequences in the database, as described in detail, below.
  • Figure 3 is a flow diagram illustrating one embodiment of a process in a computer for determining whether two sequences are homologous, as described in detail, below.
  • Figure 4 is a flow diagram illustrating one aspect of an identifier process for detecting the presence of a feature in a sequence, as described in detail, below.
  • Figures 5A, 5B and 5C schematically illustrate a model two-phase system for simulation of PLC-mediated degumming, as described in detail in Example 2, below.
  • Figure 6 schematically illustrates an exemplary vegetable oil refining process using the phospholipases of the invention.
  • Figure 7 schematically illustrates an exemplary degumming process of the invention for physically refined oils, as discussed in detail, below.
  • Figure 8 schematically illustrates phosphatide hydrolysis with a phospholipase C of the invention, as discussed in detail, below.
  • Figure 9 schematically illustrates an exemplary caustic refining process of the invention, and illustrates an alternative embodiment comprising application of a phospholipase C of the invention as a "Caustic Refining Aid" (Long Mix Caustic Refining), as discussed in detail, below.
  • Figure 10 schematically illustrates application of a phospholipase C of the invention as a degumming aid, as discussed in detail, below.
  • Figure 11 is a chart describing selected characteristics of exemplary nucleic acids and polypeptides of the invention, as described in further detail, below.
  • Figure 12 schematically illustrates data from a two enzyme system of the invention, as described in Example 3, below.
  • Figure 13 schematically illustrates an exemplary caustic refilling process of the invention, and illustrates an alternative embodiment comprising application of a phospholipase C of the invention as a "Caustic Refining Aid" (Long Mix Caustic Refining), as discussed in detail, below.
  • Figure 14 illustrates another variation of methods of the invention where two centrifugation steps are used in the process, as discussed in detail, below.
  • Figure 15 illustrates another variation of methods of the invention where three centrifugation steps are used in the process, as discussed in detail, below.
  • Figure 16 illustrates another exemplary variation of this process using acid treatment and having a centrifugation step before a degumming step, as discussed in detail, below.
  • Figure 17 illustrates the results of the in vitro digestion experiments wherein the phospholipase C variants of the invention, as discussed in detail in Example 4, below.
  • Figure 18 illustrates the results of a batch fermentor culture using an exemplary enzyme of the invention, as discussed in detail in Example 5, below.
  • Figure 19 illustrates the results of Oxygen ?Uptake Rate ("OUR") comparisons of cultures of P. pastoris MutS strains of the invention, as discussed in detail in Example 5, below.
  • Figure 20 illustrates a methanol consumption profile comparison in P. pastoris MutS strains of the invention, as discussed in detail in Example 5, below.
  • Figure 21 illustrates an "OUR" profile of a culture of a recombinant form of the exemplary PLC enzyme of the invention SEQ ID NO:2, as discussed in detail in Example 5, below.
  • Figure 22 illustrates results from an SDS-PAGE showing the quality of PLC protein produced in a culture, and a conesponding OUR profile, of a culture of a recombinant form of the exemplary PLC enzyme of the invention SEQ ID NO:2, as discussed in detail in Example 5, below.
  • Figure 23 illustrates results from an SDS-PAGE showing the quantity of active PLC located intracellularly in a culture of a recombinant form of the exemplary PLC enzyme of the invention SEQ ID NO:2, as discussed in detail in Example 5, below.
  • Figure 24 illustrates a visualization of the morphological changes in yeast cells associated with active PLC - a recombinant form of the exemplary PLC enzyme of the invention SEQ ID NO:2, as discussed in detail in Example 5, below.
  • Figure 25 graphically summarizes data showing the status of a PLC production performance at 95 h TFT (total fermentation time) in Pichia using an exemplary PLC enzyme of the invention SEQ ID NO:2, as discussed in detail in Example 5, below.
  • Figure 26 is a table summary of data from expression screening of exemplary zeocin-adapted cell colonies of the invention, as discussed in detail in Example 5, below.
  • Figure 27 illustrates data showing that PLC protein levels were higher in cultures comprising exemplary zeocin-adapted cell colonies of the invention, as discussed in detail in Example 5, below.
  • the phospholipases of the invention have a lipid acyl hydrolase (LAH) activity.
  • LAH lipid acyl hydrolase
  • the phospholipases of the invention can cleave glycerolphosphate ester linkages in phosphatidylcholine (PC), phosphatidylethanolamine (PE), phosphatidylserine (PS), phosphatidylinositol (PI), phosphatidic acid, and or sphingomyelin, or a combination thereof.
  • a phospholipase of the invention is specific for one or more specific substrates, e.g., an enzyme of the invention can have a specificity of action for PE and PC; PE an PI; PE and PS; PS and PE; PS and PI; PI and PE; PS, PI and PC; PE, PI and PC; or, PE, PS, PI and PC.
  • a phospholipase of the invention e.g., polypeptides having phospholipase A, B, C, D, patatin, phosphatidic acid phosphatases (PAP) and/or lipid acyl hydrolase (LAH) or equivalent activity
  • PAP phosphatidic acid phosphatases
  • LAH lipid acyl hydrolase
  • the PLCs of the invention can be used in addition to or in place of PLA Is and PLA2s in commercial oil degumming, such as in the ENZY?MAX® process, where phospholipids are hydrolyzed by PLAl and PLA2.
  • the phospholipases of the invention are active at a high and/or at a low temperature, or, over a wide range of temperature, e.g., they can be active in the temperatures ranging between 20°C to 90°C, between 30°C to 80°C, or between 40°C to 70°C.
  • the invention also provides phospholipases of die invention have activity at alkaline pHs or at acidic pHs, e.g., low water acidity.
  • the phospholipases of the invention can have activity in acidic pHs as low as pH 6.5, pH 6.0, pH 5.5, pH 5.0, pH 4.5, pH 4.0 and pH 3.5 or more acidic (i.e., ⁇ pH 3.5).
  • the phosphohpases of the invention can have activity in alkaline pHs as high as pH 7.5, pH 8.0, pH 8.5, pH 9.0, pH 9.5, pH 10 or more alkaline (i.e., > pH 10).
  • the phospholipases of the invention are active in the temperature range of between about 40°C to about 70°C, 75°C, or 80°C, or more, under conditions of low water activity (low water content).
  • the invention also provides methods for further modifying the exemplary phospholipases of the invention to generate enzymes with desirable properties.
  • phospholipases generated by the methods of the invention can have altered substrate specificities, substrate binding specificities, substrate cleavage patterns, thermal stability, pH/activity profile, pH/stability profile (such as increased stability at low, e.g. pH ⁇ 6 or ⁇ H ⁇ 5, or high, e.g. ⁇ H>9, pH values), stability towards oxidation, Ca 2+ dependency, specific activity and the like.
  • the mvention provides for altering any property of interest. For instance, the alteration may result in a variant which, as compared to a parent phospholipase, has altered pH and temperature activity profile.
  • the phospholipases of the invention are used in various vegetable oil processing steps, such as in vegetable oil extraction, particularly, in the removal of "phospholipid gums" in a process called “oil degumming,” as described herein.
  • the invention provides compositions (e.g., comprising enzymes of the invention) and processes for the production of vegetable oils from various sources, such as oil from rice bran, soybeans, rapeseed, peanut, sesame, sunflower and corn.
  • the phospholipase enzymes of the invention can be used in place of PLA, e.g., phospholipase A2, in any vegetable oil processing step.
  • phospholipase encompasses enzymes having any phospholipase activity, for example, cleaving a glycerolphosphate ester linkage (catalyzing hydrolysis of a glycerolphosphate ester linkage), e.g., in an oil, such as a vegetable oil.
  • the phospholipase activity of the invention can generate a water extractable phosphorylated base and a diglyceride.
  • the phospholipase activity of the invention also includes hydrolysis of glycerolphosphate ester linkages at high temperatures, low temperatures, alkaline pHs and at acidic pHs.
  • a phospholipase activity also includes cleaving a glycerolphosphate ester to generate a water extractable phosphorylated base and a diglyceride.
  • the term “a phospholipase activity” also includes cutting ester bonds of glycerin and phosphoric acid in phospholipids.
  • the term “a phosphohpase activity” also includes other activities, such as the ability to bind to and hydrolyze a substrate, such as an oil, e.g. a vegetable oil, substrate also including plant and animal phosphatidylcholines, phosphatidyl- ethanolamines, phosphatidylserines and sphingomyelins.
  • the phospholipase activity can comprise a phospholipase C (PLC) activity; a phospholipase A (PLA) activity, such as a phospholipase Al or phospholipase A2 activity; a phospholipase B (PLB) activity, such as a phospholipase Bl or phospholipase B2 activity, including lysophospholipase (LPL) activity and/or lysophospholipase-tiansacylase (LPTA) activity; a phospholipase D (PLD) activity, such as a phospholipase DI or a phospholipase D2 activity; and/or a patatin activity or any combination thereof.
  • PLC phospholipase C
  • PLA phospholipase A
  • PLA phospholipase Al or phospholipase A2 activity
  • the phospholipase activity can comprise hydrolysis of a glycoprotein, e.g., as a glycoprotein found in a potato tuber or any plant of the genus Solarium, e.g., Solanum tuberosum.
  • the phospholipase activity can comprise a patatin enzymatic activity, such as a patatin esterase activity (see, e.g., Jimenez (2002) Biotechnol. Prog. 18:635-640).
  • the phospholipase activity can comprise a lipid acyl hydrolase (LAH) activity.
  • LAH lipid acyl hydrolase
  • the phospholipase activity can comprise being specific for one or more specific substrates, e.g., an enzyme of the invention can have a specificity of action for PE and PC; PE an PI; PE and PS; PS and PE; PS and PI; PI and PE; PS, PI and PC; PE, PI and PC; or, PE, PS, PI and PC, or any combination thereof.
  • an enzyme of the invention can have a specificity of action for PE and PC; PE an PI; PE and PS; PS and PE; PS and PI; PI and PE; PS, PI and PC; PE, PI and PC; or, PE, PS, PI and PC, or any combination thereof.
  • a phospholipase of the invention can have multifunctional activity, e.g., a combination of one or more of the enzyme activities described herein.
  • a polypeptide of the invention is enzymatically active, but lacks a lipase activity or lacks any enzymatic activity that affects a neutral oil (triglyceride) fraction. It may be desirable to use such a polypeptide in a particular process, e.g., in a degumming process where it is important that the neutral oil fraction not be harmed (diminished, degraded, e.g., hydrolyzed).
  • the invention provides a degumming process comprising use of a polypeptide of the invention having a phospholipase activity, but not a lipase activity.
  • PLC phospholipases of the invention utilize (e.g., catalyze hydrolysis of) a variety of phospholipid substrates including phosphatidylcholine (PC), phosphatidylethanolamine (PE), phosphatidylserine (PS), phosphatidylinositol (PI), and/or phosphatidic acid or a combination thereof.
  • these enzymes can have varying degrees of activity on the lysophospholipid forms of these phospholipids.
  • PLC enzymes of the invention may show a preference for phosphatidylcholine and phosphatidylethanolamine as substrates.
  • phosphatidylinositol PLC phospholipases of the invention utilize a variety of phospholipid substrates including phosphatidylcholine, phosphatidylethanolamine, phosphatidylserine, phosphatidylinositol, and phosphatidic acid, or a combination thereof.
  • these enzymes can have varying degrees of activity on the lysophospholipid forms of these phospholipids.
  • phosphatidylinositol PLC enzymes of the invention may show a preference for phosphatidylinositol as a substrate.
  • patatin enzymes of the invention utilize a variety of phosphohpid substrates including phosphatidylcholine, phosphatidylethanolamine, phosphatidylserine, phosphatidylinositol, and phosphatidic acid, or a combination thereof.
  • these enzymes can have varying degrees of activity on the lysophospholipid forms of these phospholipids.
  • patatins of the invention are based on a conservation of amino acid sequence similarity.
  • these enzymes display a diverse set of biochemical properties and may perform reactions characteristic of PLA1, PLA2, PLC, or PLD enzyme classes.
  • PLD phospholipases of the invention utilize a variety of phospholipid substrates including phosphatidylcholine, phosphatidylethanolamine, phosphatidylserine, phosphatidylinositol, and phosphatidic acid, or a combination thereof.
  • these enzymes can have varying degrees of activity on die lysophospholipid forms of these phospholipids. In one aspect, these enzymes are useful for carrying out transesterification reactions to produce structured phospholipids.
  • antibody includes a peptide or polypeptide derived from, modeled after or substantially encoded by an immunoglobulin gene or immunoglobulin genes, or fragments thereof, capable of specifically binding an antigen or epitope, see, e.g. Fundamental Immunology, Third Edition, W.E. Paul, ed., Raven Press, N.Y. (1993); Wilson (1994) J. Immunol. Methods 175:267-273; Yarmush (1992) J. Biochem. Biophys. Methods 25:85-97.
  • antibody includes antigen-binding portions, i.e., "antigen binding sites,” (e.g., fragments, subsequences, complementarity determining regions (CDRs)) that retain capacity to bind antigen, including (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CHI domains; (ii) a F(ab')2 fragment, a bivalent fragment comprising two Fab fragments linlced by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VH and CHI domains; (iv) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a dAb fragment (Ward et al., (1989) Nature 341:544-546), which consists of a VH domain; and (vi) an isolated complementarity determining region (CDR).
  • antigen binding sites e.g.,
  • single chain antibodies are also included by reference in the term “antibody.”
  • antibody anay or “microanay” or “biocbip” or “chip” as used herein is a plurality of target elements, each target element comprising a defined amount of one or more polypeptides (including antibodies) or nucleic acids immobilized onto a defined area of a substrate surface, as discussed in further detail, below.
  • target element comprising a defined amount of one or more polypeptides (including antibodies) or nucleic acids immobilized onto a defined area of a substrate surface, as discussed in further detail, below.
  • computer computer program
  • processor are used in their broadest general contexts and incorporate all such devices, as described in detail, below.
  • a "coding sequence of or a “sequence encodes" a particular polypeptide or protein is a nucleic acid sequence which is transcribed and translated into a polypeptide or protein when placed under the control of appropriate regulatory sequences.
  • expression cassette refers to a nucleotide sequence which is capable of affecting expression of a structural gene (i.e., a protem coding sequence, such as a phospholipase of the invention) in a host compatible with such sequences.
  • Expression cassettes include at least a promoter operably linked with the polypeptide coding sequence; and, optionally, with other sequences, e.g., transcription termination signals.
  • expression cassettes also include plasmids, expression vectors, recombinant viruses, any form of recombinant "naked DNA” vector, and the like.
  • a “vector” comprises a nucleic acid which can infect, transfect, transiently or permanently transduce a cell. It will be recognized that a vector can be a naked nucleic acid, or a nucleic acid complexed with protein or lipid.
  • the vector optionally comprises viral or bacterial nucleic acids and/or proteins, and/or membranes (e.g., a cell membrane, a viral lipid envelope, etc.).
  • Vectors include, but are not limited to replicons (e.g., RNA replicons, bacteriophages) to which fragments of DNA may be attached and become replicated.
  • Vectors tiius include, but are not limited to RNA, autonomous self-replicating circular or linear DNA or RNA (e.g., plasmids, viruses, and the like, see, e.g., U.S. Patent No. 5,217,879), and includes both the expression and non-expression plasmids.
  • a recombinant microorganism or cell culture is described as hosting an "expression vector” this includes both extra-chromosomal circular and linear DNA and DNA that has been incorporated into the host chromosome(s).
  • the vector may either be stably replicated by the cells during mitosis as an autonomous structure, or is inco ⁇ orated within the host's genome.
  • “Plasmids” are designated by a lower case “p” preceded and/or followed by capital letters and/or numbers.
  • the starting plasmids herein are either commercially available, publicly available on an unrestricted basis, or can be constracted from available plasmids in accord with published procedures.
  • gene means the segment of DNA involved in producing a polypeptide chain, including, mter alia, regions preceding and following the coding region, such as leader and trailer, promoters and enhancers, as well as, where applicable, intervening sequences (infrons) between individual coding segments (exons).
  • nucleic acid or “nucleic acid sequence” as used herein refer to an oligonucleotide, nucleotide, polynucleotide, or to a fragment of any of these, to DNA or RNA (e.g., mRNA, rRNA, tRNA, iRNA) of genomic or synthetic origin which may be single-stranded or double-sfranded and may represent a sense or antisense strand, to peptide nucleic acid (PNA), or to any DNA-like or RNA-like material, natural or synthetic in origin, including, e.g., iRNA, ribonucleoproteins (e.g., double stranded iRNAs, e.g., iRNPs).
  • DNA or RNA e.g., mRNA, rRNA, tRNA, iRNA
  • PNA peptide nucleic acid
  • DNA-like or RNA-like material natural or synthetic in origin, including, e.g.
  • nucleic acids i.e., oligonucleotides, containing known analogues of natural nucleotides.
  • the term also encompasses nucleic- acid-like structures with synthetic backbones, see e.g., Mata (1997) Toxicol. Appl. Pharmacol. 144:189-197; Strauss-Soukup (1997) Biochemistry 36:8692-8698; Straussense Nucleic Acid Drag Dev 6:153-156.
  • amino acid or amino acid sequence refer to an oligopeptide, peptide, polypeptide, or protein sequence, or to a fragment, portion, or subunit of any of these, and to naturally occurring or synthetic molecules.
  • polypeptide and protein refer to amino acids joined to each other by peptide bonds or modified peptide bonds, i.e., peptide isosteres, and may contain modified amino acids other than the 20 gene-encoded amino acids.
  • polypeptide also includes peptides and polypeptide fragments, motifs and the like.
  • glycosylated polypeptides The peptides and polypeptides of the invention also include all "mimetic” and “peptidomimetic” forms, as described in further detail, below.
  • isolated means that the material is removed from its original environment (e.g., the natural environment if it is naturally occurring).
  • the invention provides nucleic acids which have been purified from genomic DNA or from other sequences in a library or other environment by at least one, two, three, four, five or more orders of magnitude.
  • the term "recombinant” means that the nucleic acid is adjacent to a "backbone" nucleic acid to which it is not adjacent in its natural environment.
  • nucleic acids represent 5% or more of the number of nucleic acid inserts in a population of nucleic acid "backbone molecules.”
  • Backbone molecules include nucleic acids such as expression vectors, self-replicating nucleic acids, viruses, integrating nucleic acids, and other vectors or nucleic acids used to maintain or manipulate a nucleic acid insert of interest.
  • the enriched nucleic acids represent 15%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or more of the number of nucleic acid inserts in the population of recombinant backbone molecules.
  • Recombinant polypeptides or proteins refer to polypeptides or proteins produced by recombinant DNA techniques; e.g., produced from cells transformed by an exogenous DNA constract encoding the desired polypeptide or protein.
  • synthetic polypeptides or protein are those prepared by chemical synthesis, as described in further detail, below.
  • a promoter sequence is "operably linked to" a coding sequence when RNA polymerase which initiates transcription at the promoter will transcribe the coding sequence into mRNA, as discussed further, below.
  • Olionucleotide refers to either a single stranded polydeoxynucleotide or two complementary polydeoxynucleotide strands which may be chemically synthesized.
  • Such synthetic oligonucleotides have no 5' phosphate and thus will not ligate to another oligonucleotide without adding a phosphate with an ATP in the presence of a kinase.
  • a synthetic oligonucleotide will ligate to a fragment that has not been dephosphorylated.
  • nucleic acids or polypeptides refers to two or more sequences that have at least 50%, 60%, 70%>, 75%>, 80%, 85%, 90%, 95%, 98% or 99% nucleotide or amino acid residue (sequence) identity, when compared and aligned for maximum conespondence, as measured using one any ?known sequence comparison algorithm, as discussed in detail below, or by visual inspection.
  • the invention provides nucleic acid and polypeptide sequences having substantial identity to an exemplary sequence of the invention, e.g., SEQ ID NO:l, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, etc., over a region of at least about 100 residues, 150 residues, 200 residues, 300 residues, 400 residues, or a region ranging from between about 50 residues to the full length of the nucleic acid or polypeptide.
  • Nucleic acid sequences of the invention can be substantially identical over the entire length of a polypeptide coding region.
  • substantially identical amino acid sequence is a sequence that differs from a reference sequence by one or more conservative or non-conservative amino acid substitutions, deletions, or insertions, particularly when such a substitution occurs at a site that is not the active site of the molecule, and provided that the polypeptide essentially retains its functional properties.
  • a conservative amino acid substitution for example, substitutes one amino acid for another of the same class (e.g., substitution of one hydrophobic amino acid, such as isoleucine, valine, leucine, or methionine, for another, or substitution of one polar amino acid for another, such as substitution of arginine for lysine, glutamic acid for aspartic acid or glutamine for asparagine).
  • Hybridization refers to the process by which a nucleic acid strand joins with a complementary strand through base pairing. Hybridization reactions can be sensitive and selective so that a particular sequence of interest can be identified even in samples in which it is present at low concentrations.
  • Suitably stringent conditions can be defined by, for example, the concentrations of salt or formamide in the prehybridization and hybridization solutions, or by the hybridization temperature, and are well known in the art. For example, stringency can be increased by reducing the concentration of salt, increasing the concentration of formamide, or raising the hybridization temperature, altering the time of hybridization, as described in detail, below.
  • nucleic acids of the invention are defined by their ability to hybridize under various stringency conditions (e.g., high, medium, and low), as set forth herein.
  • variant refers to polynucleotides or polypeptides of the invention modified at one or more base pairs, codons, introns, exons, or amino acid residues (respectively) yet still retain the biological activity of a phospholipase of the invention.
  • Variants can be produced by any number of means included methods such as, for example, enor-prone PCR, shuffling, oligonucleotide-directed mutagenesis, assembly PCR, sexual PCR mutagenesis, in vivo mutagenesis, cassette mutagenesis, recursive ensemble mutagenesis, exponential ensemble mutagenesis, site-specific mutagenesis, gene reassembly, GSSMTM and any combination thereof.
  • Techniques for producing variant phospholipases having activity at a pH or temperature for example, that is different from a wild-type phospholipase, are included herein.
  • GSSMTM Gene Site Saturation MutagenesisTM
  • GSSMTM Gene Site Saturation MutagenesisTM
  • GSSMTM Gene Site Saturation MutagenesisTM
  • optimal directed evolution system or “optimized directed evolution” includes a method for reassembling fragments of related nucleic acid sequences, e.g., related genes, and explained in detail, below.
  • synthetic ligation reassembly or “SLR” includes a method of ligating oligonucleotide fragments in a non-stochastic fashion, and explained in detail, below.
  • the invention provides isolated and recombinant nucleic acids (e.g., the exemplary SEQ ID NO:l, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:ll, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, SEQ ID NO:23, SEQ ID NO:25, SEQ ID NO:27, SEQ ID NO:29, SEQ ID NO:31, SEQ ID NO:33, SEQ ID NO:35, SEQ ID NO:37, SEQ ID NO:39, SEQ ID NO:41, SEQ ID NO:43, SEQ ID NO:45, SEQ ID NO:47, SEQ ID NO:49, SEQ ID NO:51, SEQ ID NO:53, SEQ ID NO:55, SEQ ID NO:57, SEQ ID NO:59, SEQ ID N0:61, SEQ ID NO:13, SEQ ID NO:15, S
  • the invention also includes methods for discovering new phospholipase sequences using the nucleic acids of the invention. Also provided are methods for modifying the nucleic acids of the invention by, e.g., synthetic ligation reassembly, optimized directed evolution system and or saturation mutagenesis.
  • the nucleic acids of the invention can be made, isolated and/or manipulated by, e.g., cloning and expression of cDNA libraries, amplification of message or genomic DNA by PCR, and the like.
  • homologous genes can be modified by manipulating a template nucleic acid, as described herein.
  • the invention can be practiced in conjunction with any method or protocol or device known in the art, which are well described in the scientific and patent literature.
  • RNA, iRNA, antisense nucleic acid, cDNA, genomic DNA, vectors, viruses or hybrids thereof may be isolated from a variety of sources, genetically engineered, amplified, and/or expressed/ generated recombinantly.
  • Recombinant polypeptides generated from these nucleic acids can be individually isolated or cloned and tested for a desired activity. Any recombinant expression system can be used, including bacterial, mammalian, yeast, insect or plant cell expression systems.
  • these nucleic acids can be synthesized in vitro by well- known chemical synthesis techniques, as described in, e.g., Adams (1983) J. Am. Chem. Soc.
  • nucleic acids such as, e.g., subcloning, labeling probes (e.g., random-primer labeling using Klenow polymerase, nick translation, amplification), sequencing, hybridization and the like are well described in the scientific and patent literature, see, e.g., Sambrook, ed., MOLECULAR CLONING: A LABORATORY IVLANUAL (2ND ED.), Vols. 1-3, Cold Spring Harbor Laboratory, (1989); CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, Ausubel, ed.
  • Another useful means of obtaining and manipulating nucleic acids used to practice the methods of die invention is to clone from genomic samples, and, if desired, screen and re-clone inserts isolated or amplified from, e.g., genomic clones or cDNA clones.
  • Sources of nucleic acid used in the methods of the invention include genomic or cDNA libraries contained in, e.g., mammalian artificial chromosomes (?MACs), see, e.g., U.S. Patent Nos. 5,721,118; 6,025,155; human artificial chromosomes, see, e.g., Rosenfeld (1997) Nat. Genet.
  • ?MACs mammalian artificial chromosomes
  • a nucleic acid encoding a polypeptide of the invention is assembled in appropriate phase with a leader sequence capable of directing secretion of the translated polypeptide or fragment thereof.
  • the invention provides fusion proteins and nucleic acids encoding them.
  • a polypeptide of the invention can be fused to a heterologous peptide or polypeptide, such as N-terminal identification peptides which impart desired characteristics, such as increased stability or simplified purification.
  • Peptides and polypeptides of the invention can also be synthesized and expressed as fusion proteins with one or more additional domains linked thereto for, e.g., producing a more immunogenic peptide, to more readily isolate a recombinantly synthesized peptide, to identify and isolate antibodies and antibody-expressing B cells, and the like.
  • Detection and purification facilitating domains include, e.g., metal chelating peptides such as polyhistidine tracts and histidine- tryptophan modules that allow purification on immobilized metals, protein A domains that allow purification on immobilized immunoglobulin, and the domain utilized in the FLAGS extension/affinity purification system (Immunex Corp, Seattle WA).
  • metal chelating peptides such as polyhistidine tracts and histidine- tryptophan modules that allow purification on immobilized metals
  • protein A domains that allow purification on immobilized immunoglobulin
  • the domain utilized in the FLAGS extension/affinity purification system Immunex Corp, Seattle WA.
  • the inclusion of a cleavable linker sequences such as Factor Xa or enterokinase (Invifrogen, San Diego CA) between a purification domain and the motif-comprising peptide or polypeptide to facihtate purification.
  • an expression vector can include an epitope-encoding nucleic acid sequence linked to six histidine residues followed by a thioredoxin and an enterokinase cleavage site (see e.g., Williams (1995) Biochemistry 34:1787-1797; Dobeli (1998) Protein Expr. Purif. 12:404-414).
  • the histidine residues facihtate detection and purification while the enterokinase cleavage site provides a means for purifying the epitope from the remainder of the fusion protein.
  • Technology pertaining to vectors encoding fusion proteins and application of fusion proteins are well described in the scientific and patent literature, see e.g., Kroll (1993) DNA Cell. Biol., 12:441-53.
  • the invention provides nucleic acid (e.g., DNA) sequences of the invention operatively linked to expression (e.g., transcriptional or translational) control sequence(s),. e.g., promoters or enhancers, to direct or modulate RNA synthesis/ expression.
  • expression control sequence can be in an expression vector.
  • Exemplary bacterial promoters include lad, lacZ, T3, T7, gpt, lambda PR, PL and tip.
  • Exemplary eukaryotic promoters include CMV immediate early, HSV thymidine kinase, early and late SV40, LTRs from retrovirus, and mouse metallothionein I.
  • Promoters suitable for expressing a polypeptide in bacteria include the E. coli lac or trp promoters, the lad promoter, the lacZ promoter, the T3 promoter, the T7 promoter, the gpt promoter, the lambda PR promoter, the lambda PL promoter, promoters from operons encoding glycolytic enzymes such as 3-phosphoglycerate kinase (PGK), and the acid phosphatase promoter.
  • Eukaryotic promoters include the CMV immediate early promoter, the HSV thymidine kinase promoter, heat shock promoters, the early and late SV40 promoter, LTRs from retrovirases, and the mouse metallothionein-I promoter.
  • Expression vectors and cloning vehicles of the invention can comprise viral particles, baculoviras, phage, plasmids, phagemids, cosmids, fosmids, bacterial artificial chromosomes, viral DNA (e.g., vaccinia, adenovirus, foul pox virus, pseudorabies and derivatives of SV40), PI -based artificial chromosomes, yeast plasmids, yeast artificial chromosomes, and any other vectors specific for specific hosts of interest (such as Bacillus, Aspergillus and yeast).
  • Vectors of the invention can include chromosomal, non-chromosomal and synthetic DNA sequences.
  • the expression vector may comprise a promoter, a ribosome-binding site for translation initiation and a transcription terminator.
  • the vector may also include appropriate sequences for amplifying expression.
  • Mammalian expression vectors can comprise an origin of replication, any necessary ribosome binding sites, a polyadenylation site, splice donor and acceptor sites, transcriptional termination sequences, and 5' flanking non-transcribed sequences.
  • DNA sequences derived from the SV40 splice and polyadenylation sites may be used to provide the required non-transcribed genetic elements.
  • the expression vectors contain one or more selectable marker genes to permit selection of host cells containing the vector.
  • selectable markers include genes encoding dihydrofolate reductase or genes conferring neomycin resistance for eukaryotic cell culture, genes conferring tetracycline or ampicillin resistance in E. coli, and the S. cerevisiae TRP1 gene.
  • Promoter regions can be selected from any desired gene using chloramphenicol fransferase (CAT) vectors or other vectors with selectable markers.
  • Vectors for expressing the polypeptide or fragment thereof in eukaryotic cells may also contain enhancers to increase expression levels. Enhancers are czs-acting elements of DNA, usually from about 10 to about 300 bp in length that act on a promoter to increase its franscription.
  • a DNA sequence may be inserted into a vector by a variety of procedures. In general, the DNA sequence is ligated to the desired position in the vector following digestion of the insert and the vector with appropriate restriction endonucleases. Alternatively, blunt ends in both the insert and the vector may be ligated.
  • a variety of cloning techniques are known in the art, e.g., as described in Ausubel and Sambrook. Such procedures and others are deemed to be within the scope of those skilled in the art.
  • the vector may be in the form of a plasmid, a viral particle, or a phage.
  • Other vectors include chromosomal, non-chromosomal and synthetic DNA sequences, derivatives of SV40; bacterial plasmids, phage DNA, baculoviras, yeast plasmids, vectors derived from combinations of plasmids and phage DNA, viral DNA such as vaccinia, adenoviras, fowl pox virus, and pseudorabies.
  • a variety of cloning and expression vectors for use with prokaryotic and eukaryotic hosts are described by, e.g., Sambrook.
  • Particular bacterial vectors which may be used include the commercially available plasmids comprising genetic elements of the well known cloning vector ⁇ BR322 (ATCC 37017), pKK223-3 (Pharmacia Fine Chemicals, Uppsala, Sweden), GEM1 (Promega Biotec, Madison, WI, USA) pQE70, pQE60, pQE-9 (Qiagen), pDIO, psiX174 pBluescript II KS, pNH8A, pNH16a, pNH18A, pNH46A (Stratagene), ptrc99a, ⁇ KK223-3, pKK233-3, pDR540, pRIT5 (Pharmacia), ⁇ KK232-8 and pCM7.
  • plasmids comprising genetic elements of the well known cloning vector ⁇ BR322 (ATCC 37017), pKK223-3 (Pharmacia Fine Chemicals, Uppsala,
  • eukaryotic vectors include pSV2CAT, pOG44, pXTl, pSG (Stratagene) pSVK3, pBPV, pMSG, and pSVL (Pharmacia).
  • any other vector may be used as long as it is replicable and viable in the host cell.
  • Host cells and transformed cells The invention also provides a transformed cell comprising a nucleic acid sequence of the invention, e.g., a sequence encoding a phospholipase of the invention, a vector of the invention.
  • the engineered host cells can be cultured in conventional nutrient media modified as appropriate for activating promoters, selecting fransformants or amplifying the genes of the invention.
  • the selected promoter may be induced by appropriate means (e.g., temperature shift or chemical induction) and die cells may be cultured for an additional period to allow them to produce the desired polypeptide or fragment thereof.
  • Cells can be harvested by centrifugation, disrupted by physical or chemical means, and the resulting crude extract is retained for further purification.
  • Microbial cells employed for expression of proteins can be disrupted by any convenient method, including freeze-thaw cycling, sonication, mechanical disruption, or use of cell lysing agents.
  • the expressed polypeptide or fragment thereof can be recovered and purified from recombinant cell cultures by methods including ammonium sulfate or ethanol precipitation, acid extraction, anion or cation exchange chromatography, phosphocellulose cliromatography, hydrophobic interaction chromatography, affinity chromatography, hydroxylapatite chromatography and lectin chromatography. Protein refolding steps can be used, as necessary, in completing configuration of the polypeptide. If desired, high performance liquid chromatography (HPLC) can be employed for final purification steps.
  • HPLC high performance liquid chromatography
  • Various mammalian cell culture systems can also be employed to express recombinant protein.
  • An exemplary phospholipase C enzyme (having a sequence as set forth in S ⁇ Q ID NO:2) has been over-expressed in active form in a variety of host systems including gram negative bacteria, such as E. coli, gram positive bacteria, such as any Bacillus sp.(e.g., Bacillus subtilis, Bacillus cereus), yeast host cells (including, e.g., Pichia pastoris, Saccharomyces sp., such as S. cerevisiae and S. pombe) and Lactococcus lactis, or mammalian, fungi, plant or insect cells.
  • the active enzyme is expressed from a variety of constructs in each host system.
  • nucleic acid expression constructs can comprise nucleotides encoding the full-length open reading frame (composed of the signal sequence, the pro-sequence, and the mature protein coding sequence) or they can comprise a subset of these genetic elements either alone or in combination with heterologous genetic elements that serve as the signal sequence and/or the pro-sequence for the mature open reading frame.
  • Each of these systems can serve as a commercial production host for the expression of PLC for use in the previously described enzymatic oil degumming processes.
  • nucleic acids encoding the polypeptides of the invention, or modified nucleic acids can be reproduced by, e.g., amplification.
  • the invention provides amplification primer sequence pairs for amplifying nucleic acids encoding polypeptides with a phosphohpase activity.
  • the invention provides an amplification primer sequence pair for amplifying a nucleic acid encoding a polypeptide having a phospholipase activity, wherein the primer pair is capable of amplifying a nucleic acid comprising a sequence of the invention, or fragments or subsequences thereof.
  • One or each member of the amplification primer sequence pair can comprise an oligonucleotide comprising at least about 10 to 50 consecutive bases of the sequence, or about 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 consecutive bases of the sequence.
  • the mvention provides amplification primer pairs, wherein the primer pair comprises a first member having a sequence as set forth by about the first (the 5') 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 residues of a nucleic acid of the invention, and a second member having a sequence as set forth by about the first (the 5') 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 residues of the complementary strand of the first member.
  • the invention provides phospholipases generated by amplification, e.g., polymerase chain reaction (PCR), using an amplification primer pair of the invention.
  • PCR polymerase chain reaction
  • the invention provides methods of making a phospholipase by amplification, e.g., polymerase chain reaction (PCR), using an amplification primer pair of the invention.
  • amplification primer pair amplifies a nucleic acid from a library, e.g., a gene library, such as an environmental library.
  • Amplification reactions can also be used to quantify the amount of nucleic acid in a sample (such as the amount of message in a cell sample), label the nucleic acid
  • the invention provides isolated and recombinant nucleic acids comprising sequences having at least about 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 61%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, or complete (100%) sequence identity to an exemplary nucleic acid of the invention (e.g., SEQ ID NO:l, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:l 1, SEQ ID NO: 13, SEQ ID NO: 15,
  • SEQ ID NO: 152 SEQ ID NO: 154, SEQ ID NO: 156, SEQ ID NO: 158, SEQ ID NO: 160,
  • SEQ ID NO: 172 or SEQ ID NO: 174) over a region of at least about 50, 75, 100, 150,
  • the invention provides polypeptides comprising sequences having at least about 50%,
  • sequence identity may be determined using any computer program and associated parameters, including those described herein, such as BLAST 2.2.2. or FASTA version 3.0t78, with the default parameters.
  • sequence identify can be over a region of at least about 5, 10, 20, 30, 40, 50, 100, 150, 200, 250, 300, 350, 400 consecutive residues, or the full length of the nucleic acid or polypeptide.
  • Figure 11 is a chart describing selected characteristics of exemplary nucleic acids and polypeptides of the invention, including sequence identity comparison of the exemplary sequences to public databases. All sequences described in Figure 11 have been subject to a BLAST search (as described in detail, below) against two sets of databases. The first database set is available through NCBI (National Center for Generic Analysis).
  • NR refers to the Non-Redundant nucleotide database maintained by NCBI.
  • This database is a composite of GenBank, GenBank updates, and E?MBL updates.
  • the entries in the column "?NR Description” refer to the definition line in any given NCBI record, which includes a description of the sequence, such as the source organism, gene name/protein name, or some description of the function of the sequence.
  • the entries in the column “? R Accession Code” refer to the unique identifier given to a sequence record.
  • the entries in the column “NR Evalue” refer to the Expect value (Evalue), which represents the probability that an alignment score as good as the one found between the query sequence (the sequences of the invention) and a database sequence would be found in the same number of comparisons between random sequences as was done in the present BLAST search.
  • the entries in the column "?NR Organism” refer to the source organism of the sequence identified as the closest BLAST hit.
  • the second set of databases is collectively known as the GeneseqTM database, which is available through
  • An EC number is the number assigned to a type of enzyme according to a scheme of standardized enzyme nomenclature developed by the Enzyme Commission of the
  • the EC number assigned to the top match is entered into the table.
  • the EC number of the top hit is used as a guide to what the EC number of the sequence of the invention might be.
  • the columns "Query DNA Length” and “Query Protein Length” refer to the number of nucleotides or the number amino acids, respectively, in the sequence of the invention that was searched or queried against either the NCBI or Geneseq databases.
  • the columns “Geneseq or ? R DNA Length” and “Geneseq or NR Protein Length” refer to the number of nucleotides or the number amino acids, respectively, in the sequence of the top match from the BLAST search.
  • the results provided in these columns are from the search that returned the lower Evalue, either from the NCBI databases or the Geneseq database.
  • the columns "Geneseq or ? R %>ID Protein" and “Geneseq or ?NR %ID DNA” refer to the percent sequence identity between the sequence of the invention and the sequence of the top BLAST match.
  • the results provided in these columns are from the search that returned the lower Evalue, either from the NCBI databases or the Geneseq database.
  • Homologous sequences also include RNA sequences in which uridines replace the thymines in the nucleic acid sequences. The homologous sequences may be obtained using any of the procedures described herein or may result from the conection of a sequencing enor.
  • nucleic acid sequences as set forth herein can be represented in the traditional single character format (see, e.g., Stryer, Lubert. Biochemistry, 3rd Ed., W. H Freeman & Co., New York) or in any other format which records the identity of the nucleotides in a sequence.
  • sequence comparison programs identified herein are used in this aspect of the invention. Protein and/or nucleic acid sequence identities (homologies) may be evaluated using any of the variety of sequence comparison algorithms and programs known in the art. Such algorithms and programs include, but are not limited to, TBLASTN, BLASTP, FASTA, TFASTA, and CLUSTALW (Pearson and Lipman, Proc. Natl. Acad. Sci.
  • test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated.
  • sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters.
  • a "comparison window" includes reference to a segment of any one of the number of contiguous residues. For example, in alternative aspects of the invention, contiguous residues ranging anywhere from 20 to the full length of an exemplary sequence of the invention, e.g., SEQ ID NO:l, SEQ ID NO:2, SEQ ID NO:3,
  • SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, etc. are compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned. If the reference sequence has the requisite sequence identity to an exemplary sequence of the invention, e.g., 50%>, 51%>, 52%>, 53%, 54%>,
  • SEQ ID NO:3 SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:
  • subsequences ranging from about 20 to 600, about 50 to 200, and about
  • 100 to 150 are compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned.
  • Methods of alignment of sequence for comparison are well-known in the art.
  • Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith &
  • Such alignment programs can also be used to screen genome databases to identify polynucleotide sequences having substantially identical sequences.
  • a number of genome databases are available, for example, a substantial portion of the human genome is available as part of the Human Genome Sequencing Project (Gibbs, 1995).
  • Several genomes have been sequenced, e.g., M. genitalium (Fraser et al., 1995), M.jannaschii (Bult et al., 1996), H. influenzae (Fleischmann et al., 1995), E. coli (Blattner et al., 1997), and yeast (S. cerevisiae) (Mewes et al., 1997), andD.
  • BLAST BLAST 2.0 and BLAST 2.2.2 algorithms are also used to practice the invention. They are described, e.g., in Altschul (1977) Nuc. Acids Res. 25:3389- 3402; Altschul (1990) J. Mol. Biol. 215:403-410. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information.
  • This algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence, which either match or satisfy some positive-valued threshold score T when aligned with a word of the same length in a database sequence. T is refened to as the neighborhood word score threshold (Altschul
  • the BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment.
  • the BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin & Altschul (1993) Proc. Natl. Acad. Sci. USA
  • nucleic acid is considered similar to a references sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.2, more preferably less than about 0.01, and most preferably less than about 0.001.
  • protein and nucleic acid sequence homologies are evaluated using the Basic Local Area Network (WLAN)
  • BLAST Alignment Search Tool
  • BLASTP and BLAST3 compare an amino acid query sequence against a protein sequence database
  • BLASTN compares a nucleotide query sequence against a nucleotide sequence database
  • BLASTX compares the six-frame conceptual translation products of a query nucleotide sequence (both strands) against a protein sequence database
  • TBLASTN compares a query protein sequence against a nucleotide sequence database translated in all six reading frames (both strands)
  • TBLASTX compares the six-frame translations of a nucleotide query sequence against the six-frame translations of a nucleotide sequence database.
  • the BLAST programs identify homologous sequences by identifying similar segments, which are refened to herein as "high-scoring segment pairs," between a query amino or nucleic acid sequence and a test sequence which is preferably obtained from a protein or nucleic acid sequence database.
  • High-scoring segment pairs are preferably identified (i.e., aligned) by means of a scoring matrix, many of which are known in the art.
  • the scoring matrix used is the BLOSUM62 matrix (Gonnet et al., Science 256:1443-1445, 1992; Henilcoff and Henikoff, Proteins 17:49-61, 1993).
  • the PAM or PAM250 matrices may also be used (see, e.g., Schwartz and Dayhoff, eds., 1978, Matrices for Detecting Distance Relationships: Atlas of Protein Sequence and Stracture, Washington: National Biomedical Research Foundation).
  • PAM or PAM250 matrices may also be used (see, e.g., Schwartz and Dayhoff, eds., 1978, Matrices for Detecting Distance Relationships: Atlas of Protein Sequence and Stracture, Washington: National Biomedical Research Foundation).
  • die NCBI BLAST 2.2.2 programs is used, default options to blastp. There are about 38 setting options in the BLAST 2.2.2 program.
  • all default values are used except for the default filtering setting (i.e., all parameters set to default except filtering which is set to OFF); in its place a "-F F" settmg is used, which disables filtering.
  • Use of default filtering often results in Karlin- Altschul violations due to short length of sequence.
  • the default values used in this exemplary aspect of the invention, and to determine the values in Figure 11, as discussed above, include: "Filter for low complexity: ON > Word Size: 3 > Matrix: Blosum62 > Gap Costs: Existence: 11 > Extension: 1"
  • a polypeptide or nucleic acid sequence of the invention can be stored, recorded, and manipulated on any medium which can be read and accessed by a computer.
  • the invention provides computers, computer systems, computer readable mediums, computer programs products and the like recorded or stored thereon the nucleic acid and polypeptide sequences of the invention, e.g., an exemplary sequence of the invention, e.g., SEQ ID NO:l, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, etc.
  • the words “recorded” and “stored” refer to a process for storing information on a computer medium.
  • Computer readable media include magnetically readable media, optically readable media, electronically readable media, magnetic/optical media, flash memories.
  • the computer readable media may be a hard disk, a floppy disk, a magnetic tape, a flash memory, CD-ROM, Digital Versatile Disk (DVD), Random Access Memory (RAM), or Read Only Memory (ROM), or any type of media known to those skilled in the art.
  • aspects of the invention include systems (e.g., internet based systems), particularly computer systems, which store and manipulate the sequences and sequence information described herein.
  • a computer system 100 is illustrated in block diagram form i Figure 1.
  • a computer system refers to the hardware components, software components, and data storage components used to analyze a nucleotide or polypeptide sequence of the invention.
  • the computer system 100 can include a processor for processing, accessing and manipulating the sequence data.
  • the processor 105 can be any well-known type of central processing unit, such as, for example, the Pentium III from Intel Corporation, or similar processor from Sun,
  • the computer system 100 is a general purpose system that comprises the processor 105 and one or more internal data storage components 110 for storing data, and one or more data retrieving devices for retrieving the data stored on the data storage components.
  • the computer system 100 includes a processor 105 connected to a bus which is connected to a main memory 115 (preferably implemented as RAM) and one or more internal data storage devices 110, such as a hard drive and/or other computer readable media having data recorded thereon.
  • the computer system 100 can further include one or more data retrieving device 118 for reading the data stored on the internal data storage devices 110.
  • the data retrieving device 118 may represent, for example, a floppy disk drive, a compact disk drive, a magnetic tape drive, or a modem capable of connection to a remote data storage system (e.g., via the internet) etc.
  • the internal data storage device 110 is a removable computer readable medium such as a floppy disk, a compact disk, a magnetic tape, etc. containing control logic and/or data recorded thereon.
  • the computer system 100 may advantageously include or be programmed by appropriate software for reading the control logic and/or the data from the data storage component once inserted in the data retrieving device.
  • the computer system 100 includes a display 120 which is used to display output to a computer user.
  • the computer system 100 can be linked to other computer systems 125a-c in a network or wide area network to provide centralized access to the computer system 100.
  • Software for accessing and processing the nucleotide or amino acid sequences of the invention can reside in main memory 115 during execution.
  • the computer system 100 may further comprise a sequence comparison algorithm for comparing a nucleic acid sequence of the invention.
  • the algorithm and sequence(s) can be stored on a computer readable medium.
  • a "sequence comparison algorithm” refers to one or more programs which are implemented (locally or remotely) on the computer system 100 to compare a nucleotide sequence with other nucleotide sequences and/or compounds stored within a data storage means.
  • the sequence comparison algorithm may compare the nucleotide sequences of an exemplary sequence, e.g., SEQ ID NO: 1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, etc. stored on a computer readable medium to reference sequences stored on a computer readable medium to identify homologies or structural motifs.
  • the parameters used with the above algorithms may be adapted depending on the sequence length and degree of homology studied. In some aspects, the parameters may be the default parameters used by the algorithms in the absence of instructions from the user.
  • Figure 2 is a flow diagram illustrating one aspect of a process 200 for comparing a new nucleotide or protein sequence with a database of sequences in order to determine the homology levels between the new sequence and the sequences in the database.
  • the database of sequences can be a private database stored within the computer system 100, or a public database such as GENBANK that is available through the Internet.
  • the process 200 begins at a start state 201 and then moves to a state 202 wherein the new sequence to be compared is stored to a memory in a computer system 100.
  • the memory could be any type of memory, including RAM or an internal storage device.
  • the process 200 then moves to a state 204 wherein a database of sequences is opened for analysis and comparison.
  • the term “same” is not limited to sequences that are absolutely identical.
  • the process 200 moves to a state 214 wherein die name of the sequence from the database is displayed to the user. This state notifies the user that the sequence with the displayed name fulfills the homology constraints that were entered. Once the name of the stored sequence is displayed to the user, the process 200 moves to a decision state 218 wherein a determination is made whether more sequences exist in the database. If no more sequences exist in the database, then the process 200 terminates at an end state 220.
  • the sequence comparer may indicate a homology level between the sequences compared or identify structural motifs, or it may identify structural motifs in sequences which are compared to these nucleic acid codes and polypeptide codes.
  • Figure 3 is a flow diagram illustrating one embodiment of a process 250 in a computer for determining whether two sequences are homologous.
  • the process 250 begins at a start state 252 and then moves to a state 254 wherein a first sequence to be compared is stored to a memory.
  • the second sequence to be compared is then stored to a memory at a state 256.
  • the process 250 then moves to a state 260 wherein the first character in die first sequence is read and then to a state 262 wherein the first character of d e second sequence is read.
  • sequence is a nucleotide sequence
  • the character would normally be either A, T, C, G or U.
  • the sequence is a protein sequence, then it can be a single letter amino acid code so that the first and sequence sequences can be easily compared.
  • a determination is then made at a decision state 264 whether the two characters are the same. If they are the same, then the process
  • the process 250 moves to a state 268 wherein the next characters in the first and second sequences are read. A determination is then made whether the next characters are the same. If they are, d en the process 250 continues this loop until two characters are not the same. If a determination is made that the next two characters are not the same, the process 250 moves to a decision state 274 to determine whether there are any more characters either sequence to read. If there are not any more characters to read, then the process 250 moves to a state 276 wherein the level of homology between the first and second sequences is displayed to the user. The level of homology is determined by calculating the proportion of characters between the sequences that were the same out of the total number of sequences in the first sequence.
  • the computer program can compare a reference sequence to a sequence of the invention to determine whether the sequences differ at one or more positions.
  • the program can record the length and identity of inserted, deleted or substituted nucleotides or amino acid residues with respect to the sequence of either the reference or the invention.
  • the computer program may be a program which determines whether a reference sequence contains a single nucleotide polymorphism (S?NP) with respect to a sequence of the invention, or, whether a sequence of the invention comprises a SIMP of a known sequence.
  • S?NP single nucleotide polymorphism
  • the computer program is a program which identifies SJNPs.
  • the method may be implemented by the computer systems described above and the method illustrated in Figure 3. The method can be performed by reading a sequence of the invention and the reference sequences through the use of the computer program and identifying differences with the computer program.
  • the computer based system comprises an identifier for identifying features within a nucleic acid or polypeptide of the invention.
  • An "identifier" refers to one or more programs which identifies certain features within a nucleic acid sequence.
  • an identifier may comprise a program which identifies an open reading frame (ORF) in a nucleic acid sequence.
  • Figure 4 is a flow diagram illusfrating one aspect of an identifier process 300 for detecting the presence of a feature in a sequence.
  • the process 300 begins at a start state 302 and then moves to a state 304 wherein a first sequence that is to be checked for features is stored to a memory 115 in d e computer system 100.
  • the process 300 then moves to a state 306 wherein a database of sequence features is opened.
  • a database would include a list of each feature's attributes along with the name of the feature. For example, a feature name could be
  • the features may be stractural polypeptide motifs such as alpha helices, beta sheets, or functional polypeptide motifs such as enzymatic active sites, helix-turn-helix motifs or other motifs known to those skilled in the art.
  • the process 300 moves to a state 308 wherein the first feature is read from the database.
  • a comparison of the attribute of the first feature with the first sequence is then made at a state 310.
  • a determination is then made at a decision state 316 whether the attribute of the feature was found in the first sequence. If the attribute was found, then the process 300 moves to a state 318 wherein the name of the found feature is displayed to the user.
  • the process 300 then moves to a decision state 320 wherein a determination is made whether move features exist in the database. If no more features do exist, then the process 300 terminates at an end state 324. However, if more features do exist in the database, then the process 300 reads the next sequence feature at a state 326 and loops back to the state 310 wherein die attribute of the next feature is compared against the first sequence. If the feature attribute is not found in the first sequence at the decision state 316, the process 300 moves directly to the decision state 320 in order to determine if any more features exist in the database.
  • the invention provides a computer program that identifies open reading frames (ORFs).
  • a polypeptide or nucleic acid sequence of the invention may be stored and manipulated in a variety of data processor programs in a variety of formats.
  • a sequence can be stored as text in a word processing file, such as MicrosoftWORD or WORDPERFECT or as an ASCII file in a variety of database programs familiar to those of skill in the art, such as DB2, SYBASE, or 0?RACLE.
  • many computer programs and databases may be used as sequence comparison algorithms, identifiers, or sources of reference nucleotide sequences or polypeptide sequences to be compared to a nucleic acid sequence of the invention.
  • the programs and databases used to practice the invention mclude, but are not limited to: MacPattern (EMBL), DiscoveryBase (Molecular Applications Group), GeneMine (Molecular Applications Group), Look (Molecular Applications Group), MacLook (Molecular Applications Group), BLAST and BLAST2 (NCBI), BLASTN and BLASTX (Altschul et al, J. Mol. Biol. 215: 403, 1990), FASTA (Pearson and Lipman, Proc. Natl. Acad. Sci. USA, 85: 2444, 1988), FASTDB (Bratlag et al. Comp. App. Biosci.
  • Motifs which may be detected using the above programs include sequences encoding leucine zippers, helix-turn-helix motifs, glycosylation sites, ubiquitination sites, alpha helices, and beta sheets, signal sequences encoding signal peptides which direct the secretion of the encoded proteins, sequences implicated in franscription regulation such as homeoboxes, acidic stretches, enzymatic active sites, substrate binding sites, and enzymatic cleavage sites.
  • the invention provides isolated or recombinant nucleic acids that hybridize under stringent conditions to an exemplary sequence of the invention, e.g., a sequence as set forth in SEQ ID NO:l, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:ll, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO: 19, SEQ ID NO:21, SEQ ID NO:23, SEQ ID NO:25, SEQ ID NO:27, SEQ ID NO:29, SEQ ID NO:31, SEQ ID NO:33, SEQ ID NO:35, SEQ ID NO:37, SEQ ID NO:39, SEQ ID NO:41, SEQ ID NO:43, SEQ ID NO:45, SEQ ID NO:47, SEQ ID NO:49, SEQ ID NO:51, SEQ ID NO:53, SEQ ID NO:55, SEQ ID NO:57, SEQ ID NO:
  • nucleic acids are useful as, e.g., hybridization probes, labeling probes, PCR oligonucleotide probes, iRNA (single or double stranded), antisense or sequences encoding antibody binding peptides (epitopes), motifs, active sites, binding domains, regulatory domains and the like.
  • nucleic acids of the invention are defined by their ability to hybridize under high stringency comprises conditions of about 50% formamide at about 37°C to 42°C.
  • nucleic acids of the invention are defined by their ability to hybridize under reduced stringency comprising conditions in about 35% to 25% formamide at about 30°C to 35°C.
  • nucleic acids of the invention are defined by their ability to hybridize under high stringency comprising conditions at 42°C in 50% formamide, 5X SSPE, 0.3% SDS, and a repetitive sequence blocking nucleic acid, such as cot-1 or salmon sperm DNA (e.g., 200 n/ml sheared and denatured salmon sperm DNA).
  • nucleic acids of the invention are defined by their ability to hybridize under reduced stringency conditions comprising 35% formamide at a reduced temperature of 35°C. Following hybridization, the filter may be washed with 6X SSC, 0.5%> SDS at 50°C. These conditions are considered to be "moderate” conditions above 25% formamide and "low” conditions below 25%> formamide.
  • a specific example of “moderate” hybridization conditions is when the above hybridization is conducted at 30%> formamide.
  • a specific example of “low stringency” hybridization conditions is when the above hybridization is conducted at 10% formamide.
  • the temperature range conesponding to a particular level of stringency can be further nanowed by calculating the purine to pyrimidine ratio of the nucleic acid of interest and adjusting the temperature accordingly.
  • Nucleic acids of the invention are also defined by their ability to hybridize under high, medium, and low stringency conditions as set forth in Ausubel and Sambrook. Variations on the above ranges and conditions can be used to practice the invention and are well known in the art. Hybridization conditions are discussed further, below.
  • the invention also provides nucleic acid probes for identifying nucleic acids encoding a polypeptide having a phospholipase activity.
  • the probe comprises at least 10 consecutive bases of a sequence as set forth in SEQ ID NO:l, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO: 11, SEQ ID NO: 13, SEQ ID NO: 15, SEQ ID NO: 17, SEQ ID NO:19, SEQ ID NO:21, SEQ ID NO:23, SEQ ID NO:25, SEQ ID NO:27, SEQ ID NO:29, SEQ ID NO:31, SEQ ID NO:33, SEQ ID NO:35, SEQ ID NO:37, SEQ ID NO:39, SEQ ID NO:41, SEQ ID NO:43, SEQ ID NO:45, SEQ ID NO:47, SEQ ID NO:49, SEQ ID NO:51, SEQ ID NO:53, SEQ
  • a probe of the invention can be at least about 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 35, 40, 50, 55, 60, 65, 70, 75, 80, 90, 100, or 150, or more, or about 10 to 50, about 20 to 60 about 30 to 70, consecutive bases of a sequence as set forth in a sequence of the invention.
  • the probes identify a nucleic acid by binding or hybridization.
  • the probes can be used in anays of the invention, see discussion below, including, e.g., capillary anays.
  • the probes of the invention can also be used to isolate other nucleic acids or polypeptides.
  • the probes of the invention can be used to determine whether a biological sample, such as a soil sample, contains an organism havmg a nucleic acid sequence of the invention or an organism from which the nucleic acid was obtained.
  • a biological sample potentially harboring the organism from which the nucleic acid was isolated is obtained and nucleic acids are obtained from the sample.
  • the nucleic acids are contacted with the probe under conditions which permit the probe to specifically hybridize to any complementary sequences present in the sample.
  • conditions which permit the probe to specifically hybridize to complementary sequences may be determined by placing the probe in contact with complementary sequences from samples known to contain the complementary sequence, as well as control sequences which do not contain the complementary sequence.
  • Hybridization conditions such as the salt concentration of the hybridization buffer, the formamide concentration of the hybridization buffer, or the hybridization temperature, may be varied to identify conditions which allow the probe to hybridize specifically to complementary nucleic acids (see discussion on specific hybridization conditions). If the sample contains the organism from which the nucleic acid was isolated, specific hybridization of the probe is then detected. Hybridization may be detected by labeling the probe with a detectable agent such as a radioactive isotope, a fluorescent dye or an enzyme capable of catalyzing the formation of a detectable product. Many methods for using the labeled probes to detect the presence of complementary nucleic acids in a sample are familiar to those skilled in the art.
  • probes comprise oligonucleotides.
  • the amplification reaction may comprise a PCR reaction. PCR protocols are described in Ausubel and Sambrook (see discussion on amplification reactions).
  • nucleic acid sequences of the invention are used as probes to identify and isolate related nucleic acids.
  • the so-identified related nucleic acids may be cDNAs or genomic DNAs from organisms other than the one from which the nucleic acid of the invention was first isolated.
  • a nucleic acid sample is contacted with the probe under conditions which permit the probe to specifically hybridize to related sequences.
  • Hybridization of the probe to nucleic acids from the related organism is then detected using any of the methods described above.
  • the conditions used to achieve a particular level of stringency will vary, depending on the nature of the nucleic acids being hybridized.
  • the length, degree of complementarity, nucleotide sequence composition (e.g., GC v. AT content), and nucleic acid type (e.g., RNA v. DNA) of the hybridizing regions of the nucleic acids can be considered in selecting hybridization conditions.
  • An additional consideration is whether one of the nucleic acids is immobilized, for example, on a filter. Hybridization may be carried out under conditions of low stringency, moderate stringency or high stringency.
  • a polymer membrane containing immobilized denatured nucleic acids is first prehybridized for 30 minutes at 45°C in a solution consisting of 0.9 M NaCl, 50 mM NaH2P04, pH 7.0, 5.0 mM Na2EDTA, 0.5% SDS, 10X Denhardfs, and 0.5 mg/ml polyriboadenylic acid. Approximately 2 X 107 cpm (specific activity 4-9 X 108 cpmug) of 32 P end-labeled oligonucleotide probe are then added to the solution.
  • the membrane is washed for 30 minutes at room temperature (RT) in IX SET (150 mM NaCl, 20 mM Tris hydrochloride, pH 7.8, 1 mM Na2EDTA) containing 0.5% SDS, followed by a 30 minute wash in fresh IX SET at Tm-10°C for the oligonucleotide probe.
  • IX SET 150 mM NaCl, 20 mM Tris hydrochloride, pH 7.8, 1 mM Na2EDTA
  • the membrane is then exposed to auto-radiographic film for detection of hybridization signals.
  • Tm is the temperature (under defined ionic strength and pH) at which 50% of the target sequence hybridizes to a perfectly complementary probe. Very stringent conditions are selected to be equal to or about 5°C lower than the Tm for a particular probe.
  • Prehybridization may be carried out in 6X SSC, 5X Denhardfs reagent, 0.5% SDS, lOO ⁇ g denatured fragmented salmon sperm DNA or 6X SSC, 5X Denhardfs reagent, 0.5%> SDS, lOO ⁇ g denatured fragmented salmon sperm DNA, 50%) formamide.
  • Formulas for SSC and Denhardfs and other solutions are listed, e.g., in Sambrook.
  • Hybridization is conducted by adding the detectable probe to the prehybridization solutions listed above. Where the probe comprises double stranded DNA, it is denatured before addition to the hybridization solution. The filter is contacted with the hybridization solution for a sufficient period of time to allow the probe to hybridize to cDNAs or genomic DNAs containing sequences complementary thereto or homologous thereto. For probes over 200 nucleotides in length, the hybridization may be carried out at 15-25°C below the Tm. For shorter probes, such as oligonucleotide probes, _ the hybridization may be conducted at 5-10°C below the Tm. In one aspect, hybridizations in 6X SSC are conducted at approximately 68°C.
  • hybridizations in 50% formamide containing solutions are conducted at approximately 42°C. All of the foregoing hybridizations would be considered to be under conditions of high stringency.
  • the filter is washed to remove any non- specifically bound detectable probe.
  • the stringency used to wash the filters can also be varied depending on the nature of the nucleic acids being hybridized, the length of the nucleic acids being hybridized, the degree of complementarity, the nucleotide sequence composition (e.g., GC v. AT content), and the nucleic acid type (e.g., RNA v. DNA).
  • Examples of progressively higher stringency condition washes are as follows: 2X SSC, 0.1%) SDS at room temperature for 15 minutes (low stringency); 0.1X SSC, 0.5%> SDS at room temperature for 30 minutes to 1 hour (moderate stringency); 0.1X SSC, 0.5%> SDS for 15 to 30 minutes at between the hybridization temperature and 68°C (high stringency); and 0.15M NaCl for 15 minutes at 72°C (very high stringency).
  • a final low stringency wash can be conducted in 0. IX SSC at room temperature.
  • the examples above are merely illustrative of one set of conditions that can be used to practice the invention, e.g., to wash filters.
  • Nucleic acids which have hybridized to the probe can be identified by autoradiography or other conventional techniques. The above procedure may be modified to identify nucleic acids having decreasing levels of homology to the probe sequence. For example, to obtain nucleic acids of decreasing homology to the detectable probe, less stringent conditions may be used.
  • the hybridization temperature may be decreased in increments of 5°C from 68°C to 42°C in a hybridization buffer having a Na+ concentration of approximately 1M.
  • the filter may be washed with 2X SSC, 0.5% SDS at the temperature of hybridization.
  • hybridization may be carried out in buffers, such as 6X SSC, containing formamide at a temperature of 42°C.
  • concentration of formamide in the hybridization buffer may be reduced in 5%> increments from 50% to 0% to identify clones having decreasing levels of homology to the probe.
  • the filter may be washed with 6X SSC, 0.5% SDS at 50°C.
  • Moderate conditions above 25% formamide and “low” conditions below 25% formamide.
  • a specific example of “moderate” hybridization conditions is when the above hybridization is conducted at 30% formamide.
  • a specific example of “low stringency” hybridization conditions is when the above hybridization is conducted at 10% formamide.
  • probes and methods of the invention can be used to isolate nucleic acids having a sequence with at least about 99%, at least 98%, at least 97%, at least 96%, at least 95%, at least 90%, at least 85%, at least 80%, at least 75%, at least 70%, at least 65%, at least 60%, at least 55%, or at least 50% homology to a nucleic acid sequence of the invention comprising at least about 10, 15, 20, 25, 30, 35, 40, 50, 75, 100, 150, 200, 250, 300, 350, 400, or 500 consecutive bases thereof, and the sequences complementary thereto. Homology may be measured using an alignment algorithm, as discussed herein.
  • the homologous polynucleotides may have a coding sequence which is a naturally occurring allelic variant of one of the coding sequences described herein.
  • allelic variants may have a substitution, deletion or addition of one or more nucleotides when compared to nucleic acids of the invention.
  • probes and methods of the invention may be used to isolate nucleic acids which encode polypeptides having at least about 99%, at least 95%, at least 90%, at least 85%, at least 80%, at least 75%, at least 70%, at least 65%, at least 60%, at least 55%, or at least 50% sequence identity (homology) to a polypeptide of the invention comprising at least 5, 10, 15, 20, 25, 30, 35, 40, 50, 75, 100, or 150 consecutive amino acids thereof as determined using a sequence alignment algorithm (e.g., such as the FASTA version 3.0t78 algorithm with the default parameters, or a BLAST 2.2.2 program with exemplary settings as set forth herein).
  • a sequence alignment algorithm e.g., such as the FASTA version 3.0t78 algorithm with the default parameters, or a BLAST 2.2.2 program with exemplary settings as set forth herein.
  • the invention further provides for nucleic acids complementary to (e.g., antisense sequences to) the nucleic acids of the invention, e.g., phospholipase-encoding nucleic acids.
  • Antisense sequences are capable of inhibiting the transport, splicing or transcription of phospholipase-encoding genes.
  • the inhibition can be effected through the targeting of genomic DNA or messenger RNA.
  • the franscription or function of targeted nucleic acid can be inhibited, for example, by hybridization and/or cleavage.
  • One particularly useful set of inhibitors provided by the present invention includes oligonucleotides which are able to either bind phospholipase gene or message, in either case preventing or inhibiting the production or function of phospholipase enzyme. The association can be though sequence specific hybridization.
  • Another useful class of inhibitors includes oligonucleotides which cause inactivation or cleavage of phospholipase message.
  • the oligonucleotide can have enzyme activity which causes such cleavage, such as ribozymes.
  • the oligonucleotide can be chemically modified or conjugated to an enzyme or composition capable of cleaving the complementary nucleic acid.
  • compositions of the invention that inhibit the expression and/or activity of phospholipase, e.g., antibodies, antisense oligonucleotides, ribozymes and RNAi, are used to slow or prevent spoilage.
  • the invention provides methods and compositions comprising application onto a plant or plant product (e.g., a fruit, seed, root, leaf, etc.) antibodies, antisense oligonucleotides, ribozymes and RNAi of the invention to slow or prevent spoilage.
  • a plant or plant product e.g., a fruit, seed, root, leaf, etc.
  • antisense oligonucleotides, ribozymes and RNAi of the invention to slow or prevent spoilage.
  • Antisense Oligonucleotides capable of binding phospholipase message which can inhibit phospholipase activity by targeting mRNA. Sfrategies for designing antisense oligonucleotides are well described in the scientific and patent literature, and the skilled artisan can design such phospholipase oligonucleotides using the novel reagents of the invention. For example, gene walking/ RNA mapping protocols to screen for effective antisense oligonucleotides are well known in the art, see, e.g., Ho (2000) Methods Enzymol.
  • RNA mapping assay 314:168-183, describing an RNA mapping assay, which is based on standard molecular techniques to provide an easy and reliable method for potent antisense sequence selection. See also Smith (2000) Eur. J. Pharm. Sci. 11:191-198.
  • Naturally occurring nucleic acids are used as antisense oligonucleotides.
  • the antisense oligonucleotides can be of any length; for example, in alternative aspects, the antisense oligonucleotides are between about 5 to 100, about 10 to 80, about 15 to 60, about 18 to 40. The optimal length can be determined by routine screening.
  • the antisense oligonucleotides can be present at any concentration. The optimal concentration can be determined by routine screening.
  • PNAs peptide nucleic acids
  • Antisense oligonucleotides having phosphorothioate linkages can also be used, as described in WO 97/03211; WO 96/39154; Mata (1997) Toxicol Appl Pharmacol 144:189-197; Antisense Therapeutics, ed. Agrawal (Humana Press, Totowa, N.J., 1996).
  • Antisense oligonucleotides having synthetic DNA backbone analogues provided by the invention can also include phosphoro-dithioate, methylphosphonate, phosphoramidate, alkyl phosphotriester, sulfamate, 3'-thioacetal, methylene(methylimino), 3'-N-carbamate, and morpholino carbamate nucleic acids, as described above.
  • Combinatorial chemistry methodology can be used to create vast numbers of oligonucleotides that can be rapidly screened for specific oligonucleotides that have appropriate binding affinities and specificities toward any target, such as the sense and antisense phospholipase sequences of the invention (see, e.g., Gold (1995) J. of Biol. Chem. 270:13581-13584).
  • Inhibitory Ribozymes The invention provides for with ribozymes capable of binding phospholipase message which can inhibit phospholipase enzyme activity by targeting mRNA.
  • Ribozymes act by binding to a target RNA through the target RNA binding portion of a ribozyme which is held in close proximity to an enzymatic portion of the RNA that cleaves the target RNA.
  • the ribozyme recognizes and binds a target RNA through complementary base-pairing, and once bound to the conect site, acts enzymatically to cleave and inactivate the target RNA.
  • the enzymatic nature of a ribozyme can be advantageous over other technologies, such as antisense technology (where a nucleic acid molecule simply binds to a nucleic acid target to block its transcription, translation or association with another molecule) as the effective concentration of ribozyme necessary to effect a therapeutic treatment can be lower than that of an antisense oligonucleotide.
  • a ribozyme is typically a highly specific inhibitor, with the specificity of inhibition depending not only on the base pairing mechanism of binding, but also on the mechanism by which the molecule inhibits the expression of the RNA to which it binds. That is, the inhibition is caused by cleavage of the RNA target and so specificity is defined as the ratio of the rate of cleavage of the targeted RNA over the rate of cleavage of non-targeted RNA. This cleavage mechanism is dependent upon factors additional to those involved in base pairing.
  • RNA molecule of this invention has- a specific substrate binding site complementary to one or more of the target gene RNA regions, and has nucleotide sequence within or sunounding that substrate binding site which imparts an RNA cleaving activity to the molecule.
  • RNA interference provides an RNA inhibitory molecule, a so- called "RNAi" molecule, comprising a phospholipase sequence of the invention.
  • the RNAi molecule comprises a double-stranded RNA (dsRNA) molecule.
  • the RNAi can inhibit expression of a phospholipase gene.
  • the RNAi is about 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25 or more duplex nucleotides in length. While the invention is not limited by any particular mechanism of action, the RNAi can enter a cell and cause the degradation of a single-stranded RNA (ssRNA) of similar or identical sequences, including endogenous mRNAs.
  • ssRNA single-stranded RNA
  • RNA interference RNA interference
  • dsRNA double-stranded RNA
  • short interfering RNA short interfering RNA
  • the RNAi's of the invention are used in gene-silencing therapeutics, see, e.g., Shuey (2002) Drag Discov. Today 7:1040-1046.
  • the invention provides methods to selectively degrade RNA using the RNAi's of the invention.
  • RNAi molecules of the invention can be used to generate a loss-of-function mutation in a cell, an organ or an animal.
  • Methods for making and using RNAi molecules for selectively degrade RNA are well known in the art, see, e.g., U.S. Patent No. 6,506,559; 6,511,824; 6,515,109; 6,489,127.
  • the invention provides methods for modifying an enzyme of the invention, e.g., by mutation of its coding sequence, e.g., by GSSMTM, to increase its resistance to protease activity.
  • the invention provides methods for modifying an enzyme of the invention, e.g., by mutation of its coding sequence, e.g., by GSSMTM, to modify the enzyme's use of metal chelators specific for Ca, Mg, Na that would not chelate Zn.
  • the invention provides methods for modifying an enzyme of the invention, e.g., by mutation of its coding sequence, e.g., by GSSMTM, that would have a desired combination of activities, e.g., PI, PA and PC/PE specific PLCs.
  • phospholipase enzymes having an altered or different activity or an altered or different stability from that of a phospholipase encoded by the template nucleic acid.
  • methods also can be repeated or used in various combinations, e.g., to generate variations in gene/ message expression, message translation or message stability.
  • the genetic composition of a cell is altered by, e.g., modification of a homologous gene ex vivo, followed by its reinsertion into the cell.
  • a nucleic acid of the invention can be altered by any means. For example, random or stochastic methods, or, non-stochastic, or "directed evolution," methods.
  • mutagens can be used to randomly mutate a gene.
  • Mutagens include, e.g., ultraviolet light or gamma irradiation, or a chemical mutagen, e.g., mitomycin, nitrous acid, photoactivated psoralens, alone or in combination, to induce DNA breaks amenable to repair by recombination.
  • chemical mutagens include, for example, sodium bisulfite, nitrous acid, hydroxylamine, hydrazine or formic acid.
  • mutagens are analogues of nucleotide precursors, e.g., nitrosoguanidine, 5- bromouracil, 2-aminopurine, or acridine. These agents can be added to a PCR reaction in place of the nucleotide precursor thereby mutating the sequence. Intercalating agents such as proflavine, acriflavine, quinacrine and the like can also be used. Any technique in molecular biology can be used, e.g., random PCR mutagenesis, see, e.g., Rice (1992) Proc. Natl. Acad. Sci. USA 89:5467-5471; or, combinatorial multiple cassette mutagenesis, see, e.g., Crameri (1995) Biotechniques
  • nucleic acids e.g., genes
  • modifications, additions or deletions are introduced by enor-prone PCR, shuffling, oligonucleotide-directed mutagenesis, assembly PCR, sexual PCR mutagenesis, in vivo mutagenesis, cassette mutagenesis, recursive ensemble mutagenesis, exponential ensemble mutagenesis, site-specific mutagenesis, gene reassembly, Gene Site Saturation MutagenesisTM (GSSMTM), synthetic ligation reassembly (SLR), recombination, recursive sequence recombination, phosphothioate-modified DNA mutagenesis, uracil-containing template mutagenesis, gapped duplex mutagenesis, point mismatch repair mutagenesis, repair-deficient host strain mutagenesis, chemical mutagenesis, radiogenic mutagenesis, deletion mutagenesis, restriction-selection
  • Additional protocols used in the methods of the invention include point mismatch repair (Kramer (1984) "Point Mismatch Repair” Cell 38:879-887), mutagenesis using repair-deficient host strains (Carter et al. (1985) "Improved oligonucleotide site- directed mutagenesis using M13 vectors” Nucl. Acids Res. 13: 4431-4443; and Carter (1987) "Improved oligonucleotide-directed mutagenesis using M13 vectors” Methods in Enzymol. 154: 382-403), deletion mutagenesis (Eghtedarzadeh (1986) "Use of oligonucleotides to generate large deletions" Nucl. Acids Res.
  • Non-stochastic, or "directed evolution,” methods include, e.g., saturation mutagenesis (e.g., GSSMTM), synthetic ligation reassembly (SLR), or a combination thereof are used to modify the nucleic acids of the invention to generate phospholipases with new or altered properties (e.g., activity under highly acidic or alkaline conditions, high temperatures, and the like).
  • Polypeptides encoded by the modified nucleic acids can be screened for an activity before testing for a phospholipase or other activity. Any testing modality or protocol can be used, e.g., using a capillary anay platform. See, e.g., U.S. Patent Nos. 6,280,926; 5,939,250. Saturation mutagenesis, or, GSSJMTM In one aspect of the invention, non-stochastic gene modification, a "directed evolution process,” is used to generate phospholipases with new or altered properties.
  • GSSMTM comprises providing a template polynucleotide and a plurality of oligonucleotides, wherein each oligonucleotide comprises a sequence homologous to the template polynucleotide, thereby targeting a specific sequence of the template polynucleotide, and a sequence that is a variant of the homologous gene; generating progeny polynucleotides comprising non-stochastic sequence variations by replicating the template polynucleotide with the oligonucleotides, thereby generating polynucleotides comprising homologous gene sequence variations.
  • At least two degenerate cassettes are used - either in the same oligonucleotide or not, for subjecting at least two original codons in a parental polynucleotide template to a full range of codon substitutions.
  • more than one N,N,G/T sequence can be contained in one oligonucleotide to introduce amino acid mutations at more than one site.
  • This plurality of N,N,G/T sequences can be directly contiguous, or separated by one or more additional nucleotide sequence(s).
  • oligonucleotides serviceable for introducing additions and deletions can be used either alone or in combination with the codons containing an N,N,G/T sequence, to introduce any combination or permutation of amino acid additions, deletions, and/or substitutions.
  • simultaneous mutagenesis of two or more contiguous amino acid positions is done using an oligonucleotide that contains contiguous N,N,G/T triplets, i.e. a degenerate (N,N,G/T)n sequence.
  • degenerate cassettes having less degeneracy than the N,N,G/T sequence are used. For example, it may be desirable in some instances to use (e.g.
  • a degenerate triplet sequence comprised of only one N, where said N can be in the first second or third position of the triplet.
  • Any other bases including any combinations and permutations thereof can be used in the remaining two positions of the triplet.
  • degenerate triplets e.g., N,N,G/T triplets
  • aUows for systematic and easy generation of a full range of possible natural amino acids (for a total of 20 amino acids) into each and every amino acid position in a polypeptide
  • the methods also include generation of less than aU possible substitutions per amino acid residue, or codon, position). For example, for a 100 amino acid polypeptide, 2000 distinct species (i.e. 20 possible amino acids per position X 100 amino acid positions) can be generated.
  • an oligonucleotide or set of oligonucleotides containing a degenerate N,N,G/T triplet 32 individual sequences can code for all 20 possible natural amino acids.
  • a reaction vessel in which a parental polynucleotide sequence is subjected to saturation mutagenesis using at least one such oligonucleotide there are generated 32 distinct progeny polynucleotides encoding 20 distinct polypeptides.
  • the use of a non-degenerate oligonucleotide in site- directed mutagenesis leads to only one progeny polypeptide product per reaction vessel.
  • Nondegenerate oligonucleotides can optionally be used in combination with degenerate primers disclosed; for example, nondegenerate oligonucleotides can be used to generate specific point mutations in a working polynucleotide. This provides one means to generate specific silent point mutations, point mutations leading to conesponding amino acid changes, and point mutations that cause the generation of stop codons and the conesponding expression of polypeptide fragments.
  • each saturation mutagenesis reaction vessel contains polynucleotides encoding at least 20 progeny polypeptide (e.g., phospholipase) molecules such that all 20 natural amino acids are represented at the one specific amino acid position conesponding to the codon position mutagenized in the parental polynucleotide
  • progeny polypeptide e.g., phospholipase
  • the 32-fold degenerate progeny polypeptides generated from each saturation mutagenesis reaction vessel can be subjected to clonal amplification (e.g. cloned into a suitable host, e.g., E. coli host, using, e.g., an expression vector) and subjected to expression screening.
  • clonal amplification e.g. cloned into a suitable host, e.g., E. coli host, using, e.g., an expression vector
  • an individual progeny polypeptide is identified by screening to display a favorable change in property (when compared to the parental polypeptide, such as increased phospholipase activity under alkaline or acidic conditions), it can be sequenced to identify the conespondingly favorable amino acid substitution contained therein.
  • favorable amino acid changes may be identified at more than one amino acid position.
  • One or more new progeny molecules can be generated that contain a combination of all or part of these favorable amino acid substitutions. For example, if 2 specific favorable amino acid changes are identified in each of 3 amino acid positions in a polypeptide, the permutations include 3 possibilities at each position (no change from the original amino acid, and each of two favorable changes) and 3 positions. Thus, there are 3 x 3 x 3 or 27 total possibilities, including 7 that were previously examined - 6 single point mutations (i.e. 2 at each of three positions) and no change at any position.
  • site-saturation mutagenesis can be used together with another stochastic or non-stochastic means to vary sequence, e.g., synthetic ligation reassembly (see below), shuffling, chimerization, recombination and other mutagenizing processes and mutagenizing agents.
  • This invention provides for the use of any mutagenizing process(es), including saturation mutagenesis, in an iterative manner.
  • Synthetic Ligation Reassembly (SLR) The invention provides a non-stochastic gene modification system termed "synthetic ligation reassembly," or simply “SLR,” a "directed evolution process,” to generate phospholipases with new or altered properties.
  • SLR is a method of ligating oligonucleotide fragments together non-stochastically. This method differs from stochastic oligonucleotide shuffling in that the nucleic acid building blocks are not shuffled, concatenated or chimerized randomly, but rather are assembled non- stochastically. See, e.g., U.S. Patent Application Serial No. (USSN) 09/332,835 entitled “Synthetic Ligation Reassembly in Directed Evolution” and filed on June 14, 1999 (“USSN 09/332,835").
  • SLR comprises the following steps: (a) providing a template polynucleotide, wherein the template polynucleotide comprises sequence encoding a homologous gene; (b) providing a plurality of building block polynucleotides, wherein the building block polynucleotides are designed to cross-over reassemble with the template polynucleotide at a predetermined sequence, and a building block polynucleotide comprises a sequence that is a variant of the homologous gene and a sequence homologous to the template polynucleotide flanking the variant sequence; (c) combining a building block polynucleotide with a template polynucleotide such that the building block polynucleotide cross-over reassembles with the template polynucleotide to generate polynucleotides comprising homologous gene sequence variations.
  • SLR does not depend on the presence of high levels of homology between polynucleotides to be reananged.
  • this method can be used to non-stochastically generate libraries (or sets) of progeny molecules comprised of over 10 100 different chimeras.
  • SLR can be used to generate libraries comprised of over 10 1000 different progeny chimeras.
  • aspects of the present invention include non-stochastic methods of producing a set of finalized chimeric nucleic acid molecule shaving an overall assembly order that is chosen by design. This method includes the steps of generating by design a plurality of specific nucleic acid building blocks having serviceable mutually compatible ligatable ends, and assembling these nucleic acid building blocks, such that a designed overall assembly order is achieved.
  • the mutually compatible ligatable ends of the nucleic acid building blocks to be assembled are considered to be "serviceable" for this type of ordered assembly if they enable the building blocks to be coupled in predetermined orders.
  • the overall assembly order in which the nucleic acid building blocks can be coupled is specified by the design of the ligatable ends. If more than one assembly step is to be used, then the overall assembly order in which the nucleic acid building blocks can be coupled is also specified by the sequential order of the assembly step(s).
  • the annealed building pieces are treated with an enzyme, such as a ligase (e.g. T4 DNA ligase), to achieve covalent bonding of the building pieces.
  • a ligase e.g. T4 DNA ligase
  • the design of the oligonucleotide building blocks is obtained by analyzing a set of progenitor nucleic acid sequence templates that serve as a basis for producing a progeny set of finalized chimeric polynucleotides.
  • These parental oligonucleotide templates thus serve as a source of sequence information that aids in the design of the nucleic acid building blocks that are to be mutagenized, e.g., chimerized or shuffled.
  • the sequences of a plurality of parental nucleic acid templates are aligned in order to select one or more demarcation points.
  • the demarcation points can be located at an area of homology, and are comprised of one or more nucleotides.
  • demarcation points are preferably shared by at least two of the progenitor templates.
  • the demarcation points can thereby be used to dehneate die boundaries of oligonucleotide building blocks to be generated in order to reanange the parental polynucleotides.
  • the demarcation points identified and selected in the progenitor molecules serve as potential chimerization points in the assembly of the final chimeric progeny molecules.
  • a demarcation point can be an area of homology (comprised of at least one homologous nucleotide base) shared by at least two parental polynucleotide sequences.
  • a demarcation point can be an area of homology that is shared by at least half of the parental polynucleotide sequences, or, it can be an area of homology that is shared by at least two thirds of the parental polynucleotide sequences. Even more preferably a serviceable demarcation points is an area of homology that is shared by at least three fourths of the parental polynucleotide sequences, or, it can be shared by at almost all of the parental polynucleotide sequences. In one aspect, a demarcation point is an area of homology that is shared by all of the parental polynucleotide sequences.
  • a ligation reassembly process is performed exhaustively in order to generate an exhaustive library of progeny chimeric polynucleotides.
  • all possible ordered combinations of the nucleic acid building blocks are represented in the set of finalized chimeric nucleic acid molecules.
  • the assembly order i.e. the order of assembly of each building block in the 5' to 3 sequence of each finalized chimeric nucleic acid
  • the assembly order is by design (or non-stochastic) as described above. Because of the non-stochastic nature of this invention, the possibility of unwanted side products is greatly reduced.
  • the ligation reassembly method is performed systematically.
  • the method is performed in order to generate a systematically compart-mentalized library of progeny molecules, with compartments that can be screened systematically, e.g. one by one.
  • this invention provides that, through the selective and judicious use of specific nucleic acid building blocks, coupled with the selective and judicious use of sequentially stepped assembly reactions, a design can be achieved where specific sets of progeny products are made in each of several reaction vessels. This allows a systematic examination and screening procedure to be performed. Thus, these methods allow a potentially very large number of progeny molecules to be examined systematically in smaller groups.
  • the progeny molecules generated preferably comprise a library of finalized chimeric nucleic acid molecules having an overall assembly order that is chosen by design.
  • the saturation mutagenesis and optimized directed evolution methods also can be used to generate different progeny molecular species.
  • nucleic acid building block in order to increase the incidence of intermolecularly homologous demarcation points and thus to allow an increased number of couplings to be achieved among the building blocks, which in turn allows a greater number of progeny chimeric molecules to be generated.
  • synthetic nature of the step in which the building blocks are generated allows the design and introduction of nucleotides (e.g., one or more nucleotides, which may be, for example, codons or infrons or regulatory sequences) that can later be optionally removed in an in vitro process (e.g. by mutagenesis) or in an in vivo process (e.g. by utilizing the gene splicing ability of a host organism).
  • nucleotides e.g., one or more nucleotides, which may be, for example, codons or infrons or regulatory sequences
  • Optimized directed evolution is directed to the use of repeated cycles of reductive reassortment, recombination and selection that allow for the directed molecular evolution of nucleic acids through recombination.
  • Optimized directed evolution allows generation of a large population of evolved chimeric sequences, wherein the generated population is significantly enriched for sequences that have a predetermined number of crossover events.
  • a crossover event is a point in a chimeric sequence where a shift in sequence occurs from one parental variant to another parental variant. Such a point is normally at the juncture of where oligonucleotides from two parents are ligated together to form a single sequence.
  • This method allows calculation of the conect concentrations of oligonucleotide sequences so that the final chimeric population of sequences is enriched for the chosen number of crossover events. This provides more control over choosing chimeric variants having a predetermined number of crossover events. In addition, this method provides a convenient means for exploring a tremendous amount of the possible protein variant space in comparison to other systems. Previously, if one generated, for example, 10 chimeric molecules during a reaction, it would be extremely difficult to test such a high number of chimeric variants for a particular activity. Moreover, a significant portion of the progeny population would have a very high number of crossover events which resulted in proteins that were less likely to have increased levels of a particular activity.
  • the population of chimerics molecules can be enriched for those variants that have a particular number of crossover events.
  • each of the molecules chosen for further analysis most likely has, for example, only three crossover events.
  • the boundaries on the functional variety between the chimeric molecules is reduced. This provides a more manageable number of variables when calculating which oligonucleotide from the original parental polynucleotides might be responsible for affecting a particular trait.
  • One method for creating a chimeric progeny polynucleotide sequence is to create oligonucleotides conesponding to fragments or portions of each parental sequence.
  • Each oligonucleotide preferably includes a unique region of overlap so that mixing the oligonucleotides together results in a new variant that has each oligonucleotide fragment assembled in the conect order. Additional information can also be found in USSN 09/332,835.
  • the number of oligonucleotides generated for each parental variant bears a relationship to the total number of resulting crossovers in the chimeric molecule that is ultimately created.
  • three parental nucleotide sequence variants might be provided to undergo a ligation reaction in order to find a chimeric variant having, for example, greater activity at high temperature.
  • a set of 50 oligonucleotide sequences can be generated conesponding to each portions of each parental variant.
  • each of the generated chimeric polynucleotides will contain oligonucleotides from each parental variant in alternating order is very low. If each oligonucleotide fragment is present in the ligation reaction in the same molar quantity it is likely that in some positions oligonucleotides from the same parental polynucleotide will ligate next to one another and thus not result in a crossover event.
  • a probability density function can be determined to predict the population of crossover events that are likely to occur during each step in a ligation reaction given a set number of parental variants, a number of oligonucleotides conesponding to each variant, and the concentrations of each variant during each step in the ligation reaction.
  • PDF probability density function
  • a target number of crossover events can be predetermined, and the system then programmed to calculate the starting quantities of each parental oligonucleotide during each step in the ligation reaction to result in a probability density function that centers on the predetermined number of crossover events.
  • This system allows generation of a large population of evolved chimeric sequences, wherein the generated population is significantly enriched for sequences that have a predetermined number of crossover events.
  • a crossover event is a point in a chimeric sequence where a shift in sequence occurs from one parental variant to another parental variant. Such a point is normally at the juncture of where oligonucleotides from two. parents are ligated together to form a single sequence.
  • the method allows calculation of the conect concentrations of oligonucleotide sequences so that the final chimeric population of sequences is enriched for the chosen number of crossover events. This provides more control over choosing chimeric variants having a predetermined number of crossover events.
  • the population of chimerics molecules can be enriched for those variants that have a particular number of crossover events.
  • each of the molecules chosen for further analysis most likely has, for example, only three crossover events.
  • the resulting progeny population can be skewed to have a predetermined number of crossover events, the boundaries on the functional variety between the chimeric molecules is reduced. This provides a more manageable number of variables when calculating which oligonucleotide from the original parental polynucleotides might be responsible for affecting a particular trait.
  • the method creates a chimeric progeny polynucleotide sequence by creating oligonucleotides conesponding to fragments or portions of each parental sequence.
  • Each oligonucleotide preferably includes a unique region of overlap so that mixing the oligonucleotides together results in a new variant that has each oligonucleotide fragment assembled in the conect order. See also USSN 09/332,835.
  • the number of oligonucleotides generated for each parental variant bears a relationship to the total number of resulting crossovers in the chimeric molecule that is ultimately created.
  • three parental nucleotide sequence variants might be provided to undergo a ligation reaction in order to find a chimeric variant having, for example, greater activity at high temperature.
  • a set of 50 oligonucleotide sequences can be generated conesponding to each portions of each parental variant. Accordingly, during the ligation reassembly process there could be up to 50 crossover events within each of the chimeric sequences. The probability that each of the generated chimeric polynucleotides will contain oligonucleotides from each parental variant in alternating order is very low.
  • each oligonucleotide fragment is present in the ligation reaction in the same molar quantity it is likely that in some positions oligonucleotides from the same parental polynucleotide will ligate next to one another and thus not result in a crossover event. If the concenfration of each oligonucleotide from each parent is kept constant during any ligation step in this example, tiiere is a 1/3 chance (assuming 3 parents) that a oligonucleotide from the same parental variant will ligate within the chimeric sequence and produce no crossover.
  • a probability density function can be determined to predict the population of crossover events that are likely to occur during each step in a ligation reaction given a set number of parental variants, a number of oligonucleotides conesponding to each variant, and the concentrations of each variant during each step in the ligation reaction.
  • PDF probability density function
  • a target number of crossover events can be predetermined, and the system then programmed to calculate the starting quantities of each parental oligonucleotide during each step in the ligation reaction to result in a probability density function that centers on the predetennined number of crossover events.
  • Determining Crossover Events include a system and software tiiat receive a desired crossover probability density function (PDF), the number of parent genes to be reassembled, and the number of fragments in the reassembly as inputs. The output of this program is a "fragment PDF" that can be used to determine a recipe for producing reassembled genes, and the estimated crossover PDF of those genes.
  • PDF crossover probability density function
  • ?MATLAB ® The Mathworks, Natick, Massachusetts
  • ?MATLAB ® The Mathworks, Natick, Massachusetts
  • these processes can be iteratively repeated. For example a nucleic acid (or, the nucleic acid) responsible for an altered phospholipase phenotype is identified, re-isolated, again modified, re-tested for activity. This process can be iteratively repeated until a desired phenotype is engineered. For example, an entire biochemical anabolic or catabolic pathway can be engineered into a cell, including phospholipase activity.
  • a particular oligonucleotide has no affect at all on the desired trait (e.g., a new phospholipase phenotype)
  • it can be removed as a variable by synthesizing larger parental oligonucleotides that include the sequence to be removed. Since incorporating the sequence within a larger sequence prevents any crossover events, there will no longer be any variation of this sequence in the progeny polynucleotides. This iterative practice of determining which oligonucleotides are most related to the desired trait, and which are unrelated, allows more efficient exploration all of the possible protein variants that might be provide a particular trait or activity.
  • In vivo shuffling of molecules is use in methods of the invention that provide variants of polypeptides of the invention, e.g., antibodies, phospholipase enzymes, and the like.
  • In vivo shuffling can be performed utilizing the natural property of cells to recombine multimers. While recombination in vivo has provided the major natural route to molecular diversity, genetic recombination remains a relatively complex process that involves 1) the recognition of homologies; 2) strand cleavage, strand invasion, and metabolic steps leading to the production of recombinant chiasma; and finally 3) the resolution of chiasma into discrete recombined molecules.
  • the invention provides a method for producing a hybrid polynucleotide from at least a first polynucleotide and a second polynucleotide.
  • the invention can be used to produce a hybrid polynucleotide by introducing at least a first polynucleotide and a second polynucleotide which share at least one region of partial sequence homology into a suitable host cell.
  • the regions of partial sequence homology promote processes which result in sequence reorganization producing a hybrid polynucleotide.
  • hybrid polynucleotide is any nucleotide sequence which results from the method of the present invention and contains sequence from at least two original polynucleotide sequences. Such hybrid polynucleotides can result from intermolecular recombination events which promote sequence integration between DNA molecules. In addition, such hybrid polynucleotides can result from inframolecular reductive reassortment processes which utilize repeated sequences to alter a nucleotide sequence within a DNA molecule.
  • the invention also provides methods of making sequence variants of the nucleic acid and phospholipase sequences of the invention or isolating phospholipase enzyme, e.g., phospholipase, sequence variants using the nucleic acids and polypeptides of the invention.
  • the invention provides for variants of a phospholipase gene of the invention, which can be altered by any means, including, e.g., random or stochastic methods, or, non-stochastic, or "directed evolution," methods, as described above.
  • the isolated variants may be naturally occurring. Variant can also be created in vitro.
  • Variants may be created using genetic engineering techniques such as site directed mutagenesis, random chemical mutagenesis, Exonuclease III deletion procedures, and standard cloning techniques. Alternatively, such variants, fragments, analogs, or derivatives may be created using chemical synthesis or modification procedures. Other methods of making variants are also familiar to those skilled in the art. These include procedures in which nucleic acid sequences obtained from natural isolates are modified to generate nucleic acids which encode polypeptides having characteristics which enhance their value in industrial or laboratory applications. In such procedures, a large number of variant sequences having one or more nucleotide differences with respect to the sequence obtained from the natural isolate are generated and characterized.
  • variants can result in amino acid changes with respect to the polypeptides encoded by the nucleic acids from the natural isolates.
  • variants may be created using enor prone PCR.
  • enor prone PCR PCR is performed under conditions where the copying fidelity of the DNA polymerase is low, such that a high rate of point mutations is obtained along the entire length of the PCR product.
  • Enor prone PCR is described, e.g., in Leung, D.W., et al.,
  • Oligonucleotide mutagenesis is described, e.g., in Reidhaar-Olson (1988) Science 241:53-57. Briefly, in such procedures a plurality of double stranded oligonucleotides bearing one or more mutations to be introduced into the cloned DNA are synthesized and inserted into the cloned DNA to be mutagenized. Clones containing the mutagenized DNA are recovered and the activities of the polypeptides they encode are assessed. Another method for generating variants is assembly PCR. Assembly PCR involves the assembly of a PCR product from a mixture of small DNA fragments. A large number of different PCR reactions occur in parallel in the same vial, with the products of one reaction priming the products of another reaction.
  • Assembly PCR is described in, e.g., U.S. Patent No. 5,965,408.
  • Still another method of generating variants is sexual PCR mutagenesis.
  • sexual PCR mutagenesis forced homologous recombination occurs between DNA molecules of different but highly related DNA sequence in vitro, as a result of random fragmentation of the DNA molecule based on sequence homology, followed by fixation of the crossover by primer extension in a PCR reaction.
  • Sexual PCR mutagenesis is described, e.g., in Stemmer (1994) Proc. Natl. Acad. Sci. USA 91:10747-10751.
  • reaction mixture 100:1 of reaction mixture is added and PCR is performed using the following regime:
  • oligonucleotides may be included in the PCR reactions.
  • the ?Klenow fragment of DNA polymerase I may be used in a first set of PCR reactions and Taq polymerase may be used in a subsequent set of PCR reactions. Recombinant sequences are isolated and the activities of die polypeptides they encode are assessed. Variants may also be created by in vivo mutagenesis.
  • random mutations in a sequence of interest are generated by propagating the sequence of interest in a bacterial strain, such as anE. coli sfrain, which carries mutations in one or more of the DNA repair pathways.
  • Mutator strains have a higher random mutation rate than that of a wild-type parent. Propagating the DNA in one of these strains will eventually generate random mutations within the DNA.
  • Mutator strains suitable for use for in vivo mutagenesis are described, e.g., in PCT Publication No. WO 91/16427.
  • Variants may also be generated using cassette mutagenesis. In cassette mutagenesis a small region of a double stranded DNA molecule is replaced with a synthetic oligonucleotide "cassette" that differs from the native sequence. The oligonucleotide often contains completely and/or partially randomized native sequence. Recursive ensemble mutagenesis may also be used to generate variants.
  • Recursive ensemble mutagenesis is an algorithm for protein engineering (protein mutagenesis) developed to produce diverse populations of phenotypically related mutants whose members differ in amino acid sequence. This method uses a feedback mechanism to control successive rounds of combinatorial cassette mutagenesis.
  • Recursive ensemble mutagenesis is described, e.g., in Arkin (1992) Proc. Natl. Acad. Sci. USA 89:7811-7815.
  • variants are created using exponential ensemble mutagenesis.
  • Exponential ensemble mutagenesis is a process for generating combinatorial libraries with a high percentage of unique and functional mutants, wherein small groups of residues are randomized in parallel to identify, at each altered position, amino acids which lead to functional proteins.
  • Exponential ensemble mutagenesis is described, e.g., inDelegrave (1993) Biotechnology Res. 11:1548-1552. Random and site-directed mutagenesis are described, e.g., in Arnold (1993) Cunent Opinion in Biotechnology 4:450-455.
  • the variants are created using shuffling procedures wherein portions of a plurality of nucleic acids which encode distinct polypeptides are fused together to create chimeric nucleic acid sequences which encode chimeric polypeptides as described in, e.g., U.S. Patent Nos. 5,965,408; 5,939,250.
  • the invention also provides variants of polypeptides of the invention comprising sequences in which one or more of the amino acid residues (e.g., of an exemplary polypeptide of the invention) are substituted with a conserved or non- conserved amino acid residue (e.g., a conserved amino acid residue) and such substituted amino acid residue may or may not be one encoded by the genetic code.
  • Conservative substitutions are those that substitute a given amino acid in a polypeptide by another amino acid of like characteristics.
  • polypeptides of the invention include those with conservative substitutions of sequences of the invention, including but not limited to the following replacements: replacements of an aliphatic amino acid such as Alanine, Valine, Leucine and Isoleucine with another aliphatic amino acid; replacement of a Serine with a Threonine or vice versa; replacement of an acidic residue such as Aspartic acid and Glutamic acid with another acidic residue; replacement of a residue bearing an amide group, such as Asparagine and Glutamine, with another residue bearing an amide group; exchange of a basic residue such as Lysine and Arginine with another basic residue; and replacement of an aromatic residue such as Phenylalanine, Tyrosine with another aromatic residue.
  • replacements of an aliphatic amino acid such as Alanine, Valine, Leucine and Isoleucine with another aliphatic amino acid
  • replacement of a Serine with a Threonine or vice versa replacement of an acidic residue such as Aspartic acid and Glutamic acid
  • variants are those in which one or more of the amino acid residues of the polypeptides of the invention includes a substituent group.
  • variants within the scope of the invention are those in which the polypeptide is associated with another compound, such as a compound to increase the half-life of the polypeptide, for example, polyethylene glycol.
  • additional variants within the scope of the invention are those in which additional amino acids are fused to the polypeptide, such as a leader sequence, a secretory sequence, a proprotein sequence or a sequence which facilitates purification, enrichment, or stabilization of the polypeptide.
  • the variants, fragments, derivatives and analogs of the polypeptides of the invention retain the same biological function or activity as the exemplary polypeptides, e.g., a phospholipase activity, as described herein.
  • the variant, fragment, derivative, or analog includes a proprotein, such that the variant, fragment, derivative, or analog can be activated by cleavage of the proprotein portion to produce an active polypeptide.
  • the invention provides methods for modifying phospholipase-encoding nucleic acids to modify codon usage.
  • the invention provides methods for modifying codons in a nucleic acid encoding a phospholipase to increase or decrease its expression in a host cell.
  • the invention also provides nucleic acids encoding a phospholipase modified to increase its expression in a host cell, phospholipase enzymes so modified, and methods of making the modified phospholipase enzymes.
  • the method comprises identifying a "non-prefened” or a “less prefened” codon in phospholipase- encoding nucleic acid and replacing one or more of these non-prefened or less prefened codons with a "prefened codon” encoding the same amino acid as the replaced codon and at least one non-prefened or less prefened codon in the nucleic acid has been replaced by a prefened codon encoding the same amino acid.
  • a prefened codon is a codon over- represented in coding sequences in genes in the host cell and a non-prefened or less prefened codon is a codon under-represented in coding sequences in genes in the host cell.
  • Host cells for expressing the nucleic acids, expression cassettes and vectors of the invention include bacteria, yeast, fungi, plant cells, insect cells and mammalian cells. Thus, the invention provides methods for optimizing codon usage in all of these cells, codon-altered nucleic acids and polypeptides made by the codon-altered nucleic acids.
  • Exemplary host cells include gram negative bacteria, such as Escherichia coli; gram positive bacteria, such as any Bacillus (e.g., B. cereus) or Streptomyces, Lactobacillas gasseri, Lactococcus lactis, Lactococcus cremoris, Bacillus subtilis.
  • Exemplary host cells also include eukaryotic organisms, e.g., various yeast, such as Saccharomyces sp., including Saccharomyces cerevisiae, Schizosaccharomyces pombe, Pichia pastoris, and Kluyveromyces lactis, Hansenula polymorpha, Aspergillus niger, and mammalian cells and cell lines and insect cells and cell lines.
  • yeast such as Saccharomyces sp., including Saccharomyces cerevisiae, Schizosaccharomyces pombe, Pichia pastoris, and Kluyveromyces lactis, Hansenula polymorpha, Aspergillus niger, and mammalian cells and cell lines and insect cells and cell lines.
  • the codons of a nucleic acid encoding a phospholipase isolated from a bacterial cell are modified such that the nucleic acid is optimally expressed in a bacterial cell different from the bacteria from which the phospholipase was derived, a yeast, a fungi, a plant cell, an insect cell or a mammalian cell.
  • Methods for optimizing codons are well known in the art, see, e.g., U.S. Patent No. 5,795,737; Baca
  • Transgenic non-human animals comprising a nucleic acid, a polypeptide, an expression cassette or vector or a transfected or transformed cell of the invention.
  • the fransgenic non-human animals can be, e.g., goats, rabbits, sheep, pigs, cows, rats and mice, comprising the nucleic acids of the invention. These animals can be used, e.g., as in vivo models to study phospholipase activity, or, as models to screen for modulators of phospholipase activity in vivo.
  • the coding sequences for the polypeptides to be expressed in the fransgenic non-human animals can be designed to be constitutive, or, under the confrol of tissue-specific, developmental-specific or inducible transcriptional regulatory factors.
  • Transgenic non-human animals can be designed and generated using any method known in the art; see, e.g., U.S. Patent Nos.
  • U.S. Patent No. 6,211,4208 describes making and using transgenic non-human mammals which express in their brains a nucleic acid constract comprising a DNA sequence.
  • U.S. Patent No. 5,387,742 describes injecting cloned recombinant or synthetic DNA sequences into fertilized mouse eggs, implanting the injected eggs in pseudo- pregnant females, and growing to term transgenic mice whose cells express proteins related to the pathology of Alzheimer's disease.
  • U.S. Patent No. 6,187,992 describes making and using a transgenic mouse whose genome comprises a disruption of the gene encoding amyloid precursor protein (APP).
  • APP amyloid precursor protein
  • the transgenic or modified animals of the invention can also be used to practice the methods of the invention.
  • the transgenic or modified animals of the invention comprise a "knockout animal,” e.g., a “knockout mouse,” engineered not to express or to be unable to express a phospholipase.
  • the invention provides transgenic plants and seeds comprising a nucleic acid, a polypeptide (e.g., a phospholipase), an expression cassette or vector or a transfected or transformed cell of the invention.
  • the invention also provides plant products, e.g., oils, seeds, leaves, extracts and the like, comprising a nucleic acid and/or a polypeptide (e.g., a phospholipase) of the invention.
  • the transgenic plant can be dicotyledonous (a dicot) or monocotyledonous (a monocot).
  • the invention also provides methods of making and using these fransgenic plants and seeds.
  • the transgenic plant or plant cell expressing a polypeptide of the invention may be constructed in accordance with any method known in the art. See, for example, U.S. Patent No. 6,309,872.
  • Nucleic acids and expression constructs of the invention can be introduced into a plant cell by any means.
  • nucleic acids or expression constructs can be introduced into the genome of a desired plant host, or, the nucleic acids or expression constructs can be episomes. Introduction into the genome of a desired plant can be such that the host's phospholipase production is regulated by endogenous transcriptional or translational confrol elements.
  • Nucleic acids of the invention can be used to manipulate metabolic pathways of a plant in order to optimize or alter host's expression of phospholipase.
  • The can change phospholipase activity in a plant.
  • a phospholipase of the invention can be used in production of a fransgenic plant to produce a compound not naturally produced by that plant. This can lower production costs or create a novel product.
  • the first step in production of a transgenic plant involves making an expression constract for expression in a plant cell. These techniques are well known in the art. They can include selecting and cloning a promoter, a coding sequence for facilitating efficient binding of ribosomes to mRNA and selecting the appropriate gene terminator sequences.
  • One exemplary constitutive promoter is Ca?MV35S, from the cauliflower mosaic virus, wliich generally results in a high degree of expression in plants.
  • An exemplary light-inducible promoter is the promoter from the cab gene, encoding the major chlorophyll a/b binding protein.
  • the nucleic acid is modified to achieve greater expression in a plant cell.
  • a sequence of the invention is likely to have a higher percentage of A-T nucleotide pairs compared to that seen in a plant, some of which prefer G-C nucleotide pairs. Therefore, A-T nucleotides in the coding sequence can be substituted with G-C nucleotides without significantly changing the amino acid sequence to enhance production of the gene product in plant ceUs.
  • Selectable marker gene can be added to the gene construct in order to identify plant cells or tissues that have successfully integrated the fransgene. This may be necessary because achieving incorporation and expression of genes in plant cells is a rare event, occurring in just a few percent of the targeted tissues or cells.
  • Selectable marker genes encode proteins that provide resistance to agents that are normaUy toxic to plants, such as antibiotics or herbicides. Only plant cells that have integrated the selectable marker gene will survive when grown on a medium containing the appropriate antibiotic or herbicide. As for other inserted genes, marker genes also require promoter and termination sequences for proper function.
  • making transgenic plants or seeds comprises incorporating sequences of the invention and, optionally, marker genes into a target expression construpt (e.g., a plasmid), along with positioning of the promoter and the terminator sequences.
  • a target expression construpt e.g., a plasmid
  • This can involve transferring the modified gene into the plant through a suitable method.
  • a construct may be introduced directly into the genomic DNA of the plant cell using techniques such as elecfroporation and microinjection of plant cell protoplasts, or the constructs can be introduced directly to plant tissue using ballistic methods, such as DNA particle bombardment. For example, see, e.g., Cbristou (1997) Plant Mol. Biol. 35:197-203; Pawlowslci (1996) Mol. Biotechnol.
  • Nucleic acids can also be introduced in to plant cells using recombinant viruses.
  • Plant cells can be transformed using viral vectors, such as, e.g., tobacco mosaic virus derived vectors (Rouwendal (1997) Plant Mol. Biol. 33:989-999), see Porta (1996) "Use of viral replicons for the expression of genes in plants," Mol. Biotechnol. 5:209-221.
  • viral vectors such as, e.g., tobacco mosaic virus derived vectors (Rouwendal (1997) Plant Mol. Biol. 33:989-999), see Porta (1996) "Use of viral replicons for the expression of genes in plants," Mol. Biotechnol. 5:209-221.
  • nucleic acids e.g., an expression constract, can be combined with suitable T-DNA flanking regions and introduced into a conventional Agrobacterium tumefaciens host vector.
  • the virulence functions o ⁇ the Agrobacterium tumefaciens host will direct the insertion of the construct and adjacent marker into the plant cell DNA when the cell is infected by the bacteria.
  • Agrobacterium tumefaciens-mediat ⁇ d transformation techniques including disarming and use of binary vectors, are well described in the scientific literature. See, e.g., Horsch (1984) Science 233:496-498;
  • A. tumefaciens can only infect a plant through wounds: when a plant root or stem is wounded it gives off certain chemical signals, in response to which, the vir genes of A. tumefaciens become activated and direct a series of events necessary for the transfer of the T-DNA from the Ti plasmid to the plant's chromosome. The T-DNA then enters the plant cell through the wound.
  • One speculation is that the T-DNA waits until the plant DNA is being replicated or transcribed, then inserts itself into the exposed plant DNA. In order to use A.
  • the tumor-inducing section of T-DNA have to be removed, while retaining the T-DNA border regions and the vir genes.
  • the transgene is then inserted between the T-DNA border regions, where it is fransfened to the plant cell and becomes integrated into the plant's chromosomes.
  • the invention provides for the transformation of monocotyledonous plants using the nucleic acids of the invention, including important cereals, see Hiei (1997) Plant Mol. Biol. 35:205-218. See also, e.g., Horsch, Science (1984) 233:496; Fraley (1983) Proc. Natl. Acad.
  • Plant regeneration from cultured protoplasts is described in Evans et al., Protoplasts Isolation and Culture, Handbook of Plant Cell Culture, pp. 124-176, MacMillilan Publishing Company, New York, 1983; and Binding, Regeneration of Plants, Plant Protoplasts, pp. 21-73, CRC Press, Boca Raton, 1985. Regeneration can also be obtained from plant callus, explants, organs, or parts thereof. Such regeneration techniques are described generally in Klee (1987) Ann. Rev. of Plant Phys. 38:467-486. To obtain whole plants from fransgenic tissues such as immature embryos, they can be grown under controlled environmental conditions in a series of media containing nutrients and hormones, a process known as tissue culture.
  • the expression cassette is stably inco ⁇ orated in transgenic plants, it can be introduced into other plants by sexual crossing. Any of a number of standard breeding techniques can be used, depending upon the species to be crossed. Since fransgenic expression of the nucleic acids of the invention leads to phenotypic changes, plants comprising the recombinant nucleic acids of the invention can be sexually crossed with a second plant to obtain a final product. Thus, the seed of the invention can be derived from a cross between two fransgenic plants of the invention, or a cross between a plant of the invention and another plant.
  • the desired effects can be enhanced when both parental plants express the polypeptides (e.g., a phospholipase) of the invention.
  • the desired effects can be passed to future plant generations by standard propagation means.
  • the nucleic acids and polypeptides of the invention are expressed in or inserted in any plant or seed.
  • Transgenic plants of the invention can be dicotyledonous or monocotyledonous.
  • Examples of monocot transgenic plants of the invention are grasses, such as meadow grass (blue grass, Pod), forage grass such as festuca, lolium, temperate grass, such as Agrostis, and cereals, e.g., wheat, oats, rye, barley, rice, sorghum, and maize (corn).
  • Examples of dicot fransgenic plants of the invention are tobacco, legumes, such as lupins, potato, sugar beet, pea, bean and soybean, and cruciferous plants (family Brassicaceae), such as cauliflower, rape seed, and the closely related model organism Arabidopsis thaliana.
  • the transgenic plants and seeds of the mvention include a broad range of plants, including, but not limited to, species from the genera Anacardium, Arachis, Asparagus, Atropa, Avena, Brassica, Citrus, Citrullus, Capsicum, Carthamus, Cocos, Cojfea, Cucumis, Cucurbita, Daucus, Elaeis, Fragaria, Glycine, Gossypium, Helianthus, Heterocallis, Hordeum, Hyoscyamus, Lactuca, Linum, Lolium, Lupinus, Lycopersicon, Mains, Manihot, Majorana, Medicago, Nicotiana, Olea, Oryza, Panieum, Pannisetum, Persea, Phaseolus, Pistachio, Pisum, Pyrus, Primus, Raphanus, Ricinus, Secale, Senecio, Sinapis, Solanum, Sorghum, Theobromus,
  • polypeptides and peptides The invention provides isolated or recombinant polypeptides havmg a sequence identity (e.g., at least 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, or complete (100%) sequence identity) to an exemplary sequence of the invention, e.g., SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO: 10, SEQ ID NO: 12, SEQ ID NO: 14, S
  • Peptides of the invention can be useful as, e.g., labeling probes, antigens, toleragens, motifs, phospholipase active sites, binding domains, regulatory domains, and the like.
  • the polypeptide has a phospholipase activity, e.g., cleavage of a glycerolphosphate ester linkage, the ability to hydrolyze phosphate ester bonds, including patatin, lipid acyl hydrolase (LAH), phospholipase A, B, C and/or phospholipase D activity, or any combination thereof.
  • a phospholipase activity e.g., cleavage of a glycerolphosphate ester linkage, the ability to hydrolyze phosphate ester bonds, including patatin, lipid acyl hydrolase (LAH), phospholipase A, B, C and/or phospholipase D activity, or any combination thereof.
  • LAH lipid
  • exemplary polypeptides of die invention have a phospholipase activity, Signal Sequence Location, and an initial source, as set forth in the following Table 1, below.
  • SEQ ID NO: 143, 144 means the polypeptide having a sequence as set forth in SEQ ID NO: 144, and encoded by, e.g., SEQ ID NO: 143, having a PLA-specific PLA activity, initially isolated from an unknown source;
  • SEQ ID NO: 167, 168 row where 167, 168 means the polypeptide having a sequence as set forth in SEQ ID NO: 168, and encoded by, e.g., SEQ ID NO: 167, having a phosphatidic acid phosphatase activity, a signal sequence at residues 1 to 30 ("AA1-30" means amino acid residues 1 to 30, etc.), i.e., MARSWKWRPLLSSFLLVSLAPFSTSVPCFK, and initially isolated
  • the invention also provides peptides comprising signal sequences, and chimeric polypeptides, where the peptides or chimerics comprise signal sequences as set forth in Table 1, and as described below.
  • the polypeptide has a phospholipase activity but lacks neutral oil (triglyceride) hydrolysis activity.
  • the polypeptide has a phospholipase activity but lacks any activity that affects a debutral oil (triglyceride) fraction.
  • the invention provides a degumming process comprising use of a polypeptide of the invention having a phospholipase activity, but not a lipase activity.
  • Polypeptides and peptides of the invention can be isolated from natural sources, be synthetic, or be recombinantly generated polypeptides. Peptides and proteins can be recombinantly expressed in vitro or in vivo.
  • peptides and polypeptides of the invention can be made and isolated using any method known in the art.
  • Polypeptide and peptides of the invention can also be synthesized, whole or in part, using chemical methods well known in the art. See e.g., Carathers (1980) Nucleic Acids Res. Symp. Ser. 215-223; Horn (1980) Nucleic Acids Res. Symp. Ser. 225-232; Banga, A.K., Therapeutic Peptides and Proteins, Formulation, Processing and Delivery Systems (1995) Technomic Publishing Co., Lancaster, PA.
  • peptide synthesis can be performed using various solid-phase techniques (see e.g., Roberge (1995) Science 269:202; Merrifield (1997) Methods Enzymol.
  • peptides and polypeptides of the invention can also be glycosylated.
  • the glycosylation can be added post-translationally either chemically or by cellular biosynthetic mechanisms, wherein the later inco ⁇ orates the use of known glycosylation motifs, which can be native to the sequence or can be added as a peptide or added in the nucleic acid coding sequence.
  • the glycosylation can be 0-linked or N-linked.
  • the peptides and polypeptides of the invention include all “mimetic” and “peptidomimetic” forms.
  • the terms "mimetic” and “peptidomimetic” refer to a synthetic chemical compoimd which has substantially the same structural and/or functional characteristics of the polypeptides of the invention.
  • a mimetic composition is within the scope of the invention if it has a phospholipase activity.
  • Polypeptide mimetic compositions of the invention can contain any combination of non-natural stractural components.
  • mimetic compositions of the invention include one or all of the following three stractural groups: a) residue linkage groups other than the natural amide bond ("peptide bond") linkages; b) non-natural residues in place of naturally occurring amino acid residues; or c) residues which induce secondary stractural mimicry, i.e., to induce or stabilize a secondary stracture, e.g., a beta turn, gamma turn, beta sheet, alpha helix conformation, and the like.
  • secondary stractural mimicry i.e., to induce or stabilize a secondary stracture, e.g., a beta turn, gamma turn, beta sheet, alpha helix conformation, and the like.
  • a polypeptide of the invention can be characterized as a mimetic when all or some of its residues are joined by chemical means other than natural peptide bonds.
  • Individual peptidomimetic residues can be joined by peptide bonds, other chemical bonds or coupling means, such as, e.g., glutaraldehyde, N-hydroxysuccinimide esters, bifunctional maleimides, N,N'-dicyclohexylcarbodiimide (DCC) or N,N'-di- isopropylcarbodiimide (DIG).
  • a polypeptide of the invention can also be characterized as a mimetic by containing all or some non-natural residues in place of naturally occurring amino acid residues.
  • Non-natural residues are well described in the scientific and patent literature; a few exemplary non-natural compositions useful as mimetics of natural amino acid residues and guidelines are described below.
  • Mimetics of aromatic amino acids can be generated by replacing by, e.g., D- or L- naphylalanine; D- or L- phenylglycine; D- or L- 2 thieneylalanine; D- or L-l, -2, 3-, or 4- pyreneylalanine; D- or L-3 thieneylalanine; D- or L-(2-pyridinyl)-alanine; D- or L-(3-pyridinyl)-alanine; D- or L-(2-pyrazinyl)-alanine; D- or L-(4-isopropyl)-phenylglycine; D-(trifluoromethyl)-phenylglycine; D- (trifluoromethyl)-phenylalanine; D-p-fluoro-phenylalanine; D- or L-p-biphenyl- phenylalanine; K- or L-p-methoxy-bipheny
  • Aromatic rings of a non-natural amino acid include, e.g., thiazolyl, thiophenyl, pyrazolyl, benzimidazolyl, naphthyl, furanyl, pynolyl, and pyridyl aromatic rings.
  • Mimetics of acidic amino acids can be generated by substitution by, e.g., non-carboxylate amino acids while maintaining a negative charge; (phosphono)alanine; sulfated threonine.
  • Carboxyl side groups (e.g., aspartyl or glutamyl) can also be selectively modified by reaction with carbodiimides (R'-N-C-N-R') such as, e.g., 1- cyclohexyl-3(2-mo ⁇ holinyl-(4-ethyl) carbodiimide or l-ethyl-3(4-azonia- 4,4- dimetholpentyl) carbodiimide.
  • Aspartyl or glutamyl can also be converted to asparaginyl and glutaminyl residues by reaction with ammonium ions.
  • Mimetics of basic amino acids can be generated by substitution with, e.g., (in addition to lysine and arginine) the amino acids ornithine, citralline, or (guanidino)-acetic acid, or (guanidino)alkyl-acetic acid, where alkyl is defined above.
  • Nitrile derivative e.g., containing the CN-moiety in place of COOH
  • Asparaginyl and glutaminyl residues can be deaminated to the conesponding aspartyl or glutamyl residues.
  • Arginine residue mimetics can be generated by reacting arginyl with, e.g., one or more conventional reagents, including, e.g., phenylglyoxal, 2,3-butanedione, 1,2-cyclo- hexanedione, or ninhydrin, preferably under alkaline conditions.
  • Tyrosine residue mimetics can be generated by reacting tyrosyl with, e.g., aromatic diazonium compounds or tetranitromethane. N-acetylimidizol and tefranitromethane can be used to form O- acetyl tyrosyl species and 3-nitro derivatives, respectively.
  • Cysteine residue mimetics can be generated by reacting cysteinyl residues with, e.g., alpha-haloacetates such as 2- chloroacetic acid or chloroacetamide and conesponding amines; to give carboxymethyl or carboxyamidomethyl derivatives.
  • alpha-haloacetates such as 2- chloroacetic acid or chloroacetamide and conesponding amines
  • Lysine mimetics can be generated (and amino terminal residues can be altered) by reacting lysinyl with, e.g., succinic or other carboxylic acid anhydrides. Lysine and other alpha-ammo-containing residue mimetics can also be generated by reaction with imidoesters, such as methyl picolinimidate, pyridoxal phosphate, pyridoxal, chloroborohydri.de, trinifro- benzenesulfonic acid, O-methylisourea, 2,4, pentanedione, and fransamidase-catalyzed reactions with glyoxylate.
  • imidoesters such as methyl picolinimidate, pyridoxal phosphate, pyridoxal, chloroborohydri.de, trinifro- benzenesulfonic acid, O-methylisourea, 2,4, pentanedione, and fransamidase-catalyzed reactions with g
  • Mimetics of methionine can be generated by reaction with, e.g., methionine sulfoxide.
  • Mimetics of proline include, e.g., pipecolic acid, thiazolidine carboxylic acid, 3- or 4- hydroxy proline, dehydroproline, 3- or 4-methylproline, or 3,3,- dimethylproline.
  • Histidine residue mimetics can be generated by reacting histidyl with, e.g., diethylprocarbonate or para-bromophenacyl bromide.
  • any amino acid naturally occurring in the L-configuration (which can also be refened to as the R or S, depending upon the stracture of the chemical entity) can be replaced with the amino acid of the same chemical stractural type or a peptidomimetic, but of the opposite chirahty, refened to as the D- amino acid, but also can be refened to as the R- or S- form.
  • the invention also provides methods for modifying the polypeptides of the invention by either natural processes, such as post-tianslational processing (e.g., phosphorylation, acylation, etc), or by chemical modification techniques, and the resulting modified polypeptides.
  • Modifications can occur anywhere in the polypeptide, including the peptide backbone, the amino acid side-chains and the amino or carboxyl termini. It will be appreciated that the same type of modification may be present in the same or varying degrees at several sites in a given polypeptide. Also a given polypeptide may have many types of modifications.
  • Modifications include acetylation, acylation, ADP-ribosylation, amidation, covalent attachment of flavin, covalent attachment of a heme moiety, covalent attachment of a nucleotide or nucleotide derivative, covalent attachment of a lipid or lipid derivative, covalent attachment of a phosphatidylinositol, cross-linking cyclization, disulfide bond formation, demethylation, formation of covalent cross-links, formation of cysteine, formation of pyroglutamate, formylation, gamma- carboxylation, glycosylation, GPI anchor formation, hydroxylation, iodination, methylation, myristolyation, oxidation, pegylation, proteolytic processing, phosphorylation, prenylation, racemization, selenoylation, sulfation, and transfer-RNA mediated addition of ammo acids to protein such as arginylation.
  • a plate of rods or pins is inverted and inserted into a second plate of conesponding wells or reservoirs, which contain solutions for attaching or anchoring an appropriate amino acid to the pin's or rod's tips.
  • a process step i.e., inverting and inserting the rod's and pin's tips into appropriate solutions, amino acids are built into desired peptides.
  • FMOC peptide synthesis systems are available. For example, assembly of a polypeptide or fragment can be carried out on a solid support using an Applied Biosystems, Inc. Model 431 ATM automated peptide synthesizer.
  • Phospholipase enzymes The invention provides novel phospholipases, nucleic acids encoding them, antibodies that bind them, peptides representing the enzyme's antigenic sites (epitopes) and active sites, regulatory and binding domains, and methods for making and using them.
  • polypeptides of the invention have a phospholipase activity, or any combination of phospholipase activities, as described herein (e.g., cleavage of a glycerolphosphate ester linkage, lacking lipase activity, etc.).
  • the phospholipases of the invention have activities that have been modified from those of the exemplary phospholipases described herein.
  • the invention includes phospholipases with and without signal sequences and the signal sequences themselves.
  • the invention includes fragments or subsequences of enzymes of the invention, e.g., peptides or polypeptides comprising or consisting of catalytic domains ("active sites"), binding sites, regulatory domains, epitopes, signal sequences, prepro domains, and the like.
  • the invention also includes immobilized phospholipases, anti-phospholipase antibodies and fragments thereof.
  • the invention includes heterocomplexes, e.g., fusion proteins, heterodimers, etc., comprising the phospholipases of the invention. Determining peptides representing the enzyme's antigenic sites (epitopes), active sites, binding sites, signal sequences, and the like can be done by routine screening protocols. These enzymes and processes of the invention can be used to achieve a more complete degumming of high phosphorus oils, in particular, rice, soybean, corn, canola, and sunflower oils. For example, in one aspect, upon cleavage by PI-PLC, phosphatidylinositol is converted to diacylglycerol and phosphoinositol.
  • PI-PLC phosphatidylinositol is converted to diacylglycerol and phosphoinositol.
  • the diacylglycerol partitions to the aqueous phase (improving oil yield) and the phosphoinositol partitions to the aqueous phase where it is removed as a component of the heavy phase during centrifugation.
  • An enzyme of the invention e.g., a PI-PLC of the invention, can be inco ⁇ orated into either a chemical or physical oil refining process.
  • enzymes of the invention have phosphatidylinositol- specific phospholipase C (PI-PLC) activity, phosphatidylcholine-specific phospholipase C activity, phosphatidic acid phosphatase activity, phospholipase A activity and/or patatin-related phospholipase activity.
  • PI-PLC phosphatidylinositol- specific phospholipase C
  • phosphatidylcholine-specific phospholipase C activity phosphatidic acid phosphatase activity
  • phospholipase A activity phospholipase A activity
  • patatin-related phospholipase activity phosphatidylinositol- specific phospholipase C
  • the invention provides methods wherein these enzymes (including phosphatidylinositol-specific phospholipase C (PIPLC), phosphatidylcholine-specific phospholipase C, and/or phospholipase D (in conjunction with a phosphatase), phosphatidic acid phosphatase, phospholipase A, patatin-related phospholipases of the invention) are used alone or in combination in the degumming of oils, e.g., vegetable oils, e.g., high phosphorus oils, such as soybean, corn, canola, rice bran and sunflower oils.
  • oils e.g., vegetable oils, e.g., high phosphorus oils, such as soybean, corn, canola, rice bran and sunflower oils.
  • enzymes and processes of the invention can be used to achieve a more complete degumming of high phosphorus oils, in particular, soybean, corn, canola, rice bran and sunflower oils.
  • phosphatidylinositol is converted to diacylglycerol and phosphoinositol.
  • the diacylglycerol partitions to the aqueous phase (improving oil yield) and the phosphoinositol partitions to the aqueous phase where it is removed as a component of the heavy phase during centrifugation.
  • An enzyme of the invention e.g., a PI-PLC of the invention, can be inco ⁇ orated into either a chemical or physical oil refining process.
  • the invention provides compositions, e.g., solutions, comprising sodium citrate at monral pH to hydrate non-hydratables.
  • the invention provides sodium turite solutions in a pH range of between about 4 to 9, or, 5 to 8, or, 6 to 7, that can be used to hydrate non-hydratable phospholipids (including enzymes of the invention) in high phosphorus oils.
  • the hydration of non-hydratable phospholipids is by chelating the calcium and magnesium associated with the phospholipids, thereby allowing the formerly insoluble phospholipid salts to more readily partition in the aqueous phase.
  • a phospholipase of the invention e.g., a phospholipase-specific phosphohydrolase of the invention
  • a phospholipase of the invention will convert the phosphohpid to diacylglycerol and a phosphate-ester.
  • calcium and magnesium metal content are lowered upon addition of acid and caustic (see discussion on caustic processes).
  • the enzymes of the invention are highly selective catalysts. As with other enzymes, they catalyze reactions with extraordinar stereo-, regio,-, and chemo- selectivities that are unparalleled in conventional synthetic chemistry. Moreover, the enzymes of the invention are remarkably versatile.
  • Enzymes of the invention can be tailored to function in organic solvents, operate at extreme pHs (for example, high pHs and low pHs) extreme temperatures (for example, high temperatures and low temperatures), extreme salinity levels (for example, high salinity and low salinity), and catalyze reactions with compounds that are structurally unrelated to their natural, physiological substrates.
  • Enzymes of the invention can be designed to be reactive toward a wide range of natural and unnatural subsfrates, thus enabling the modification of virtually any organic lead compound.
  • Enzymes of the invention can also be designed to be highly enantio- and reg ⁇ selective. The high degree of functional group specificity exhibited by these enzymes enables one to keep track of each reaction in a synthetic sequence leading to a new active compound.
  • Enzymes of the invention can also be designed to catalyze many diverse reactions unrelated to their native physiological function in nature.
  • the present invention exploits the unique catalytic properties of enzymes. Whereas the use of biocatalysts (i.e., purified or crude enzymes, non-living or living ceUs) in chemical transformations normally requires the identification of a particular biocatalyst that reacts with a specific starting compound.
  • the present invention uses selected biocatalysts, i.e., the enzymes of the mvention, and reaction conditions that are specific for functional groups that are present in many starting compounds. Each biocatalyst is specific for one functional group, or several related functional groups, and can react with many starting compounds containing this functional group.
  • the biocatalytic reactions produce a population of derivatives from a single starting compound. These derivatives can be subjected to another round of biocatalytic reactions to produce a second population of derivative compounds. Thousands of variations of the original compound can be produced with each iteration of biocatalytic derivatization. Enzymes react at specific sites of a starting compound without affecting the rest of the molecule, a process that is very difficult to achieve using traditional chemical methods. This high degree of biocatalytic specificity provides the means to identify a single active enzyme within a library.
  • the library is characterized by the series of biocatalytic reactions used to produce it, a so-called "biosynthetic history".
  • Screening the library for biological activities and tracing the biosynthetic history identifies the specific reaction sequence producing the active compound.
  • the reaction sequence is repeated and the stracture of the synthesized compound determined.
  • This mode of identification unlike other synthesis and screening approaches, does not require immobilization technologies, and compounds can be synthesized and tested free in solution using virtually any type of screening assay. It is important to note, that the high degree of specificity of enzyme reactions on functional groups allows for the "fracking" of specific enzymatic reactions that make up the biocatalytically produced library.
  • the invention also provides methods of discovering new phospholipases using the nucleic acids, polypeptides and antibodies of the invention. In one aspect, lambda phage libraries are screened for expression-based discovery of phospholipases.
  • lambda phage libraries in screening allows detection of toxic clones; improved access to substrate; reduced need for engineering a host, by-passing the potential for any bias resulting from mass excision of the library; and,, faster growth at low clone densities.
  • Screening of lambda phage libraries can be in liquid phase or in solid phase. Screening in liquid phase gives greater flexibility in assay conditions; additional substrate flexibility; higher sensitivity for weak clones; and ease of automation over solid phase screening. Many of the procedural steps are performed using robotic automation enabhng the execution of many thousands of biocatalytic reactions and screening assays per day as well as ensuring a high level of accuracy and reproducibility (see discussion of anays, below).
  • Phospholipase signal sequences The invention provides phospholipase signal sequences (e.g., signal peptides (SPs)), e.g., peptides comprising signal sequences and/or chimeric polypeptides, where the peptides or chimerics have a signal sequence as set forth in Table 1, or as set forth, below.
  • SPs signal peptides
  • the invention provides nucleic acids encoding these signal sequences (SPs, e.g., a peptide having a sequence comprising/ consisting of amino terminal residues of a polypeptide of the invention).
  • the invention provides a signal sequence comprising a peptide comprising/ consisting of a sequence as set forth in residues 1 to 20, 1 to 21, 1 to 22, 1 to 23, 1 to 24, 1 to 25, 1 to 26, 1 to 27, 1 to 28, 1 to 28, 1 to 30, 1 to 31, 1 to 32 or 1 to 33 of a polypeptide of the invention, e.g., SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO: 10, SEQ ID NO: 12, SEQ ID NO: 14, SEQ ID NO: 16, SEQ ID NO: 18, SEQ ID NO:20, SEQ ID NO:22, SEQ ID NO:24, SEQ ID NO:26, SEQ ID NO:28, SEQ ID NO:30, SEQ ID NO:32, SEQ ID NO:34, SEQ ID NO:36, SEQ ID NO:38, SEQ ID NO:40, SEQ ID NO:42, SEQ ID NO:44, SEQ ID NO:46, SEQ ID NO:48, SEQ ID NO:
  • Any of these peptides can be part of a chimeric protein, e.g., a recombinant protein.
  • a signal sequence peptide can be matched with another enzyme of the invention (e.g., a phospholipase of the invention from which is was not derived), or, with another phospholipase, or with any polypeptide, as discussed further, below.
  • the invention provides a nucleic acid sequence encoding a signal sequence from one phospholipase operably linked to a nucleic acid sequence of a different phospholipase or, optionally, a signal sequence from a non-phospholipase protein may be desired.
  • Phospholipase prepro domains, binding domains and catalytic domains
  • the invention provides prepro domains, binding domains (e.g., substrate binding domain) and catalytic domains (CDs).
  • the invention provides phospholipases of the invention with heterologous CDs, SPs and/or prepro sequences, e.g., sequences with a yeast signal sequence.
  • a phospholipase of the invention can comprise a heterologous CD, SP and/or prepro in a vector, e.g., a pPIC series vector (Invifrogen, Carlsbad, CA).
  • SPs, CDs, and/or prepro sequences of the invention are identified following identification of novel phospholipase polypeptides. The pathways by which proteins are sorted and transported to their proper cellular location are often refened to as protein targeting pathways.
  • One of the most important elements in all of these targeting systems is a short amino acid sequence at the amino terminus of a newly synthesized polypeptide caUed the signal sequence.
  • This signal sequence directs a protein to its appropriate location in the cell and is removed during transport or when the protein reaches its final destination.
  • Most lysosomal, membrane, or secreted proteins have an amino-terminal signal sequence that marks them for translocation into the lumen of the endoplasmic reticulum.
  • the signal sequences can vary in length from 13 to 45 or more amino acid residues.
  • novel hydrolase signal peptides are identified by a method refened to as SignalP.
  • a phospholipase of the invention may not have SPs and/or prepro sequences, and/or catalytic domains (CDs).
  • the invention provides phospholipases lacking all or part of an SP, a CD and/or a prepro domain.
  • the invention provides a nucleic acid sequence encoding a signal sequence (SP), a CD and/or prepro from one phospholipase operably linlced to a nucleic acid sequence of a different phospholipase or, optionally, a signal sequence (SPs), a CD and/or prepro domain from a non-phospholipase protein may be desired.
  • SPs signal sequence
  • CDs catalytic domains
  • the heterologous sequences are sequences not naturally associated (e.g., to a phospholipase) with an SP, prepro domain and/or CD.
  • the sequence to which the SP, prepro domain and/or CD are not naturally associated can be on the SP's, prepro domain and/or CD's amino terminal end, carboxy terminal end, and/or on both ends of the SP and/or CD.
  • the invention provides an isolated or recombinant polypeptide comprising (or consisting of) a polypeptide comprising a signal sequence (SP), prepro domain and/or catalytic domain (CD) of die invention with the proviso that it is not associated with any sequence to which it is naturally associated (e.g., phospholipase sequence).
  • the invention provides isolated or recombinant nucleic acids encoding these polypeptides.
  • the isolated or recombinant nucleic acid of the invention comprises coding sequence for a signal sequence (SP), prepro domain and/or catalytic domain (CD) of the invention and a heterologous sequence (i.e., a sequence not naturally associated with the a signal sequence (SP), prepro domain and/or catalytic domain (CD) of the invention).
  • the heterologous sequence can be on the 3' terminal end, 5' terminal end, and/or on both ends of the SP, prepro domain and/or CD coding sequence.
  • the polypeptides of the invention include phospholipases in an active or inactive form.
  • the polypeptides of the invention include proproteins before “maturation” or processing of prepro sequences, e.g., by a proprotein-processing enzyme, such as a proprotein convertase to generate an "active" mature protein.
  • the polypeptides of the invention include phospholipases inactive for other reasons, e.g., before “activation” by a post-franslational processing event, e.g., an endo- or exo-peptidase or proteinase action, a phosphorylation event, an amidation, a glycosylation, a de- glycosylation, a sulfation, a dimerization event, and/or the like.
  • polypeptides of the invention can be formulated as a protein preparation into any liquid, solid, semi-solid or gel form.
  • a protein preparation of the invention can comprise a formulation comprising a non-aqueous liquid composition, a cast solid, a powder, a lyophilized powder, a granular form, a particulate form, a compressed tablet, a pellet, a pill, a gel form, a hydrogel, a paste, an aerosol, a spray, a lotion or a slurry formulation.
  • the polypeptides of the invention include all active forms, including active subsequences, e.g., catalytic domains (CDs) or active sites, of an enzyme of the invention.
  • CDs catalytic domains
  • the invention provides catalytic domains or active sites as set forth below.
  • the invention provides a peptide or polypeptide comprising or consisting of an active site domain as predicted through use of a database such as Pfam (which is a large collection of multiple sequence alignments and hidden Markov models covering many common protein families, The Pfam protein families database, A. Bateman, E. Birney, L. Cerruti, R. Durbin, L. Etwiller, S.R. Eddy, S. Griffiths-Jones, K.L. Howe, M. Marshall, and E.L.L. Sonnhammer, Nucleic Acids Research, 30(l):276-280, 2002) or equivalent.
  • Pfam which is a large collection of multiple sequence alignments and hidden Markov models covering many common protein families, The Pfam protein families database, A. Bateman, E. Birney, L. Cerruti, R. Durbin, L. Etwiller, S.R. Eddy, S. Griffiths-Jones, K.L
  • the invention provides fusion of N-terminal or C-terminal subsequences of enzymes of the invention (e.g., signal sequences, prepro sequences) with other polypeptides, active proteins or protein fragments.
  • enzymes of the invention e.g., signal sequences, prepro sequences
  • the production of an enzyme of the invention may also be accomplished by expressing the enzyme as an inactive fusion protein that is later activated by a proteolytic cleavage event (using either an endogenous or exogenous protease activity, e.g. trypsin) that results in the separation of the fusion protein partner and the mature enzyme, e.g., phospholipase C enzyme.
  • the fusion protein can comprise a pectate lyase sequence, a xylanase sequence, a phosphatidic acid phosphatase sequence, or another sequence, e.g., a sequence that has previously been shown to be over-expressed in a host system of interest.
  • Any host system can be used (see discussion, above), for example, any bacteria, e.g., a gram positive bacteria, such as Bacillus, or a gram negative bacteria, such as E. coli, or any yeast, e.g., Pichia pastoris.
  • the anangement of the nucleotide sequences in the chimeric nucleotide construction can be determined based on the protein expression levels achieved with each fusion construct.
  • the nucleotide sequences is assembled as follows: Signal sequence/fusion protein linker sequence/protease cleavage recognition site/ mature enzyme (e.g., any enzyme of the invention, e.g., a phospholipase) or Signal sequence/pro sequence/mature enzyme/linker sequence/fusion protein.
  • Signal sequence/fusion protein linker sequence/protease cleavage recognition site/ mature enzyme e.g., any enzyme of the invention, e.g., a phospholipase
  • Signal sequence/pro sequence/mature enzyme/linker sequence/fusion protein e.g., any enzyme of the invention, e.g., a phospholipase
  • enzyme e.g., any enzyme of the invention, e.g., a phospholipase
  • inactive fusion protein may improve the overall expression of the enzyme's sequence, may reduce any potential toxicity associated with the ove ⁇ roduction of active enzyme and/or may increase the shelf life of enzyme prior to use because enzyme would be inactive until the fusion protein e.g. pectate lyase is separated from the enzyme, e.g., phospholipase protein.
  • the invention provides specific formulations for the activation of phospholipase of the invention expressed as a fusion protein.
  • the activation of the phospholipase activity initially expressed as an inactive fusion protein is accomplished using a proteolytic activity or potentially a proteolytic activity in combination with an amino-terminal or carboxyl-terminal peptidase.
  • This activation event may be accomplished in a variety of ways and at variety of points in the manufacturing/storage process prior to application in oil degumming.
  • Exemplary processes of the invention include: Cleavage by an endogenous activity expressed by the manufacturing host upon secretion of the fusion constract into the fermentation media;
  • glycosylation can be added post-translationally either chemically or by cellular biosynthetic mechanisms, wherein the later inco ⁇ orates the use of known glycosylation motifs, which can be native to the sequence or can be added as a peptide or added in the nucleic acid coding sequence.
  • the invention provides a polypeptide comprising an N- linked glycosylated SEQ ID NO:2, as described, e.g., in the following table:
  • the full-length SEQ ID NO:2 (which in one aspect is encoded by SEQ ID NO:l) open reading frame encodes seven (7) potential asparagine-linked (N-linked) glycosylation sites.
  • the expression of the wild-type SEQ ID NO:2 open reading frame in a glycosylating host results in the production of a glycosylated SEQ ID NO:2 phospholipase enzyme that is essentially inactive due to the presence of N-linked glycosylation.
  • Enzymatic deglycosylation of the wild-type, glycosylated SEQ ID NO:2 with PNGase F or Endoglycosidase H results in the activation of the SEQ ID NO:2 activity.
  • modification of one or more of the N-linked glycosylation sites through mutagenesis results in the production of SEQ ID NO:2 with varying degrees of increased activity.
  • Mutagenesis of the nucleotide codon encoding the asparagine in SEQ ID NO:2 glycosylation sites 4,5, and/or 6 e.g.
  • converting the asparagine to an aspartic acid results in the production of an enzyme with increased PLC activity compared to the wild- type open reading frame expressed in the same host (the triple mutant expressed in Pichia pastoris possesses a specific activity and a functional activity that is essentially identical to that of the wild-type sequence expressed in a non-glycosylating host like E. coli. It is also possible to abolish the N-linked glycosylation site by mutagenesis of the serine or threonine residue in the N-linked glycosylation consensus sequence (NXS/T), for example by converting these nucleotide codons to produce valine or isoleucine at these positions instead of serine or threonine. The use of this strategy to remove N-linked glycosylation sites also results in the production of active SEQ ID NO:2 phospholipase in glycosylating host expression systems.
  • the invention provides isolated, synthetic or recombinant polypeptides (e.g., enzymes, antibodies) having a phospholipase activity, or any combination of phospholipase activities, and nucleic acids encoding them. Any of the many phospholipase activity assays known in the art can be used to determine if a polypeptide has a phospholipase activity and is within the scope of the invention. Routine protocols for determining phospholipase A, B, D and C, patatin and lipid acyl hydrolase activities, or lipase activity, are well known in the art.
  • Methylumbelliferyl (fluorescent) phosphocholine assays to determine phospholipase activity are described, e.g., in Goode (1997) "Evidence for cell surface and internal phospholipase activity in ascidian eggs,” Develop. Growth Differ. 39:655-660; Diaz (1999) "Direct fluorescence-based lipase activity assay," BioTechniques 27:696- 700.
  • Amplex Red (fluorescent) Phospholipase Assays to determine phospholipase activity are available as kits, e.g., the detection of phosphatidylcholine- specific phospholipase using an Amplex Red phosphatidylcholine-specific phospholipase assay kit from Molecular Probes Inc. (Eugene, OR), according to manufacturer's instructions. Fluorescence is measured in a fluorescence microplate reader using excitation at 560 ⁇ 10 nm and fluorescence detection at 590 ⁇ 10 nm. The assay is sensitive at very low enzyme concentrations.
  • Thin layer chromatography assays to determine phospholipase activity are described, e.g., in Reynolds (1991) Methods in Enzymol. 197:3-13; Taguchi (1975) "Phospholipase from Clostridium novyi type A.I,” Biochim. Biophys. Acta 409:75-85.
  • Thin layer chromatography is a widely used technique for detection of phospholipase activity.
  • Various modifications of this method have been used to extract the phospholipids from the aqueous assay mixtures. In some PLC assays the hydrolysis is stopped by addition of chloroform methanol (2:1) to the reaction mixture.
  • the unreacted starting material and the diacylglycerol are extracted into the organic phase and may be fractionated by TLC, while the head group product remains in the aqueous phase.
  • radiolabeled substrates can be used (see, e.g., Reynolds (1991) Methods in Enzymol. 197:3-13).
  • the ratios of products and reactants can be used to calculate the actual number of moles of substrate hydrolyzed per unit time. If all the components are extracted equally, any losses in the exfraction will affect all components equally.
  • Hybrid (chimeric ' ) phospholipases and peptide libraries provides hybrid phospholipases and fusion proteins, including peptide libraries, comprising sequences of the invention.
  • the peptide libraries of the invention can be used to isolate peptide modulators (e.g., activators or inhibitors) of targets, such as phospholipase substrates, receptors, enzymes.
  • the peptide libraries of the invention can be used to identify formal binding partners of targets, such as ligands, e.g., cytokines, hormones and the like.
  • the invention provides chimeric proteins comprising a signal sequence (SP) and/or catalytic domain (CD) of the invention and a heterologous sequence (see above).
  • SP signal sequence
  • CD catalytic domain
  • the invention also provides methods for generating "improved" and hybrid phospholipases using the nucleic acids and polypeptides of the invention.
  • the invention provides methods for generating enzymes tiiat have activity, e.g., phospholipase activity (such as, e.g., phospholipase A, B, C or D activity, patatin esterase activity, cleavage of a glycerolphosphate ester linkage, cleavage of an ester linkage in a phospholipid in a vegetable oil) at extreme alkaline pHs and/or acidic pHs, high and low temperatures, osmotic conditions and the like.
  • phospholipase activity such as, e.g., phospholipase A, B, C or D activity, patatin esterase activity, cleavage of a glycerolphosphate ester linkage, cleavage of an ester linkage in a phospholipid in a vegetable oil
  • the invention provides methods for generating hybrid enzymes (e.g., hybrid phospholipases).
  • the methods of the invention produce new hybrid polypeptides by utilizing cellular processes that integrate the sequence of a first polynucleotide such that resulting hybrid polynucleotides encode polypeptides demonstrating activities derived from the first biologically active polypeptides.
  • the first polynucleotides can be an exemplary nucleic acid sequence (e.g., SEQ ID NO:l, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, etc.) encoding an exemplary phospholipase of the invention (e.g., SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ ID NO: 8, etc.).
  • the first nucleic acid can encode an enzyme from one organism that functions effectively under a particular environmental condition, e.g. high salinity. It can be "integrated" with an enzyme encoded by a second polynucleotide from a different organism that functions effectively under a different environmental condition, such as extremely high temperatures.
  • a hybrid polynucleotide containing sequences from the first and second original polynucleotides may encode an enzyme that exhibits characteristics of both enzymes encoded by the original polynucleotides.
  • the enzyme encoded by the hybrid polynucleotide may function effectively under environmental conditions shared by each of the enzymes encoded by the first and second polynucleotides, e.g., high salinity and extreme temperatures.
  • a hybrid polypeptide resulting from this method of the invention may exhibit specialized enzyme activity not displayed in the original enzymes.
  • the resulting hybrid polypeptide encoded by a hybrid polynucleotide can be screened for specialized activities obtained from each of the original enzymes, i.e. the type of bond on which the phospholipase acts and die temperature at which the phospholipase functions.
  • the phospholipase may be screened to ascertain those chemical functionalities which distinguish the hybrid phospholipase from the original phospholipases, such as: (a) amide (peptide bonds), i.e., phospholipases; (b) ester bonds, i.e., phospholipases and lipases; (c) acetals, i.e., glycosidases and, for example, the temperature, pH or salt concenfration at which the hybrid polypeptide functions.
  • amide (peptide bonds) i.e., phospholipases
  • ester bonds i.e., phospholipases and lipases
  • acetals i.e., glycosidases and, for example, the temperature, pH or salt concenfration at which the hybrid polypeptide functions.
  • Sources of the polynucleotides to be "integrated” with nucleic acids of the invention may be isolated from individual organisms ("isolates”), collections of organisms that have been grown in defined media (“enrichment cultures”), or, uncultivated organisms ("environmental samples”).
  • isolated cultures collections of organisms that have been grown in defined media
  • environment cultures uncultivated organisms
  • the use of a culture-independent approach to derive polynucleotides encoding novel bioactivities from environmental samples is most preferable since it aUows one to access untapped resources of biodiversity.
  • “Environmental libraries” are generated from environmental samples and represent the collective genomes of naturally occurring organisms archived in cloning vectors that can be propagated in suitable prokaryotic hosts.
  • the libraries are not limited to the small fraction of prokaryotes that can be grown in pure culture. Additionally, a normalization of the environmental DNA present in these samples could allow more equal representation of the DNA from aU of the species present in the original sample. This can dramatically increase the efficiency of finding interesting genes from minor constituents of the sample that may be under-represented by several orders of magnitude compared to the dominant species.
  • gene libraries generated from one or more uncultivated microorgamsms are screened for an activity of interest. Potential pathways encoding bioactive molecules of interest are first captured in prokaryotic cells in the form of gene expression libraries. Polynucleotides encoding activities of interest are isolated from such libraries and introduced into a host cell.
  • microorganisms may be extremophiles, such as hyperthermophiles, psychrophiles, psychrotrophs, halophiles, barophiles and acidophiles.
  • extremophiles such as hyperthermophiles, psychrophiles, psychrotrophs, halophiles, barophiles and acidophiles.
  • polynucleotides encoding phospholipase enzymes isolated from extremophilic microorganisms are used to make hybrid enzymes.
  • Such enzymes may function at temperatures above 100°C in, e.g., tenestrial hot springs and deep sea thermal vents, at temperatures below 0°C in, e.g., arctic waters, in the saturated salt environment of, e.g., the Dead Sea, at pH values around 0 in, e.g., coal deposits and geothermal sulfur-rich springs, or at pH values greater than 11 in, e.g., sewage sludge.
  • phospholipases cloned and expressed from extremophilic organisms can show high activity throughout a wide range of temperatures and pHs.
  • Polynucleotides selected and isolated as described herein, including at least one nucleic acid of the invention, are introduced into a suitable host cell.
  • a suitable host cell is any cell that is capable of promoting recombination and/or reductive reassortment.
  • the selected polynucleotides can be in a vector that includes appropriate control sequences.
  • the host cell can be a higher eukaryotic cell, such as a mammalian cell, or a lower eukaryotic cell, such as a yeast cell, or preferably, the host cell can be a prokaryotic cell, such as a bacterial cell.
  • Introduction of the constract into the host cell can be effected by calcium phosphate transfection, DEAE-Dextran mediated fransfection, or elecfroporation (Davis et al., 1986).
  • Exemplary appropriate hosts include bacterial cells, such as E.
  • DNA sequences derived from the SV40 splice, and polyadenylation sites may be used to provide die required non-transcribed genetic elements.
  • Host cells containing the polynucleotides of interest can be cultured in conventional nutrient media modified as appropriate for activating promoters, selecting fransformants or amplifying genes.
  • the culture conditions such as temperature, pH and the like, are those previously used with the host cell selected for expression, and will be apparent to the ordinarily skilled artisan.
  • the clones which are identified as having the specified enzyme activity may then be sequenced to identify the polynucleotide sequence encoding an enzyme having the enhanced activity.
  • Gene cluster DNA can be isolated from different organisms and ligated into vectors, particularly vectors containing expression regulatory sequences which can control and regulate the production of a detectable protein or protein-related anay activity from the ligated gene clusters.
  • vectors which have an exceptionally large capacity for exogenous DNA introduction are particularly appropriate for use with such gene clusters and are described by way of example herein to include the f-factor (or fertility factor) of E. coli.
  • This f-factor of E. coli is a plasmid which affects high-frequency fransfer of itself during conjugation and is ideal to achieve and stably propagate large DNA fragments, such as gene clusters from mixed microbial samples.
  • “Fosmids,” cosmids or bacterial artificial chromosome (BAC) vectors can be used as cloning vectors. These are derived from E. coli f-factor which is able to stably integrate large segments of genomic DNA. When integrated with DNA from a mixed uncultured environmental sample, this makes it possible to achieve large genomic fragments in the form of a stable "environmental DNA library.” Cosmid vectors were originally designed to clone and propagate large segments of genomic DNA. Cloning into cosmid vectors is described in detail in Sambrook et al., Molecular Cloning: A Laboratory Manual, 2nd ⁇ d., Cold Spring Harbor Laboratory Press (1989).
  • two or more vectors containing different polyketide synthase gene clusters can be introduced into a suitable host cell. Regions of partial sequence homology shared by the gene clusters will promote processes which result in sequence reorganization resulting in a hybrid gene cluster. The novel hybrid gene cluster can then be screened for enhanced activities not found in the original gene clusters.
  • the invention relates to a method for producing a biologically active hybrid polypeptide using a nucleic acid of the invention and screening the polypeptide for an activity (e.g., enhanced activity) by: (1) introducing at least a first polynucleotide (e.g., a nucleic acid of the invention) in operable linkage and a second polynucleotide in operable linkage, said at least first polynucleotide and second polynucleotide sharing at least one region of partial sequence homology, into a suitable host cell; (2) growing the host cell under conditions which promote sequence reorganization resulting in a hybrid polynucleotide in operable linkage; (3) expressing a hybrid polypeptide encoded by the hybrid polynucleotide; (4) screening the hybrid polypeptide under conditions which promote identification of the desired biological activity (e.g., enhanced phospholipase activity); and (5) isolating the a polynucleotide encoding the
  • This process of "reductive reassortment” occurs by an "intra-molecular", RecA- independent process.
  • novel polynucleotides are generated by the process of reductive reassortment.
  • the method involves the generation of constructs containing consecutive sequences (original encoding sequences), their insertion into an appropriate vector, and their subsequent introduction into an appropriate host cell.
  • the reassortment of the individual molecular identities occurs by combinatorial processes between the consecutive sequences in the constract possessing regions of homology, or between quasi-repeated units.
  • the reassortment process recombines and/or reduces the complexity and extent of the repeated sequences, and results in the production of novel molecular species.
  • reassortment process may involve homologous recombination or the natural property of quasi-repeated sequences to direct their own evolution. Repeated or "quasi-repeated” sequences play a role in genetic instability. "Quasi-repeats" are repeats that are not restricted to their original unit structure. Quasi- repeated units can be presented as an anay of sequences in a constract; consecutive units of similar sequences.
  • the cell performs to reduce the complexity of the resulting constract operates between the quasi-repeated sequences.
  • the quasi-repeated units provide a practically limitless repertoire of templates upon which slippage events can occur.
  • the constructs containing the quasi-repeats thus effectively provide sufficient molecular elasticity that deletion (and potentially insertion) events can occur virtually anywhere within the quasi-repetitive units.
  • the inversion delineates the endpoints of the adjacent unit so that deletion formation will favor the loss of discrete units.
  • the sequences to be reasserted are in the same orientation. Random orientation of quasi-repeated sequences will result in the loss of reassortment efficiency, while consistent orientation of the sequences will offer the highest efficiency. However, while having fewer of the contiguous sequences in the same orientation decreases the efficiency, it may still provide sufficient elasticity for the effective recovery of novel molecules. Constructs can be made with the quasi-repeated sequences in the same orientation to allow higher efficiency.
  • Sequences can be assembled in a head to tail orientation using any of a variety of methods, including the following: a) Primers that include a poly-A head and poly-T tail which when made single-stranded would provide orientation can be utilized. This is accomplished by having the first few bases of the primers made from RNA and hence easily removed RNase H. b) Primers that include unique restriction cleavage sites can be utilized. Multiple sites, a battery of unique sequences, and repeated syntiiesis and ligation steps would be required, c) The inner few bases of the primer could be thiolated and an exonuclease used to produce properly tailed molecules.
  • the recovery of the re-assorted sequences relies on the identification of cloning vectors with a reduced repetitive index (RI).
  • the re-assorted encoding sequences can then be recovered by amplification.
  • the products are re-cloned and expressed.
  • the recovery of cloning vectors with reduced RI can be affected by: 1) The use of vectors only stably maintained when the construct is reduced in complexity. 2) The physical recovery of shortened vectors by physical procedures. In this case, the cloning vector would be recovered using standard plasmid isolation procedures and size fractionated on either an agarose gel, or column with a low molecular weight cut off utilizing standard procedures. 3) The recovery of vectors containing interrupted genes which can be selected when insert size decreases.
  • Encoding sequences for example, genes
  • Encoding sequences may demonstrate a high degree of homology and encode quite diverse protein products. These types of sequences are particularly useful in the present invention as quasi-repeats. However, this process is not limited to such nearly identical repeats.
  • the following is an exemplary method of the invention.
  • Encoding nucleic acid sequences are derived from three (3) species, including a nucleic acid of the invention. Each sequence encodes a protein with a distinct set of properties, including an enzyme of the invention. Each of the sequences differs by a single or a few base pairs at a unique position in the sequence.
  • the quasi-repeated sequences are separately or collectively amplified and ligated into random assemblies such that all possible permutations and combinations are available in the population of ligated molecules.
  • the number of quasi-repeat units can be controlled by the assembly conditions.
  • the average number of quasi-repeated units in a construct is defined as the repetitive index (RI).
  • RI repetitive index
  • the constructs may, or may not be size fractionated on an agarose gel according to published protocols, inserted into a cloning vector, and transfected into an appropriate host cell.
  • the cells are then propagated and "reductive reassortment" is effected.
  • the rate of the reductive reassortment process may be stimulated by the introduction of DNA damage if desired.
  • the method comprises the additional step of screening the library members of the shuffled pool to identify individual shuffled library members having the ability to bind or otherwise interact, or catalyze a particular reaction (e.g., such as catalytic domain of an enzyme) with a predetermined macromolecule, such as for example a proteinaceous receptor, an oligosaccharide, virion, or other predetermined compound or stracture.
  • a predetermined macromolecule such as for example a proteinaceous receptor, an oligosaccharide, virion, or other predetermined compound or stracture.
  • polypeptides e.g., phospholipases
  • the polypeptides that are identified from such libraries can be used for various proposes, e.g., the industrial processes described herein and/or can be subjected to one or more additional cycles of shuffling and/or selection.
  • polynucleotides generated by the method of the invention can be subjected to agents or processes which promote the introduction of mutations into the original polynucleotides. The introduction of such mutations would increase the diversity of resulting hybrid polynucleotides and polypeptides encoded therefrom.
  • the agents or processes which promote mutagenesis can include, but are not limited to: (+)-CC-1065, or a synthetic analog such as (+)-CC-1065-(N3-Adenine (See Sun and Hurley, (1992); an N-acetylated or deacetylated 4'-fluro-4-aminobiphenyl adduct capable of inhibiting DNA synthesis (See , for example, van de Poll et al. (1992)); or a N-acetylated or deacetylated 4-aminobiphenyl adduct capable of inhibiting DNA synthesis (See also, van de Poll et al. (1992), pp.
  • bivalent chromium, a trivalent chromium salt, a polycyclic aromatic hydrocarbon (PAH) DNA adduct capable of inhibiting DNA replication such as 7-bromomethyl-benz[a] anthracene ("B?MA”), tris(2,3-dibromopropyl)phosphate ("Tris- BP"), l,2-dibromo-3-chloropropane (“DBCP”), 2-bromoacrolein (2BA), benzo[a]pyrene- 7,8-dihydrodiol-9-10-epoxide (“BPDE”), a platinum(II) halogen salt, N-hydroxy-2- amino-3-methylimidazo[4,5-f]-quinoline (“N-hydroxy-IQ”), and N-hydroxy-2-amino-l- methyl-6-phenylimidazo[4,5-f]-pyridine (“N-hydroxy-PhIP”).
  • PHA polycyclic aromatic hydrocarbon
  • Especially prefened means for slowing or halting PCR amplification consist of UV light (+)-CC-1065 and (+)- CC-1065-(N3-Adenine).
  • Particularly encompassed means are DNA adducts or polynucleotides comprising the DNA adducts from the polynucleotides or polynucleotides pool, which can be released or removed by a process including heating the solution comprising the polynucleotides prior to further processing.
  • a variety of apparatus and methodologies can be used to in conjunction with the polypeptides and nucleic acids of the invention, e.g., to screen polypeptides for phospholipase activity, to screen compounds as potential modulators of activity (e.g., potentiation or inhibition of enzyme activity), for antibodies that bind to a polypeptide of the invention, for nucleic acids that hybridize to a nucleic acid of the invention, and the like.
  • Immobilized Enzyme Solid Supports The phospholipase enzymes, fragments thereof and nucleic acids that encode the enzymes and fragments can be affixed to a solid support.
  • phospholipases This is often economical and efficient in the use of the phospholipases in industrial processes.
  • a consortium or cocktail of phosphohpase enzymes (or active fragments thereof), which are used in a specific chemical reaction, can be attached to a solid support and dunked into a process vat. The enzymatic reaction can occur. Then, the solid support can be taken out of the vat, along with the enzymes affixed thereto, for repeated use.
  • an isolated nucleic acid of the invention is affixed to a solid support.
  • the solid support is selected from the group of a gel, a resin, a polymer, a ceramic, a glass, a microelecfrode and any combination thereof.
  • solid supports useful in this invention include gels.
  • Some examples of gels include Sepharose, gelatin, glutaraldehyde, chitosan-freated glutaraldehyde, albumin-glutaraldehyde, chitosan-Xanthan, toyopearl gel (polymer gel), alginate, alginate-polylysine, canageenan, agarose, glyoxyl agarose, magnetic agarose, dextran-agarose, poly(Carbamoyl Sulfonate) hydrogel, BSA-PEG hydrogel, phosphorylated polyvinyl alcohol (PVA), monoaminoethyl-N-aminoethyl (MANA), amino, or any combination thereof.
  • solid support Another type of solid support that can be used is a microelecfrode.
  • An example is a polyethyleneimine- coated magnetite.
  • Graphitic particles can be used as a solid support.
  • Other exemplary solid supports used to practice the invention comprise diatomaceous earth products and silicates. Some examples include CELITE ® KEMTE ® , DIACTIV ® , PRIMISIL ® , DIAFIL ® diatomites and MICRO-CEL ® , CALFLO ® , SILASORBTM, and CELKATE ® synthetic calcium and magnesium silicates.
  • Another example of a solid support is a cell, such as a red blood cell.
  • Methods of immobilization There are many methods that would be known to one of skill in the art for immobilizing enzymes or fragments thereof, or nucleic acids, onto a solid support. Some examples of such methods include, e.g., electrostatic droplet generation, electrochemical means, via adso ⁇ tion, via covalent binding, via cross-linking, via a chemical reaction or process, via encapsulation, via entrapment, via calcium alginate, or via poly (2- hydroxyethyl methacrylate). Like methods are described in Methods in Enzymology, Immobilized Enzymes and Cells, Part C. 1987. Academic Press. Edited by S. P. Colowick and N. O. Kaplan. Volume 136; and Immobilization of Enzymes and Cells.
  • Capillary Arrays Capillary anays, such as the GIGA?MATRIXTM, Diversa Co ⁇ oration, San Diego, CA, can be used to in the methods of the invention.
  • Nucleic acids or polypeptides of the invention can be immobilized to or applied to an anay, including capillary anays.
  • Arrays can be used to screen for or monitor libraries of compositions (e.g., small molecules, antibodies, nucleic acids, etc.) for their ability to bind to or modulate the activity of a nucleic acid or a polypeptide of the invention.
  • Capillary anays provide another system for holding and screening samples.
  • a sample screening apparatus can include a plurality of capillaries formed into an anay of adjacent capillaries, wherein each capillary comprises at least one wall defining a lumen for retaining a sample.
  • the apparatus can further include interstitial material disposed between adjacent capillaries in the anay, and one or more reference indicia formed within of the interstitial material.
  • a capillary for screening a sample wherein the capillary is adapted for being bound in an anay of capillaries, can include a first wall defining a lumen for retaining the sample, and a second wall formed of a filtering material, for filtering excitation energy provided to the lumen to excite the sample.
  • a polypeptide or nucleic acid e.g., a ligand
  • a first component into at least a portion of a capillary of a capillary anay.
  • Each capillary of the capillary anay can comprise at least one wall defining a lumen for retaining the first component.
  • An air bubble can be introduced into the capillary behind the first component.
  • a second component can be introduced into the capillary, wherein the second component is separated from the first component by the air bubble.
  • a sample of interest can be introduced as a first liquid labeled with a detectable particle into a capillary of a capillary anay, wherein each capillary of the capillary anay comprises at least one wall defining a lumen for retaining the first liquid and the detectable particle, and wherein the at least one wall is coated with a binding material for binding the detectable particle to the at least one wall.
  • the method can further include removing the first liquid from die capillary tube, wherein the bound detectable particle is maintained within the capillary, and introducing a second liquid into the capillary tube.
  • the capillary anay can include a plurality of individual capillaries comprising at least one outer wall defining a lumen.
  • the outer wall of the capillary can be one or more walls fused together. Similarly, the wall can define a lumen that is cylindrical, square, hexagonal or any other geometric shape so long as die walls form a lumen for retention of a liquid or sample.
  • the capillaries of the capillary array can be held together in close proximity to form a planar stracture.
  • the capillaries can be bound together, by being fused (e.g., where the capillaries are made of glass), glued, bonded, or clamped side-by-side.
  • the capillary anay can be formed of any number of individual capillaries, for example, a range from 100 to 4,000,000 capillaries.
  • a capillary anay can form a microtiter plate having about 100,000 or more individual capiUaries bound together.
  • Arrays, or "BioChips" Nucleic acids or polypeptides of the invention can be immobilized to or applied to an anay.
  • Anays can be used to screen for or monitor libraries of compositions (e.g., small molecules, antibodies, nucleic acids, etc.) for their ability to bind to or modulate the activity of a nucleic acid or a polypeptide of the invention.
  • a monitored parameter is transcript expression of a phospholipase gene.
  • One or more, or, all the transcripts of a cell can be measured by hybridization of a sample comprising franscripts of the cell, or, nucleic acids representative of or complementary to transcripts of a cell, by hybridization to immobilized nucleic acids on an anay, or "biochip.”
  • an “anay” of nucleic acids on a microchip some or all of the franscripts of a cell can be simultaneously quantified.
  • anays comprising genomic nucleic acid can also be used to determine the genotype of a newly engineered sfrain made by the methods of the invention.
  • Polypeptide anays can also be used to simultaneously quantify a plurality of proteins.
  • the present invention can be practiced with any known “anay,” also refened to as a “microanay” or “nucleic acid anay” or “polypeptide anay” or “antibody anay” or “biochip,” or variation thereof.
  • Arrays are generically a plurality of “spots” or “target elements,” each target element comprising a defined amount of one or more biological molecules, e.g., oligonucleotides, immobilized onto a defined area of a substiate surface for specific binding to a sample molecule, e.g., mRNA transcripts.
  • any known anay and/or method of making and using anays can be inco ⁇ orated in whole or in part, or variations thereof, as described, for example, in U.S. Patent Nos. 6,277,628; 6,277,489; 6,261,776; 6,258,606; 6,054,270; 6,048,695; 6,045,996; 6,022,963; 6,013,440; 5,965,452; 5,959,098 5,856,174; 5,830,645; 5,770,456; 5,632,957; 5,556,752; 5,143,854; 5,807,522; 5,800,992 : 5,744,305; 5,700,637; 5,556,752; 5,434,049; see also, e.g., WO 99/51773; WO 99/09217 WO 97/46313; WO 96/17958; see also, e.g., Johnston (1998) Cun.
  • Antibodies and Antibody-based screening methods The invention provides isolated or recombinant antibodies that specifically bind to a phospholipase of the invention. These antibodies can be used to isolate, identify or quantify the phospholipases of the invention or related polypeptides. These antibodies can be used to inhibit the activity of an enzyme of the invention. These antibodies can be used to isolated polypeptides related to those of the invention, e.g., related phospholipase enzymes.
  • the antibodies can be used in immunoprecipitation, staining (e.g., FACS), immunoaffinity columns, and the like.
  • nucleic acid sequences encoding for specific antigens can be generated by immunization followed by isolation of polypeptide or nucleic acid, amplification or cloning and immobilization of polypeptide onto an anay of the invention.
  • the methods of the invention can be used to modify the structure of an antibody produced by a cell to be modified, e.g., an antibody's affinity can be increased or decreased.
  • the ability to make or modify antibodies can be a phenotype engineered into a cell by the methods of the invention.
  • Antibodies also can be generated in vifro, e.g., using recombinant antibody binding site expressing phage display libraries, in addition to the traditional in vivo methods using animals. See, e.g., Hoogenboom (1997) Trends Biotechnol. 15:62-70; Katz (1997) Annu. Rev. Biophys. Biomol. Struct. 26:27-45.
  • the polypeptides can be used to generate antibodies which bind specifically to the polypeptides of the invention.
  • the resulting antibodies may be used in immunoaffinity chromatography procedures to isolate or purify the polypeptide or to determine whether the polypeptide is present in a biological sample.
  • a protein preparation such as an extract, or a biological sample is contacted with an antibody capable of specifically binding to one of the polypeptides of the invention.
  • the antibody is attached to a solid support, such as a bead or other column matrix.
  • the protein preparation is placed in contact with the antibody under conditions in which the antibody specifically binds to one of the polypeptides of the invention. After a wash to remove non-specifically bound proteins, the specifically bound polypeptides are eluted.
  • the ability of proteins in a biological sample to bind to the antibody may be determined using any of a variety of procedures familiar to those skilled in the art.
  • binding may be determined by labeling the antibody with a detectable label such as a fluorescent agent, an enzymatic label, or a radioisotope.
  • binding of the antibody to the sample may be detected using a secondary antibody having such a detectable label thereon.
  • detectable label such as a fluorescent agent, an enzymatic label, or a radioisotope.
  • binding of the antibody to the sample may be detected using a secondary antibody having such a detectable label thereon.
  • Particular assays include ELISA assays, sandwich assays, radioimmunoassays, and Western Blots.
  • Polyclonal antibodies generated against the polypeptides of the invention can be obtained by direct injection of the polypeptides into an animal or by administering the polypeptides to an animal, for example, a nonhuman. The antibody so obtained will then bind the polypeptide itself.
  • 4,946,778 can be adapted to produce single chain antibodies to the polypeptides of the invention.
  • transgenic mice may be used to express humanized antibodies to these polypeptides or fragments thereof.
  • Antibodies generated against the polypeptides of the invention may be used in screening for similar polypeptides from other organisms and samples. In such techniques, polypeptides from the organism are contacted with the antibody and those polypeptides which specificaUy bind the antibody are detected. Any of the procedures described aboye may be used to detect antibody binding.
  • the invention provides many industrial uses and medical applications using polypeptides of the invention, e.g., a phospholipase and other enzymes of the invention, e.g., phospholipases A, B, C and D, patatins, including converting a non- hydratable phosphohpid to a hydratable form, oil degumming, processing of oils from plants, fish, algae and the like, to name just a few applications.
  • polypeptides of the invention e.g., a phospholipase and other enzymes of the invention, e.g., phospholipases A, B, C and D, patatins, including converting a non- hydratable phosphohpid to a hydratable form, oil degumming, processing of oils from plants, fish, algae and the like, to name just a few applications.
  • an enzymes can be added in a specific order, e.g., phospholipases with differing specificities are added in a specific order, for example, an enzyme with PC- and PE-hydrolyzing activity is added first (or two enzymes are added, one with PC-hydrolyzing activity and the other with PE-hydrolyzing activity), then an enzyme with Pl-hydrolyzing activity (e.g., PLC activity) is added, or any combination thereof.
  • Pl-hydrolyzing activity e.g., PLC activity
  • any or all of the methods of the invention can be used on a "process scale", e.g., an oil processes or refining on a scale from about 15,000; 25,000; 50,000; 75,000; or 100,000 lbs of refined oil/day up to about 1, 2, 3, 4, 5 or 6 or more million lbs refined oil/day.
  • a “process scale” e.g., an oil processes or refining on a scale from about 15,000; 25,000; 50,000; 75,000; or 100,000 lbs of refined oil/day up to about 1, 2, 3, 4, 5 or 6 or more million lbs refined oil/day.
  • Methods of using phospholipase enzymes in industrial applications are well known in the art.
  • the phospholipases and methods of the invention can be used for the processing of fats and oils as described, e.g., in JP Patent Application Publication H6-306386, describing converting phospholipids present in the oils and fats into water-soluble substances containing phosphoric acid groups.
  • Phospholipases of the invention can be used to process plant oils and phospholipids such as those derived from or isolated from rice bran, soy, canola, palm, cottonseed, corn, palm kernel, coconut, peanut, sesame, sunflower.
  • Phospholipases of the invention can be used to process essential oils, e.g., those from fruit seed oils, e.g., grapeseed, apricot, borage, etc.
  • Phospholipases of the invention can be used to process oils and phospholipids in different forms, including crude forms, degummed, gums, wash water, clay, silica, soapstock, and the like.
  • the phospholipids of the invention can be used to process high phosphorus oils, fish oils, animal oils, plant oils, algae oils and the like.
  • a phospholipase C can be used, an alternative comprises use of a phospholipase D of the invention and a phosphatase (e.g., using a PLD/ phosphatase combination to improve yield in a high phosphoras oil, such as a soy bean oil).
  • Phospholipases of the invention can be used to process and make edible oils, biodiesel oils, liposomes for pharmaceuticals and cosmetics, structured phospholipids and structured lipids.
  • Phospholipases of the invention can be used in oil extraction.
  • Phospholipases of the invention can be used to process and make various soaps. Processing Edible Oils: Generation of 1,3-diacylglycerol (1,3 DAG)
  • the invention provides processes using enzyme(s) of the invention to make 1,3-diacylglycerol (1,3 DAG).
  • a phospholipase C or phospholipase In one aspect, a phospholipase C or phospholipase
  • D plus a phosphatase generates 1,2-diacylglycerol; this improves oil yield during edible oil refining.
  • a caustic neutralization step for example as a caustic refining aid
  • 1,2-diacylglyceride (1,2-DAG) undergoes acyl migration and is converted to 1,3-DAG.
  • 1,3-DAG possesses increased health benefits and therefore the use of PLC as a caustic refining aid produces an oil with increased nutritional value.
  • the invention provides processes using enzyme(s) of the invention to make and process edible oils, including generation of edible oils with increased amounts of 1,3-DAG.
  • Diacylglycerols are naturally occurring compounds found in many edible oils.
  • a base causes the isomerization of 1,2-DAG, produced by PLC, into 1,3-DAG which provides a nutritional health benefit over 1,2-DAG, e.g., the 1,3-DAG is burned as energy instead of being stored as fat (as is 1,2-DAG).
  • the methods of the invention generate an elevated level of 1,3-DAG (decreasing 1,2-DAG). Nutritionally, 1,3-DAG is better for you than 1,2-DAG.
  • the invention provides a process using an enzyme of the invention for making a food, e.g., a baked good, having increased levels of 1,3-DAG diacylglycerol and baked goods comprising diacylglycerol oils.
  • a food e.g., a baked good
  • the baked goods are cookies, cakes and similar baked goods.
  • combination of enzymes that can be used in the methods of the invention, including the processing of edible oils include (where one, several or all of the enzymes in the combination comprise an enzyme of the instant invention): o PLC + PI-PLC + PLA (PLA added after completion of PLC reactions); o PLD + phosphatase + PI-PLC followed by PLA; or, o PLC or (PLC + PI-PLC) + PLA specific for phosphatidic acid (all enzymes added together or sequentially).
  • Oil degumming and vegetable oil processing The enzymes of the invention (e.g., polypeptides of the invention having lipase, phospholipase, esterase and/or glycosidase or equivalent activity) can be used in various vegetable oil processing steps, such as in vegetable oil extraction, particularly, in the removal of "phosphohpid gums" in a process called "oil degumming". These processes of the invention can be used on a "process scale”, e.g., on a scale from about 15,000; 25,000; 50,000; 75,000; or 100,000 lbs of refined oil/day up to about 1, 2, 3, 4, 5 or 6 or more million lbs refined oil/day.
  • a “process scale” e.g., on a scale from about 15,000; 25,000; 50,000; 75,000; or 100,000 lbs of refined oil/day up to about 1, 2, 3, 4, 5 or 6 or more million lbs refined oil/day.
  • the invention provides oil degumming processes comprising use of a phospholipase of the invention, e.g., a PLC of the invention.
  • the process further comprises addition of another phospholipase (which can also be a phospholipase of the invention), e.g., another PLC, a PLA, a PLB, a PLB or a patatin of the invention, or an enzyme (which can also be an enzyme of the invention) having a lysophospholipase-transacylase (LPTA) activity or lysophospholipase (LPL) activity and lysophospholipase-transacylase (LPTA), or a combination thereof, and/or a patatin-like phospholipase (which can also be an enzyme of the invention).
  • LPTA lysophospholipase-transacylase
  • LPL lysophospholipase
  • LPTA lysophospholipase-transacylase
  • the invention provides processes comprising use of a phospholipase of the invention, e.g., a PLC of the invention, to reduce gum mass and increase neutral oil (triglyceride) gain through reduced oil enfrapment.
  • the invention provides processes comprising use of a phospholipase of the invention, e.g., a PLC of the invention, for increasing neutral oils and diacylglycerol (DAG) production to contribute to the oil phase.
  • DAG diacylglycerol
  • processes of the invention may comprise one or more other enzymes such as a protease, an amylase, a lipase, a cutinase, another phospholipase (including, e.g., an enzyme of the invention), a carbohydrase, a cellulase, a pectinase, a mannanase, an arabinase, a galactanase, a xylanase, an oxidase, e.g., a lactase, and/or a peroxidase, or polypeptides with equivalent activity, or a combination thereof.
  • enzymes such as a protease, an amylase, a lipase, a cutinase, another phospholipase (including, e.g., an enzyme of the invention), a carbohydrase, a cellulase, a pectinase,
  • the phospholipases of the invention can be used in various vegetable oil processing steps, such as in vegetable oil extraction, particularly, in the removal of "phospholipid gums" in a process called “oil degumming,” as described above.
  • the invention provides methods for processing vegetable oils from various sources, such as rice bran, soybeans, rapeseed, peanuts and other nuts, sesame, sunflower, palm and com.
  • the methods can used in conjunction with processes based on extraction with as hexane, with subsequent refining of the crade exfracts to edible oils, including use of the methods and enzymes of the invention.
  • the first step in the refining sequence is the so-called “degumming" process, which serves to separate phosphatides by the addition of water.
  • the material precipitated by degumming is separated and further processed to mixtures of lecithins.
  • the commercial lecithins such as soybean lecithin and sunflower lecithin, are semi-solid or very viscous materials. They consist of a mixture of polar lipids, mainly phospholipids, and oil, mainly triglycerides.
  • the phospholipases of the invention can be used in any "degumming" procedure, including water degumming, ALCON oil degumming (e.g., for soybeans), safinco degumming, "super degumming," UF degumming, TOP degumming, uni- degumming, dry degumming and ENZYMAXTM degumming. See, e.g., U.S. Patent Nos. 6,355,693; 6,162,623; 6,103,505; 6,001,640; 5,558,781; 5,264,367.
  • the invention provides methods for enzymatic degumming under conditions of low water, e.g., in the range of between about 0.1 %> to 20 % water, or, 0.5% to 10% water.
  • this results in the improved separation of a heavy phase from the oil phase during centrifugation.
  • the improved separation of these phases can result in more efficient removal of phospholipids from the oil, including both hydratable and nonhydratable oils.
  • this can produce a gum fraction that contains less entrained neutral oil (triglycerides), thereby improving the overall yield of oil during the degumming process.
  • phospholipases of the invention are used to treat oils (e.g., vegetable oils, including crude oils, such as rice bran, soy, canola, flower and the like), e.g., in degumming processes, to reduce gum mass and increase monral oil gain through reduced oil entrapment.
  • oils e.g., vegetable oils, including crude oils, such as rice bran, soy, canola, flower and the like
  • phospholipases of the invention e.g., a polypeptide having PLC activity
  • DAG diacylglycerol
  • the phospholipases of the invention can be used in the industrial application of enzymatic degumming as described, e.g., in CA 1102795, which describes a method of isolating polar lipids from cereal lipids by the addition of at least 50%> by weight of water.
  • This method is a modified degumming in the sense that it utilizes the principle of adding water to a crade oil mixture.
  • the invention provides enzymatic processes comprising use of phospholipases of the invention (e.g., a PLC) comprising hydrolysis of hydrated phospholipids in oil at a temperature of about 20°C to 40°C, at an alkaline pH, e.g., a pH of about pH 8 to pH 10, using a reaction time of about 3 to 10 minutes. This can result in less than 10 ppm final oil phosphorus levels.
  • phospholipases of the invention e.g., a PLC
  • hydrolysis of hydrated phospholipids in oil at a temperature of about 20°C to 40°C, at an alkaline pH, e.g., a pH of about pH 8 to pH 10, using a reaction time of about 3 to 10 minutes. This can result in less than 10 ppm final oil phosphorus levels.
  • the invention provides enzymatic processes that utilize a phospholipase C enzyme to hydrolyze a glyceryl phosphoester bond and thereby enable the return of the diacylglyceride portion of phospholipids back to the oil, e.g., a vegetable, fish or algae oil (a "phospholipase C (PLC) caustic refining aid”); and, reduce the phospholipid content in a degumming step to levels low enough for high phosphorus oils to be physically refined (a "phospholipase C (PLC) degumming aid").
  • PLC phospholipase C
  • the two approaches can generate different values and have different target applications.
  • a number of distinct steps compose the degumming process preceding the core bleaching and deodorization refining processes. These steps include heating, mixing, holding, separating and drying. Following the heating step, water and often acid are added and mixed to allow the insoluble phospholipid "gum" to agglomerate into particles which may be separated. While water separates many of the phosphatides in degumming, portions of the phospholipids are non-hydratable phosphatides (NHPs) present as calcium or magnesium salts. Degumming processes address these NHPs by the addition of acid. Following the hydration of phospholipids, the oil is mixed, held and separated by centrifugation.
  • NHPs non-hydratable phosphatides
  • the invention provides methods using a PLC of the invention in the gum fraction.
  • oil is added to the crade oil to create an emulsion that results in the movement of the phosphatidylcholine, phosphatidyl-ethanolamine and phosphatidylinositol into the aqueous phase (water degumming). Following centrifugation, these phospholipids are major components of the aqueous gum fraction.
  • the phospholipids in the gum fraction can be treated with phospholipase C or phospholipase D plus phosphatase (or other combinations, noted below) to generate diacylglycerol (DAG) and a phosphate ester.
  • DAG diacylglycerol
  • the DAG can be extracted from the other gum components and treated with a lipase under conditions suitable for the transesterification of the DAG to produce a desired triacylglycerol (structured lipid).
  • the majority of the 1,2-DAG can be converted to 1,3- DAG by increasing the pH of the gum following the PLC reaction, for example, by adding caustic.
  • the 1,3-DAG can then be extracted from the gum and reacted with a lipase under the appropriate conditions to transesterify the 1,3-DAG at the sn2 position to create the desired structured triacylglycerol.
  • the fatty acids used in the transesterification reaction could come from a variety of sources including the free fatty acids found in the crude oil.
  • the phospholipids from water degumming are used in combination with a PLC of the invention to create structured lipids.
  • the water- degummed oil can be exposed to a PLC and/or PLD (either or both can be enzymes of the invention) plus phosphatase or one of these combinations followed by PLA (can be an enzyme of the invention) to reduce the phosphoras to levels suitable for caustic or physical refining.
  • combination of enzymes that can be used in the methods of the invention include (where one, several or all of the enzymes in the combination comprise an enzyme of the instant invention): o PLC + PI-PLC + PLA (PLA added after completion of PLC reactions); o PLD + phosphatase + PI-PLC followed by PLA; or, o PLC or (PLC + PI-PLC) + PLA specific for phosphatidic acid (all enzymes added together or sequentially).
  • Caustic refilling The invention provides processes using phospholipases (including enzymes of the invention) in caustic refining, where the enzymes are used as caustic refining aids.
  • a PLC or PLD and/or a phosphatase are used in the processes as adrop-in, either before, during, or after a caustic neutralization refining process (either continuous or batch refining).
  • the amount of enzyme added may vary according to the process.
  • the water level used in the process can be low, e.g., about 0.5 to 5%.
  • caustic is be added to the process multiple times.
  • the process may be performed at different temperatures (25°C to 70°C), with different acids orcaustics, and at varying pH (4-12). Concenfrated solutions of caustic, e.g., more concenfrated than the industrial standard of 11%, to decrease mass of gum can be used.
  • the concentrated solution of caustic is between about 12% and 50%> concenfrated, e.g., about 20%, 30%>, 40%>, 50%>, or 60% or more concentrated.
  • a phospholipase C enzyme of the invention hydrolyzes a phosphatide at a glyceryl phosphoester bond to generate a diglyceride and water-soluble phosphate compound. The hydrolyzed phosphatide moves to the aqueous phase, leaving the diglyceride in the oil phase, as illustrated in Figure 8.
  • One objective of the PLC "Caustic Refining Aid" is to convert the phospholipid gums formed during neutralization into a diacylglyceride that will migrate back into the oil phase.
  • one objective of the "PLC Degumming Aid” is to reduce the phospholipids in crude oil to a phosphorus equivalent of less than 10 parts per million (ppm).
  • Acids that may be used in a caustic refining process include, but are not limited to, phosphoric, citric, ascorbic, sulfuric, fumaric, maleic, hydrochloric and/or acetic acids. Acids are used to hydrate non-hydratable phospholipids.
  • Caustics that may be used include, but are not limited to, KOH- and NaOH. Caustics are used to neutralize free fatty acids.
  • phospholipases or more particularly a PLC or a PLD and a phosphatase, are used for purification of phytosterols from the gum/soapstock.
  • An alternate embodiment of the invention to add the phospholipase before caustic refining is to express the phospholipase in a plant.
  • the phospholipase is added during crashing of the plant, seeds or other plant part.
  • the phospholipase is added following crushing, but prior to refining (i.e. in holding vessels).
  • phospholipase is added as a refining pre-treatment, either with or without acid.
  • Another embodiment of the invention, already described, is to add the phospholipase during a caustic refining process. In this process, the levels of acid and caustic are varied depending on the level of phosphorus and the level of free fatty acids.
  • the phospholipase is added after caustic refining (Fig. 9).
  • the phospholipase is added in an intense mixer or in a retention mixer, prior to separation.
  • the phospholipase is added following the heat step.
  • the phospholipase is added in the centrifugation step.
  • the phospholipase is added to the soapstock.
  • the phospholipase is added to the washwater.
  • the phospholipase is added during the bleaching and/or deodorizing steps.
  • a phospholipase e.g., a phospholipase C
  • a phospholipase C enzyme of the invention will hydrolyze the phosphatide from both hydratable and non-hydratable phospholipids in neutralized crude and degummed oils before bleaching and deodorizing.
  • Exemplary "caustic refining" processes of the invention are illusfrated in Figure 9 and Figure 13.
  • Figure 9 includes exemplary times, temperature and pHs for static mixer (30 to 60 min, 50 to 60°C, pH 5 to 6.5) and retention mixer (3 to 10 min, 20 to 40°C).
  • the target enzyme can be applied as a drop-in product in the existing caustic neutralization process, as illustrated in Figure 9.
  • any phospholipase including, e.g., a phospholipase of the invention, such as a PLC, PLB, PLA and/or PLC, can be used in a crude oil degumming process, as described, e.g., in Bailey's Industrial Oil & Fat Products v.4 (ed. Y. H. Hui).
  • Figure 14 and Figure 15 illustrate variations of methods of the mvention where two or three centrifugation steps, respectively, are used in the process, which can be used to process any oil, e.g., a vegetable oil such as crude soy oil, as shown in the figure.
  • the exemplary method of Figure 15 has a centrifugation step before caustic refining (in addition to a centrifugation step after caustic refining and before die water wash, and, after the water wash), while the exemplary method of Figure 14 does not have a centrifugation step before caustic refining.
  • Figure 16 illustrates another exemplary variation of this process using acid treatment and having a centrifugation step before a degumming step; this exemplary process can be used to process any oil, e.g., a vegetable oil such as crade soy oil, as shown in the figure.
  • a phospholipase of the invention enables phosphoras to be removed to the low levels acceptable in physical refining.
  • a PLC of the invention will hydrolyze the phosphatide from both hydratable and non-hydratable phospholipids in crade oils before bleaching and deodorizing.
  • the target enzyme can be applied as a drop-in product in an existing degumming operation, see, e.g., Figure 10.
  • a PLC Degumming Aid process of the invention can eliminate losses in one, or all three, areas noted in Table 2. Losses associated in a PLC process can be estimated to be about 0.8% versus 5.2% on a mass basis due to removal of the phosphatide. Table 2: Losses Addressed by PLC Products
  • Additional potential benefits of this process of the invention include the following: ⁇ Reduced adsorbents - less adsorbents required with lower ( ⁇ 5 ppm) phosphorus ⁇ Lower chemical usage — less chemical and processing costs associated with hydration of non-hydratable phospholipids ⁇ Lower waste generation - less water required to remove phosphoras from oil
  • Oils processed (e.g., "degummed") by the methods of the invention include plant oilseeds, e.g., soybean oil, rapeseed oil, rice bran oil and sunflower oil.
  • the "PLC Caustic Refining Aid" of the invention can save 1.2% over existing caustic refining processes.
  • the refining aid application addresses soy oil that has been degummed for lecithin and these are also excluded from the value/load calculations.
  • Performance targets of the processes of the invention can vary according to the applications and more specifically to the point of enzyme addition, see Table 3. Table 3: Performance Targets by Application
  • a phospholipase Ai can convert non-hydratable native phospholipids to a hydratable form.
  • the enzyme is sensitive to heat. This may be desirable, since heating the oil can destroy the enzyme.
  • the degumming reaction must be adjusted to pH 4-5 and 60°C to accommodate this enzyme. At 300 Units/kg oil saturation dosage, this exemplary process is successful at taking previously water-degummed oil phosphoras content down to ⁇ 10 ppm P. Advantages can be decreased H 2 0 content and resultant savings in usage, handling and waste.
  • Table 4 lists exemplary applications for industrial uses for enzymes of the invention: Table 4: Exemplary Application
  • the phospholipases of the invention can be used in any vegetable oil processing step.
  • phospholipase enzymes of the invention can be used in place of PLA, e.g., phospholipase A2, in any vegetable oil processing step.
  • Oils that are "processed” or “degummed” in the methods of the invention include soybean oils, rapeseed oils, com oils, oil from palm kernels, canola oils, sunflower oils, sesame oils, peanut oils, rice bran oil and the like.
  • the main products from this process include triglycerides.
  • the amount of phospholipase employed is about 10-10,000 units, or, alternatively, about, 100-2,000 units, per 1 kg of crade oil.
  • the enzyme treatment is conducted for 5 min to 10 hours at a temperature of 30°C to 90°C, or, alternatively, about, 40°C to 70°C. The conditions may vary depending on the optimum temperature of the enzyme.
  • the amount of water added to dissolve the enzyme is 5-1,000 wt. parts per 100 wt. parts of crude oil, or, alternatively, about, 10 to 200 wt. parts per 100 wt. parts of crude oil.
  • the enzyme liquid is separated with an appropriate means such as a centrifugal separator and the processed oil is obtained.
  • Phosphorus-containing compounds produced by enzyme decomposition of gummy substances in such a process are practically all fransfened into the aqueous phase and removed from the oil phase.
  • the processed oil can be additionally washed with water or organic or inorganic acid such as, e.g., acetic acid, citric acid, phosphoric acid, succinic acid, and equivalent acids, or with salt solutions.
  • the enzyme is bound to a filter or the enzyme is added to an oil prior to filtration or the enzyme is used to periodically clean filters.
  • a phospholipase-mediated physical refining aid water and enzyme are added to crude oil (e.g., crude vegetable oil).
  • crude oil e.g., crude vegetable oil
  • a PLC or a PLD of the invention and a phosphatase are used in the process.
  • the water level can be low, i.e. 0.5 - 5%> and the process time should be short (less than 2 hours, or, less than 60 minutes, or, less than 30 minutes, or, less than 15 minutes, or, less than 5 minutes).
  • the process can be ran at different temperatures (25°C to 70°C), using different acids and/or caustics, at different pHs (e.g., 3-10).
  • water degumming is performed first to collect lecithin by centrifugation and then PLC or PLC and PLA of the invention is added to remove non- hydratable phospholipids (the process should be performed under low water concenfration).
  • water degumming of crude oil to less than 10 ppm (edible oils) and subsequent physical refining (less than 50 ppm for biodiesel) is performed.
  • an emulsifier is added and/or the crade oil is subjected to an intense mixer to promote mixing.
  • an emulsion-breaker is added and/or the crude oil is heated to promote separation of the aqueous phase.
  • an acid is added to promote hydration of non-hydratable phospholipids.
  • phospholipases can be used to mediate purification of phytosterols from the gum/soapstock.
  • the invention provides compositions and methods (which can comprise use of phospholipases of the invention) for oil degumming comprising using varying amounts of acid and base without making soapstock. Using this aspect of the invention for oil degumming, acid (including phosphoric and/or citric) can be used to hydrate non-hydratable phospholipids in high phosphorus oils (including soybean, canola, and sunflower).
  • the pH of the aqueous phase can be raised using caustic addition: the amount of caustic added can create a favorable pH for enzyme activity but will not result in the formation of a significant soapstock fraction in the oil. Because a soapstock is not formed, the free fatty acids in the oil can be removed downstream, following die degumming step, during bleaching and deodorization. Enzymes of the invention are used to improve oil extraction and oil degumming (e.g., vegetable oils).
  • a PLC of the invention and at least one plant cell waU degrader e.g., a cellulase, a hemicellulase or the like, to soften walls and increase yield at extraction
  • a phospholipase C of the invention as well as other hydrolases (e.g., a cellulase, a hemicellulase, an esterase, a protease and/or a phosphatase) are used during the crashing steps associated with oil production (including but not limited to soybean, canola, sunflower, rice bran oil).
  • the invention provides processes using a phospholipase of the invention (e.g., a phospholipase-specific phosphohydrolase of the invention), or another phospholipase, in a modified "organic refining process," which can comprise addition of the enzyme (e.g., a PLC) in a citric acid holding tank.
  • a phospholipase of the invention e.g., a phospholipase-specific phosphohydrolase of the invention
  • a modified "organic refining process” which can comprise addition of the enzyme (e.g., a PLC) in a citric acid holding tank.
  • the enzymes of the invention can be used in any oil processing method, e.g., degumming or equivalent processes.
  • the enzymes of the invention can be used in processes as described in U.S. Patent Nos. 5,558,781; 5,264,367; 6,001,640.
  • the process described in USPN 5,558,781 uses either phospholipase Al, A2 or B, essentially breaking down lecithin in the oil that behaves as an emulsifier.
  • the enzymes and methods of the invention can be used in processes for the reduction of phosphorus-containing components in edible oils comprising a high amount of non-hydratable phosphoras by using of a phospholipase of the invention, e.g., a polypeptide having a phospholipase A and/or B activity, as described, e.g., in EP Patent Number: EP 0869167.
  • the edible oil is a crude oil, a so-called “non- degummed oil.”
  • the method freat a non-degummed oil, including pressed oils or extracted oils, or a mixture thereof, from, e.g., rapeseed, soybean, sesame, peanut, com, rice bran or sunflower.
  • the phosphatide content in a crude oil can vary from 0.5 to 3% w/w conesponding to a phosphoras content in the range of 200 to 1200 ppm, or, in the range of 250 to 1200 ppm.
  • the crude oil can also contains small concentrations of carbohydrates, sugar compounds and metal/phosphatide acid complexes of Ca, Mg and Fe.
  • the process comprises treatment of a phospholipid or lysophospholipid with the phospholipase of the invention so as to hydrolyze fatty acyl groups.
  • the phospholipid or lysophospholipid comprises lecithin or lysolecithin.
  • the edible oil has a phosphoras content from between about 50 to 250 ppm, and the process comprises treating the oil with a phospholipase of the invention so as to hydrolyze a major part of the phospholipid and separating an aqueous phase containing the hydrolyzed phospholipid from the oil.
  • the oil prior to the enzymatic degumming process the oil is water-degummed.
  • the methods provide for the production of an animal feed comprising mixing the phospholipase of the invention with feed substances and at least one phospholipid.
  • the enzymes and methods of the invention can be used in processes of oil degumming as described, e.g., in WO 98/18912.
  • the phospholipases of the invention can be used to reduce the content of phospholipid in an edible oil.
  • the process can comprise treating the oil with a phospholipase of the invention to hydrolyze a major part of the phospholipid and separating an aqueous phase containing the hydrolyzed phospholipid from the oil. This process is applicable to the purification of any edible oil, which contains a phospholipid, e.g.
  • vegetable oils such as soybean oil, rice bran oil, rapeseed oil and sunflower oil, fish oils, algae and animal oils and the like.
  • the vegetable oil Prior to the enzymatic treatment, the vegetable oil is preferably prefreated to remove slime (mucilage), e.g. by wet refining.
  • the oil can contain between about 50 to 250 ppm, or between 50 to about 1500 ppm, or more, of phosphorus, as phospholipid at the start of the treatment with phospholipase, and the process of the invention can reduce this value to below between about 5 to 10 ppm.
  • the enzymes of the invention can be used in processes as described in JP Application No.: H5-132283, filed April 25, 1993, which comprises a process for the purification of oils and fats comprising a step of converting phospholipids present in the oils and fats into water-soluble substances containing phosphoric acid groups and removing them as water-soluble substances. An enzyme action is used for the conversion into water-soluble substances. An enzyme having a phospholipase C activity is preferably used as the enzyme.
  • the enzymes of the invention can be used in processes as described as the "Organic Refining Process," (ORP) (IPH, Omaha, NE) which is a method of refining seed oils.
  • the quantity of enzyme(s) necessary to be added to oils and fats, according to this process, may range, depending on the enzymes and the products to be processed, from between about 5 to 400 ppm, or between about 20 to 400 ppm; e.g., 0.005 kg to 0.4 kg of enzyme for 1000 kg of oil or fat, and preferably from 5 to 100 ppm, i.e., from 0.005 to 0.1 kg of enzyme for 1000 kg of oil, these values being understood to be for concentrated enzymes, i.e., without diluent or solvent.
  • Palm oil can be pre-treated before treatment with an enzyme of the invention. For example, about 30 kg of raw palm oil is heated to +50°C. 1% solutions were prepared in distilled water with cellulases and pectinases. 600 g of each of these was added to aqueous solutions of the oil under strong agitation for a few minutes. The oil is then kept at +50°C under moderate agitation, for a total reaction time of two hours.
  • the invention provides a process for the reduction of the content process for the reduction of the content of phosphoras-containing components in animal and vegetable oils by enzymatic decomposition using a phospholipase of the invention.
  • predemucilaginated animal and vegetable oil with a phosphoras content of between about of 50 to 1500 ppm, or, between about 50 to 250 ppm is agitated with an organic carboxylic acid and the pH value of the resulting mixture set to between about pH 4 to pH 6, an enzyme solution which contains phospholipase Ai, A 2 , or B of the invention is added to the mixture in a mixing vessel under turbulent stirring and with the formation of fine droplets, where an emulsion with 0.5 to 5 % by weight relative to the oil is formed, said emulsion being conducted through at least one subsequent reaction vessel under turbulent motion during a reaction time of 0.1 to 10 hours at temperatures in the range of 20 to 80° C and where the treated oil, after separation of the aqueous solution, has a phosphorus content under 5 ppm.
  • the organic refining process is applicable to both crade and degummed oil.
  • the process uses inline addition of an organic acid under controlled process conditions, in conjunction with conventional centrifugal separation.
  • the water separated naturally from the vegetable oil phospholipids ('NOP") is recycled and reused.
  • the total water usage can be substantially reduced as a result of the Organic Refining Process.
  • the phospholipases and methods of the invention can also be used in the enzymatic treatment of edible oils, as described, e.g., in U.S. Patent No. 6,162,623. In this exemplary methods, the invention provides an amphiphilic enzyme.
  • the enzyme can be a lipase.
  • the immobilized lipase can be used for reactions catalyzed by lipase such as interesterification of mono-, di- or triglycerides, de- acidification of a triglyceride oil, or removal of phospholipids from a triglyceride oil when the lipase is a phospholipase.
  • the aqueous phase may contain a fermentation liquid, an edible triglyceride oil may be the hydrophobic phase, and carriers include sugars, starch, dextran, water soluble cellulose derivatives and fermentation residues.
  • This exemplary method can be used to process triglycerides, diglycerides, monoglycerides, glycerol, phospholipids, glycolipids or fatty acids, which may be in the hydrophobic phase.
  • the process for the removal of phospholipids from triglyceride oil comprising mixing a triglyceride oil containing phospholipids with a preparation containing a phospholipase of the invention; hydrolyzing the phospholipids to lysophospholipid; separating the hydrolyzed phospholipids from the oil, wherein the phospholipase is an immobilized phospholipase.
  • the phospholipases and methods of the invention can also be used in the enzymatic treatment of edible oils, as described, e.g., in U.S. Patent No. 6,127,137. This exemplary method hydrolyzes both fatty acyl groups in intact phospholipid.
  • the phospholipase of the invention used in this exemplary method has no lipase activity and is active at very low pH. These properties make it very suitable for use in oil degumming, as enzymatic and alkaline hydrolysis (saponification) of the oil can both be suppressed.
  • the invention provides a process for hydrolyzing fatty acyl groups in a phospholipid or lysophospholipid comprising treating the phospholipid or lysophospholipid with the phospholipase that hydrolyzes both fatty acyl groups in a phospholipid and is essentially free of lipase activity.
  • the phosphohpase of the invention has a temperature optimum at about 50°C, measured at pH 3 to pH 4 for 10 minutes, and a pH optimum of about pH 3, measured at 40°C for about 10 minutes.
  • the phospholipid or lysophospholipid comprises lecithin or lysolecithin.
  • an aqueous phase containing the hydrolyzed phospholipid is separated from the oil.
  • the invention provides a process for removing phospholipid from an edible oil, comprising treating the oil at pH 1.5 to 3 with a dispersion of an aqueous solution of the phospholipase of the invention, and separating an aqueous phase containing the hydrolyzed phospholipid from the oil.
  • the oil is freated to remove mucilage prior to the treatment with the phospholipase.
  • the oil prior to the treatment with the phospholipase contains the phospholipid in an amount conesponding to 50 to
  • the treatment with phospholipase is done at 30°C to 45°C for 1 to 12 hours at a phospholipase dosage of 0.1 to 10 mg/1 in the presence of
  • enzymes of the invention are immobilized by preparing an emulsion containing a continuous hydrophobic phase, such as a triglyceride oil, and a dispersed aqueous phase containing an amphiphilic enzyme, such as lipase or a phospholipase of the invention, and carrier material that is partly dissolved and partly undissolved in the aqueous phase, and removing water from the aqueous phase until the phase turns into solid enzyme coated carrier particles.
  • a continuous hydrophobic phase such as a triglyceride oil
  • an amphiphilic enzyme such as lipase or a phospholipase of the invention
  • the undissolved part of the carrier material may be a material that is insoluble in water and oil, or a water soluble material in undissolved form because the aqueous phase is already saturated with the water soluble material.
  • the aqueous phase may be formed with a crade lipase fermentation liquid containing fermentation residues and biomass that can serve as carrier materials.
  • Immobilized lipase is useful for ester re-anangement and de-acidification in oils.
  • the immobilized enzyme can be regenerated for a subsequent reaction by adding water to obtain partial dissolution of the carrier, and with the resultant enzyme and carrier-containing aqueous phase dispersed in a hydrophobic phase evaporating water to again form enzyme coated carrier particles.
  • the phospholipases and methods of the invention can also be used in the enzymatic treatment of edible oils, as described, e.g., in U.S. Patent No. 6,143,545.
  • the method also can comprise contacting an oil at a pH from about pH 5 to 8 with an aqueous solution of a phospholipase A or B of the invention (e.g., PLA1, PLA2, or a PLB), which solution is emulsified in the oil until the phosphorus content of the oil is reduced to less than 11 ppm, and then separating the aqueous phase from the treated oil.
  • a phospholipase A or B of the invention e.g., PLA1, PLA2, or a PLB
  • the phospholipases and methods of the invention can also be used in the enzymatic treatment of edible oils, as described, e.g., in U.S. Patent No. 5,532,163.
  • the invention provides processes for the refining of oil and fat by which phospholipids in the oil and fat to be treated can be decomposed and removed efficiently.
  • the invention provides a process for the refining of oil and fat which comprises reacting, in an emulsion, the oU and fat with an enzyme of the invention, e.g., an enzyme having an activity to decompose glycerol-fatty acid ester bonds in glycerophospholipids (e.g., a PLA2 of the invention); and another process in which the enzyme-treated oil and fat is washed with water or an acidic aqueous solution.
  • the acidic aqueous solution to be used in the washing step is a solution of at least one acid, e.g., citric acid, acetic acid, phosphoric acid and salts thereof.
  • the emulsified condition is formed using 30 weight parts or more of water per 100 weight parts of the oil and fat. Since oil and fat can be purified without employing the conventional aUcali refining step, generation of washing waste water and industrial waste can be reduced. In addition, the recovery yield of oil is improved because loss of neutral oil and fat due to their inclusion in these wastes does not occur in the inventive process.
  • the invention provides a process for refining oil and fat containing about 100 to 10,000 ppm of phospholipids which comprises: reacting, in an emulsified condition, said oil and fat with an enzyme of the invention having activity to decompose glycerol-fatty acid ester bonds in glycerophospholipids.
  • the invention provides processes for refining oil and fat containing about 100 to 10,000 ppm of phospholipids which comprises reacting, in an emulsified condition, oil and fat with an enzyme of the invention having activity to decompose glycerol-fatty acid ester bonds in glycerophospholipids; and subsequently washing the freated oil and fat with a washing water.
  • the phospholipases and methods of the invention can also be used in the enzymatic treatment of edible oils, as described, e.g., in U.S. Patent No. 5,264,367.
  • the content of phosphorus-containing components and the iron content of an edible vegetable or animal oil, such as an oil, e.g., soybean oil, which has been wet-refined to remove mucilage, are reduced by enzymatic decomposition by contacting the oil with an aqueous solution of an enzyme of the invention, e.g., a phospholipase Al, A2, or B, and then separating the aqueous phase from the treated oil.
  • an enzyme of the invention e.g., a phospholipase Al, A2, or B
  • the invention provides an enzymatic method for decreasing the content of phosphoras- and iron-containing components in oils, which have been refined to remove mucilage.
  • An oil which has been refined to remove mucilage, can be treated with an enzyme of the invention, e.g., phospholipase C, Al, A2, or B. Phosphorus contents below 5 ppm and iron contents below 1 ppm can be achieved. The low iron content can be advantageous for the stability of the oil.
  • the phospholipases and methods of the invention can also be used for preparing fransesterified oils, as described, e.g., in U.S. Patent No. 5,288,619.
  • the invention provides methods for enzymatic transesterification for preparing a margarine oil having both low trans- acid and low intermediate chain fatty acid content.
  • the method includes the steps of providing a transesterification reaction mixture containing a stearic acid source material and an edible hquid vegetable oil, transesterifying the stearic acid source material and the vegetable oil using a 1-, 3- positionally specific lipase, and then finally hydrogenating the fatty acid mixture to provide a recycle stearic acid source material for a recyclic reaction with the vegetable oil.
  • the invention also provides a counter- cunent method for preparing a fransesterified oil.
  • the method includes the steps of providing a transesterification reaction zone containing a 1-, 3 -positionally specific lipase, introducing a vegetable oil into the transesterification zone, introducing a stearic acid source material, conducting a supercritical gas or subcritical liquefied gas counter- cunent fluid, carrying out a transesterification reaction of the triglyceride stream with the stearic acid or stearic acid monoester stream in the reaction zone, withdrawing a fransesterified triglyceride margarine oil stream, withdrawing a counter-cunent fluid phase, hydrogenating the fransesterified stearic acid or stearic acid monoester to provide a hydrogenated recycle stearic acid source material, and introducing the hydrogenated recycle stearic acid source material into the reaction zone.
  • the highly unsaturated phospholipid compound may be converted into a triglyceride by appropriate use of a phospholipase C of the invention to I remove the phosphate group in the sn-3 position, followed by 1,3 lipase acyl ester synthesis.
  • the 2-substituted phospholipid may be used as a functional food ingredient directly, or may be subsequently selectively hydrolyzed in reactor 160 using an immobilized phospholipase C of the invention to produce a 1- diglyceride, followed by . enzymatic esterification as described herein to produce a triglyceride product having a 2- substituted polyunsaturated fatty acid component.
  • the phospholipases and methods of the invention can also be used in a vegetable oil enzymatic degumming process as described, e.g., in U.S. Patent No. 6,001,640.
  • This method of the invention comprises a degumming step in the production of edible oils. Vegetable oils from which hydratable phosphatides have been eliminated by a previous aqueous degurmning process are freed from non- hydratable phosphatides by enzymatic treatment using a phospholipase of the invention.
  • the process can be gentle, economical and environment-friendly.
  • Phospholipases that only hydrolyze lysolecithin, but not lecithin, are used in this degumming process.
  • the aqueous phase containing the enzyme can also be finely dispersed by means of ultrasound action.
  • a dispersion apparatus can be used.
  • the enzymatic reaction probably takes place at the border surface between the oil phase and the aqueous phase. It is the goal of all these measures for mixing to create the greatest possible surface for the aqueous phase which contains the enzyme.
  • the addition of surfactants increases the microdispersion of the aqueous phase. In some cases, therefore, surfactants with HLB values above 9, such as Na-dodecyl sulfate, are added to the enzyme solution, as described, e.g., in EP-A 0 513 709. A similar effective method for improving emulsification is the addition of lysolecithin.
  • the amounts added can lie in the range of 0.001%> to 1%>, with reference to the oil.
  • the temperature during enzyme treatment is not critical. Temperatures between 20°C and 80°C can be used, but the latter can only be applied for a short time. In this aspect, a phosphohpase of the invention having a good temperature and/or low pH tolerance is used. Application temperatures of between 30°C and 50°C are optimal.
  • the treatment period depends on the temperature and can be kept shorter with an increasing temperature. Times of 0.1 to 10 hours, or, 1 to 5 hours are generally sufficient.
  • the reaction takes place in a degumming reactor, which can be divided into stages, as described, e.g., in DE-A 43 39 556. Therefore continuous operation is possible, along with batch operation.
  • the reaction can be carried out in different temperature stages. For example, incubation can take place for 3 hours at 40°C, then for 1 hour at 60°C. If the reaction proceeds in stages, this also opens up the possibility of adjusting different pH values in tire individual stages. For example, in the first stage the pH of the solution can be adjusted to 7, for example, and in a second stage to 2.5, by adding citric acid. In at least one stage, however, the pH of the enzyme solution must be below 4, or, below 3. If the pH was subsequently adjusted below this level, a deterioration of effect may be found. Therefore the citric acid can be added to the enzyme solution before the latter is mixed into the oil.
  • the enzyme solution After completion of the enzyme treatment, the enzyme solution, together with the decomposition products of the NHP contained in it, can be separated from the oil phase, in batches or continuously, e.g., by means of centrifugation. Since the enzymes are characterized by a high level of stability and the amount of the decomposition products contained in the solution is slight (they may precipitate as sludge) the same aqueous enzyme phase can be used several times. There is also the possibility of freeing the enzyme of the sludge, see, e.g., DE-A 43 39 556, so that an enzyme solution which is essentially free of sludge can be used again. In one aspect of this degumming process, oils which contain less than 15 ppm phosphoras are obtained.
  • One goal is phosphoras contents of less than 10 ppm; or, less than 5 ppm. With phosphoras contents below 10 ppm, further processing of the oil according to the process of distiUative de-acidification is easily possible. A number of other ions, such as magnesium, calcium, zinc, as well as iron, can be removed from the oU, e.g., below 0.1 ppm. Thus, this product possesses ideal prerequisites for good oxidation resistance during further processing and storage.
  • the phospholipases and methods of the invention also can also be used for reducing the amount of phosphorus-containing components in vegetable and animal oils as described, e.g., in EP patent EP 0513709.
  • the content of phosphorus- containing components, especially phosphatides, such as lecithin, and the iron content in vegetable and animal oils, which have previously been deslimed, e.g. soya oil, are reduced by enzymatic breakdown using a phospholipase Al, A2 or B of the invention.
  • the phospholipases and methods of the invention can also be used for refining fat or oils as described, e.g., in JP 06306386.
  • the invention provides processes for refining a fat or oil comprising a step of converting a phospholipid in a fat or an oil into a water-soluble phosphoric-group-containing substance and removing this substance.
  • an enzyme of the invention e.g., a PLC
  • a PLC phospholipase C activity
  • the phospholipase C of the invention has an activity that cuts ester bonds of glycerin and phosphoric acid in phospholipids.
  • the method can comprise washing the enzyme-treated oil with water or an acidic aqueous solution.
  • the enzyme of the invention is added to and reacted with the crade oil.
  • the amount of phospholipase C employed can be 10 to 10,000 units, or, about 100 to 2,000 units, per 1 kg of crade oil.
  • the phospholipases and methods of the invention can also be used for water-degumming processes as described, e.g., in Dijkstra, Albert J., et al., Oleagineux, Co ⁇ s Gras, Lipides (1998), 5(5), 367-370.
  • the water- degumming process is used for the production of lecithin and for dry degumming processes using a degumming acid and bleaching earth.
  • This method may be economically feasible only for oils with a low phosphatide content, e.g., palm oil, lauric oils, etc.
  • the acid refining process is used, whereby this process is carried out at the oil mill to allow gum disposal via the meal.
  • this acid refined oil is a possible "polishing" operation to be carried out prior to physical refining.
  • the phospholipases and methods of the invention can also be used for degumming processes as described, e.g., in Dijkstra, et al., Res. Dev. Dep., N.V. Vandemoortele Coord. Cent., Izegem, Belg. JAOCS, J. Am. Oil Chem. Soc. (1989), 66: 1002-1009.
  • the total degumming process involves dispersing an acid such as H 3 P0 4 or citric acid into soybean oil, allowing a contact time, and then mixing a base such as caustic soda or Na silicate into the acid-in-oil emulsion. This keeps the degree of neutralization low enough to avoid forming soaps, because that would lead to increased oil loss. Subsequently, the oil passed to a centrifugal separator where most of the gums are removed from the oil stream to yield a gum phase with minimal oil content. The oil stream is then passed to a second centrifugal separator to remove all remaining gums to yield a dilute gum phase, which is recycled. Washing and drying or in-line alkali refining complete the process.
  • an acid such as H 3 P0 4 or citric acid
  • a base such as caustic soda or Na silicate
  • the totally degummed oil can be subsequently alkali refined, bleached and deodorized, or bleached and physically refined.
  • the phospholipases and methods of the invention can also be used for the removal of nonhydratable phospholipids from a plant oil, e.g., soybean oil, as described, e.g., in Hvolby, et al., Sojakagefabr., Copenhagen, Den., J. Amer. Oil Chem. Soc. (1971) 48:503-509.
  • water-degummed oil is mixed at different fixed pH values with buffer solutions with and without Ca " * " " , Mg/Ca-binding reagents, and surfactants.
  • the nonhydratable phospholipids can be removed in a nonconverted state as a component of micelles or of mixed emulsifiers.
  • the nonhydratable phospholipids are removable by conversion into dissociated forms, e.g., by removal of Mg and Ca from the phosphatidates, which can be accomplished by acidulation or by treatment with Mg/Ca-complexing or Mg/Ca-precipitating reagents.
  • Nonhydratable phospholipids can result in reduced emulsion formation and in improved separation of the deacidified oil from the emulsion layer and the soapstock.
  • the phospholipases and methods of the invention can also be used for the degumming of vegetable oils as described, e.g., Buchold, et al., Frankfurt/Main, Germany. Fettmaschine Technologie (1993), 95(8), 300-304.
  • aqueous suspensions of an enzyme of the invention e.g., phospholipase A2
  • an enzyme of the invention e.g., phospholipase A2
  • hydrolyzes the fatty acid bound at the sn2 position of the phospholipid resulting in 1-acyl-lysophospholipids which are insoluble in oil and thus more amenable to physical separation.
  • Even the addition of small amounts conesponding to about 700 lecitase units/kg oil results in a residual P concenfration of less than 10 ppm, so that chemical refining is replaceable by physical refining, eliminating the necessity for damralization, soapstock splitting, and wastewater treatment.
  • the phospholipases and methods of the invention can also be used for the degumming of vegetable oils as described, e.g., by EnzyMax, Dahlke, Klaus, Dept. G- PDO, Lurgi Ol-Gas, Chemie, GmbH, Frankfurt, Germany. Oleagineux, Co ⁇ s Gras, Lipides (1997), 4(1), 55-57.
  • This exemplary process is a degumming process for the physical refining of almost any kind of oil.
  • phosphatides are converted to water-soluble lysophosphatides which are separated from the oil by centrifugation.
  • the residual phosphoras content in the enzymatically degummed oil can be as low as 2 ppm P.
  • the phospholipases and methods of the invention can also be used for the degumming of vegetable oils as described, e.g., by Cleenewerck, et al., N.V. Vamo Mills, Izegem, Belg. Fettmaschine Technologie (1992), 94:317-22; and, Clausen, Kim; Nielsen, Munk. Novozymes A/S, Den. Dansk Kemi (2002) 83(2):24-27.
  • the phospholipases and methods of the invention can inco ⁇ orate the pre-refining of vegetable oils with acids as described, e.g., by Nilsson- Johansson, et al., Fats Oils Div., Alfa-Laval Food Eng.
  • the phospholipases and methods of the invention can also be used for the degumming of vegetable oils as described, e.g., by Jerzewska, et al., Inst. Przemyslu Miesnego i Tluszczowego, Warsaw, Pol., Tluszcze Jadalne (2001), 36(3/4), 97-110.
  • enzymatic degumming of hydrated low-eracrc acid rapeseed oil is by use of a phospholipase A2 of the invention.
  • the enzyme can catalyze the hydrolysis of fatty acid ester linkages to the central carbon atom of the glycerol moiety in phospholipids. It can hydrolyze non-hydratable phospholipids to their conesponding hydratable lyso- compounds. With a nonpurified enzyme preparation, better results can be achieved with the addition of 2% preparation for 4 hours (87%> P removal).
  • an acidic polymer e.g., an alginate or pectin
  • an acidic polymer e.g. alginic acid or pectin or a more soluble salt form
  • the acidic polymers can reduce and/or disrupt phospholipid-metal complexes by binding calcium and/or magnesium in the crude oil, thereby improving the solubility of nonhydratable phospholipids.
  • these phospholipids will move to the oil/water interface or enter the aqueous phase and either be converted to diacylglycerol and the conesponding side chain or the intact phospholipid will be removed by subsequent centrifugation as a component of the heavy phase.
  • the presence of the acidic polymer in the aqueous phase can also increase the density of the aqueous phase and result in an improved separation of the heavy phase from the oil (light) phase.
  • One exemplary process of the invention for oil degumming alters the deodorization procedure to get a diacylglycerol (DAG) fraction.
  • DAG diacylglycerol
  • the deodorization conditions can be modified with the goal of improving the separation of the free fatty acids (FFA) from the diacylglycerol/triacylglycerol fraction or further modified to separate the diacylglycerol from the triacylglycerol fraction.
  • FFA free fatty acids
  • the invention provides methods for refining vegetable oils (e.g., soybean oil, com oil, cottonseed oil, palm oil, peanut oil, rapeseed oil, safflower oil, sunflower seed oil, sesame seed oil, rice bran oil, coconut oil or canola oil) and their byproducts, and processes for deodorizing lecithin, for example, as described in U.S. Patent No. 6,172,248, or 6,172,247, wherein the methods comprise use of at least one enzyme of the invention, e.g., a phospholipase C of the invention.
  • the invention provides lecithin and vegetable oils comprising at least one enzyme of the invention.
  • Crade or degummed vegetable oil can be supplied from a storage tank (e.g., through a pump) and can be heated.
  • the vegetable oil to be purified can be either crade or "degummed” oil.
  • phosphatidylinositol-PLC (PI-PLC) enzymes of the invention are used for vegetable oil degumming.
  • PI-PLC enzymes of the invention can be used alone or in combination with other enzymes (for instance PLC, PLD, phosphatase enzymes of the invention) to improve oil yield during the degumming of vegetable oils (including soybean, canola, and sunflower).
  • Enzymatic processing of oilseeds The invention provides compositions (e.g., enzymes) and methods for enzymatic processing of oilseeds, including soybean, canola, coconut, avocado and olive paste. In one aspect, these processes of the invention can increase the oil yield and to improve the nutritional quality of the obtained meals. In some aspects, enzymatic processing of oilseeds using the enzymes and methods of the invention will provide economical and environmental benefits, as well as alternative technologies for oil exfraction and processing food for human and animal consumption.
  • compositions e.g., enzymes
  • methods for enzymatic processing of oilseeds including soybean, canola, coconut, avocado and olive paste.
  • these processes of the invention can increase the oil yield and to improve the nutritional quality of the obtained meals.
  • enzymatic processing of oilseeds using the enzymes and methods of the invention will provide economical and environmental benefits, as well as alternative technologies for oil exfraction and processing food for human and animal consumption.
  • the processes of the invention comprise use of phospholipases of the invention, other phospholipases, proteases, phosphatases, phytases, xylanases, amylases (e.g., ⁇ - amylases), glucanases (e.g., ⁇ -glucanases), polygalacturonases, galactolipases, cellulases, hemicellulases, pectinases and other plant cell waU degrading enzymes, as well as mixed enzyme preparations and cell lysates.
  • phospholipases of the invention other phospholipases, proteases, phosphatases, phytases, xylanases, amylases (e.g., ⁇ - amylases), glucanases (e.g., ⁇ -glucanases), polygalacturonases, galactolipases, cellulases, hemicellulases, pectinases and
  • the processes of the invention can be practiced in conjunction with other processes, e.g., enzymatic treatments, e.g., with carbohydrases, including cellulase, hemicellulase and other side degrading activities, or, chemical processes, e.g., hexane exfraction of soybean oil.
  • the enzymatic treatment can increase the oil extractability by 8-10% when the enzymatic treatment is carried out prior to the solvent extraction.
  • the processes of the invention can be practiced with aqueous extraction processes.
  • the aqueous extraction methods can be environmentally cleaner alternative technologies for oil extraction.
  • Low exfraction yields of aqueous process can be overcome by using enzymes that hydrolyze the stractural polysaccharides forming the cell wall of oilseeds, or that hydrolyze the proteins which form the cell and lipid body membranes, e.g., utilizing digestions comprising cellulase, hemicellulase, and/or protopectinase for extraction of oil from soybean cells.
  • enzymes that hydrolyze the stractural polysaccharides forming the cell wall of oilseeds, or that hydrolyze the proteins which form the cell and lipid body membranes, e.g., utilizing digestions comprising cellulase, hemicellulase, and/or protopectinase for extraction of oil from soybean cells.
  • methods are practiced with an enzyme of the invention as described by Kasai (2003) J. Agric. Food Chem. 51:6217-6222, who reported that the most effective enzyme to digest the cell wall was cellulase.
  • the methods of the invention further comprise inco ⁇ oration of various enzymatic treatments in the treatment of seeds, e.g., canola seeds, these treatments comprising use of proteases, cellulases, and hemicellulases (in various combinations with each other and with one or more enzymes of the invention).
  • the methods can comprise enzymatic treatments of canola seeds at 20 to 40 moisture during the incubation with enzymes prior to a conventional process; as described, e.g., by Sosulski (1990) Proc. Can. Inst. Food Sci. Technol. 3:656.
  • the methods of the invention can further comprise inco ⁇ oration of proteases, ⁇ -amylases, polygalacturonases (in various combinations with each other and with one or more enzymes of the hivention) to hydrolyze ceUular material in coconut meal and release the coconut oil, which can be recovered by centrifugation, as described, e.g., by McGlone (1986) J. of Food Sci. 51:695-697.
  • the methods of the invention can further comprise inco ⁇ oration of pectinases, ⁇ -amylases, proteases, cellulases in different combinations (with each other and with one or more enzymes of the invention) to result in significant yield improvement (-70%) in the best case) during enzymatic extraction of avocado oil, as described, e.g., by Buenrostro (1986) Biotech. Letters 8(7):505-506.
  • olive paste is freated with cellulase, hemicellulase, poligalacturonase, pectin-methyltransferase, protease and their combinations (with each other and with one or more enzymes of the invention), as described, e.g., by Montedoro (1976) Acta Vitamin. Enzymol. (Milano) 30:13.
  • Purification of phytosterols from vegetable oils The invention provides methods for purification of phytosterols and trite ⁇ enes, or plant sterols, from vegetable oils.
  • Phytosterols that can be purified using phospholipases and methods of the invention include ⁇ -sitosterol, campesterol, stigmasterol, stigmastanol, ⁇ -sitostanol, sitostanol, desmosterol, chalinasterol, poriferasterol, clionasterol and brassicasterol.
  • Plant sterols are important agricultural products for health and nutritional industries.
  • phospholipases and methods of the invention are used to make emulsifiers for cosmetic manufacturers and steroidal intermediates and precursors for the production of hormone phannaceuticals.
  • Phospholipases and methods of the invention are used to make (e.g., purify) analogs of phytosterols and their esters for use as cholesterol-lowering agents with cardiologic health benefits.
  • Phospholipases and methods of the invention are used to purify plant sterols to reduce serum cholesterol levels by inhibiting cholesterol abso ⁇ tion in the intestinal lumen.
  • Phospholipases and methods of the invention are used to purify plant sterols tiiat have immunomodulating properties at extremely low concentrations, including enhanced cellular response of T lymphocytes and cytotoxic ability of natural killer cells against a cancer cell line.
  • Phospholipases and methods of the hivention are used to purify plant sterols for the treatment of pulmonary tuberculosis, rheumatoid arthritis, management of HIV-infested patients and inhibition of immune stress, e.g., in marathon runners.
  • Phospholipases and methods of the invention are used to purify sterol components present in the sterol fractions of commodity vegetable oils (e.g., coconut, canola, cocoa butter, corn, cottonseed, linseed, olive, palm, peanut, rice bran, safflower, sesame, soybean, sunflower oils), such as sitosterol (40.2-92.3 %), campesterol (2.6-38.6 %), stigmasterol (0-31 %) and 5-avenasterol (1.5 -29 %).
  • commodity vegetable oils e.g., coconut, canola, cocoa butter, corn, cottonseed, linseed, olive, palm, peanut, rice bran, safflower, sesame, soybean, sunflower oils
  • Methods of the invention can inco ⁇ orate isolation of plant-derived sterols in oil seeds by solvent extraction with chloroform-methanol, hexane, methylene chloride, or acetone, followed by saponification and chromatographic purification for obtaining enriched total sterols.
  • the plant samples can be extracted by supercritical fluid extraction with supercritical carbon dioxide to obtain total lipid extracts from which sterols can be enriched and isolated.
  • the crade isolate can be purified and separated by a wide variety of chromatographic techniques including column chromatography (CC), gas chromatography, thin-layer chromatography (TLC), normal phase high-performance liquid chromatography (HPLC), reversed-phase HPLC and capillary electrochromatography.
  • CC and TLC procedures employ the most accessible, affordable and suitable for sample clean up, purification, qualitative assays and preliminary estimates of the sterols in test samples.
  • Phytosterols are lost in the vegetable oils lost as byproducts during edible oil refining processes.
  • Phospholipases and methods of the invention use phytosterols isolated from such byproducts to make phytosterol-enriched products isolated from such byproducts.
  • Phytosterol isolation and purification methods of the invention can inco ⁇ orate oil processing industry byproducts and can comprise operations such as molecular distillation, liquid-liquid extraction and crystallization.
  • Methods of the invention can inco ⁇ orate processes for the extraction of lipids to extract phytosterols.
  • methods of the invention can use nonpolar solvents as hexane (commonly used to extract most types of vegetable oils) quantitatively to extract free phytosterols and phytosteryl fatty-acid esters.
  • Steryl glycosides and fatty- acylated steryl glycosides are only partially exfracted with hexane, and increasing polarity of the solvent gave higher percentage of extraction.
  • One procedure that can be used is the Bligh and Dyer chloroform-methanol method for extraction of all sterol lipid classes, including phospholipids.
  • One exemplary method to both qualitatively separate and quantitatively analyze phytosterol lipid classes comprises injection of the lipid extract into HPLC system.
  • Phospholipases and methods of the invention can be used to remove sterols from fats and oils, as described, e.g., in U.S. Patent No. 6,303,803. This is a method for reducing sterol content of sterol-containing fats and oils.
  • the sterol-reduced fat or oil is separated from the aqueous separation mixture.
  • the conespondingly sterol-enriched fraction also may be isolated from the aqueous separation mixture.
  • These steps can be performed at ambient temperatures, costs involved in heating are minimized, as is the possibility of thermal degradation of the product. Additionally, a minimal amount of equipment is required, and since all required materials are food grade, the methods require no special precautions regarding handling, waste disposal, or contamination of the final product(s).
  • Phospholipases and methods of the invention can be used to remove sterols from fats and oils, as described, e.g., in U.S. Patent No. 5,880,300.
  • Phospholipid aggregates are contacted with, for example, a sterol-containing fat or oil in an aqueous environment and then mixed. Following adequate mixing, the sterol-reduced fat or oil is separated from the aqueous separation mixture. Alternatively, the conespondingly sterol- enriched phospholipid also may be isolated from the aqueous separation mixture.
  • Plant (e.g., vegetable) oils contain plant sterols (phytosterols) that also may be removed using the methods of the present invention. This method is applicable to a fat/oil product at any stage of a commercial processing cycle.
  • a sterol- containing distillate fraction from, for example, an intermediate stage of processing can be subjected to the sterol-extraction procedures described above.
  • This provides a sterol- enriched lecithin or other phospholipid material that can be further processed in order to recover the extracted sterols.
  • Detergent Compositions The invention provides detergent compositions comprising one or more phospholipase of the invention, and methods of making and using these compositions.
  • the invention inco ⁇ orates all methods of making and using detergent compositions, see, e.g., U.S. Patent No. 6,413,928; 6,399,561; 6,365,561; 6,380,147.
  • the detergent compositions can be a one and two part aqueous composition, a non-aqueous liquid composition, a cast solid, a granular form, a particulate form, a compressed tablet, a gel and/or a paste and a slurry form.
  • the invention also provides methods capable of a rapid removal of gross food soils, films of food residue and other minor food compositions using these detergent compositions.
  • Phospholipases of the invention can facilitate the removal of stains by means of catalytic hydrolysis of phospholipids.
  • Phospholipases of the invention can be used in dishwashing detergents in textile laundering detergents.
  • the actual active enzyme content depends upon the method of manufacture of a detergent composition and is not critical, assuming the detergent solution has the desired enzymatic activity.
  • the amount of phospholipase present in the final solution ranges from about 0.001 mg to 0.5 mg per gram of the detergent composition.
  • the particular enzyme chosen for use in the process and products of this invention depends upon the conditions of final utility, including the physical product form, use pH, use temperature, and soil types to be degraded or altered. The enzyme can be chosen to provide optimum activity and stability for any given set of utility conditions.
  • the polypeptides of the present invention are active in the pH ranges of from about 4 to about 12 and in the temperature range of from about 20°C to about 95°C.
  • the detergents of the invention can comprise cationic, semi-polar nonionic or zwitterionic surfactants; or, mixtures thereof.
  • Phospholipases of the present invention can be formulated into powdered and liquid detergents having pH between 4.0 and 12.0 at levels of about 0.01 to about 5% (preferably 0.1% to 0.5%) by weight.
  • These detergent compositions can also include other enzymes such as known proteases, cellulases, lipases or endoglycosidases, as well as builders and stabilizers.
  • the addition of phospholipases of the invention to conventional cleaning compositions does not create any special use limitation. In other words, any temperature and pH suitable for the detergent is also suitable for the present compositions as long as the pH is within the above range, and the temperature is below the described enzyme's denaturing temperature.
  • the polypeptides of the invention can be used in a cleaning composition without detergents, again either alone or in combination with builders and stabilizers.
  • the present invention provides cleaning or disinfecting compositions including detergent and/or disinfecting compositions for cleaning and or disinfecting hard surfaces, detergent compositions for cleaning and/or disinfecting fabrics, dishwashing compositions, oral cleaning compositions, denture cleaning compositions, and/or contact lens cleaning solutions.
  • the invention provides a method for washing an object comprising contacting the object with a phospholipase of the invention under conditions sufficient for washing.
  • a phospholipase of the invention may be included as a detergent additive.
  • the detergent composition of the invention may, for example, be formulated as a hand or machine laundry detergent composition comprising a phospholipase of the invention.
  • a laundry additive suitable for pre-treatment of stained fabrics can comprise a phospholipase of the invention.
  • a fabric softener composition can comprise a phospholipase of the invention.
  • a phospholipase of the invention can be formulated as a detergent composition for use in general household hard surface cleaning operations.
  • detergent additives and detergent compositions of the invention may comprise one or more other enzymes such as a protease, a lipase, a cutinase, another phospholipase, a carbohydrase, a cellulase, a pectinase, a mannanase, an arabinase, a galactanase, a xylanase, an oxidase, e.g., a lactase, and/or a peroxidase.
  • the properties of the enzyme(s) of the invention are chosen to be compatible with the selected detergent (i.e.
  • phospholipase enzymes of the invention are used to remove malodorous materials from fabrics.
  • Various detergent compositions and methods for making them that can be used in practicing the invention are described in, e.g., U.S. Patent Nos. 6,333,301; 6,329,333; 6,326,341; 6,297,038; 6,309,871; 6,204,232; 6,197,070; 5,856,164.
  • Waste treatment The phospholipases of the invention can be used in waste treatment.
  • the invention provides a solid waste digestion process using phospholipases of the invention.
  • the methods can comprise reducing the mass and volume of substantially untreated solid waste.
  • Solid waste can be freated with an enzymatic digestive process in the presence of an enzymatic solution (including phospholipases of the invention) at a controlled temperature.
  • the solid waste can be converted into a liquefied waste and any residual solid waste.
  • the resulting liquefied waste can be separated from said any residual solidified waste. See e.g., U.S. Patent No. 5,709,796.
  • the phospholipases can be used in detoxification processes, e.g., for the detoxification of endotoxins, e.g., compositions comprising lipopolysaccharides (LPS), and, the invention provides detoxification processes using at least one enzyme of the invention, e.g., a patatin having a sequence as set forth in SEQ ID NO: 12 (encoded by SEQ ID NO: 11), SEQ ID NO: 14 (encoded by SEQ ID NO: 13), SEQ ID NO: 18 (encoded by SEQ ID NO: 17), SEQ ID NO:26 (encoded by SEQ ID NO:25), SEQ ID NO:28 (encoded by SEQ ID NO:27), SEQ ID NO:34 (encoded by SEQ ID NO:33), SEQ ID NO:36 (encoded by SEQ ID NO:35), SEQ ID NO:44 (encoded by SEQ ID NO:43), SEQ ID NO: 12 (encoded by SEQ ID NO: 11), SEQ ID NO:
  • a phospholipase of the invention is used to detoxify a lipopolysaccharide (LPS). In one aspect, this detoxification is by deacylation of 2' and/or 3' fatty acid chains from lipid A.
  • a phospholipase e.g., a PLC, a patatin
  • a phospholipase of the invention is used to hydrolyze a 2 '-lauroyl and/or a 3'-myristoyl chain from a lipid, e.g., a lipid A (e.g., from a bacterial endotoxin).
  • the process of the invention is used to destroy an endotoxin, e.g., a toxin from a gram negative bacteria, as from E. coli.
  • an endotoxin e.g., a toxin from a gram negative bacteria, as from E. coli.
  • a phospholipase e.g., a PLC, a patatin
  • the process of the invention is used to destroy an endotoxin, e.g., a toxin from a gram negative bacteria, as from E. coli.
  • a phospholipase e.g., a PLC, a patatin
  • toxin poisoning e.g., from an on-going gram negative infection
  • prophylactically to prevent the effects of endotoxin during an infection e.g., an infection in an animal or a human.
  • the invention provides a pharmaceutical composition
  • a phospholipase e.g., a PLC, a patatin
  • a hydrolase of the invention for the amelioration or prevention of lipopolysaccharide (LPS) toxic effects, e.g., during sepsis.
  • Processing foods can be used to process foods, e.g., to change their stability, shelf-life, flavor, texture, improve on their nutritional status, and the like.
  • phospholipases of the invention are used to generate acidic phospholipids for controlling bitter taste in foods.
  • the invention provides cheese-making processes using phospholipases of the invention (and, thus, the invention also provides cheeses comprising phospholipases of the invention).
  • the enzymes of the invention e.g., phospholipase A, lysophospholipase or a combination thereof
  • the enzymes of the invention are used to process cheeses for flavor enhancement, to increase yield and/ or for "stabilizing" cheeses, e.g., by reducing the tendency for "oil-off," or, in one aspect, the enzymes of the invention are used to produce cheese from cheese milk.
  • These processes of the invention can inco ⁇ orate any method or protocol, e.g., as described, e.g., in U.S. Patent Nos.
  • the phospholipases of the invention are used to stabilize fat emulsion in milk or milk- comprising compositions, e.g. cream, and are used to stabilize milk compositions, e.g. for the manufacturing of creams or cream liquors.
  • the invention provides a process for enhancing the favor of a cheese using at least one enzyme of the invention, the process comprising incubating a protein, a fat and a protease and a lipase in an aqueous medium under conditions that produce an enhanced cheese flavor (e.g., reduced bitterness), e.g., as described in WO 99/66805.
  • phospholipases of the invention are used to enhance flavor in a cheese (e.g., a curd) by mixing with water, a protease, and a lipase (of the invention) at an elevated temperature, e.g., between about 75°C to 95°C, as described, e.g., in U.S. Patent No. 4,752,483.
  • a protease also can be used in any of these processes of the invention, see, e.g., Brindisi (2001) J. of Food Sci. 66:1100-1107.
  • a combination of esterases, lipases, phospholipases and/or proteases can be used in these or any process of the invention.
  • a phospholipase of the invention is used to reduce the content of phosphoras components in a food, e.g., an oil, such as a vegetable oil having a high non-hydratable phosphorus content, e.g., as described in WO 98/26057.
  • the phospholipases of the invention can also be used to study the phosphoinositide (PI) signaling system; in the diagnosis, prognosis and development of treatments for bipolar disorders (see, e.g., Pandey (2002) Neuropsychopharmacology 26:216-228); as antioxidants; as modified phospholipids; as foaming and gelation agents; to generate angiogenic lipids for vascularizing tissues; to identify phospholipase, e.g., PLA, PLB, PLC, PLD and/or patatin modulators (agonists or antagonists), e.g., inhibitors for use as anti-neoplasties, anti-inflammatory and as analgesic agents.
  • PI phosphoinositide
  • the phospholipases of the invention for example PLA and PLC enzymes, are used to generate immunotoxins and various therapeutics for anti-cancer treatments.
  • the phospholipases of the invention can be used in conjunction with other enzymes for decoloring (i.e.
  • a PLD and a phosphatase may be used in combination, to produce the same result as a PLC alone.
  • PA/PI specific enzymes e.g. Degumming process
  • PA/PI specific enzymes e.g.
  • Small scale degumming assay embodiment Use of other enzymes to reduce gum mass (e.g., PYROLASETM enzyme, chlorophyllase, peroxidase, lipase, laccase, mannanase, protease, lactase, Degumming process alternative amylase, etc. or combinations thereof) embodiment Use of compound to better facilitate Degumming process alternative oil/gum separation embodiment Degumming process alternative
  • hydrophobic delivery system for DAG production, possibly for altering PLC (liposomes, hydrated enzyme in substrate specificity or directing product refined oil droplets) formation towards the 1,3-DAG type
  • This invention provides methods comprising use of recombinant technology to make and expressing enzymes or other proteins with biological activity, e.g., noxious or toxic enzymes, (wherein the enzymes or other proteins are not normally glycosylated) in an inactive or less active, but re-activatable, form.
  • biological activity e.g., noxious or toxic enzymes
  • these methods comprise using any deglycosylating enzyme or set of enzymes, many of which can have been identified and/or are commerciaUy available.
  • the endoglycosidase H enzyme cleaves at the last NGlucNac leaving one NClucNac still attached to the N residue.
  • the PNGaseF enzyme cleaves off all of the sugars and converts the amino side chain of the N residue into a hydroxyl group resulting in the N amino acid becoming an aspartate (D) amino acid in the enzyme.
  • the methods comprise using endoglycosidase H and/or PNGaseF or equivalent enzymes in vivo or in vitro to re-activate partially or completely the engineered "temporarily inactivated” proteins.
  • the method comprises targeting the enzymes or other polypeptides to the host secretory pathway so that the enzymes will be glycosylated.
  • the new glycosylation sites are designed such that glycosylation inactivates the enzyme or modifies its activity, e.g., decreases it activity or other otherwise modifies activity, such as blocks a substrate binding site.
  • the enzyme is inactive or less active, noxious or toxic enzymes could be expressed at higher levels since the negative effects of their activity are no longer a limitation to how much of the protein can accumulate in the host cells.
  • the inactive, glycosylated enzyme can be re-activated (partially or completely) by removing the sugars, e.g., using commercially available deglycosylating enzymes, for example, by removing the sugars in vitro, or removing the sugars in vivo using whole cell engineering approaches.
  • a eukaryotic glycosylation target site such as ?NXS/T is added to any protein, for example, an enzyme of the invention.
  • the invention provides methods for the production of enzymes that normally are too noxious or toxic to be tolerated in large amounts by a host cell. The effect can temporary as it is possible to regenerate the active enzyme (by deglycosylation, e.g., by post-translational modification/ deglycosylation) for future work requiring an active enzyme.
  • the invention provides methods for making and expressing a protein having a biological activity whose activity is temporarily inactivated by glycosylation comprising: (a) providing a nucleic acid encoding a protein having a biological activity, wherein the protein is not naturally glycosylated; (b) inserting at least one glycosylation motif coding sequence into the protein-encoding nucleic acid, wherein the glycosylated form of the protein is inactive; (c) inserting a targeting sequence into the protein such that it is directed to a host cell's secretory pathway, wherein the host cell is capable of recognizing the glycosylation motif and glycosylating the protein; and (d) expressing the modified nucleic acid in the host cell.
  • EXAMPLE 1 BLAST PROGRAM USED FOR SEQUENCE IDENTIFY PROFILING This example describes an exemplary sequence identity program to determine if a nucleic acid is within the scope of the invention.
  • An NCBI BLAST 2.2.2 program is used, default options to blastp. All default values were used except for the default filtering setting (i.e., all parameters set to default except filtering which is set to
  • EXAMPLE 2 SIMULATION OF PLC MEDIATED DEGUMMING This example describes the simulation of phospholipase C (PLC)-mediated degumming. Due to its poor solubility in water phosphatidylcholine (PC) was originally dissolved in ethanol (100 mg/ml). For initial testing, a stock solution of PC in 50 mM 3- mo ⁇ holinopropanesulpholic acid or 60 mM citric acid/NaOH at pH 6 was prepared. The PC stock solution (lO ⁇ l, l ⁇ g/ ⁇ l) was added to 500 ⁇ l of refined soybean oil (2% water) in an Eppendorf tube. To generate an emulsion the content of the tube was mixed for 3 min by vortexing (see Fig. 5A).
  • PC phospholipase C
  • genes may exist on one plasmid, multiple plasmids, or the genes may be inserted into the genome of the expression host by homologous recombination.
  • the genes may be introduced into a single site in the host genome as a DNA expression cassette that contains one or more copies of both genes.
  • one or more copies of each gene may be introduced into distinct sites in the host chromosome.
  • the expression of these two gene sequences could be driven by one type of promoter or each gene sequence may be driven by an independent promoter. Depending on the number of copies of each gene and the type of promoter, the final sfrain will express varying ratios of each active enzyme type.
  • mutants having improved expression in a glycosylating host and altered resistance to secreted proteases.
  • the I elimination of the glycosylation sites was effected as indicated below: amino acid positions amino acid 63, amino acid 131, and amino acid 134, of the phospholipase C enzyme of the invention having an amino acid sequence as set forth in SEQ ID NO:2, encoded, e.g., by SEQ ID NO:l.
  • This elimination of the glycosylation sites improved expression of this variant, active phospholipase C enzyme (PLC, SEQ ID NO:2) when the protein was heterologously expressed in the yeast Pichia pastoris.
  • PLC active phospholipase C enzyme
  • This strategy of reducing or eliminating potential glycosylation sites in the PLC enzyme can improve the expression of active PLC in any glycosylating host.
  • the invention provides phospholipase enzymes (and the nucleic acids that encode them) having a sequence of any of the exemplary phospholipases of the invention with one or more or all of the glycosylation sites altered, as described above.
  • the invention provides methods of making variant phospholipase coding sequences having increased expression in a host cell, where the method comprises modifying a phospholipase coding sequence of the invention such that one, several or all N-linked glycosylation site coding motifs are modified to a non-glycosylated motif.
  • the invention also provides phospholipase coding sequence made by this process, and the enzymes they encode.
  • Supernatant containing a mixture of native secreted Pichia pastoris proteases is mixed and incubated with wild type and mutant PLC enzyme preparations. Reactions are quenched and degradation visualized by SDS-PAGE versus the no protease negative control. Degradation may also determined by measurement of residual PLC activity. Novelty was derived from the observation that certain mutations to knock-out glycosylation significantly change the susceptibility of the expressed phospholipase to degradation during fermentation. An advantage to the method is direct selection of mutants with increased or decreased resistance to the proteases secreted by the host organism during production.
  • This process of the invention can employ site directed mutagenesis (e.g., GSSMTM) to change the amino acid sequence of a phospholipase C enzyme of the invention, e.g., as shown below - a subsequence of SEQ ID NO:2 encoded by SEQ ID NO:l.
  • site directed mutagenesis e.g., GSSMTM
  • Each of the amino acids highlighted in red (below) were changed from asparagine (N in single letter code) to Aspartate (D), serine (S), or another amino acid as described below.
  • These amino acids are designated as amino acid 63, amino acid 131, and amino acid 134 of the sequence below where tryptophan (W) is designated amino acid 1.
  • the invention also provides a process for changing the susceptibility of the expressed phospholipase C by changing the amino acid in position 131.
  • the invention provides variant phospholipases having any one of, or several or all of these modifications, depending on whether it was desired to increase or decrease the resistance of the expressed phospholipase C to degradation by protease.
  • the invention provides variant phospholipases having any one of, or several or all of these modifications in positions equivalent to position 131 of S ⁇ Q ID NO:2.
  • a stable mutant shows a PLC band of similar staining intensity in the "-"(control no protease reaction) and die “+” (reaction contains protease).
  • EXAMPLE 5 PROCESS FOR STABLE HIGH LEVEL EXPRESSION PLC
  • the invention provides a fermentation process for stable, high level expression and high specific activity of phospholipase enzymes, e.g., PLC, in yeast cultures, e.g., Pichia pastoris cultures.
  • the enzymes produced by this method can be used, e.g., in vegetable oil refinement, such as soybean, canola, sunflower or other oils.
  • the invention provides a production process comprising characteristics that enable production of active phospholipase, e.g., PLC, in a yeast cell culture, e.g., Pichia pastoris, as fed-batch cultures at a g/1 scale.
  • the poor MeOH utilization characteristics can be overcome, thereby improving the production characteristics further, by producing PLC in Pichia strains with a Mut phenotype without compromising scalability chaUenges normally associated with a Mut phenotype (and are therefore, not used on industrial scale).
  • this process of the invention improves the production of active PLC by >50-fold (from 100 U/ml using conventional methods to >5000 U/ml whole broth; > 5 g/1 protein) compared to conditions that are normally applied in industrial scale Pichia systems.
  • the invention comprises a zinc supplementation.
  • This zinc supplementation strategy for the cultures of the invention renders the PLC activity nearly completely stable ( ⁇ 5%> loss in activity) as a whole broth, e.g., at 4°C for > 5 days. This significantly aides the recovery process since 1) production of unstable protein activity continues to worsen during the recovery process, and 2) it allows for more processing flexibility, especially at large-scale.
  • Tryptophanyl Aminopeptidase Micr opiate Assay The invention provides a Tryptophanyl Aminopeptidase Microplate Assay, which was developed for determination of relative tryptophanyl aminopeptidase activities in Pichia fermentation timepoint samples. The throughput capacity of this assay is sufficient for sampling of multiple timepoints from numerous fermentations.
  • Microplate preparation Aliquot 90 ⁇ l substrate solution per well of black 96-well for each sample replicate, blanks and references Place microplate on fluorescent microplate reader stage (e.g. SpectraMax, Molecular Dynamics)
  • Bodipy BSA Protease Microplate Assay The invention provides a Bodipy BSA Protease Microplate Assay to aid in the determination of general protease activity in Pichia fermentation timepoint samples. The throughput capacity of this assay is sufficient for sampling of multiple timepoints from numerous fermentations.
  • Substrate • DQ B SA green (Molecular Probes, D 12050)
  • Substrate solution • Dissolve contents of one vial of substrate (1 mg) in 1 mL water containing 0.1 % sodium azide
  • Samples • Pichia fermentation timepoints • Centrifuge to remove cells.
  • Bodipy BSA was selected as a general protease substrate. Lack of hydrolysis of bodipy BSA does not indicate the absence of protease(s) but it has been shown to conelate to hydrolysis of PLC enzyme and loss of PLC activity. It has been demonstrated that BSA may be substituted with bodipy ovalbumin or casein. In one aspect, it is useful to characterize protease activity across a fermentation timecourse since the activity may be temporal and transient.
  • the substrate has been shown to be very stable under these conditions and a negative control blank should show no increase in absorbance over time PLC activity measurement in whole culture broth or supernatant:
  • the invention provides a PLC activity measurement assay in whole culture broth or supernatant; this is a modification of a method described, e.g., by Edward A.
  • the PLC activity measurement assay of the invention comprises:
  • Assay Procedure I - Prepare dilutions of the samples to be assayed using the dilution buffer (1.0% Gum Arabic, 1.0% Triton X-100, 1 mM zinc sulfate). Prepare dilutions immediately before assay, using ice-cold buffer, and store in an ice bath until used. - Transfer 20 mL of the substrate solution into a jacketed glass vessel of about 50 mL capacity, the outer chamber of which is connected to a thermostatically controlled water bath. Cover the mixture, and stir continuously with a mechanical stirring device.
  • the hivention provides cells, cell systems and methods for expressing phospholipase C comprising using a Pichia sfrain with a Mut phenotype.
  • the method comprises inserting a heterologous PLC-encoding nucleic acid in the Pichia strain.
  • the ceU is then cultured under conditions whereby the PLC is expressed.
  • the method can further comprise supplementing the culture conditions with zinc.
  • these methods, cells and cell systems use SEQ ID NO: 2, which is a zinc-requiring metalloenzyme. In one aspect, it is used at 3 moles/mole. It has a MW of approximately 28 kDa and a pi of approximately 5.2, and has a broad substrate tolerance: PC > PE> PS » PI.
  • the unprocessed enzyme has a signal sequence of 24 amino acids, a prosequence of 13 amino acids, and a "mature" enzyme of 245 amino acid residues.
  • the Mut + Pichia strains of the invention have two copies of alcohol oxidase (AOX) genes, AOX1 and AOX2, affected during transformation ("Mut” stands for "Methanol Utilization”), as follows: Mut Single crossover event, AOX1 and AOX2 genes intact Growth and expression on methanol alone. Co-feeding possible Mut Double crossover event disrupts the AOX1 gene Growth and expression improved with co-feeding Mut ' Recombination event disrupts AOX1 and 2 genes Cannot metabolize methanol, requires co-feeding
  • AOX alcohol oxidase
  • Mut + ⁇ Mut s p ⁇ c ⁇ Mu Mut + P ⁇ c ⁇ Mut +
  • Optimal Induction Concentration of Methanol Oxygen Consumption Rate Mut + grows faster than Mut s on Methanol due to faster uptake capacity
  • Ease of Transition Period after Induction Mut + not used for expression at large scale • Aeration/cooling capacity, MeOH sensitivity
  • the methanol utilization pathway in Pichia pastoris is well known in the art.
  • Alcohol oxidase (AOX) catalyzes the conversion of methanol to formaldehyde; thus, if the AOX is overexpressed, results in a "pickled" yeast cell.
  • An exemplary fermentation protocol for Pichia pastoris used in one aspect of the invention comprises: • Seed Culture (flask or tank) • Batch fermentation in rich medium to enhance biomass • Fed-Batch Fermentor Culture • Batch Phase (Glycerol) • Biomass growth as initial carbon source is consumed. • Glucose or Glycerol Feeding Phase • Addition of feed triggered by D.O.
  • Figure 18 illustrates the results of a batch fermentor culture, as discussed above, using only glycerol.
  • Protease activity is from an endogenous protease in Pichia.
  • the batch fermentation can be rich medium to enhance biomass.
  • the progressive increase in protease activity beginning at about 69 hours conesponds to a progressive decrease in PLC activity.
  • a higher co-feed rate of glycerol (glyc) improves active PLC expression and decreases (eliminates) protease production, as the following data summary table illustrates:
  • PLC does not seem to affect physiological growth characteristics of this Mut + phenotype strain - which expresses recombinant PLC SEQ ID NO:2, in a 6X copy number, the data illustrated in Figure 21, an OUR profile as set forth in the figure description. This is a supply-driven MeOH feeding with no residual glucose or MeOH in Mut + cultures. Additionally, the quality of PLC protein produced is unpredictably variable, e.g., « or » 50%) of total PLC protein is active, as iUustrated by the representation of the results from SDS-PAGE, in Figure 22.
  • the OUR profile (discussed above) graphic summary of data is inserted into the upper section of the SDS-PAGE illusfration.
  • a significant quantity of active PLC was located intracellularly, as illusfrated in Figure 23 (also showing the study's protocol), _ where >700 U/ml PLC was detected intracellularly (in Fig. 23, PLC (SEQ ID NO:2) + an alpha signal peptide (from Saccharomyces) + glycosylation).
  • Mo ⁇ hological changes were conelated with active PLC concentration, as illustrated in Figure 24. Magnitude of the mo ⁇ hological change was sfrain and C-source dependent.
  • Figure 25 graphically summarizes data showing the status of a PLC production performance at 95 h TFT (total fermentation time) in Pichia.
  • the five bars on die right side of the graph show results from the "Zeo sfrain", or Zeocin adaptation of the PLC producing Pichia pastoris sfrain.
  • This strain is an antibiotic-resistant markerless strain expressing as a heterologous gene a PLC of the invention (SEQ ID NO:2) in a Pichia pastoris strain. It has been demonstrated that by adapting the strain with zeocin, an antibiotic, one can obtain a new stable sfrain with greatly improved expression level for the protein of interest.
  • strain #1 (containing SEQ ID NO:2)
  • strain #1 was grown in a series of dilution steps, each time with an increasing concentration of zeocin, which is an antibiotic.
  • zeocin which is an antibiotic.
  • a portion of the culture from previous step was diluted to an optical density at 600nm (OD600) of 1.0 with fresh medium and an increasing amount of zeocin was added to the new culture for another 24 hours of growth.
  • OD600 optical density at 600nm
  • zeocin 1.0
  • zeocin concentration of 200 ug/ml was used and the final culture was streaked to a ?MD/YPD plate to allow individual colonies to grow. It was found that the colonies from the final stage culture show high tolerance to zeocin, while the parent strain exhibits very little tolerance.
  • strain #2 (containing SEQ ID NO:2)
  • sfrain #1 shows dramatic improvement (about 70%> higher) in PLC expression compared to the original PLC strain, sfrain #1. It was also demonstrated that sfrain #2 is stable both in zeocin tolerance and PLC expression after a 40-generation passage, indicating that the new strain acquired the "permanent" trait of high PLC expression and zeocin tolerance.
  • a high level of PLC activity was achieved using the "Zeo strain” (Zeocin Pichia adaptation) of the invention: 4100 u/ml achieved in mini-tanks. This result comes from the Pichia strain comprising 6x DSD SEQ ID NO:2.
  • this SEQ ID NO:2- expressing sfrain was "adapted" by growing it in a series of steps, each with increasing concentration of zeocin. Apparently, this adaptation process forced some changes (in molecular or genetic level) to die strain/construct and resulted in significant improvement of PLC activity level. Exemplary results are: • Tank 1, 2, and 4 (each representing different colonies) aU out-performed the original pre-adapted SEQ ID NO:2-expressing strain, with tank 1 & 4 both got to 4100 u ml and tank 2 got to 3500 u/ml.
  • Tank 1 & 4 got to over 3000 u/ml as early as in 75 hrs, representing a much faster activity accumulation comparing to the original pre-adapted SEQ ID NO: 2- expressing strain (which is normally well below 2000 u/ml at the time).
  • Rationale of zeocin adaptation Earlier stage of work on PLC expression was done in the Pichia pPICZa vector, which contains the zeocin-resistance marker. Zeocin was thus used for transformation selection. Later on, we switched to the AMR-less version construct to develop commercial product candidates.
  • step increase of zeocin concenfration to zeo 5, zeo 10, zeo 15, zeo 20, zeo 40, zeo 60, zeo 80, zeo 100 and finally to zeo 200 were carried out (zeo 100 is normally used for transformation selection).
  • zeo 100 is normally used for transformation selection.
  • Each step fresh medium was used and previous stage culture was used to inoculate the next stage culture with OD of 1.0 and grown for -24 hrs. Cultures of each stage were also streaked to YPD plates for preservation and to obtain individual colonies.
  • Mini-tank fermentation results of zeo-adapted colonies To test the effects of zeocin adaptation, a dozen of colonies from zeo 200 and zeo 100 cultures (that were streaked to YPD plates) was picked and screened with mini-tanks. The results are summarized in slide 6. We were able to find several colonies that significantly outperformed the original construct (Pichia sfrain comprising SEQ ID NO:2). Among them, colony #5 from zeo 200 culture showed about 50%> improvement on PLC activity level. Observations on the screening: • There were no apparent differences on growth profiles between the zeo-adapted cultures and the original SEQ ID NO:2-expressing strain.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biotechnology (AREA)
  • General Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Microbiology (AREA)
  • Biochemistry (AREA)
  • Biomedical Technology (AREA)
  • Molecular Biology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Oil, Petroleum & Natural Gas (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Medicinal Chemistry (AREA)
  • Physics & Mathematics (AREA)
  • Cell Biology (AREA)
  • Biophysics (AREA)
  • Plant Pathology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Nutrition Science (AREA)
  • Hematology (AREA)
  • Diabetes (AREA)
  • Obesity (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Enzymes And Modification Thereof (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Detergent Compositions (AREA)
  • Breeding Of Plants And Reproduction By Means Of Culturing (AREA)
  • Peptides Or Proteins (AREA)
PCT/US2005/007908 2002-04-19 2005-03-08 Phospholipases, nucleic acids encoding them and methods for making and using them Ceased WO2005086900A2 (en)

Priority Applications (10)

Application Number Priority Date Filing Date Title
CN2005800146676A CN101426918B (zh) 2004-03-08 2005-03-08 磷脂酶,编码磷脂酶的核酸以及制备和应用磷脂酶的方法
ES05727242.9T ES2601431T3 (es) 2004-03-08 2005-03-08 Fosfolipasas, ácidos nucleicos que las codifican y métodos para prepararlas y usarlas
EP05727242.9A EP1748954B1 (en) 2004-03-08 2005-03-08 Phospholipases, nucleic acids encoding them and methods for making and using them
BRPI0508559-4 BRPI0508559B1 (pt) 2004-03-08 2005-03-08 ácido nucleico recombinante, sintético ou isolado, cassete de expressão, vetor ou um veículo de clonagem, célula transformada, polipeptídeos recombinantes, método de produzir um polipeptídeo recombinante, método de desengomação de uma gordura ou um óleo e processo para reduzir a massa de goma e aumentar o ganho de óleo
AU2005221136A AU2005221136B2 (en) 2004-03-08 2005-03-08 Phospholipases, nucleic acids encoding them and methods for making and using them
CA2559060A CA2559060C (en) 2004-03-08 2005-03-08 Phospholipases, nucleic acids encoding them and methods for making and using them
US10/592,450 US7977080B2 (en) 2002-04-19 2005-03-08 Phospholipases, nucleic acids encoding them and methods for making and using them
JP2007502990A JP2007531516A (ja) 2004-03-08 2005-03-08 ホスホリパーゼ、それらをコードする核酸並びにそれらの製造方法及び使用方法
US11/625,765 US7943360B2 (en) 2002-04-19 2007-01-22 Phospholipases, nucleic acids encoding them and methods for making and using them
US13/090,682 US20120100581A1 (en) 2002-04-19 2011-04-20 Phospholipases, nucleic acids encoding them and methods for making and using them

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US10/796,907 US7226771B2 (en) 2002-04-19 2004-03-08 Phospholipases, nucleic acids encoding them and methods for making and using them
US10/796,907 2004-03-08

Related Parent Applications (1)

Application Number Title Priority Date Filing Date
US10/796,907 Continuation-In-Part US7226771B2 (en) 2002-04-19 2004-03-08 Phospholipases, nucleic acids encoding them and methods for making and using them

Related Child Applications (3)

Application Number Title Priority Date Filing Date
US10/592,450 A-371-Of-International US7977080B2 (en) 2002-04-19 2005-03-08 Phospholipases, nucleic acids encoding them and methods for making and using them
EP16184319.8A Previously-Filed-Application EP3190182A1 (en) 2004-03-08 2005-03-08 Phospholipases, nucleic acids encoding them and methods for making and using them
US11/625,765 Division US7943360B2 (en) 2002-04-19 2007-01-22 Phospholipases, nucleic acids encoding them and methods for making and using them

Publications (2)

Publication Number Publication Date
WO2005086900A2 true WO2005086900A2 (en) 2005-09-22
WO2005086900A3 WO2005086900A3 (en) 2009-04-02

Family

ID=34976224

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2005/007908 Ceased WO2005086900A2 (en) 2002-04-19 2005-03-08 Phospholipases, nucleic acids encoding them and methods for making and using them

Country Status (12)

Country Link
US (2) US7226771B2 (https=)
EP (2) EP3190182A1 (https=)
JP (2) JP2007531516A (https=)
CN (1) CN101426918B (https=)
AU (1) AU2005221136B2 (https=)
BR (1) BRPI0508559B1 (https=)
CA (1) CA2559060C (https=)
ES (1) ES2601431T3 (https=)
HU (1) HUE030573T2 (https=)
PL (1) PL1748954T3 (https=)
PT (1) PT1748954T (https=)
WO (1) WO2005086900A2 (https=)

Cited By (39)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP1788080A1 (en) * 2005-11-22 2007-05-23 Süd-Chemie Ag Use of a thermostable phospholipase in the degumming of an oil or fat, and a method for obtaining a thermostable phopholipase
WO2009035551A1 (en) 2007-09-12 2009-03-19 Martek Biosciences Corporation Biological oils and production and uses thereof
EP2057274A4 (en) * 2006-09-21 2010-01-06 Verenium Corp PHOSPHOLIPASE, NUCLEIC CAUSE, THAT CODE AND METHOD FOR THE PRODUCTION AND USE THEREOF
WO2010150213A1 (en) * 2009-06-25 2010-12-29 Danisco A/S Protein
WO2011046815A1 (en) * 2009-10-16 2011-04-21 Bunge Oils, Inc. Oil degumming methods
US7943360B2 (en) 2002-04-19 2011-05-17 Verenium Corporation Phospholipases, nucleic acids encoding them and methods for making and using them
WO2011082190A1 (en) 2009-12-28 2011-07-07 Martek Biosciences Corporation Recombinant thraustochytrids that grow on sucrose, and compositions, methods of making, and uses thereof
US7977080B2 (en) 2002-04-19 2011-07-12 Verenium Corporation Phospholipases, nucleic acids encoding them and methods for making and using them
WO2012001153A1 (de) 2010-07-01 2012-01-05 Süd-Chemie AG Phospholipase-träger-komplex
US8241876B2 (en) 2008-01-07 2012-08-14 Bunge Oils, Inc. Generation of triacylglycerols from gums
US8298799B2 (en) 2003-03-07 2012-10-30 Dsm Ip Assets B. V. Hydrolases, nucleic acids encoding them and methods for making and using them
US8460905B2 (en) 2007-09-11 2013-06-11 Bunge Oils, Inc. Enzymatic degumming utilizing a mixture of PLA and PLC phospholipases with reduced reaction time
US8557551B2 (en) 2004-09-10 2013-10-15 Dsm Ip Assets B.V. Compositions and methods for making and modifying oils
US8956853B2 (en) 2007-01-30 2015-02-17 Bunge Oils, Inc. Enzymatic degumming utilizing a mixture of PLA and PLC phospholipases
US9017990B2 (en) 2004-09-10 2015-04-28 Dsm Ip Assets B.V. Methods for enzymatic decolorization of chlorophyll
WO2016166149A1 (en) 2015-04-14 2016-10-20 Dsm Ip Assets B.V. Use of phospholipase c
WO2017142904A1 (en) 2016-02-19 2017-08-24 Basf Se Baking lipases
WO2018200464A1 (en) 2017-04-25 2018-11-01 Bunge Oils, Inc. Process for enzymatic degumming
WO2019063613A1 (en) 2017-09-26 2019-04-04 Dsm Ip Assets B.V. ENZYMATIC ELIMINATION OF CHLOROPHYLL SUBSTRATES FROM TRIACYLGLYCEROL OILS
WO2019081976A2 (en) 2017-10-25 2019-05-02 Basf Se BETA-AMYLASE ENZYMES
WO2019206994A1 (en) 2018-04-26 2019-10-31 Basf Se Lipase enzymes
WO2019211143A1 (en) 2018-05-03 2019-11-07 Basf Se Amylase enzymes
WO2019215078A1 (en) 2018-05-07 2019-11-14 Dsm Ip Assets B.V. Process for enzymatic oil degumming
WO2020169563A1 (en) 2019-02-20 2020-08-27 Basf Se Industrial fermentation process for bacillus using defined medium and magnesium feed
WO2020169564A1 (en) 2019-02-20 2020-08-27 Basf Se Industrial fermentation process for bacillus using defined medium and trace element feed
WO2020185737A1 (en) 2019-03-11 2020-09-17 Basf Se Amylases and methods for making and using them
WO2020193535A2 (en) 2019-03-25 2020-10-01 Basf Se Amylase enzymes
WO2020198212A1 (en) 2019-03-27 2020-10-01 Bunge Global Innovation, Llc Silica adsorbent treatment for removal of chlorophyll derivatives from triacylglycerol-based oils
WO2020193532A1 (en) 2019-03-25 2020-10-01 Basf Se Cleaning composition having amylase enzymes
WO2020193534A2 (en) 2019-03-25 2020-10-01 Basf Se Amylase enzymes
WO2020249546A1 (en) 2019-06-13 2020-12-17 Basf Se Method of recovering a protein from fermentation broth using a divalent cation
WO2021004830A1 (en) 2019-07-05 2021-01-14 Basf Se Industrial fermentation process for microbial cells using a fed-batch pre-culture
WO2021032881A1 (en) 2019-08-22 2021-02-25 Basf Se Amylase variants
US11162086B2 (en) 2017-05-12 2021-11-02 Basf Se Lipase enzymes
WO2023208768A1 (en) 2022-04-26 2023-11-02 Dsm Ip Assets B.V. Method of producing cannabis distillate
WO2023225459A2 (en) 2022-05-14 2023-11-23 Novozymes A/S Compositions and methods for preventing, treating, supressing and/or eliminating phytopathogenic infestations and infections
WO2024178230A1 (en) 2023-02-24 2024-08-29 Caravan Ingredients Inc. Egg replacer composition and methods of making and using the same
US12110531B2 (en) 2017-06-16 2024-10-08 Danstar Ferment Ag Method for increasing oil yield during ethanol production
WO2024243330A1 (en) 2023-05-22 2024-11-28 Caravan Ingredients Inc. Baked goods enhancer and methods of making and using the same

Families Citing this family (81)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20050287250A1 (en) * 1995-06-07 2005-12-29 Danisco A/S Method
DE69604491T3 (de) 1995-06-07 2008-09-25 Danisco A/S Methode zur verbesserung der eigenschaften von mehlteig, sowie zusammensetzung zur teigverbesserung und verbesserte nahrungsmittel
US6936289B2 (en) 1995-06-07 2005-08-30 Danisco A/S Method of improving the properties of a flour dough, a flour dough improving composition and improved food products
GB0112226D0 (en) * 2001-05-18 2001-07-11 Danisco Method of improving dough and bread quality
ATE231186T1 (de) 1998-07-21 2003-02-15 Danisco Lebensmittel
US6632429B1 (en) * 1999-12-17 2003-10-14 Joan M. Fallon Methods for treating pervasive development disorders
US20070053895A1 (en) * 2000-08-14 2007-03-08 Fallon Joan M Method of treating and diagnosing parkinsons disease and related dysautonomic disorders
US8030002B2 (en) 2000-11-16 2011-10-04 Curemark Llc Methods for diagnosing pervasive development disorders, dysautonomia and other neurological conditions
ES2284897T3 (es) 2001-05-18 2007-11-16 Danisco A/S Procedimiento para la preparacion de una masa con una enzima.
US7955814B2 (en) * 2003-01-17 2011-06-07 Danisco A/S Method
US20050196766A1 (en) * 2003-12-24 2005-09-08 Soe Jorn B. Proteins
MXPA05007653A (es) * 2003-01-17 2005-09-30 Danisco Metodo.
GB0716126D0 (en) * 2007-08-17 2007-09-26 Danisco Process
US7906307B2 (en) * 2003-12-24 2011-03-15 Danisco A/S Variant lipid acyltransferases and methods of making
US7718408B2 (en) 2003-12-24 2010-05-18 Danisco A/S Method
GB0405637D0 (en) 2004-03-12 2004-04-21 Danisco Protein
CN102533440B (zh) 2004-07-16 2017-09-19 杜邦营养生物科学有限公司 用酶使油脱胶的方法
US20080058282A1 (en) 2005-08-30 2008-03-06 Fallon Joan M Use of lactulose in the treatment of autism
US20070148311A1 (en) * 2005-12-22 2007-06-28 Bunge Oils, Inc. Phytosterol esterification product and method of make same
US20080215251A1 (en) * 2006-08-31 2008-09-04 Pioneer Hi-Bred International, Inc. Computational method for choosing nucleotide sequences to specifically silence genes
MX2009008021A (es) * 2007-01-25 2009-08-07 Danisco Produccion de una aciltransferasa de lipido de celulas de bacillus licheniformis transformadas.
BRPI0808024B1 (pt) * 2007-01-30 2017-05-16 Bunge Oils Inc método para desengomar uma composição de óleo
WO2009081094A2 (en) * 2007-12-21 2009-07-02 Danisco A/S Process
US8658163B2 (en) 2008-03-13 2014-02-25 Curemark Llc Compositions and use thereof for treating symptoms of preeclampsia
US8084025B2 (en) 2008-04-18 2011-12-27 Curemark Llc Method for the treatment of the symptoms of drug and alcohol addiction
US9320780B2 (en) 2008-06-26 2016-04-26 Curemark Llc Methods and compositions for the treatment of symptoms of Williams Syndrome
PL2318035T3 (pl) 2008-07-01 2019-10-31 Curemark Llc Sposoby i kompozycje do leczenia objawów zaburzeń neurologicznych i zaburzeń zdrowia psychicznego
US10776453B2 (en) 2008-08-04 2020-09-15 Galenagen, Llc Systems and methods employing remote data gathering and monitoring for diagnosing, staging, and treatment of Parkinsons disease, movement and neurological disorders, and chronic pain
US20100092447A1 (en) 2008-10-03 2010-04-15 Fallon Joan M Methods and compositions for the treatment of symptoms of prion diseases
US9092437B2 (en) * 2008-12-31 2015-07-28 Microsoft Technology Licensing, Llc Experience streams for rich interactive narratives
US20110113315A1 (en) * 2008-12-31 2011-05-12 Microsoft Corporation Computer-assisted rich interactive narrative (rin) generation
US20110119587A1 (en) * 2008-12-31 2011-05-19 Microsoft Corporation Data model and player platform for rich interactive narratives
KR20170005191A (ko) 2009-01-06 2017-01-11 큐어론 엘엘씨 이. 콜라이에 의한 구강 감염의 치료 또는 예방을 위한 조성물 및 방법
CN102300989B (zh) 2009-01-06 2015-12-09 柯尔朗恩有限责任公司 用于治疗或预防金黄色葡萄球菌感染以及用于根除或减少表面上金黄色葡萄球菌的组合物和方法
US8703463B2 (en) * 2009-03-10 2014-04-22 Dsm Ip Assets B.V. Pregastric esterase and derivatives thereof
GB0904787D0 (en) * 2009-03-20 2009-05-06 Desmet Ballestra Engineering Sa Improved enzymatic oil recuperation process
US9056050B2 (en) 2009-04-13 2015-06-16 Curemark Llc Enzyme delivery systems and methods of preparation and use
US9315764B1 (en) * 2009-05-01 2016-04-19 Rrip, Llc Method of processing phospholipid based lipid materials
CA2774600C (en) * 2009-10-14 2018-02-13 Xyleco, Inc. Producing edible residues from ethanol production
UA109884C2 (uk) * 2009-10-16 2015-10-26 Поліпептид, що має активність ферменту фосфатидилінозитол-специфічної фосфоліпази с, нуклеїнова кислота, що його кодує, та спосіб його виробництва і застосування
US9511125B2 (en) 2009-10-21 2016-12-06 Curemark Llc Methods and compositions for the treatment of influenza
ES2651313T3 (es) * 2009-12-28 2018-01-25 Dsm Ip Assets B.V. Traustoquítridos recombinantes que crecen en xilosa, y composiciones, métodos de preparación y usos de los mismos
EP2630244A4 (en) * 2010-10-19 2014-04-02 Univ Missouri Method for increasing plant oil production
RU2013126882A (ru) * 2010-11-12 2014-12-20 Новозимс А/С Полипептиды, обладающие активностью фосфолипазы с, и полинуклеотиды, кодирующие их
GB201019639D0 (en) * 2010-11-19 2010-12-29 Loders Croklaan Bv Method
US8980252B2 (en) 2011-04-21 2015-03-17 Curemark Llc Methods of treatment of schizophrenia
TWI414362B (zh) 2011-05-18 2013-11-11 Ind Tech Res Inst 萃取裝置
US8586387B2 (en) * 2011-08-30 2013-11-19 Supernova Diagnostics, Inc. Methods of triggering activation of encapsulated signal-generating substances and apparatus utilising activated signal-generating substances
ES2676455T3 (es) 2012-02-17 2018-07-19 Clariant Produkte (Deutschland) Gmbh Procedimiento para la desmucilaginación enzimática de aceite
WO2013122599A1 (en) * 2012-02-17 2013-08-22 Sunho Biodiesel America Llc Enzymatic production of monoglycerides
US10350278B2 (en) 2012-05-30 2019-07-16 Curemark, Llc Methods of treating Celiac disease
BR112014031377B1 (pt) 2012-06-14 2020-09-01 Bunge Global Innovation Llc Processo para a produção de óleos saturados baixos
WO2014007622A1 (en) * 2012-07-04 2014-01-09 Coöperatie Avebe U.A. Lipase in short-chain esterification of fatty acids
ES2738181T3 (es) * 2013-03-08 2020-01-20 Keck Graduate Inst Of Applied Life Sciences Promotores de levadura de Pichia pastoris
DK3527667T3 (da) 2013-03-08 2021-02-22 Biogrammatics Inc Gærpromotorer til proteinekspression
WO2015017045A1 (en) * 2013-07-03 2015-02-05 Keclon Sa Modified bacillus cereus phospholipase c protein and method of processing vegetable oil
CN104630174B (zh) * 2013-11-07 2019-09-27 丰益(上海)生物技术研发中心有限公司 磷脂酶c突变体及其用途
CN104630175B (zh) * 2013-11-14 2019-10-25 丰益(上海)生物技术研发中心有限公司 一种磷脂酶c
WO2015083757A1 (ja) 2013-12-05 2015-06-11 ナガセケムテックス株式会社 風味改善用酵素組成物、不快臭発生抑制方法および不快臭発生抑制食品の製造方法
EP2910129A1 (de) 2014-02-21 2015-08-26 Clariant Produkte (Deutschland) GmbH Zusammensetzung für die enzymatische Ölentschleimung
US9616114B1 (en) 2014-09-18 2017-04-11 David Gordon Bermudes Modified bacteria having improved pharmacokinetics and tumor colonization enhancing antitumor activity
CN104388448B (zh) * 2014-12-18 2018-07-03 山东大学 一种玉米磷脂酶A2基因ZmsPLA2-1及其应用
US10676723B2 (en) 2015-05-11 2020-06-09 David Gordon Bermudes Chimeric protein toxins for expression by therapeutic bacteria
CN105985984B (zh) * 2015-06-17 2018-10-02 深圳益世康宁生物科技有限公司 携带pap抗原基因的重组腺相关病毒载体及构建方法与应用
US10982171B2 (en) 2015-07-17 2021-04-20 Keclon Sa Methods for oil degumming
CN106884009A (zh) 2015-12-16 2017-06-23 丰益(上海)生物技术研发中心有限公司 高效的不依赖锌离子的磷脂酶c突变体
CN108430227B (zh) * 2016-02-03 2022-03-08 不二制油集团控股株式会社 相对于可可脂的光降解耐性赋予法
WO2017134839A1 (ja) * 2016-02-03 2017-08-10 不二製油グループ本社株式会社 ココアバター
CN106047732B (zh) * 2016-05-26 2019-09-03 江南大学 一种高分泌型耐热酵母基因工程菌及其应用
CN110218712B (zh) * 2016-06-02 2021-08-03 天津科技大学 磷脂酶d突变体及其在制备磷脂酸、磷脂酰丝氨酸中的应用
US11129906B1 (en) 2016-12-07 2021-09-28 David Gordon Bermudes Chimeric protein toxins for expression by therapeutic bacteria
US11180535B1 (en) 2016-12-07 2021-11-23 David Gordon Bermudes Saccharide binding, tumor penetration, and cytotoxic antitumor chimeric peptides from therapeutic bacteria
CN108239667B (zh) * 2016-12-27 2022-08-12 丰益(上海)生物技术研发中心有限公司 一种磷脂酶c活力的检测方法
AU2018250823A1 (en) 2017-04-10 2019-10-17 Curemark, Llc Compositions for treating addiction
CN108120761B (zh) * 2017-11-30 2020-10-16 宁波大学 基于具有电催化活性的多肽模拟物的电化学生物传感器用于乙酰胆碱酯酶检测
CN108384768A (zh) * 2018-02-28 2018-08-10 江苏中酶生物科技有限公司 一种磷脂酶c的突变体及其应用
CN108359654B (zh) * 2018-03-02 2021-11-05 江苏中酶生物科技有限公司 一种具有磷脂酶b活性的多肽或蛋白质及其应用
US11541009B2 (en) 2020-09-10 2023-01-03 Curemark, Llc Methods of prophylaxis of coronavirus infection and treatment of coronaviruses
CN112522233B (zh) * 2020-12-11 2022-05-03 中国农业大学 一种米曲霉磷脂酶c及其编码基因与应用
CN116103264B (zh) * 2022-12-28 2025-05-09 厦门蓝湾科技有限公司 一种提高磷脂酶d合成ps活性的理性定向进化方法
CN116574394B (zh) * 2023-04-19 2024-11-19 南京溯远基因科技有限公司 一种敏感性荧光染料剂及其制备方法

Family Cites Families (146)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
SE318048B (https=) 1959-09-21 1969-12-01 Pellerin Ab Zenith
GB1541017A (en) 1975-03-10 1979-02-21 Unilever Ltd Degumming process for triglyceride oils
SE417441B (sv) 1977-08-19 1981-03-16 Kare Larsson Forfarande for att isolera polera lipider ur en blandning av polera och opolera cerealiclipider genom blandning med vatten och derpa foljande tyngdkraftsseparation
US4240972A (en) 1978-12-19 1980-12-23 Canada Packers Limited Continuous process for contacting of triglyceride oils with _an acid
US4458066A (en) 1980-02-29 1984-07-03 University Patents, Inc. Process for preparing polynucleotides
LU83441A1 (fr) 1981-06-19 1983-04-06 Tirtiaux Sa Procede de traitement des huiles et graisses et produits ainsi obtenus
US4707364A (en) * 1984-01-27 1987-11-17 Miles Laboratories, Inc. Composition for accelerating cheese aging
US5087571A (en) 1984-06-22 1992-02-11 President And Fellows Of Harvard College Method for providing a cell culture from a transgenic non-human mammal
US4683202A (en) 1985-03-28 1987-07-28 Cetus Corporation Process for amplifying nucleic acid sequences
US4683195A (en) 1986-01-30 1987-07-28 Cetus Corporation Process for amplifying, detecting, and/or-cloning nucleic acid sequences
GB2183661B (en) 1985-03-30 1989-06-28 Marc Ballivet Method for obtaining dna, rna, peptides, polypeptides or proteins by means of a dna recombinant technique
US4752483A (en) * 1986-05-30 1988-06-21 Campbell Soup Company Method for producing a highly flavored cheese ingredient
US5030240A (en) 1986-06-09 1991-07-09 The Clorox Company Enzymatic peracid bleaching system
US4946778A (en) 1987-09-21 1990-08-07 Genex Corporation Single polypeptide chain binding molecules
US4987071A (en) 1986-12-03 1991-01-22 University Patents, Inc. RNA ribozyme polymerases, dephosphorylases, restriction endoribonucleases and methods
US5015580A (en) 1987-07-29 1991-05-14 Agracetus Particle-mediated transformation of soybean plants and lines
US5573933A (en) 1987-04-14 1996-11-12 Luminis Pty, Ltd. Transgenic pigs
US5700637A (en) 1988-05-03 1997-12-23 Isis Innovation Limited Apparatus and method for analyzing polynucleotide sequences and method of generating oligonucleotide arrays
US6054270A (en) 1988-05-03 2000-04-25 Oxford Gene Technology Limited Analying polynucleotide sequences
US5217879A (en) 1989-01-12 1993-06-08 Washington University Infectious Sindbis virus vectors
US5143854A (en) 1989-06-07 1992-09-01 Affymax Technologies N.V. Large scale photolithographic solid phase synthesis of polypeptides and receptor binding screening thereof
US5527681A (en) 1989-06-07 1996-06-18 Affymax Technologies N.V. Immobilized molecular synthesis of systematically substituted compounds
US5744101A (en) 1989-06-07 1998-04-28 Affymax Technologies N.V. Photolabile nucleoside protecting groups
US5800992A (en) 1989-06-07 1998-09-01 Fodor; Stephen P.A. Method of detecting nucleic acids
US5288619A (en) * 1989-12-18 1994-02-22 Kraft General Foods, Inc. Enzymatic method for preparing transesterified oils
WO1991016427A1 (en) 1990-04-24 1991-10-31 Stratagene Methods for phenotype creation from multiple gene populations
US5326477A (en) 1990-05-07 1994-07-05 Bio-Sep, Inc. Process for digesting solid waste
US5387742A (en) 1990-06-15 1995-02-07 Scios Nova Inc. Transgenic mice displaying the amyloid-forming pathology of alzheimer's disease
DE69133512T2 (de) 1990-11-23 2006-09-28 Bayer Bioscience N.V. Verfahren zur Transformation monokotyler Pflanzen
EP0563296B1 (en) 1990-12-20 1999-03-17 Ixsys, Inc. Optimization of binding proteins
US6110700A (en) 1991-03-11 2000-08-29 The General Hospital Corporation PRAD1 cyclin and its cDNA
DE4115938A1 (de) * 1991-05-16 1992-11-19 Metallgesellschaft Ag Enzymatisches verfahren zur verminderung des gehaltes an phosphorhaltigen bestandteilen in pflanzlichen und tierischen oelen
US5922854A (en) 1991-06-14 1999-07-13 Kumar; Ramesh Purifying Human Hemogloblin from transgenic pig red cells and plasmids containing pig globin nucleic acids
CA2075135A1 (en) 1991-08-02 1993-02-03 David E. Ellis Particle-mediated transformation of gymnosperms
US5632957A (en) 1993-11-01 1997-05-27 Nanogen Molecular biological diagnostic systems including electrodes
JPH05236997A (ja) 1992-02-28 1993-09-17 Hitachi Ltd ポリヌクレオチド捕捉用チップ
JPH06306386A (ja) 1993-04-25 1994-11-01 Showa Sangyo Co Ltd 油脂の精製方法
JP2937746B2 (ja) * 1993-04-25 1999-08-23 昭和産業株式会社 油脂の精製方法
EP0670670A4 (en) 1993-09-30 1996-04-24 Agracetus HETEROLOGICAL PEROXIDASE PROCESSING TRANSGENIC COTTON PLANTS.
US6045996A (en) 1993-10-26 2000-04-04 Affymetrix, Inc. Hybridization assays on oligonucleotide arrays
US6468742B2 (en) 1993-11-01 2002-10-22 Nanogen, Inc. Methods for determination of single nucleic acid polymorphisms using bioelectronic microchip
US5965452A (en) 1996-07-09 1999-10-12 Nanogen, Inc. Multiplexed active biologic array
DE4339556C1 (de) 1993-11-19 1995-02-02 Metallgesellschaft Ag Verfahren zum Entschleimen von Pflanzenöl mittels Enzymen
US5837458A (en) 1994-02-17 1998-11-17 Maxygen, Inc. Methods and compositions for cellular and metabolic engineering
US5605793A (en) 1994-02-17 1997-02-25 Affymax Technologies N.V. Methods for in vitro recombination
US6117679A (en) 1994-02-17 2000-09-12 Maxygen, Inc. Methods for generating polynucleotides having desired characteristics by iterative selection and recombination
US5834252A (en) 1995-04-18 1998-11-10 Glaxo Group Limited End-complementary polymerase reaction
US6335160B1 (en) 1995-02-17 2002-01-01 Maxygen, Inc. Methods and compositions for polypeptide engineering
US5639940A (en) 1994-03-03 1997-06-17 Pharmaceutical Proteins Ltd. Production of fibrinogen in transgenic animals
MX198456B (es) 1994-03-09 2000-09-05 Abbott Lab Animales trangenicos que producen oligosacaridos y glucoconjugados.
WO1995024494A1 (en) 1994-03-09 1995-09-14 Abbott Laboratories Humanized milk
DK0753057T3 (da) 1994-03-29 2006-01-30 Novozymes As Alkalisk Bacillus-amylase
US5807522A (en) 1994-06-17 1998-09-15 The Board Of Trustees Of The Leland Stanford Junior University Methods for fabricating microarrays of biological samples
US5959171A (en) 1994-08-17 1999-09-28 Pharming B.V. Method for the production of biologically active polypeptides in a mammal's
EP0778886A4 (en) 1994-09-01 2001-05-02 TRANSGENIC ANIMAL WHICH EXPRESSES A FAMILY FORM OF THE HUMAN AMYLOID FOREQUARTER PROTEIN
US6111166A (en) 1994-09-19 2000-08-29 Medarex, Incorporated Transgenic mice expressing human Fcα and β receptors
US5795737A (en) 1994-09-19 1998-08-18 The General Hospital Corporation High level expression of proteins
US5880327A (en) 1994-09-21 1999-03-09 American National Red Cross Transgenic mammals expressing human coagulation factor VIII
US5556752A (en) 1994-10-24 1996-09-17 Affymetrix, Inc. Surface-bound, unimolecular, double-stranded DNA
US6187992B1 (en) 1994-12-05 2001-02-13 Merck & Co., Inc. Transgenic mouse having a disrupted amyloid precursor protein gene
US5830645A (en) 1994-12-09 1998-11-03 The Regents Of The University Of California Comparative fluorescence hybridization to nucleic acid arrays
US6093562A (en) 1996-02-05 2000-07-25 Novo Nordisk A/S Amylase variants
US5959098A (en) 1996-04-17 1999-09-28 Affymetrix, Inc. Substrate preparation process
CA2223103A1 (en) 1995-06-06 1996-12-12 Isis Pharmaceuticals Inc. Oligonucleotides having phosphorothioate linkages of high chiral purity
BR9608589A (pt) 1995-06-07 1999-09-14 Willian C Orr Composições e processo de combustão em fase vapor
TR199701705T1 (xx) 1995-06-27 1998-04-21 Unilever N.V. Trigliserid ya�lar�n i�lenmesinde hareketsiz enzim ve kullan�m�.
US5856174A (en) 1995-06-29 1999-01-05 Affymetrix, Inc. Integrated nucleic acid diagnostic device
US5985662A (en) 1995-07-13 1999-11-16 Isis Pharmaceuticals Inc. Antisense inhibition of hepatitis B virus replication
US5958672A (en) 1995-07-18 1999-09-28 Diversa Corporation Protein activity screening of clones having DNA from uncultivated microorganisms
DE19527274A1 (de) * 1995-07-26 1997-01-30 Metallgesellschaft Ag Enzymatisches Verfahren zur Entschleimung von pflanzlichen Ölen mit Aspergillus-Phospholipase
SE504664C2 (sv) 1995-09-22 1997-03-24 Scotia Lipidteknik Ab Sätt att framställa fraktionerad olja, oljan, dess användning samt emulsionskomposition innehållande oljan
US5721118A (en) 1995-10-31 1998-02-24 The Regents Of The University Of California, San Diego Mammalian artificial chromosomes and methods of using same
US5830696A (en) 1996-12-05 1998-11-03 Diversa Corporation Directed evolution of thermophilic enzymes
US6171820B1 (en) 1995-12-07 2001-01-09 Diversa Corporation Saturation mutagenesis in directed evolution
US5965408A (en) 1996-07-09 1999-10-12 Diversa Corporation Method of DNA reassembly by interrupting synthesis
US5939250A (en) 1995-12-07 1999-08-17 Diversa Corporation Production of enzymes having desired activities by mutagenesis
US6238884B1 (en) 1995-12-07 2001-05-29 Diversa Corporation End selection in directed evolution
US6022963A (en) 1995-12-15 2000-02-08 Affymetrix, Inc. Synthesis of oligonucleotide arrays using photocleavable protecting groups
US6013440A (en) 1996-03-11 2000-01-11 Affymetrix, Inc. Nucleic acid affinity columns
US6096548A (en) 1996-03-25 2000-08-01 Maxygen, Inc. Method for directing evolution of a virus
US6025155A (en) 1996-04-10 2000-02-15 Chromos Molecular Systems, Inc. Artificial chromosomes, uses thereof and methods for preparing artificial chromosomes
US6197070B1 (en) 1996-05-15 2001-03-06 The Procter & Gamble Company Detergent compositions comprising alpha combination of α-amylases for malodor stripping
AU3568897A (en) 1996-06-07 1998-01-05 Eos Biotechnology, Inc. Immobilised linear oligonucleotide arrays
US6326341B1 (en) 1996-09-11 2001-12-04 The Procter & Gamble Company Low foaming automatic dishwashing compositions
US6127137A (en) 1996-10-31 2000-10-03 Novo Nordisk A/S Acidic phospholipase, production and methods using thereof
AU4772597A (en) * 1996-10-31 1998-05-22 Novo Nordisk A/S Novel phospholipase, production and use thereof
AU5187898A (en) 1996-12-09 1998-07-03 Novo Nordisk A/S Reduction of phosphorus containing components in edible oils comprising a high amount of non-hydratable phosphorus by use of a phospholipase, a phospholipase from a filamentous fungus having phospholipase a and/or b activity
US6103505A (en) 1996-12-09 2000-08-15 Novo Nordisk A/S Method for reducing phosphorus content of edible oils
JP4017082B2 (ja) 1996-12-19 2007-12-05 ユニリーバー・ナームローゼ・ベンノートシャープ 固定化酵素及びトリグリセリド油の処理のためのその使用
US6069122A (en) 1997-06-16 2000-05-30 The Procter & Gamble Company Dishwashing detergent compositions containing organic diamines for improved grease cleaning, sudsing, low temperature stability and dissolution
US6326204B1 (en) 1997-01-17 2001-12-04 Maxygen, Inc. Evolution of whole cells and organisms by recursive sequence recombination
EP1717322B1 (en) 1997-01-17 2012-07-18 Codexis Mayflower Holdings, LLC Evolution of whole cells and organisms by recursive sequence recombination
DE19703364A1 (de) 1997-01-30 1998-08-06 Henkel Ecolab Gmbh & Co Ohg Pastenförmiges Wasch- und Reinigungsmittel
US6303803B1 (en) 1997-01-31 2001-10-16 Cargill, Incorporated Removal of sterols from fats and oils
US5880300A (en) 1997-01-31 1999-03-09 Cargill, Incorporated Phospholipid-based removal of sterols from fats and oils
EP0973940B1 (en) 1997-03-18 2008-07-02 Novozymes A/S An in vitro method for the construction of a dna library
JP4263248B2 (ja) 1997-03-18 2009-05-13 ノボザイムス アクティーゼルスカブ Dnaのシャッフリングによるライブラリーの作成方法
US5948653A (en) 1997-03-21 1999-09-07 Pati; Sushma Sequence alterations using homologous recombination
US6153410A (en) 1997-03-25 2000-11-28 California Institute Of Technology Recombination of polynucleotide sequences using random or defined primers
US6826296B2 (en) 1997-07-25 2004-11-30 Affymetrix, Inc. Method and system for providing a probe array chip design database
CN1273609A (zh) 1997-08-15 2000-11-15 希斯克有限公司 检测或量化核酸物类的方法和组合物
CN1677076A (zh) 1997-09-11 2005-10-05 生物风险公司 制备高密度阵列的方法
US6465178B2 (en) 1997-09-30 2002-10-15 Surmodics, Inc. Target molecule attachment to surfaces
AU1124499A (en) 1997-10-28 1999-05-17 Maxygen, Inc. Human papillomavirus vectors
CA2308119C (en) 1997-10-30 2014-06-03 Novo Nordisk A/S .alpha.-amylase mutants
WO1999023107A1 (en) 1997-10-31 1999-05-14 Maxygen, Incorporated Modification of virus tropism and host range by viral genome shuffling
EP1032644B1 (en) 1997-11-10 2003-03-19 The Procter & Gamble Company Process for preparing a detergent tablet
US6118044A (en) 1997-11-14 2000-09-12 Sankyo Company, Limited Transgenic animal allergy models and methods for their use
DK1036198T3 (da) 1997-12-08 2013-01-02 California Inst Of Techn Fremgangsmåde til fremstilling af polynukleotid- og polypeptidsekvenser
US6506559B1 (en) 1997-12-23 2003-01-14 Carnegie Institute Of Washington Genetic inhibition by double-stranded RNA
MXPA00007893A (es) 1998-02-11 2002-10-23 Maxygen Inc Direccion de vectores de vacunas geneticas.
CA2320958A1 (en) 1998-02-11 1999-08-19 Maxygen, Inc. Antigen library immunization
AU3463699A (en) 1998-04-03 1999-10-25 Phylos, Inc. Addressable protein arrays
WO1999053001A1 (en) * 1998-04-08 1999-10-21 Novo Nordisk A/S An enzymatic oil-degumming process
US6156952A (en) 1998-04-09 2000-12-05 Constituent Institution Of The University Of Maryland System HIV transgenic animals and uses therefor
AU3408199A (en) 1998-05-01 1999-11-23 Novo Nordisk A/S Enhancers such as n-hydroxyacetanilide
US6048695A (en) 1998-05-04 2000-04-11 Baylor College Of Medicine Chemically modified nucleic acids and methods for coupling nucleic acids to solid support
DE19824705A1 (de) 1998-06-03 1999-12-09 Henkel Kgaa Amylase und Protease enthaltende Wasch- und Reinigungsmittel
US6022567A (en) 1998-06-23 2000-02-08 Nestec S.A. Flavor enhancer
ATE547532T1 (de) 1998-06-29 2012-03-15 Bristol Myers Squibb Co Verfahren zur erzeugung von hochgradig diversen bibliotheken
JP4335995B2 (ja) 1998-07-22 2009-09-30 昭 神谷 環境保全型粒状洗浄用組成物
FR2782323B1 (fr) 1998-08-12 2002-01-11 Proteus Procede de production in vitro de sequences polynucleotidiques recombinees, banques de sequences et sequences ainsi obtenues
US6183962B1 (en) 1998-09-09 2001-02-06 Millennium Pharmaceuticals, Inc. Protein kinase molecules and uses therefor
US6277628B1 (en) 1998-10-02 2001-08-21 Incyte Genomics, Inc. Linear microarrays
US6642426B1 (en) 1998-10-05 2003-11-04 David L. Johnson Fluid-bed aromatics alkylation with staged injection of alkylating agents
US6172248B1 (en) * 1998-11-20 2001-01-09 Ip Holdings, L.L.C. Methods for refining vegetable oils and byproducts thereof
US6277489B1 (en) 1998-12-04 2001-08-21 The Regents Of The University Of California Support for high performance affinity chromatography and other uses
US7024312B1 (en) 1999-01-19 2006-04-04 Maxygen, Inc. Methods for making character strings, polynucleotides and polypeptides having desired characteristics
US6617122B1 (en) 1999-03-15 2003-09-09 Xenon Genetics, Inc. Process for identifying modulators of ABC1 activity
AU766617B2 (en) 1999-03-16 2003-10-23 Novozymes A/S Process for producing cheese
US6399121B1 (en) 1999-03-16 2002-06-04 Novozymes A/S Process for producing cheese
US6511824B1 (en) 1999-03-17 2003-01-28 Exelixis, Inc. Nucleic acids and polypeptides of invertebrate TWIK channels and methods of use
US6309871B1 (en) 1999-03-31 2001-10-30 Novozymes A/S Polypeptides having alkaline α-amylase activity
US6221653B1 (en) 1999-04-27 2001-04-24 Agilent Technologies, Inc. Method of performing array-based hybridization assays using thermal inkjet deposition of sample fluids
US6653151B2 (en) 1999-07-30 2003-11-25 Large Scale Proteomics Corporation Dry deposition of materials for microarrays using matrix displacement
EP1106603A3 (en) 1999-12-06 2003-11-19 Fuji Photo Film Co., Ltd. DNA chip and reactive solid carrier
US6531644B1 (en) 2000-01-14 2003-03-11 Exelixis, Inc. Methods for identifying anti-cancer drug targets
JP2004518413A (ja) 2000-10-12 2004-06-24 エクセリクシス・インコーポレイテッド ヒトect2と使用方法
US6309872B1 (en) 2000-11-01 2001-10-30 Novozymes Biotech, Inc Polypeptides having glucoamylase activity and nucleic acids encoding same
US6660491B2 (en) * 2000-11-24 2003-12-09 Ikeda Food Research Co., Ltd. Process for producing dietary sterol fatty acid esters
JP2005517418A (ja) 2002-02-20 2005-06-16 ノボザイムス アクティーゼルスカブ チーズの製造方法
AU2003243157C1 (en) 2002-04-19 2008-09-04 Verenium Corporation Phospholipases, nucleic acids encoding them and methods for making and using them
US7226771B2 (en) 2002-04-19 2007-06-05 Diversa Corporation Phospholipases, nucleic acids encoding them and methods for making and using them
EP2853593B1 (en) 2003-03-07 2017-10-04 DSM IP Assets B.V. Hydrolases, nucleic acids encoding them and mehods for making and using them
CA2601472A1 (en) 2005-03-08 2006-09-14 Verenium Corporation Hydrolases, nucleic acids encoding them and methods for improving paper strength
US9409174B2 (en) 2013-06-21 2016-08-09 Bio-Rad Laboratories, Inc. Microfluidic system with fluid pickups

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
None

Cited By (60)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7943360B2 (en) 2002-04-19 2011-05-17 Verenium Corporation Phospholipases, nucleic acids encoding them and methods for making and using them
US7977080B2 (en) 2002-04-19 2011-07-12 Verenium Corporation Phospholipases, nucleic acids encoding them and methods for making and using them
US9193962B2 (en) 2003-03-07 2015-11-24 Dsm Ip Assets B.V. Hydrolases, nucleic acids encoding them and methods for making and using them
US10308920B2 (en) 2003-03-07 2019-06-04 Dsm Ip Assets B.V. Hydrolases, nucleic acids encoding them and methods for making and using them
US8298799B2 (en) 2003-03-07 2012-10-30 Dsm Ip Assets B. V. Hydrolases, nucleic acids encoding them and methods for making and using them
US9034612B2 (en) 2004-09-10 2015-05-19 Dsm Ip Assets, B.V. Compositions and methods for making and modifying oils
US8557551B2 (en) 2004-09-10 2013-10-15 Dsm Ip Assets B.V. Compositions and methods for making and modifying oils
US9499844B2 (en) 2004-09-10 2016-11-22 Dsm Ip Assets B.V. Compositions and methods for making and modifying oils
US9243267B2 (en) 2004-09-10 2016-01-26 Dsm Ip Assets B.V. Compositions and methods for making and modifying oils
US9017990B2 (en) 2004-09-10 2015-04-28 Dsm Ip Assets B.V. Methods for enzymatic decolorization of chlorophyll
EP1788080A1 (en) * 2005-11-22 2007-05-23 Süd-Chemie Ag Use of a thermostable phospholipase in the degumming of an oil or fat, and a method for obtaining a thermostable phopholipase
WO2007059927A1 (en) * 2005-11-22 2007-05-31 Süd-Chemie AG Use of a thermostable phospholipase in the degumming of an oil or fat, and a method for obtaining a thermostable phospholipase
US8637290B2 (en) 2006-09-21 2014-01-28 Dsm Ip Assets B.V. Phospholipases, nucleic acids encoding them and methods for making and using them
EA015591B1 (ru) * 2006-09-21 2011-10-31 Верениум Корпорейшн Фосфолипазы, кодирующие их нуклеиновые кислоты и способы их получения и применения
EP2057274A4 (en) * 2006-09-21 2010-01-06 Verenium Corp PHOSPHOLIPASE, NUCLEIC CAUSE, THAT CODE AND METHOD FOR THE PRODUCTION AND USE THEREOF
US8956853B2 (en) 2007-01-30 2015-02-17 Bunge Oils, Inc. Enzymatic degumming utilizing a mixture of PLA and PLC phospholipases
US8460905B2 (en) 2007-09-11 2013-06-11 Bunge Oils, Inc. Enzymatic degumming utilizing a mixture of PLA and PLC phospholipases with reduced reaction time
US9453172B2 (en) 2007-09-12 2016-09-27 Dsm Ip Assets B.V. Biological oils and production and uses thereof
WO2009035551A1 (en) 2007-09-12 2009-03-19 Martek Biosciences Corporation Biological oils and production and uses thereof
US8541211B2 (en) 2008-01-07 2013-09-24 Bunge Oils, Inc. Generation of triacylglycerols
US8241876B2 (en) 2008-01-07 2012-08-14 Bunge Oils, Inc. Generation of triacylglycerols from gums
WO2010150213A1 (en) * 2009-06-25 2010-12-29 Danisco A/S Protein
CN102575243A (zh) * 2009-10-16 2012-07-11 邦奇油类公司 油脱胶方法
US9045712B2 (en) 2009-10-16 2015-06-02 Bunge Global Innovation, Llc Oil degumming methods
CN102575243B (zh) * 2009-10-16 2016-02-03 邦奇油类公司 油脱胶方法
WO2011046815A1 (en) * 2009-10-16 2011-04-21 Bunge Oils, Inc. Oil degumming methods
WO2011082190A1 (en) 2009-12-28 2011-07-07 Martek Biosciences Corporation Recombinant thraustochytrids that grow on sucrose, and compositions, methods of making, and uses thereof
WO2012001153A1 (de) 2010-07-01 2012-01-05 Süd-Chemie AG Phospholipase-träger-komplex
DE102010025764A1 (de) 2010-07-01 2012-01-05 Süd-Chemie AG Phospholipase-Träger-Komplex
WO2016166149A1 (en) 2015-04-14 2016-10-20 Dsm Ip Assets B.V. Use of phospholipase c
WO2017142904A1 (en) 2016-02-19 2017-08-24 Basf Se Baking lipases
WO2018200464A1 (en) 2017-04-25 2018-11-01 Bunge Oils, Inc. Process for enzymatic degumming
US10501703B2 (en) 2017-04-25 2019-12-10 Bunge Oils, Inc. Process for enzymatic degumming
EP3401383A1 (en) 2017-05-08 2018-11-14 Bunge Oils, Inc. Process for enzymatic degumming
US11162086B2 (en) 2017-05-12 2021-11-02 Basf Se Lipase enzymes
US11214777B2 (en) 2017-05-12 2022-01-04 Basf Se Method for using lipase enzymes for cleaning
US12110531B2 (en) 2017-06-16 2024-10-08 Danstar Ferment Ag Method for increasing oil yield during ethanol production
EP4481040A2 (en) 2017-09-26 2024-12-25 Bunge Global Innovation, LLC. Enzymatic removal of chlorophyll substrates from triacylglycerol-based oils
WO2019063614A1 (en) 2017-09-26 2019-04-04 Bunge Global Innovation, Llc. ENZYMATIC REMOVAL OF CHLOROPHYLLIC SUBSTRATES FROM TRIACYLGLYCEROL OILS
WO2019063613A1 (en) 2017-09-26 2019-04-04 Dsm Ip Assets B.V. ENZYMATIC ELIMINATION OF CHLOROPHYLL SUBSTRATES FROM TRIACYLGLYCEROL OILS
WO2019081976A2 (en) 2017-10-25 2019-05-02 Basf Se BETA-AMYLASE ENZYMES
WO2019206994A1 (en) 2018-04-26 2019-10-31 Basf Se Lipase enzymes
WO2019211143A1 (en) 2018-05-03 2019-11-07 Basf Se Amylase enzymes
WO2019215078A1 (en) 2018-05-07 2019-11-14 Dsm Ip Assets B.V. Process for enzymatic oil degumming
WO2020169564A1 (en) 2019-02-20 2020-08-27 Basf Se Industrial fermentation process for bacillus using defined medium and trace element feed
WO2020169563A1 (en) 2019-02-20 2020-08-27 Basf Se Industrial fermentation process for bacillus using defined medium and magnesium feed
WO2020185737A1 (en) 2019-03-11 2020-09-17 Basf Se Amylases and methods for making and using them
WO2020193534A2 (en) 2019-03-25 2020-10-01 Basf Se Amylase enzymes
WO2020193532A1 (en) 2019-03-25 2020-10-01 Basf Se Cleaning composition having amylase enzymes
WO2020193535A2 (en) 2019-03-25 2020-10-01 Basf Se Amylase enzymes
US11098265B2 (en) 2019-03-27 2021-08-24 Bunge Global Innovation, Llc Silica adsorbent treatment for removal of chlorophyll derivatives from triacylglycerol-based oils
WO2020198212A1 (en) 2019-03-27 2020-10-01 Bunge Global Innovation, Llc Silica adsorbent treatment for removal of chlorophyll derivatives from triacylglycerol-based oils
WO2020249546A1 (en) 2019-06-13 2020-12-17 Basf Se Method of recovering a protein from fermentation broth using a divalent cation
US12146171B2 (en) 2019-06-13 2024-11-19 Basf Se Method of recovering a protein from fermentation broth using a divalent cation
WO2021004830A1 (en) 2019-07-05 2021-01-14 Basf Se Industrial fermentation process for microbial cells using a fed-batch pre-culture
WO2021032881A1 (en) 2019-08-22 2021-02-25 Basf Se Amylase variants
WO2023208768A1 (en) 2022-04-26 2023-11-02 Dsm Ip Assets B.V. Method of producing cannabis distillate
WO2023225459A2 (en) 2022-05-14 2023-11-23 Novozymes A/S Compositions and methods for preventing, treating, supressing and/or eliminating phytopathogenic infestations and infections
WO2024178230A1 (en) 2023-02-24 2024-08-29 Caravan Ingredients Inc. Egg replacer composition and methods of making and using the same
WO2024243330A1 (en) 2023-05-22 2024-11-28 Caravan Ingredients Inc. Baked goods enhancer and methods of making and using the same

Also Published As

Publication number Publication date
JP2011172583A (ja) 2011-09-08
AU2005221136A1 (en) 2005-09-22
PL1748954T3 (pl) 2017-02-28
US7226771B2 (en) 2007-06-05
EP1748954A4 (en) 2009-10-28
CA2559060C (en) 2017-09-05
EP1748954B1 (en) 2016-08-17
US7977080B2 (en) 2011-07-12
CN101426918A (zh) 2009-05-06
WO2005086900A3 (en) 2009-04-02
AU2005221136B2 (en) 2011-06-09
US20080317731A1 (en) 2008-12-25
CN101426918B (zh) 2013-03-27
HUE030573T2 (en) 2017-05-29
EP3190182A1 (en) 2017-07-12
EP1748954A2 (en) 2007-02-07
BRPI0508559B1 (pt) 2019-12-10
PT1748954T (pt) 2016-11-21
BRPI0508559A (pt) 2007-08-14
US20050108789A1 (en) 2005-05-19
CA2559060A1 (en) 2005-09-22
ES2601431T3 (es) 2017-02-15
JP2007531516A (ja) 2007-11-08

Similar Documents

Publication Publication Date Title
AU2005221136B2 (en) Phospholipases, nucleic acids encoding them and methods for making and using them
EP1497418B1 (en) Phospholipases, nucleic acids encoding them and methods for making and using them
US8637290B2 (en) Phospholipases, nucleic acids encoding them and methods for making and using them
US10487316B2 (en) Phospholipases, nucleic acids encoding them and methods for making and using them
US9512382B2 (en) Oil degumming methods
US7943360B2 (en) Phospholipases, nucleic acids encoding them and methods for making and using them
AU2011218662B2 (en) Phospholipases, nucleic acids encoding them and methods for making and using them
AU2008201667A1 (en) Phospholipases, nucleic acids encoding them and methods for making and using them

Legal Events

Date Code Title Description
AK Designated states

Kind code of ref document: A2

Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BW BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE EG ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NA NI NO NZ OM PG PH PL PT RO RU SC SD SE SG SK SL SM SY TJ TM TN TR TT TZ UA UG US UZ VC VN YU ZA ZM ZW

AL Designated countries for regional patents

Kind code of ref document: A2

Designated state(s): BW GH GM KE LS MW MZ NA SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IS IT LT LU MC NL PL PT RO SE SI SK TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG

WWE Wipo information: entry into national phase

Ref document number: 2007502990

Country of ref document: JP

Ref document number: 2559060

Country of ref document: CA

NENP Non-entry into the national phase

Ref country code: DE

WWW Wipo information: withdrawn in national office

Ref document number: DE

WWE Wipo information: entry into national phase

Ref document number: 2005221136

Country of ref document: AU

REEP Request for entry into the european phase

Ref document number: 2005727242

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2005727242

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2893/KOLNP/2006

Country of ref document: IN

ENP Entry into the national phase

Ref document number: 2005221136

Country of ref document: AU

Date of ref document: 20050308

Kind code of ref document: A

WWP Wipo information: published in national office

Ref document number: 2005221136

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 200580014667.6

Country of ref document: CN

WWP Wipo information: published in national office

Ref document number: 2005727242

Country of ref document: EP

ENP Entry into the national phase

Ref document number: PI0508559

Country of ref document: BR

WWE Wipo information: entry into national phase

Ref document number: 10592450

Country of ref document: US