WO2004032870A2 - Methods for treating post-surgical pain by admisnistering a nerve growth factor antagonist and compositions containing the same - Google Patents

Methods for treating post-surgical pain by admisnistering a nerve growth factor antagonist and compositions containing the same Download PDF

Info

Publication number
WO2004032870A2
WO2004032870A2 PCT/US2003/032089 US0332089W WO2004032870A2 WO 2004032870 A2 WO2004032870 A2 WO 2004032870A2 US 0332089 W US0332089 W US 0332089W WO 2004032870 A2 WO2004032870 A2 WO 2004032870A2
Authority
WO
WIPO (PCT)
Prior art keywords
ngf
antibody
pain
antagonist
post
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2003/032089
Other languages
English (en)
French (fr)
Other versions
WO2004032870A3 (en
Inventor
David L. Shelton
German J. Vergara
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Rinat Neuroscience Corp
Original Assignee
Rinat Neuroscience Corp
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=32093988&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=WO2004032870(A2) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Priority to SI200331974T priority Critical patent/SI1556083T1/sl
Priority to CN2003801053364A priority patent/CN1723039B/zh
Priority to NZ539101A priority patent/NZ539101A/en
Priority to JP2004543631A priority patent/JP4584713B2/ja
Priority to DK03779091.2T priority patent/DK1556083T3/da
Priority to EP03779091A priority patent/EP1556083B1/en
Priority to DE60335957T priority patent/DE60335957D1/de
Priority to AT03779091T priority patent/ATE497391T1/de
Application filed by Rinat Neuroscience Corp filed Critical Rinat Neuroscience Corp
Priority to HK05107956.2A priority patent/HK1074173B/en
Priority to BR0315164-6A priority patent/BR0315164A/pt
Priority to AU2003285864A priority patent/AU2003285864C1/en
Priority to MXPA05003502A priority patent/MXPA05003502A/es
Priority to CA002501626A priority patent/CA2501626A1/en
Publication of WO2004032870A2 publication Critical patent/WO2004032870A2/en
Publication of WO2004032870A3 publication Critical patent/WO2004032870A3/en
Priority to IL167654A priority patent/IL167654A/en
Anticipated expiration legal-status Critical
Priority to NO20052219A priority patent/NO20052219L/no
Ceased legal-status Critical Current

Links

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/22—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against growth factors ; against growth regulators
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00—Drugs for disorders of the nervous system
    • A61P25/04—Centrally acting analgesics, e.g. opioids
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P41/00—Drugs used in surgical methods, e.g. surgery adjuvants for preventing adhesion or for vitreum substitution
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered

Definitions

  • the present invention relates to the use of an Nerve Growth Factor
  • NTF NGF antagonist for the prevention, amelioration, or treatment of post-surgical pain.
  • Nerve growth factor was the first neurotrophin to be identified, and its role in the development and survival of both peripheral and central neurons has been well characterized. NGF has been shown to be a critical survival and maintenance factor in the development of peripheral sympathetic and embryonic sensory neurons and of basal forebrain cholinergic neurons (Smeyne, et al, Nature 368:246-249 (1994); Crowley, et al, Cell 76:1001-1011 (1994)).
  • NGF upregulates expression of neuropeptides in sensory neurons (Lindsay, et al, Nature 337:362-364 (1989)), and its activity is mediated through two different membrane-bound receptors, the TrkA tyrosine kinase receptor and the p75 receptor which is structurally related to other members of the tumor necrosis factor receptor family (Chao, et al, Science 232:518-521 (1986)).
  • TrkA tyrosine kinase receptor and the p75 receptor which is structurally related to other members of the tumor necrosis factor receptor family (Chao, et al, Science 232:518-521 (1986)).
  • NGF has been increasingly implicated in processes outside of the nervous system. For example, NGF has been shown to enhance vascular permeability (Often, et al, Eur J Pharmacol.
  • NGF is produced by a number of cell types including mast cells
  • B-lymphocytes Torcia, et al, Cell 85:345-356 (1996), keratinocytes (Di Marco, et al, J. Biol. Chem. 268:22838-22846)), smooth muscle cells (Ueyama, et al, J. Hypertens. 11:1061-1065 (1993)), fibroblasts (Lindholm, et al, Eur. J. Neurosci. 2:795-801 (1990)), bronchial epithelial cells (Kassel, et al, Clin, Exp.
  • NGF receptors have been found on a variety of cell types outside of the nervous system. For example, TrkA has been found on human monocytes, T- and B-lymphocytes and mast cells.
  • NGF neurotrophin BDNF
  • Neurosci 17, 8476-8490 (1997)) which in turn changes pain signal processing in the spinal cord (Hains, et al, Neurosci Lett. 320(3), 125- 8 (2002); Miletic, et al, Neurosci Lett.
  • bradykinin receptor expression inducing bradykinin receptor expression (Peterson et al, Neuroscience 83:161-168 (1998)), inducing changes in expression of genes responsible for nerve activation and conduction such as ion channels (Boettger, et al., Brain 125(Pt 2), 252-63 (2002); Kerr, etal, Neuroreport 12(14), 3077-8 (2001); Gould, et al, Brain Res 854(1-2), 19-29 (2000)), potentiating the pain related receptor VR1 (Chuang, et al, Nature 411 (6840), 957-62 (2001); and causing pathological changes in muscles (Foster, et al, JPathol 197(2), 245-55 (2002)).
  • NGF mediated pain responses are at least somewhat mediated by mast cells (Lewin, et al, Eur. J. Neurosci. 6:1903-1912 (1994), Woolf, et al, J. Neurosci. 16:2716-2723 (1996) although the potential relevance of this remains to be shown in humans.
  • Primary sympathetic neurons are also known to respond to NGF and to also be involved in pain signaling (Aley, et al, Neuroscience 71:1083-1090 (1996)). It is clear that removing sympathetic innervation modifies the hyperalgesia normally seen in response to treatment with NGF (Woolf, et al, J. Neurosci. 16:2716-2723 (1996)).
  • Post-surgical pain can have two clinically important aspects, namely resting pain, or pain that occurs when the patient is not moving and mechanical pain which is exacerbated by movement (coughing/sneezing, getting out of bed, physiotherapy, etc.).
  • the major problem with post-surgical pain management for major surgery is that the drugs currently used have a variety of prominent side effects that delay recovery, prolong hospitalization and subject certain vulnerable patient groups to the risk of serious complications.
  • Post-surgical pain, or pain that occurs after surgery or traumatic injury is a serious and often intractable medical problem.
  • There are two general categories of medication for the treatment of pain both of which have disadvantages.
  • the first category includes the nonsteroidal anti-inflammatory drugs (NSAIDs) which are used to treat mild or moderate pain, but whose therapeutic use is limited by undesirable gastrointestinal effects such as gastric erosion, the formation of peptic ulcer or the inflammation of the duodenum and of the colon. NSAIDs also can cause renal toxicity with prolonged use, and further, as described below, are not very effective for treating pain associated with or arising from certain conditions, including post-surgical pain.
  • the second category includes morphine and related opioids which are used to treat moderate to severe pain but whose therapeutic use is limited because of undesirable effects such as sedation, confusion, constipation, respiratory depression, renal colic, tolerance to prolonged use and the risk of addiction. Compounds useful for treating pain with fewer or no side effects are therefore needed.
  • Pain is often categorized as "inflammatory”, “neuropathic” or
  • visceral but these traditional general labels have inherent problems. They imply mechanistic similarity or identity among all sources of pain within one of these very general categories. In fact, there are many different types of inflammatory pain and sources of pain that are neither inflammatory nor neuropathic. Further, types of pain that have an inflammatory component, and/or are traditionally termed "inflammatory”, does not mean that other physiological aspects do not contribute to the pain state. For example, both osteoarthritis and interstitial cystitis would be defined by their names as sterile inflammatory conditions of respectively joints or the urinary bladder, but it is clear that the pains associated with these two conditions are mechanistically quite different from each other. This is indicated by the varying effects of a given type of anti-pain medication with respect to these types of pain.
  • Post-surgical pain (interchangeably termed, post-incisional pain) is often considered a variety of inflammatory pain. While there may be an "inflammatory" component to post-surgical pain, clearly additional mechanisms are involved. For example, during surgery or other injury, both vasculature and nerves are cut or torn. This does not happen in a tissue undergoing only inflammation. It is clear that cutting a nerve can induce ongoing activity, which is perceived as painful. In addition, severing blood vessels lead to a tissue that is relatively ischemic, also a painful stimulus that is not present during inflammation alone.
  • central pain transmitting neurons during incision and sensitization are not necessary for pain behaviors several days later. Rather, for incisions, enhanced responsiveness of central neurons and pain require ongoing afferent input from the incision. After any preincision analgesic treatment abates, the surgical wound appears capable of reinitiating sensitization and regenerating the pain responses.
  • hyperalgesia including the uninjured zone
  • Secondary hyperalgesia hyperalgesia outside the injured area
  • central sensitization i.e. central sensitization.
  • flare or redness possibly a result of axon reflexes
  • incision was distinct from the area of hyperalgesia.
  • the large area of hyperalgesia never developed when local anesthetic injection was made before the incision. Moreover, it could not be reversed by local anesthetic injection after incision.
  • the present invention is based upon the discovery that antagonists of NGF are effective in treating post-surgical pain.
  • the treatment addresses one or more aspects of post-surgical pain as described herein.
  • the invention features a method for preventing or treating post-surgical pain (referred to interchangeably as "post-incisional” or “post-traumatic pain") by administering an antagonist of nerve growth factor (NGF).
  • NGF nerve growth factor
  • the invention provides methods for reducing incidence of post-surgical pain, ameliorating post-surgical pain, palliating post- surgical pain; and/or delaying the development or progression of post-surgical pain in an individual, said methods comprising administering an effective amount of an NGF antagonist.
  • the invention provides methods for increasing pain threshold in an individual comprising administering an effective amount of NGF antagonist.
  • the invention provides methods for enhancing recovery from surgery and/or injury-induced traumatic wound in an individual comprising administering an effective amount of an NGF antagonist.
  • resting pain is suppressed, ameliorated and/or prevented, in some embodiments, mechanically-induced pain (including pain resulting from movement) is suppressed, ameliorated and/or prevented, and in some embodiment, thermally-induced pain is suppressed, ameliorated and/or prevented.
  • mechanically-induced pain is suppressed, ameliorated and/or prevented by administering an anti-NGF antibody.
  • resting pain is suppressed, ameliorated and/or prevented by administering an anti-NGF antibody.
  • thermally-induced pain is suppressed, ameliorated and/or prevented by administering an anti-NGF antibody.
  • allodynia i.e., increased response (i.e., increased noxious sensation) to a normally non-noxious stimulus)
  • hyperalgesia i.e., increased response to a normally noxious or unpleasant stimulus
  • allodynia and/or hyperalgesia is thermal or mechanical (tactile) in nature, or resting pain.
  • the pain is chronic pain.
  • the pain is associated with site of incision, wound or trauma, and/or proximal, at or near the site of incision, wound, and/or trauma.
  • an NGF antagonist suitable for use in the methods of the invention is any agent that can directly or indirectly result in decreased NGF biological activity.
  • an NGF antagonist e.g., an antibody
  • binds (physically interacts with) NGF binds to an NGF receptor (such as trkA receptor and or p75), and/or reduces (impedes and/or blocks) downstream NGF receptor signaling (e.g., inhibitors of kinase signaling).
  • an NGF antagonist binds (physically interacts with) NGF.
  • an NGF antagonist binds to an NGF receptor (such as TrkA receptor and/or ⁇ 75).
  • an NGF antagonist reduces (impedes and/or blocks) downstream NGF receptor signaling (e.g., inhibitors of kinase signaling). In other embodiments, an NGF antagonist inhibits (reduces) NGF synthesis and/or release.
  • the NGF antagonist is an NGF antagonist that is not a TrkA immunoadhesin (i.e., is other than a TrkA immunoadhesin). In another embodiment, the NGF antagonist is other than an anti-NGF antibody. In other embodiment, the NGF antagonist is other than a TrkA immunoadhesin and other than an anti-NGF antibody.
  • the NGF antagonist binds NGF (such as hNGF) and does not significantly bind to related neurotrophins, such as NT- 3, NT4/5, and/or BDNF.
  • the NGF antagonist is selected from any one or more of the following: an anti-NGF antibody, an anti-sense molecule directed to an NGF (including an anti-sense molecule directed to a nucleic acid encoding NGF), an anti-sense molecule directed toward an NGF receptor (such as trkA and/or p75) (including an anti-sense molecule directed to a nucleic acid encoding an NGF receptor), an NGF inhibitory compound, an NGF structural analog, a dominant-negative mutation of a TrkA and/or p75 receptor that binds an NGF, an anti-TrkA antibody, an anti-p75 antibody, and a kinase inhibitor.
  • the NGF antagonist is an anti-NGF antibody.
  • the anti-NGF antibody is humanized (such as antibody E3 described herein).
  • the anti-NGF antibody is antibody E3 (as described herein).
  • the anti-NGF antibody comprises one or more CDR(s) of antibody E3 (such as one, two, three, four, five, or, in some embodiments, all six CDRs from E3).
  • the antibody is human.
  • the anti-NGF antibody comprises the amino acid sequence of the heavy chain variable region shown in Table 1 (SEQ ID NO:l) and the amino acid sequence of the light chain variable region shown in Table 2 (SEQ ID NO:2).
  • the antibody comprises a modified constant region, such as a constant region that is immunologically inert, e.g., does not trigger complement mediated lysis, or does not stimulate antibody-dependent cell mediated cytotoxicity (ADCC).
  • the constant region is modified as described in Eur. J. Immunol. (1999) 29:2613-2624; PCT Application No. PCT/GB99/01441; and/or UK Patent Application No. 9809951.8.
  • the NGF antagonist binds to NGF.
  • the NGF antagonist is an antibody that binds specifically to NGF (such as human NGF).
  • the antibody binds essentially the same NGF epitope 6 as an antibody selected from any one or more of the following mouse monoclonal antibodies: Mab 911, MAb 912 and MAb 938 (See Hongo, et al., Hybridoma 19:215-227 (2000)).
  • the NGF antagonist binds to the trkA receptor.
  • the NGF antagonist may be an anti-human NGF (anti-hNGF) monoclonal antibody that is capable of binding hNGF and effectively inhibiting the binding of hNGF to human TrkA (hTrkA) and/or effectively inhibiting activation of human TrkA receptor.
  • the binding affinity of an anti-NGF antibody to NGF can be about 0.10 to about 1.0 nM, about 0.10 nM to about 0.80 nM, about 0.15 to about 0.75 nM and about 0.18 to about 0.72 nM. In one embodiment, the binding affinity is between about 2 pM and 22 pM. In some embodiment, the binding affinity is about 10 nM. In other embodiments, the binding affinity is less than about 10 nM. In other embodiments, the binding affinity is about 0.1 nM or about 0.07 nM. In other embodiments, the binding affinity is less than about 0.1 nM, or less than about 0.07 nM.
  • the binding affinity is any of about 100 nM, about 50 nM, about 10 nM, about 1 nM, about 500 pM, about 100 pM, or about 50 pM to any of about 2 pM, about 5 pM, about 10 pM, about 15 pM, about 20 pM, or about 40 pM. In some embodiments, the binding affinity is any of about 100 nM, about 50 nM, about 10 nM, about 1 nM, about 500 pM, about 100 pM, or about 50 pM, or less than about 50 pM.
  • the binding affinity is less than any of about 100 nM, about 50 nM, about 10 nM, about 1 nM, about 500 pM, about 100 pM, or about 50 pM. In still other embodiments, the binding affinity is about 2 pM, about 5 pM, about 10 pM, about 15 pM, about 20 pM, about 40 pM, or greater than about 40 pM.
  • binding affinity can be expressed as K D , or dissociation constant, and an increased binding affinity corresponds to a decreased KD-
  • the binding affinity of anti-NGF mouse monoclonal antibody 911 (Hongo et al., Hybridoma 19:215-227 (2000) to human NGF is about 10 nM
  • the binding affinity of humanized anti-NGF antibody E3 (described herein) to human NGF is about 0.07 nM.
  • the NGF antagonist may be administered prior to, during, and/or after the surgery, incision and/or wound that causes or is associated with the post- surgical pain.
  • the NGF antagonist is administered prior to the surgery, incision or wound.
  • Administration of an NGF antagonist can be by any means known in the art, including: orally, intravenously, subcutaneously, intraarterially, intramuscularly, intracardially, intraspinally, intrathoracically, intraperitoneally, intraventricularly, sublingually, and/or transdermally.
  • the NGF antagonist is an anti-NGF antibody, and administration is by one or more of the following means: intravenously, subcutaneously, via inhalation, intraarterially, intramuscularly, intracardially, intraventricularly, and intraperitoneally. Administration may be systemic, e.g. intravenously, or localized.
  • the NGF antagonist is administered in a ' dose of about 0.1 to 10 mg/kg of body weight, and in other embodiments, the NGF antagonist is administered in a dose of about 0.3 to 2.0 mg/kg of body weight.
  • the invention features a composition for treating and/or preventing post-surgical pain comprising an effective amount of a nerve growth factor (NGF) antagonist, in combination with one or more pharmaceutically acceptable excipients.
  • NGF nerve growth factor
  • the NGF antagonist is an antibody that specifically binds to the NGF molecule.
  • the NGF antagonist is any antagonist described herein.
  • the invention features a kit for use in any of the methods described herein.
  • the kit comprises any of the NGF antagonists described herein, in combination with a pharmaceutically acceptable carrier.
  • the kit further comprises instructions for use of the NGF antagonist in any of the methods described herein.
  • Figure 1 is a graph depicting cumulative resting pain as assessed
  • FIG. 1 is a graph depicting thermal pain (hyperalgesia) as assessed 24 hours before surgery (“baseline”), 4 hours after surgery ("post- surgery”) and 1 and 2 days after surgery.
  • Control refers to no anti-NGF antibody treatment
  • 91 refers to animals treated with 35 mg/kg anti-NGF antibody 911 (also called “Mab 911 "). Hongo et al., Hybridoma 19:215-227 (2000). Treatment with anti- NGF antibody significantly reduced post-surgical resting pain.
  • Figure 2 is a graph depicting thermal pain (hyperalgesia) as assessed 24 hours before surgery (“baseline”), 4 hours after surgery ("post- surgery”) and 1 and 2 days after surgery.
  • Control refers to no anti-NGF antibody treatment
  • 91 refers to animals treated with 35 mg/kg anti-NGF antibody 911. Treatment with anti-NGF antibody significantly reduced post- surgical thermal hyperalgesia.
  • Figure 3 is a graph depicting mechanical pain (hyperalgesia) in response to mechanical stimulation as assessed 24 hours before surgery (“baseline”), 3 hours after surgery (“post-surgery”) and 1, 2 and 3 days after surgery.
  • Control refers to no anti-NGF treatment
  • 91 refers to animals treated with anti-NGF antibody 911. Treatment with 7 mg/kg anti-NGF antibody reduced post-surgical mechanically-induced pain.
  • Figure 4 is a graph depicting resting pain assessed 24 hours after surgery and showing that treatment with 0.02 mg/kg, 0.1 mg/kg, 0.6 mg/kg, or 1 mg/kg humanized anti-NGF antibody E3 reduced pain. "*" indicates a statistically significant difference (p ⁇ 0.5) from the negative control.
  • Figure 5 is a graph depicting resting pain assessed 24 hours after surgery and showing that treatment with 0.5 mg/kg of humanized anti-NGF antibody E3 significantly (p ⁇ 0.005) reduced resting pain when injected two hours after surgery.
  • Figure 6 is a graph depicting resting pain assessed 24 hours after surgery and showing that treatment with 5 mg/kg anti-NGF antibody 911 significantly reduced resting pain (p ⁇ 0.02) when injected 14 days pre-surgery.
  • Figure 7 is a graph depicting resting pain assessed 24 hours after surgery and showing that treatment with 5 mg/kg anti-NGF antibody 911 reduced resting pain when injected 21 days pre-surgery.
  • Figure 8 is a graph depicting proportion of intact wounds present after incision and treatment with saline, 1 mg/kg anti-NGF antibody 911, or the positive control, ketorolac.
  • the proportion of intact wounds following treatment with anti-NGF antibody 911 did not differ from the proportion of intact wounds following treatment with saline (negative control).
  • treatment with anti-NGF antibody showed no effect on wound healing.
  • animals treated with the NSAID ketorolac positive control
  • Figure 9 is a graph depicting that treatment with the small molecule NGF antagonist, K252a, significantly (p O.005) reduced resting pain after surgery, when assessed at three hours ("3H-P-tmt") after treatment with K252a.
  • “lH-P-tmt” refers to one hour post-K525a treatment.
  • Figure 10 is a graph comparing treatment with anti-NGF antibody,
  • the present invention is based on the discovery that in vivo administration of a therapeutically effective amount of an NGF antagonist such as anti-NGF monoclonal antibody may be used to prevent and/or treat post-surgical pain.
  • Post-surgical pain has been previously treated with high doses of opioid analgesics. These agents cause undesirable side effects such as decreased gastric motility, sedation, respiratory depression and renal colic.
  • opioid analgesics such as opioid analgesics.
  • Other pain agents, such as NSAIDs have been relatively unsuccessful in treating this type of pain. Further, some NSAIDs are known to inhibit wound healing.
  • the invention features methods of preventing or treating post- surgical pain in an individual (including a mammal, both human and non-human) by administering an effective amount of an NGF antagonist such as an anti-NGF antibody, for instance an anti-human NGF (anti-hNGF) monoclonal antibody.
  • an NGF antagonist such as an anti-NGF antibody, for instance an anti-human NGF (anti-hNGF) monoclonal antibody.
  • the invention provides methods for ameliorating, delaying the development of and/or preventing the progression of post-surgical pain comprising administering an effective amount of an NGF antagonist to an individual.
  • resting pain is suppressed, ameliorated and/or prevented, and in some embodiments, mechanically-induced pain (such as pain resulting from movement or other mechanical or tactile stimulation) is suppressed, ameliorated and/or prevented.
  • thermally- induced pain is suppressed, ameliorated and/or prevented.
  • mechanically-induced pain is suppressed, ameliorated and/or prevented by administering an anti-NGF antibody.
  • resting pain is suppressed, ameliorated and/or prevented by administering an anti-NGF antibody.
  • thermally-induced pain is suppressed, ameliorated and/or prevented by administering an anti-NGF antibody.
  • allodynia is suppressed, ameliorated and/or prevented, and in some embodiments, hyperalgesia is suppressed, ameliorated and/or prevented.
  • allodynia and/or hyperalgesia is thermal or mechanical (tactile) in nature, or resting pain.
  • the pain is chronic pain. In other embodiments, the pain is at, proximal, and/or near to one or more site(s) of incision, wound or trauma.
  • compositions and kits for treating post- surgical pain comprising an NGF antagonist such as an anti-NGF antibody, for instance an anti-NGF monoclonal antibody, for use in any of the methods provided herein.
  • an NGF antagonist such as an anti-NGF antibody, for instance an anti-NGF monoclonal antibody, for use in any of the methods provided herein.
  • the anti-NGF antibody is capable of effectively inhibiting NGF binding to its TrkA and/or p75 receptor(s) and/or of effectively inhibiting NGF from activating its TrkA and/or p75 receptor(s).
  • an "antibody” (interchangeably used in plural form) is an immunoglobulin molecule capable of specific binding to a target, such as a carbohydrate, polynucleotide, lipid, polypeptide, etc., through at least one antigen recognition site, located in the variable region of the immunoglobulin molecule.
  • the term encompasses not only intact polyclonal or monoclonal antibodies, but also fragments thereof (such as Fab, Fab', F(ab')2, Fv), single chain (ScFv), mutants thereof, fusion proteins comprising an antibody portion, humanized antibodies, chimeric antibodies, diabodies linear antibodies, single chain antibodies, multispecific antibodies (e.g., bispecific antibodies) and any other modified configuration of the immunoglobulin molecule that comprises an antigen recognition site of the required specificity.
  • An antibody includes an antibody of any class, such as IgG, IgA, or IgM (or sub-class thereof), and the antibody need not be of any particular class.
  • immunoglobulins can be assigned to different classes. There are five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into subclasses (isotypes), e.g., IgGl, IgG2, IgG3, IgG4, IgAl and IgA2.
  • the heavy- chain constant domains that correspond to the different classes of immunoglobulins are called alpha, delta, epsilon, gamma, and mu, respectively.
  • the subunit structures and three-dimensional configurations of different classes of immunoglobulins are well known.
  • a “monoclonal antibody” refers to a homogeneous antibody population wherein the monoclonal antibody is comprised of amino acids (naturally occurring and non-naturally occurring) that are involved in the selective binding of an antigen.
  • a population of monoclonal antibodies is highly specific, being directed against a single antigenic site.
  • the term "monoclonal antibody” encompasses not only intact monoclonal antibodies and full-length monoclonal antibodies, but also fragments thereof (such as Fab, Fab', F(ab')2, Fv), single chain (ScFv), mutants thereof, fusion proteins comprising an antibody portion, humanized monoclonal antibodies, chimeric monoclonal antibodies, and any other modified configuration of the immunoglobulin molecule that comprises an antigen recognition site of the required specificity and the ability to bind to an antigen. It is not intended to be limited as regards to the source of the antibody or the manner in which it is made (e.g., by hybridoma, phage selection, recombinant expression, transgenic animals, etc.).
  • Humanized antibodies refer to a molecule having an antigen binding site that is substantially derived from an immunoglobulin from a non- human species and the remaining immunoglobulin structure of the molecule based upon the structure and/or sequence of a human immunoglobulin.
  • the antigen binding site may comprise either complete variable domains fused onto constant domains or only the complementarity determining regions (CDRs) grafted onto appropriate framework regions in the variable domains.
  • Antigen binding sites may be wild type or modified by one or more amino acid substitutions, e.g., modified to resemble human immunoglobulin more closely.
  • Some forms of humanized antibodies preserve all CDR sequences (for example, a humanized mouse antibody which contains all six CDRs from the mouse antibodies).
  • humanized antibodies have one or more CDRs (one, two, three, four, five, six) which are altered with respect to the original antibody.
  • framework region (FR) residues or other residues of the human immunoglobulin replaced by corresponding non-human residues.
  • humanized antibodies may comprise residues which are not found in the recipient antibody or in the donor antibody.
  • NGF nerve growth factor
  • nerve growth factor and “NGF” refers to nerve growth factor and variants thereof that retain at least part of the activity of NGF.
  • NGF includes all mammalian species of native sequence NGF, including human, canine, feline, equine, or bovine.
  • NGF receptor refers to a polypeptide that is bound by or activated by NGF.
  • NGF receptors include the TrkA receptor and the p75 receptor of any mammalian species, including, but are not limited to, human, canine, feline, equine, primate, or bovine.
  • NGF antagonist refers to any molecule that blocks, suppresses or reduces (including significantly) NGF biological activity, including downstream pathways mediated by NGF signaling, such as receptor binding and/or elicitation of a cellular response to NGF.
  • antagonist implies no specific mechanism of biological action whatsoever, and is deemed to expressly include and encompass all possible pharmacological, physiological, and biochemical interactions with NGF whether direct or indirect, or whether interacting with NGF, its receptor, or through another mechanism, and its consequences which can be achieved by a variety of different, and chemically divergent, compositions.
  • Exemplary NGF antagonists include, but are not limited to, an anti-NGF antibody, an anti-sense molecule directed to an NGF (including an anti-sense molecule directed to a nucleic acid encoding NGF), an NGF inhibitory compound, an NGF structural analog, a dominant-negative mutation of a TrkA receptor that binds an NGF, a TrkA immunoadhesin, an anti-TrkA antibody, an anti-p75 antibody, and a kinase inhibitor.
  • an NGF antagonist e.g., an antibody
  • NGF receptor such as trkA receptor and/or p75 receptor
  • an NGF antagonist binds NGF and prevents TrkA receptor dimerization and/or TrkA autophosphorylation. In other embodiments, an NGF antagonist inhibits or reduces NGF synthesis and/or production (release). Examples of types of NGF antagonists are provided herein.
  • an "anti-NGF antibody” refers to an antibody which is able to bind to NGF and inhibit NGF biological activity and/or downstream pathway(s) mediated by NGF signaling.
  • TrkA immunoadhesin refers to a soluble chimeric molecule comprising a fragment of a TrkA receptor, for example, the extracellular domain of a TrkA receptor and an immunoglobulin sequence, which retains the binding specificity of the TrkA receptor.
  • Bioactivity of NGF generally refers to the ability to bind
  • NGF receptors and/or activate NGF receptor signaling pathways.
  • a biological activity includes any one or more of the following: the ability to bind an NGF receptor (such as p75 and/or TrkA); the ability to promote TrkA receptor dimerization and/or autophosphorylation; the ability to activate an NGF receptor signaling pathway; the ability to promote cell differentiation, proliferation, survival, growth and other changes in cell physiology, including (in the case of neurons, including peripheral and central neuron) change in neuronal morphology, synaptogenesis, synaptic function, neurotransmitter and/or neuropeptide release and regeneration following damage; and the ability to mediate post-surgical pain.
  • an NGF receptor such as p75 and/or TrkA
  • TrkA receptor dimerization and/or autophosphorylation the ability to activate an NGF receptor signaling pathway
  • the ability to promote cell differentiation, proliferation, survival, growth and other changes in cell physiology including (in the case of neurons, including peripheral and central neuron) change in neuronal morph
  • epitopope is used to refer to binding sites for (monoclonal or polyclonal) antibodies on protein antigens.
  • treatment is an approach for obtaining beneficial or desired clinical results.
  • beneficial or desired clinical results include, but are not limited to, one or more of the following: improvement in any aspect of the pain including lessening severity, alleviation of one or more symptoms associated with post-surgical pain including any aspect of post-surgical pain (such as resting pain and/or mechanically-induced pain, shortening duration of pain, and/or reduction of pain sensitivity or sensation).
  • An "effective amount” is an amount sufficient to effect beneficial or desired clinical results including alleviation or reduction in pain.
  • an effective amount of an NGF antagonist is an amount sufficient to treat, ameliorate, reduce the intensity of or prevent post-surgical pain.
  • the "effective amount” may reduce pain at rest (resting pain) or mechanically-induced pain (including pain following movement, or both), and it may be administered before, during, and/or after an incision, cut, tear or injury. In some embodiment, the "effective amount” is an amount sufficient to delay development of post-surgical pain. [0062] "Reducing incidence" of pain means any of reducing severity
  • a "method of reducing incidence of post-surgical pain in an individual" reflects administering the NGF antagonist described herein based on a reasonable expectation that such administration may likely cause such a reduction in incidence in that particular individual.
  • “Ameliorating" post-surgical pain or one or more symptoms of post-surgical pain means a lessening or improvement of one or more symptoms of a post-surgical pain as compared to not administering an NGF antagonist. "Ameliorating” also includes shortening or reduction in duration of a symptom.
  • "Palliating" post-surgical pain or one or more symptoms of a post- surgical pain means lessening the extent of one or more undesirable clinical manifestations of post-surgical pain in an individual or population of individuals treated with an NGF antagonist in accordance with the invention.
  • “delaying" the development of post-surgical pain means to defer, hinder, slow, retard, stabilize, and/or postpone progression of post-surgical pain.
  • This delay can be of varying lengths of time, depending on the history of the disease and/or individuals being treated. As is evident to one skilled in the art, a sufficient or significant delay can, in effect, encompass prevention, in that the individual does not develop post-surgical pain.
  • a method that "delays" development of the symptom is a method that reduces probability of developing the symptom in a given time frame and/or reduces extent of the symptoms in a given time frame, when compared to not using the method. Such comparisons are typically based on clinical studies, using a statistically significant number of subjects.
  • “Development” or “progression” of post-surgical pain means initial manifestations and/or ensuing progression of the disorder. Development of post- surgical pain can be detectable and assessed using standard clinical techniques as well known in the art. However, development also refers to progression that may be undetectable. For purpose of this invention, development or progression refers to the biological course of the symptoms. “Development” includes occurrence, recurrence, and onset. As used herein "onset” or “occurrence” of post-surgical pain includes initial onset and/or recurrence.
  • An "individual” is a vertebrate, preferably a mammal, more preferably a human. Mammals include, but are not limited to, farm animals, sport animals, pets, primates, horses, dogs, cats, mice and rats. [0068] "Post-surgical pain” (interchangeably termed “post-incisional” or
  • post-traumatic pain refers to pain arising or resulting from an external trauma such as a cut, puncture, incision, tear, or wound into tissue of an individual (including that that arises from all surgical procedures, whether invasive or non- invasive).
  • post-surgical pain does not include pain that occurs without an external physical trauma.
  • post-surgical pain is internal or external pain, and the wound, cut, trauma, tear or incision may occur accidentally (as with a traumatic wound) or deliberately (as with a surgical incision).
  • pain includes nociception and the sensation of pain, and pain can be assessed objectively and subjectively, using pain scores and other methods well-known in the art.
  • Post-surgical pain includes allodynia (i.e., increased response to a normally non-noxious stimulus) and hyperalgesia (i.e., increased response to a normally noxious or unpleasant stimulus), which can in turn, be thermal or mechanical (tactile) in nature.
  • the pain is characterized by thermal sensitivity, mechanical sensitivity and/or resting pain.
  • the post-surgical pain comprises mechanically-induced pain or resting pain.
  • the post-surgical pain comprises resting pain.
  • the pain can be primary or secondary pain, as is well-known in the art.
  • “Resting pain” refers to pain occurring even while the individual is at rest as opposed to, for example, pain occurring when the individual moves or is subjected to other mechanical stimuli (for example, poking or prodding).
  • “Mechanically-induced pain” (interchangeably termed mechanosensory pain) refers to pain induces by a mechanical stimulus, such as the application of weight to a surface, tactile stimulus, and stimulation caused or associated with movement (including coughing, shifting of weight, etc.).
  • Recovery from surgery, trauma or wound is "enhanced” when an aspect of recovery from surgery, trauma, or wound is improved (as compared to recovery from surgery, trauma or wound without administering an NGF antagonist).
  • the presence and/or intensity of undesired side-effects may be reduced and/or eliminated in the presence of an NGF antagonist relative to the presence and/or intensity of such side-effects in the absence of an NGF antagonist.
  • This enhancement is indicated by administration of an NGF antagonist and is not meant to convey that such a comparison (administration of an NGF antagonist verses no administration) must be conducted and proven with respect to any given individual.
  • compositions comprising one or more of these agents.
  • These compositions may further comprise suitable excipients, such as pharmaceutically acceptable excipients (carriers) including buffers, which are well known in the art.
  • suitable excipients such as pharmaceutically acceptable excipients (carriers) including buffers, which are well known in the art.
  • carriers such as pharmaceutically acceptable excipients (carriers) including buffers, which are well known in the art.
  • carriers such as pharmaceutically acceptable excipients (carriers) including buffers, which are well known in the art.
  • the present invention can be used alone or in combination with other conventional methods of treatment.
  • the present invention is useful for treating, delaying development of and/or preventing post-surgical pain in individuals including all mammals, both human and non-human. Moreover, the present invention is useful in individuals having an incisional wound to tissue whether a cut, puncture or tear, whether internal or external. Such an incisional wound may occur accidentally as with traumatic wound or deliberately as with surgery.
  • the invention provides methods of treating post-surgical pain in an individual comprising administering an effective amount of an NGF antagonist, such as an anti-NGF antibody.
  • an NGF antagonist such as an anti-NGF antibody.
  • the post-surgical pain comprises one or more of: allodynia, hyperalgesia, mechanically-induced pain, thermally-induced pain, mechanically induced pain, or resting pain.
  • the post-surgical pain comprises mechanically-induced pain and/or resting pain.
  • anti-NGF antibodies alleviate both of these aspects.
  • the post-surgical pain comprises resting pain.
  • the pain can be primary and/or secondary pain.
  • allodynia is suppressed, ameliorated and/or prevented, and in some embodiments, hyperalgesia is suppressed, ameliorated and/or prevented.
  • allodynia and/or hyperalgesia is thermal or mechanical (tactile) in nature (or both), or resting pain.
  • the pain is chronic pain. In other embodiments, the pain is at, proximal and/or near to one or more site(s) of incision, wound or trauma.
  • the invention provides methods of preventing, ameliorating and/or preventing the development or progression of post-surgical pain.
  • the NGF antagonist such as an anti-NGF antibody
  • the NGF antagonist is administered prior to surgery (in some embodiment, prior to activity likely to result in external trauma and/or wound).
  • the NGF antagonist can be administered 30 minutes, one hour, 5 hours, 10 hours, 15 hours, 24 hours or even more, such as 1 day, several days, or even a week, two weeks, three weeks, or more prior to the activity with a risk of trauma, wound or incision, or prior to an operation (in some embodiment, likely to result in trauma, wound or incision).
  • the NGF antagonist is administered during and/or after surgery or activity likely to result in external trauma or wound.
  • the NGF antagonist is administered 1 hour, 2 hours, 3 hours, 4 hours, 6 hours, 8 hours, 12 hours, 24 hours, 30 hours, 36 hours, or more, after surgery, wound, or trauma.
  • the invention provides methods for increasing pain threshold.
  • increasing pain threshold refers to a reduction, diminishment and/or minimization of pain associated with surgery, incision, trauma or wound (including reduced, diminished, and/or minimized subjective perception of pain).
  • the invention provides methods for enhancing recovery from surgery (as well as enhancing recovery from wound, traumatic injury, and/or incision).
  • the NGF antagonist can be administered before an event or condition(s) with an increased risk of external trauma (such as an impact), injury, or wound.
  • an event or condition with increased risk of external trauma, injury or wound encompasses dangerous vocations, combat, and/or sporting activities.
  • Diagnosis or assessment of pain is well-established in the art.
  • Pain relief may also be characterized by time course of relief.
  • pain relief is subjectively or objectively observed after 1, 2, or a few hours (and in some embodiments, peaks at about 12- 18 hours). In another embodiment, pain relief is subjectively or objectively observed at 24, 36, 48, 60 72 or more hours following surgery (or event associated with wound or trauma).
  • NGF antagonists refers to any molecule that blocks, suppresses or reduces (including significantly) NGF biological activity, including downstream pathways mediated by NGF signaling, such as receptor binding and/or elicitation of a cellular response to NGF.
  • the term "antagonist” implies no specific mechanism of biological action whatsoever, and is deemed to expressly include and encompass all possible pharmacological, physiological, and biochemical interactions with NGF and its consequences which can be achieved by a variety of different, and chemically divergent, compositions.
  • Exemplary NGF antagonists include, but are not limited to, an anti-NGF antibody, an anti-sense molecule directed to NGF (including an anti-sense molecule directed to a nucleic acid encoding NGF), an anti-sense molecule directed to an NGF receptor (such as TrkA receptor and/or p75 receptor) (including an anti-sense molecule directed to a nucleic acid encoding TrkA and/or p75), an NGF inhibitory compound, an NGF structural analog, a dominant-negative mutation of a TrkA receptor that binds an NGF, a TrkA immunoadhesin, an anti-TrkA antibody, an anti-p75 antibody, and a kinase inhibitor.
  • an anti-NGF antibody an anti-sense molecule directed to NGF (including an anti-sense molecule directed to a nucleic acid encoding NGF)
  • an anti-sense molecule directed to an NGF receptor such as TrkA receptor and/or p75
  • an NGF antagonist e.g., an antibody
  • NGF receptor such as TrkA receptor and/or p75 receptor
  • an NGF antagonist binds (physically interacts with) NGF.
  • an NGF antagonist binds to an NGF receptor (such as trkA receptor or p75). In other embodiments, an NGF antagonist reduces (impedes and/or blocks) downstream NGF receptor signaling (e.g., inhibitors of kinase signaling). In other embodiments, an NGF antagonist inhibits (reduces) NGF synthesis and/or release. In another embodiment, the NGF antagonist is an NGF antagonist that is not a TrkA immunoadhesin (i.e., is other than a TrkA immunoadhesin). In another embodiment, the NGF antagonist is other than an anti-NGF antibody.
  • the NGF antagonist is other than a TrkA immunoadhesin and other than an anti-NGF antibody.
  • the NGF antagonist binds NGF (such as hNGF) and does not significantly bind to related neurotrophins, such as NT-3, NT4/5, and/or BDNF.
  • the NGF antagonist is not associated with an adverse immune response.
  • the NGF antagonist is an anti-NGF antibody.
  • the anti-NGF antibody is humanized (such as antibody E3 described herein).
  • the anti-NGF antibody is antibody E3 (as described herein).
  • the anti-NGF antibody comprises one or more CDR(s) of antibody E3 (such as one, two, three, four, five, or, in some embodiments, all six CDRs from E3).
  • the antibody is human.
  • the anti-NGF antibody comprises the amino acid sequence of the heavy chain variable region shown in Table 1 (SEQ ID NO:l) and the amino acid sequence of the light chain variable region shown in Table 2 (SEQ ID NO:2).
  • the antibody comprises a modified constant region, such as a constant region that is immunologically inert, e.g., does not trigger complement mediated lysis, or does not stimulate antibody-dependent cell mediated cytotoxicity (ADCC).
  • the constant region is modified as described in Eur. J. Immunol. (1999) 29:2613-2624; PCT Application No. PCT/GB99/01441; and/or UK Patent Application No. 9809951.8.
  • the NGF antagonist comprises an anti-NGF antibody.
  • An anti-NGF antibody should exhibit any one or more of the following characteristics: (a) bind to NGF; (b) inhibit NGF biological activity or downstream pathways mediated by NGF signaling function; (c) prevent, ameliorate, or treat any aspect of post-surgical pain; (d) block or decrease NGF receptor activation (including TrkA receptor dimerization and/or autophosphorylation); (e) increase clearance of NGF; (f) inhibit (reduce) NGF synthesis, production or release; (g) enhance recovery from surgery, wound or trauma.
  • Anti-NGF antibodies are known in the art, see, e.g., PCT
  • the anti-NGF antibody is a humanized mouse anti-NGF monoclonal antibody termed antibody "E3", which comprises the human heavy chain IgG2a constant region containing the following mutations:
  • IgG2a sequence see Eur. J. Immunol. (1999) 29:2613-2624); the human light chain kappa constant region; and the heavy and light chain variable regions shown in Tables 1 and 2.
  • KAPKLLIYYTSRFHSGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQEHT LPYTFGQGTKLEIKRT (SEQ ID NO:2).
  • Vector Eb.911.3E is a polynucleotide encoding the light chain variable region shown in Table 2; vector Eb.pur.911.3E is a polynucleotide encoding the light chain variable region shown in Table 2 and vector Db.911.3E is a polynucleotide encoding the heavy chain variable region shown in Table 1.
  • the anti-NGF antibody comprises one or more CDR(s) of antibody E3 (such as one, two, three, four, five, or, in some embodiments, all six CDRs from E3). Determination of CDR regions is well within the skill of the art.
  • the antibodies useful in the present invention can encompass monoclonal antibodies, polyclonal antibodies, antibody fragments (e.g., Fab, Fab', F(ab')2, Fv, Fc, etc.), chimeric antibodies, bispecific antibodies, heteroconjugate antibodies, single chain (ScFv), mutants thereof, fusion proteins comprising an antibody portion, humanized antibodies, and any other modified configuration of the immunoglobulin molecule that comprises an antigen recognition site of the required specificity, including glycosylation variants of antibodies, amino acid sequence variants of antibodies, and covalently modified antibodies.
  • the antibodies may be murine, rat, human, or any other origin (including chimeric or humanized antibodies).
  • the antibody reacts with NGF in a manner that inhibits NGF and/or downstream pathways mediated by the NGF signaling function.
  • the antibody is a human antibody which recognizes one or more epitopes on human NGF.
  • the antibody is a mouse or rat antibody which recognizes one or more epitopes on human NGF.
  • the antibody recognizes one or more epitopes on an NGF selected from the group consisting of: primate, canine, feline, equine, and bovine.
  • the antibody comprises a modified constant region, such as a constant region that is immunologically inert, e.g., does not trigger complement mediated lysis, or does not stimulate antibody- dependent cell mediated cytotoxicity (ADCC).
  • ADCC activity can be assessed using methods disclosed in U.S. Patent No. 5, 500, 362.
  • the constant region is modified as described in Eur. J. Immunol. (1999) 29:2613-2624; PCT Application No. PCT/GB99/01441; and/or UK Patent Application No. 9809951.8.
  • the binding affinity of an anti-NGF antibody to NGF can be about 0.10 to about 0.80 nM, about 0.15 to about 0.75 nM and about 0.18 to about 0.72 nM. In one embodiment, the binding affinity is between about 2 pM and 22 pM. In some embodiment, the binding affinity is about 10 nM. In other embodiments, the binding affinity is less than about 10 nM. In other embodiments, the binding affinity is about 0.1 nM or about 0.07 nM. In other embodiments, the binding affinity is less than about 0.1 nM, or less than about 0.07 nM.
  • the binding affinity is any of about 100 nM, about 50 nM, about 10 nM, about 1 nM, about 500 pM, about 100 pM, or about 50 pM to any of about 2 pM, about 5 pM, about 10 pM, about 15 pM, about 20 pM, or about 40 pM. In some embodiments, the binding affinity is any of about 100 nM, about 50 nM, about 10 nM, about 1 nM, about 500 pM, about 100 pM, or about 50 pM, or less than about 50 pM.
  • the binding affinity is less than any of about 100 nM, about 50 nM, about 10 nM, about 1 nM, about 500 pM, about 100 pM, or about 50 pM. In still other embodiments, the binding affinity is about 2 pM, about 5 pM, about 10 pM, about 15 pM, about 20 pM, about 40 pM, or greater than about 40 pM.
  • One way of determining binding affinity of antibodies to NGF is by measuring binding affinity of monofunctional Fab fragments of the antibody. To obtain monofunctional Fab fragments, an antibody (for example, IgG) can be cleaved with papain or expressed recombinantly.
  • CM5 chips can be activated with N-ethyl-N'-(3- dimethylaminopropyl)-carbodiinide hydrochloride (EDC) and N- hydroxysuccinimide (NHS) according to the supplier's instructions.
  • EDC N-ethyl-N'-(3- dimethylaminopropyl)-carbodiinide hydrochloride
  • NHS N- hydroxysuccinimide
  • the antibody binds human NGF, and does not significantly bind an NGF from another vertebrate species (in some embodiment, mammalian). In some embodiments, the antibody binds human NGF as well as one or more NGF from another vertebrate species (in some embodiments, mammalian). In still other embodiments, the antibody binds NGF and does not significantly cross-react with other neurotrophins (such as the related neurotrophins, NT3, NT4/5, and/or BDNF). In some embodiments, the antibody binds NGF as well as at least one other neurotrophin.
  • other neurotrophins such as the related neurotrophins, NT3, NT4/5, and/or BDNF.
  • the antibody binds to a mammalian species of NGF, such as horse or dog, but does not significantly bind to NGF from anther mammalian species.
  • the epitope(s) can be continuous or discontinuous.
  • the antibody binds essentially the same hNGF epitopes as an antibody selected from the group consisting of MAb 911, MAb 912, and MAb 938 as described in Hongo et al., Hybridoma, 19:215-227 (2000).
  • the antibody binds essentially the same hNGF epitope as MAb 911.
  • the antibody binds essentially the same epitope as MAb 909. Hongo et al., supra.
  • the epitope may comprise one or more of: residues K32, K34 and E35 within variable region 1 (amino acids 23- 35) of hNGF; residues F79 and T81 within variable region 4 (amino acids 81-88) of hNGF; residues H84 and K88 within variable region 4; residue R103 between variable region 5 (amino acids 94-98) of hNGF and the C-terminus (amino acids 111-118) of hNGF; residue El l within pre-variable region 1 (amino acids 10-23) of hNGF; Y52 between variable region 2 (amino acids 40-49) of hNGF and variable region 3 (amino acids 59-66) of hNGF; residues LI 12 and SI 13 within the C-terminus of hNGF; residues R59 and R69 within variable region 3 of hNGF; or residues VI 8, V20, and G23 within pre-variable region 1 of hNGF.
  • an epitope can comprise one or more of the variable region 1, variable region 3, variable region 4, variable region 5, the N-terminus region, and /or the C-terminus of hNGF.
  • the antibody significantly reduces the solvent accessibility of residue R103 of hNGF.
  • antibodies that can inhibit NGF may be made by using immunogens that express full length or partial sequence of NGF.
  • an immunogen comprising a cell that overexpresses NGF may be used.
  • Another example of an immunogen that can be used is NGF protein that contains full-length NGF or a portion of the NGF protein.
  • the anti-NGF antibodies may be made by any method known in the art.
  • the route and schedule of immunization of the host animal are generally in keeping with established and conventional techniques for antibody stimulation and production, as further described herein.
  • General techniques for production of human and mouse antibodies are known in the art and are described herein.
  • any mammalian subject including humans or antibody producing cells therefrom can be manipulated to serve as the basis for production of mammalian, including human, hybridoma cell lines.
  • the host animal is inoculated intraperitoneally, intramuscularly, orally, subcutaneously, intraplantar, and/or intradermally with an amount of immunogen, including as described herein.
  • Hybridomas can be prepared from the lymphocytes and immortalized myeloma cells using the general somatic cell hybridization technique of Kohler, B. and Milstein, C. (1975) Nature 256:495-497 or as modified by Buck, D. W., et al., In Vitro, 18:377-381 (1982).
  • Available myeloma lines including but not limited to X63-Ag8.653 and those from the Salk Institute, Cell Distribution Center, San Diego, Calif., USA, may be used in the hybridization.
  • the technique involves fusing myeloma cells and lymphoid cells using a fusogen such as polyethylene glycol, or by electrical means well known to those skilled in the art.
  • the cells are separated from the fusion medium and grown in a selective growth medium, such as hypoxanthine-aminopterin-thymidine (HAT) medium, to eliminate unhybridized parent cells.
  • a selective growth medium such as hypoxanthine-aminopterin-thymidine (HAT) medium
  • HAT hypoxanthine-aminopterin-thymidine
  • Any of the media described herein, supplemented with or without serum, can be used for culturing hybridomas that secrete monoclonal antibodies.
  • EBN immortalized B cells may be used to produce the anti- ⁇ GF monoclonal antibodies of the subject invention.
  • hybridomas are expanded and subcloned, if desired, and supernatants are assayed for anti-immunogen activity by conventional immunoassay procedures (e.g., radioimmunoassay, enzyme immunoassay, or fluorescence immunoassay).
  • immunoassay procedures e.g., radioimmunoassay, enzyme immunoassay, or fluorescence immunoassay.
  • Hybridomas that may be used as source of antibodies encompass all derivatives, progeny cells of the parent hybridomas that produce monoclonal antibodies specific for ⁇ GF, or a portion thereof. Hybridomas that produce such antibodies may be grown in vitro or in vivo using known procedures. The monoclonal antibodies may be isolated from the culture media or body fluids, by conventional immunoglobulin purification procedures such as ammonium sulfate precipitation, gel electrophoresis, dialysis, chromatography, and ultrafiltration, if desired. Undesired activity if present, can be removed, for example, by running the preparation over adsorbents made of the immunogen attached to a solid phase and eluting or releasing the desired antibodies off the immunogen.
  • a protein that is immunogenic in the species to be immunized e.g., keyhole limpet hemocyanin, serum albumin, bovine thyroglobulin, or soybean
  • the anti-NGF antibody (monoclonal or polyclonal) of interest may be sequenced and the polynucleotide sequence may then be cloned into a vector for expression or propagation.
  • the sequence encoding the antibody of interest may be maintained in vector in a host cell and the host cell can then be expanded and frozen for future use.
  • the polynucleotide sequence may be used for genetic manipulation to "humanize" the antibody or to improve the affinity, or other characteristics of the antibody.
  • the constant region may be engineered to more resemble human constant regions to avoid immune response if the antibody is used in clinical trials and treatments in humans.
  • a number of "humanized" antibody molecules comprising an antigen-binding site derived from a non-human immunoglobulin have been described, including chimeric antibodies having rodent or modified rodent V regions and their associated complementarity determining regions (CDRs) fused to human constant domains.
  • CDRs complementarity determining regions
  • rodent CDRs grafted into a human supporting framework region (FR) prior to fusion with an appropriate human antibody constant domain See, for example, Riechmann et al. Nature 332:323- 327 (1988), Nerhoeyen et al. Science 239:1534-1536 (1988), and Jones et al. Nature 321 :522-525 (1986).
  • Another reference describes rodent CDRs supported by recombinantly veneered rodent framework regions. See, for example, European Patent Publication No. 0519596. These "humanized" molecules are designed to minimize unwanted immunological response toward rodent anti- human antibody molecules which limits the duration and effectiveness of therapeutic applications of those moieties in human recipients.
  • the antibody constant region can be engineered such that it is immunologically inert (e.g., does not trigger complement lysis). See, e.g. PCT Application No. PCT/GB99/01441; UK Patent Application No. 9809951.8.
  • Other methods of humanizing antibodies that may also be utilized are disclosed by Daugherty et al, Nucl Acids Res. 19:2471-2476 (1991) and in U.S. Patent Nos. 6,180,377; 6,054,297; 5,997,867; 5,866,692; 6,210,671; and 6,350,861; and in PCT Publication No. WO 01/27160.
  • Fully human antibodies may be obtained by using commercially available mice that have been engineered to express specific human immunoglobulin proteins. Transgenic animals that are designed to produce a more desirable (e.g., fully human antibodies) or more robust immune response may also be used for generation of humanized or human antibodies. Examples of such technology are Xenomouse TM from Abgenix, Inc. (Fremont, CA) and HuMAb-Mouse® and TC MouseTM from Medarex, Inc. (Princeton, NJ). [0104] In an alternative, antibodies may be made recombinantly and expressed using any method known in the art. In another alternative, antibodies may be made recombinantly by phage display technology. See, for example, U.S.
  • the filamentous particle contains a single-stranded DNA copy of the phage genome, selections based on the functional properties of the antibody also result in selection of the gene encoding the antibody exhibiting those properties.
  • the phage mimics some of the properties of the B cell.
  • Phage display can be performed in a variety of formats; for review see, e.g., Johnson, Kevin S. and Chiswell, David J., Current Opinion in Structural Biology 3, 564-571 (1993).
  • V-gene segments can be used for phage display.
  • Antibodies may be made recombinantly by first isolating the antibodies and antibody producing cells from host animals, obtaining the gene sequence, and using the gene sequence to express the antibody recombinantly in host cells (e.g., CHO cells). Another method which may be employed is to express the antibody sequence in plants (e.g., tobacco) or transgenic milk. Methods for expressing antibodies recombinantly in plants or milk have been disclosed. See, for example, Peeters, et al. Vaccine 19:2756 (2001); Lonberg, N. and D. Huszar Int. Rev. Immunol 13:65 (1995); and Pollock, et al, J Immunol Methods 231 :147( 1999). Methods for making derivatives of antibodies, e.g., humanized, single chain, etc. are known in the art.
  • Immunoassays and flow cytometry sorting techniques such as fluorescence activated cell sorting (FACS) can also be employed to isolate antibodies that are specific for NGF.
  • FACS fluorescence activated cell sorting
  • the antibodies can be bound to many different carriers.
  • Carriers can be active and/or inert. Examples of well-known carriers include polypropylene, polystyrene, polyethylene, dextran, nylon, amylases, glass, natural and modified celluloses, polyacrylamides, agaroses and magnetite. The nature of the carrier can be either soluble or insoluble for purposes of the invention. Those skilled in the art will know of other suitable carriers for binding antibodies, or will be able to ascertain such, using routine experimentation.
  • DNA encoding the monoclonal antibodies is readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the monoclonal antibodies).
  • the hybridoma cells serve as a preferred source of such DNA.
  • the DNA may be placed into expression vectors (such as expression vectors disclosed in PCT Publication No. WO 87/04462), which are then transfected into host cells such as E. coli cells, simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of monoclonal antibodies in the recombinant host cells.
  • expression vectors such as expression vectors disclosed in PCT Publication No. WO 87/04462
  • host cells such as E. coli cells, simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells
  • the DNA also may be modified, for example, by substituting the coding sequence for human heavy and light chain constant domains in place of the homologous murine sequences, Morrison et al, Proc. Nat. Acad. Sci. 81:6851 (1984), or by covalently joining to the immunoglobulin coding sequence all or part of the coding sequence for a non-immunoglobulin polypeptide.
  • "chimeric" or “hybrid” antibodies are prepared that have the binding specificity of an anti-NGF monoclonal antibody herein.
  • Anti-NGF antibodies may be characterized using methods well known in the art.
  • one method is to identify the epitope to which it binds, or "epitope mapping.”
  • epitope mapping There are many methods known in the art for mapping and characterizing the location of epitopes on proteins, including solving the crystal structure of an antibody-antigen complex, competition assays, gene fragment expression assays, and synthetic peptide-based assays, as described, for example, in Chapter 11 of Harlow and Lane, Using Antibodies, a Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York, 1999.
  • epitope mapping can be used to determine the sequence to which an anti-NGF antibody binds.
  • Epitope mapping is commercially available from various sources, for example, Pepscan Systems (Edelhertweg 15, 8219 PH Lelystad, The Netherlands).
  • the epitope can be a linear epitope, i.e., contained in a single stretch of amino acids, or a confbrmational epitope formed by a three-dimensional interaction of amino acids that may not necessarily be contained in a single stretch.
  • Peptides of varying lengths e.g., at least 4-6 amino acids long
  • the epitope to which the anti-NGF antibody binds can be determined in a systematic screening by using overlapping peptides derived from the NGF sequence and determining binding by the anti-NGF antibody.
  • the gene fragment expression assays the open reading frame encoding NGF is fragmented either randomly or by specific genetic constructions and the reactivity of the expressed fragments of NGF with the antibody to be tested is determined.
  • the gene fragments may, for example, be produced by PCR and then transcribed and translated into protein in vitro, in the presence of radioactive amino acids. The binding of the antibody to the radioactively labeled NGF fragments is then determined by immunoprecipitation and gel electrophoresis.
  • Certain epitopes can also be identified by using large libraries of random peptide sequences displayed on the surface of phage particles (phage libraries). Alternatively, a defined library of overlapping peptide fragments can be tested for binding to the test antibody in simple binding assays.
  • mutagenesis of an antigen binding domain, domain swapping experiments and alanine scanning mutagenesis can be performed to identify residues required, sufficient, and/or necessary for epitope binding.
  • domain swapping experiments can be performed using a mutant NGF in which various fragments of the NGF polypeptide have been replaced (swapped) with sequences from a closely related, but antigenically distinct protein (such as another member of the neurotrophin protein family).
  • an anti-NGF antibody By assessing binding of the antibody to the mutant NGF, the importance of the particular NGF fragment to antibody binding can be assessed.
  • Yet another method which can be used to characterize an anti-NGF antibody is to use competition assays with other antibodies known to bind to the same antigen, i.e., various fragments on NGF, to determine if the anti-NGF antibody binds to the same epitope as other antibodies.
  • Competition assays are well known to those of skill in the art.
  • Example of antibodies that can be used in the competition assays for the present invention include MAb 911, 912, 938, as described in Hongo, et al, Hybridoma 19:215-227 (2000).
  • NGF antagonists other than anti-NGF antibodies may be used.
  • the NGF antagonist comprises at least one antisense molecule capable of blocking or decreasing the expression of a functional NGF.
  • Nucleotide sequences of the NGF are known and are readily available from publicly available databases. See, e.g., Borsani et al, Nuc. Acids Res. 1990, 18, 4020; Accession Number NM 002506; Ullrich et al, Nature 303:821-825 (1983). It is routine to prepare antisense oligonucleotide molecules that will specifically bind NGF mRNA without cross-reacting with other polynucleotides.
  • Exemplary sites of targeting include, but are not limited to, the initiation codon, the 5' regulatory regions, the coding sequence and the 3' untranslated region.
  • the oligonucleotides are about 10 to 100 nucleotides in length, about 15 to 50 nucleotides in length, about 18 to 25 nucleotides in length, or more.
  • the oligonucleotides can comprise backbone modifications such as, for example, phosphorothioate linkages, and 2'-O sugar modifications well know in the art.
  • Exemplary antisense molecules include the NGF antisense molecules described in U.S. Publication No. 20010046959; see also http://www.rna-tec.com/repair.htm.
  • the NGF antagonist comprises at least one antisense molecule capable of blocking or decreasing the expression of a functional NGF receptor (such as TrkA and/or p75).
  • a functional NGF receptor such as TrkA and/or p75. Woolf et al., J. Neuroscie (2001) 21(3):1047-55; Taglialetela et al, J Neurochem (1996) 66(5): 1826-35. Nucleotide sequences of TrkA and p75 are known and are readily available from publicly available databases.
  • the NGF antagonist comprises at least one
  • NGF inhibitory compound refers to a compound other than an anti-NGF antibody that directly or indirectly reduces, inhibits, neutralizes, or abolishes NGF biological activity.
  • An NGF inhibitory compound should exhibit any one or more of the following characteristics: (a) bind to NGF; (b) inhibit NGF biological activity or downstream pathways mediated by NGF signaling function; (c) prevent, ameliorate or treat any aspect of post-surgical pain; (d) block or decrease NGF receptor activation (including TrkA receptor dimerization and/or autophosphorylation); (e) increase clearance of NGF; (f) inhibit (reduce) NGF synthesis, production or release; (g) enhance recovery from surgery.
  • Exemplary NGF inhibitory compounds include the small molecule NGF inhibitors described in U.S. Publication No. 20010046959; the compounds that inhibit NGF's binding to p75, as described in PCT Publication No. WO 00/69829; the compounds that inhibit NGF's binding to TrkA and/or p75, as described in PCT Publication No. WO 98/17278. Additional examples of NGF inhibitory compounds include the compounds described in PCT Publication Nos. WO 02/17914 and WO 02/20479, and in U.S. Patent Nos. 5,342,942; 6,127,401; and 6,359,130. Further exemplary NGF inhibitory compounds are compounds that are competitive inhibitors of NGF. See U.S. Patent No. 6,291,247. Furthermore, one skilled in the art can prepare other small molecules NGF inhibitory compounds. [0116] In some embodiments, an NGF inhibitory compound binds NGF.
  • Exemplary sites of targeting include, but are not limited to, the portion of the NGF that binds to the TrkA receptor and/or p75 receptor, and those portions of the NGF that are adjacent to the receptor-binding region and which are responsible, in part, for the correct three-dimensional shape of the receptor- binding portion.
  • an NGF inhibitory compound binds an NGF receptor (such as TrkA and/or p75) and inhibits an NGF biological activity.
  • Exemplary sites of targeting include those portions of TrkA and/or p75 that bind to NGF.
  • a small molecule in embodiment comprising small molecules, can have a molecular weight of about any of 100 to 20,000 daltons, 500 to 15,000 daltons, or 1000 to 10,000 daltons. Libraries of small molecules are commercially available.
  • the small molecules can be administered using any means known in the art, including inhalation, intraperitoneally, intravenously, intramuscularly, subcutaneously, intrathecally, intraventricularly, orally, enterally, parenterally, intranasally, or dermally.
  • the NGF-antagonist according to the invention when it is a small molecule, it will be administered at the rate of 0.1 to 300 mg/kg of the weight of the patient divided into one to three or more doses. For an adult patient of normal weight, doses ranging from 1 mg to 5g per dose can be administered.
  • the NGF antagonist comprises at least one
  • NGF structural analogs in the present invention refer to compounds that have a similar 3 -dimensional structure as part of that of NGF and which bind to an NGF receptor under physiological conditions in vitro or in vivo, wherein the binding at least partially inhibits an NGF biological activity.
  • the NGF structural analog binds to a TrkA and/or a p75 receptor.
  • Exemplary NGF structural analogs include, but are not limited to, the bicyclic peptides described in PCT Publication No. WO 97/15593; the bicyclic peptides described in U.S. Patent No. 6,291,247; the cyclic compounds described in U.S. Patent No.
  • NGF structural analogs can also be designed and synthesized through molecular modeling of NGF-receptor binding, for example by the method described in PCT Publication No. WO 98/06048.
  • the NGF structural analogs can be monomers or dimers/oligomers in any desired combination of the same or different structures to obtain improved affinities and biological effects.
  • the invention provides an NGF antagonist comprising at least one dominant-negative mutant of the TrkA receptor and/or p75 receptor.
  • One skilled in the art can prepare dominant-negative mutants of, e.g., the TrkA receptor such that the receptor will bind the NGF and, thus, act as a "sink" to capture NGFs.
  • the dominant-negative mutants will not have the normal bioactivity of the TrkA receptor upon binding to NGF.
  • Exemplary dominant-negative mutants include, but are not limited to, the mutants described in the following references: Li et al, Proc. Natl Acad. Sci. USA 1998, 95, 10884; Eide et al, J. Neurosci.
  • the dominant negative mutants can be administered in protein form or in the form of an expression vector such that the dominant negative mutant, e.g., mutant TrkA receptor, is expressed in vivo.
  • the protein or expression vector can be administered using any means known in the art, such as intraperitoneally, intravenously, intramuscularly, subcutaneously, intrathecally, intraventricularly, orally, enterally, parenterally, intranasally, dermally, or by inhalation.
  • administration of expression vectors includes local or systemic administration, including injection, oral administration, particle gun or catheterized administration, and topical administration.
  • One skilled in the art is familiar with administration of expression vectors to obtain expression of an exogenous protein in vivo. See, e.g., U.S. Patent Nos. 6,436,908; 6,413,942; and 6,376,471.
  • Targeted delivery of therapeutic compositions containing an antisense polynucleotide, expression vector, or subgenomic polynucleotides can also be used.
  • Receptor-mediated DNA delivery techniques are described in, for example, Findeis et al, Trends Biotechnol (1993) 11 :202; Chiou et al, Gene Therapeutics: Methods And Applications Of Direct Gene Transfer (J.A. Wolff, ed.) (1994); Wu et ⁇ /., J. Biol Chem. (1988) 263:621; Wu et al., J. Biol. Chem. (1994) 269:542; Zenke et al, Proc. Natl. Acad. Sci.
  • compositions containing a polynucleotide are administered in a range of about 100 ng to about 200 mg of DNA for local administration in a gene therapy protocol.
  • concentration ranges of about 500 ng to about 50 mg, about 1 ⁇ g to about 2 mg, about 5 ⁇ g to about 500 ⁇ g, and about 20 ⁇ g to about 100 ⁇ g of DNA or more can also be used during a gene therapy protocol.
  • the therapeutic polynucleotides and polypeptides of the present invention can be delivered using gene delivery vehicles.
  • the gene delivery vehicle can be of viral or non- viral origin (see generally, Jolly, Cancer Gene Therapy (1994) 1:51; Kimura, Human Gene Therapy (1994) 5:845; Connelly, Human Gene Therapy (1995) 1:185; and Kaplift, Nature Genetics (1994) 6:148). Expression of such coding sequences can be induced using endogenous mammalian or heterologous promoters and/or enhancers. Expression of the coding sequence can be either constitutive or regulated.
  • Niral-based vectors for delivery of a desired polynucleotide and expression in a desired cell are well known in the art.
  • Exemplary viral-based vehicles include, but are not limited to, recombinant retroviruses (see, e.g., PCT Publication ⁇ os. WO 90/07936; WO 94/03622; WO 93/25698; WO 93/25234; WO 93/11230; WO 93/10218; WO 91/02805; U.S. Patent ⁇ os. 5, 219,740 and 4,777,127; GB Patent No. 2,200,651; and EP Patent No.
  • alphavirus- based vectors e.g., Sindbis virus vectors, Semliki forest virus (ATCC VR-67; ATCC VR-1247), Ross River virus (ATCC VR-373; ATCC VR-1246) and Venezuelan equine encephalitis virus (ATCC VR-923; ATCC VR-1250; ATCC VR 1249; ATCC VR-532)
  • AAV adeno-associated virus
  • Non- viral delivery vehicles and methods can also be employed, including, but not limited to, polycationic condensed DNA linked or unlinked to killed adenovirus alone (see, e.g., Curiel, Hum. Gene Ther. (1992) 3:147); ligand- linked DNA (see, e.g., Wu, J Biol. Chem. (1989) 264:16985); eukaryotic cell delivery vehicles cells (see, e.g., U.S. Patent No. 5,814,482; PCT Publication Nos. WO 95/07994; WO 96/17072; WO 95/30763; and WO 97/42338) and nucleic charge neutralization or fusion with cell membranes. Naked DNA can also be employed.
  • Exemplary naked DNA introduction methods are described in PCT Publication No. WO 90/11092 and U.S. Patent No. 5,580,859.
  • Liposomes that can act as gene delivery vehicles are described in U.S. Patent No. 5,422,120; PCT PubUcationNos. WO 95/13796; WO 94/23697; WO 91/14445; and EP Patent No. 0524968. Additional approaches are described in Philip, Mol. Cell Biol. (1994) 14:2411, and in Woffendin, Proc. Natl. Acad. Sci. (1994) 91 :1581.
  • an expression vector can be used to direct expression of any of the protein-based NGF antagonists described herein (e.g., anti-NGF antibody, TrkA immunoadhesin, etc.).
  • NGF antagonists e.g., anti-NGF antibody, TrkA immunoadhesin, etc.
  • other TrkA receptor fragments that are capable of blocking (from partial to complete blocking) NGF and/or an NGF biological activity are known in the art.
  • the NGF antagonist comprises at least one
  • TrkA immunoadhesins as used herein refer to soluble chimeric molecules comprising the extracellular domain of a TrkA receptor and an immunoglobulin sequence, which retains the binding specificity of the TrkA receptor (substantially retains the binding specificity of the trkA receptor) and is capable of binding to NGF.
  • TrkA immunoadhesins are known in the art, and have been found to block the binding of NGF to the TrkA receptor. See, e.g., U.S. Patent No. 6, 153, 189. Brennan et al. report administration of TrkA immunoadhesin in a rat model of post-surgical pain. See Society for Neuroscience Abstracts 24 (1-2) 880 (1998).
  • the TrkA immunoadhesin comprises a fusion of a TrkA receptor amino acid sequence (or a portion thereof) from TrkA extracellular domain capable of binding NGF (in some embodiments, an amino acid sequence that substantially retains the binding specificity of the trkA receptor) and an immunoglobulin sequence.
  • the TrkA receptor is a human TrkA receptor sequence
  • the fusion is with an immunoglobulin constant domain sequence.
  • the immunoglobulin constant domain sequence is an immunoglobulin heavy chain constant domain sequence.
  • the association of two TrkA receptor-immunoglobulin heavy chain fusions results in a homodimeric immunoglobulin-like structure.
  • An immunoglobulin light chain can further be associated with one or both of the TrkA receptor-immunoglobulin chimeras in the disulfide-bonded dimer to yield a homotrimeric or homotetrameric structure. Examples of suitable TrkA immunoadhesins include those described in U.S. Patent No. 6,153,189.
  • the NGF antagonist comprises at least one anti -TrkA antibody capable of blocking, suppressing, altering, and/or reducing NGF physical interaction with the TrkA receptor and/or downstream signaling, whereby an NGF biological activity is reduced and/or blocked.
  • Anti-TrkA antibodies are known in the art. Exemplary anti-TrkA antibodies include those described in PCT Publication Nos. WO 97/21732, WO 00/73344, WO 02/15924, and U.S. Publication No. 20010046959.
  • the NGF antagonist comprises at least one anti-p75 antibody capable of blocking, suppressing and/or reducing NGF physical interaction with the p75 receptor and/or downstream signaling, whereby an NGF biological activity is reduced and/or blocked.
  • the NGF antagonist comprises at least one kinase inhibitor capable of inhibiting downstream kinase signaling associated with TrkA and/or p75 receptor activity.
  • An exemplary kinase inhibitor is K252a or K252b, which is known in the art and described in Knusel et al, J. Neurochem. 59:715-722 (1992); Knusel et al, J. Neurochemistry 57:955-962 (1991); Koizumi et al, J. Neuroscience 8:715-721 (1988); Hirata et al, Chemical Abstracts 111 :728, XP00204135, see abstract and 12th Collective Chemical Substance Index, p. 34237, c.
  • Anti-NGF antibodies and other NGF antagonists can be identified or characterized using methods known in the art, whereby reduction, amelioration, or neutralization of an NGF biological activity is detected and/or measured.
  • a kinase receptor activation (KIRA) assay described in U.S. Patent Nos. 5,766,863 and 5,891,650 can be used to identify NGF antagonists.
  • This ELISA- type assay is suitable for qualitative or quantitative measurement of kinase activation by measuring the autophosphorylation of the kinase domain of a receptor protein tyrosine kinase (hereinafter "rPTK”), e.g.
  • rPTK receptor protein tyrosine kinase
  • TrkA receptor as well as for identification and characterization of potential antagonists of a selected rPTK, e.g., TrkA.
  • the first stage of the assay involves phosphorylation of the kinase domain of a kinase receptor, for example, a TrkA receptor, wherein the receptor is present in the cell membrane of an eukaryotic cell.
  • the receptor may be an endogenous receptor or nucleic acid encoding the receptor, or a receptor construct, may be transformed into the cell.
  • a first solid phase e.g., a well of a first assay plate
  • a substantially homogeneous population of such calls usually a mammalian cell line
  • a "receptor construct” it usually comprises a fusion of a kinase receptor and a flag polypeptide.
  • the flag polypeptide is recognized by the capture agent, often a capture antibody, in the ELISA part of the assay.
  • An analyte such as a candidate anti-NGF antibody or other NGF antagonists, is then added together with NGF to the wells having the adherent cells, such that the tyrosine kinase receptor (e.g. TrkA receptor) is exposed to (or contacted with) NGF and the analyte.
  • This assay enables identification of antibodies (or other NGF antagonists) that inhibit activation of TrkA by its ligand NGF.
  • the adhering cells are solubilized using a lysis buffer (which has a solubilizing detergent therein) and gentle agitation, thereby releasing cell lysate which can be subjected to the ELISA part of the assay directly, without the need for concentration or clarification of the cell lysate.
  • the cell lysate thus prepared is then ready to be subjected to the
  • a second solid phase (usually a well of an ELISA microtiter plate) is coated with a capture agent (often a capture antibody) which binds specifically to the tyrosine kinase receptor, or, in the case of a receptor construct, to the flag polypeptide. Coating of the second solid phase is carried out so that the capture agent adheres to the second solid phase.
  • the capture agent is generally a monoclonal antibody, but, as is described in the examples herein, polyclonal antibodies may also be used.
  • the cell lysate obtained is then exposed to, or contacted with, the adhering capture agent so that the receptor or receptor construct adheres to (or is captured in) the second solid phase.
  • a washing step is then carried out, so as to remove unbound cell lysate, leaving the captured receptor or receptor construct.
  • the adhering or captured receptor or receptor construct is then exposed to, or contacted with, an anti- phosphotyrosine antibody which identifies phosphorylated tyrosine residues in the tyrosine kinase receptor.
  • the anti-phosphotyrosine antibody is conjugated (directly or indirectly) to an enzyme which catalyses a color change of a non-radioactive color reagent.
  • phosphorylation of the receptor can be measured by a subsequent color change of the reagent.
  • the enzyme can be bound to the anti-phosphotyrosine antibody directly, or a conjugating molecule (e.g., biotin) can be conjugated to the anti-phosphotyrosine antibody and the enzyme can be subsequently bound to the anti-phosphotyrosine antibody via the conjugating molecule.
  • binding of the anti-phosphotyrosine antibody to the captured receptor or receptor construct is measured, e.g., by a color change in the color reagent.
  • the NGF antagonists can also be identified by incubating a candidate agent with NGF and monitoring any one or more of the following characteristics: (a) binding to NGF; (b) inhibiting NGF biological activity or downstream pathways mediated by NGF signaling function; (c) inhibiting, blocking or decreasing NGF receptor activation (including TrkA dimerization and/or autophosphorylation); (d) increasing clearance of NGF; (e) treating or preventing any aspect of post-surgical pain; (f) inhibiting (reducing) NGF synthesis, production or release; (g) enhancing recovery from surgery.
  • an NGF antagonist is identified by incubating an candidate agent with NGF and monitoring binding and attendant reduction or neutralization of a biological activity of NGF.
  • the binding assay may be performed with purified NGF polypeptide(s), or with cells naturally expressing, or transfected to express, NGF polypeptide(s).
  • the binding assay is a competitive binding assay, where the ability of a candidate antibody to compete with a known NGF antagonist for NGF binding is evaluated.
  • the assay may be performed in various formats, including the ELISA format.
  • an NGF antagonist is identified by incubating a candidate agent with NGF and monitoring attendant inhibition of TrkA receptor dimerization and/or autophosphorylation. [0133] Following initial identification, the activity of a candidate anti-
  • NGF antagonist can be further confirmed and refined by bioassays, known to test the targeted biological activities.
  • bioassays can be used to screen candidates directly.
  • NGF promotes a number of morphologically recognizable changes in responsive cells. These include, but are not limited to, promoting the differentiation of PC 12 cells and enhancing the growth of neurites from these cells (Urfer et al, Biochem. 36:4775-4781 (1997); Tsoulfas et al, Neuron 10:975-990 (1993)), promoting neurite outgrowth from explants of responsive sensory and sympathetic ganglia (Levi-Montalcini, R. and Angeletti, P. Nerve growth factor. Physiol. Rev.
  • the assay for inhibition of NGF biological activity entail culturing NGF responsive cells with NGF plus an analyte, such as a candidate anti-NGF antibody and a candidate NGF antagonist. After an appropriate time the cell response will be assayed (cell differentiation, neurite outgrowth or cell survival).
  • the ability of a candidate NGF antagonist to block or neutralize a biological activity of NGF can also be assessed by monitoring the ability of the candidate agent to inhibit NGF mediated survival in the embryonic rat dorsal root ganglia survival bioassay as described in Hongo et al, Hybridoma 19:215-227 (2000).
  • compositions for use in the methods of the invention are provided.
  • compositions used in the methods of the invention comprise an effective amount of an NGF antagonist (such as anti-NGF antibody), and, in some embodiments, further comprise a pharmaceutically acceptable excipient.
  • an NGF antagonist such as anti-NGF antibody
  • the composition is for use in any of the methods described herein. Examples of such compositions, as well as how to formulate, are also described in an earlier section and below.
  • the composition comprises an NGF antagonist.
  • the composition comprises one or more NGF antagonists.
  • the composition comprises one or more NGF antagonists selected from any one or more of the following: an antagonist (e.g., an antibody) that binds (physically interacts with) NGF, an antagonist that binds to an NGF receptor (such as a TrkA and/or p75 receptor), and an antagonist that reduces (impedes and/or blocks) downstream NGF receptor signaling.
  • an antagonist e.g., an antibody
  • an antagonist that binds to an NGF receptor such as a TrkA and/or p75 receptor
  • an antagonist that reduces (impedes and/or blocks) downstream NGF receptor signaling e.g., the composition comprises any NGF antagonist that is not a TrkA immunoadhesin (i.e., is other than a TrkA immunoadhesin).
  • the composition comprises any NGF antagonist that is other than an anti-NGF antibody.
  • the composition comprises any NGF antagonist that is other than a TrkA immunoadhesin and other than an anti-NGF antibody.
  • an NGF antagonist inhibits (reduces) NGF synthesis, production or release.
  • the NGF antagonist binds NGF and does not significantly cross- react with related neurotrophins (such as NT3, NT4/5, and/or BDNF).
  • the NGF antagonist is not associated with an adverse immune response.
  • the NGF antagonist is selected from the group consisting of an anti-NGF antibody, an anti-sense molecule directed to an NGF (including an anti-sense molecule directed to a nucleic acid encoding NGF), an anti-sense molecule directed to an NGF receptor (such as TrkA and/or p75), an NGF inhibitory compound, an NGF structural analog, a dominant-negative mutation of a TrkA receptor that binds an NGF, a TrkA immunoadhesin, an anti- TrkA antibody, an anti-p75 antibody and a kinase inhibitor.
  • the NGF antagonist is an anti-NGF antibody.
  • the anti-NGF antibody recognizes human NGF.
  • the anti- NGF antibody is human. In still other embodiments, the anti-NGF antibody is humanized (such as antibody E3 described herein). In still other embodiment, the anti-NGF antibody comprises a constant region that does not trigger an unwanted or undesirable immune response, such as antibody-mediated lysis or ADCC. In other embodiments, the anti-NGF antibody comprises one or more CDR(s) of antibody E3 (such as one, two, three, four, five, or, in some embodiments, all six [0136] It is understood that the compositions can comprise more than one
  • a composition can comprise more than one member of a class of NGF antagonist (e.g., a mixture of anti-NGF antibodies that recognize different epitopes of NGF), as well as members of different classes of NGF antagonists (e.g., an anti-NGF antibody and an NGF inhibitory compound).
  • Other exemplary compositions comprise more than one anti-NGF antibodies that recognize the same epitope(s), different species of anti-NGF antibodies that bind to different epitopes of NGF, or different NGF inhibitory compounds.
  • the composition used in the present invention can further comprise pharmaceutically acceptable carriers, excipients, or stabilizers (Remington: The Science and Practice of Pharmacy 20th Ed. (2000) Lippincott Williams and Wilkins, Ed. K.
  • Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations, and may comprise buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride, benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone;
  • NGF Zn-protein complexes
  • non-ionic surfactants such as TWEENTM, PLURONIC STM or polyethylene glycol (PEG).
  • TWEENTM TWEENTM
  • PLURONIC STM polyethylene glycol
  • PEG polyethylene glycol
  • Pharmaceutically acceptable excipients are further described herein.
  • the NGF antagonist and compositions thereof can also be used in conjunction with other agents that serve to enhance and/or complement the effectiveness of the agents. Kits
  • the invention also provides kits for use in the instant methods.
  • Kits of the invention include one or more containers comprising an NGF antagonist (such as an antibody, such as humanized antibody E3 described herein), and in some embodiments, further comprise instructions for use in accordance with any of the methods of the invention described herein.
  • the NGF antagonist is any NGF antagonist described herein.
  • the kit comprises an NGF antagonist that is not a TrkA immunoadhesin (i.e., is other than a TrkA immunoadhesin).
  • the kit comprises an NGF antagonist that is other than an anti-NGF antibody.
  • the kit comprises any NGF antagonist that is other than a TrkA immunoadhesin and other than an anti-NGF antibody.
  • the kit comprises an anti-NGF antibody (such as antibody E3 described herein).
  • the kit comprises an anti-NGF antibody comprising one or more CDR(s) of antibody E3 (such as one, two, three, four, five, or, in some embodiments, all six CDRs from E3).
  • these instructions comprise a description of administration of the NGF antagonist to treat, ameliorate or prevent post-surgical pain according to any of the methods described herein.
  • the kit may further comprise a description of selecting an individual suitable for treatment based on identifying whether that individual has post-surgical pain or whether the individual is at risk of post-surgical pain.
  • the instruction comprises a description of administering an NGF antagonist to treat, prevent and/or ameliorate post-surgical pain.
  • the instructions comprise a description of administering an NGF antagonist to an individual at risk of post-surgical pain.
  • the instructions relating to the use of an NGF antagonist generally include information as to dosage, dosing schedule, and route of administration for the intended treatment.
  • the containers may be unit doses, bulk packages (e.g., multi-dose packages) or sub-unit doses. Instructions supplied in the kits of the invention are typically written instructions on a label or package insert (e.g., a paper sheet included in the kit), but machine-readable instructions (e.g., instructions carried on a magnetic or optical storage disk) are also acceptable.
  • kits of this invention are in suitable packaging. Suitable packaging includes, but is not limited to, vials, bottles, jars, flexible packaging (e.g., sealed Mylar or plastic bags), and the like. Also contemplated are packages for use in combination with a specific device, such as an inhaler, nasal administration device (e.g., an atomizer) or an infusion device such as a minipump.
  • a specific device such as an inhaler, nasal administration device (e.g., an atomizer) or an infusion device such as a minipump.
  • kits may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle).
  • the container may also have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle).
  • At least one active agent in the composition is an NGF antagonist, such as an anti-NGF antibody.
  • the container may further comprise a second pharmaceutically active agent.
  • Kits may optionally provide additional components such as buffers and interpretive information. Normally, the kit comprises a container and a label or package insert(s) on or associated with the container.
  • the NGF antagonist can be administered to an individual via any suitable route.
  • the NGF antagonist can be administered orally, intravenously, sublingually, subcutaneously, intraarterially, intrasynovially, intravescicular (such as via the bladder), intramuscularly, intracardiacly, intrathoracicly, intraperitoneally, intraventricularly, sublingually, by inhalation, by suppository, and transdermally.
  • They can be administered orally, for example, in the form of tablets, troches, capsules, elixirs, suspensions, syrups, wafers, lollypops, chewing gum or the like prepared by art recognized procedures.
  • the NGF antagonist such as an anti-NGF antibody
  • the NGF antagonist is administered to a individual in accordance with known methods, such as intravenous administration, e.g., as a bolus or by continuous infusion over a period of time, by intramuscular, intraperitoneal, intracerebrospinal, subcutaneous, intra-articular, intrasynovial, intrathecal, oral, inhalation or topical routes.
  • known methods such as intravenous administration, e.g., as a bolus or by continuous infusion over a period of time, by intramuscular, intraperitoneal, intracerebrospinal, subcutaneous, intra-articular, intrasynovial, intrathecal, oral, inhalation or topical routes.
  • nebulizers for liquid formulations including jet nebulizers and ultrasonic nebulizers are useful for administration.
  • Liquid formulations can be directly nebulized and lyophilized powder can be nebulized after reconstitution.
  • NGF antagonist can be aerosolized using a fluorocarbon formulation and a metered dose inhaler, or inhaled as a lyophilized and milled powder.
  • an NGF antagonist is administered via site- specific or targeted local delivery techniques.
  • site-specific or targeted local delivery techniques include various implantable depot sources of the NGF antagomst or local delivery catheters, such as infusion catheters, an indwelling catheter, or a needle catheter, synthetic grafts, adventitial wraps, shunts and stents or other implantable devices, site specific carriers, direct injection, or direct application. See, e.g., PCT Publication No. WO 00/53211 and U.S. Patent No. 5,981,568.
  • an NGF antagonist such as anti-NGF antibody
  • an NGF antagonist may be administered neat.
  • the NGF antagonist comprises an anti-NGF antibody, and may be in various formulations, including formulations comprising a pharmaceutically acceptable excipient.
  • Pharmaceutically acceptable excipients are known in the art, and are relatively inert substances that facilitate administration of a pharmacologically effective substance. For example, an excipient can give form or consistency, or act as a diluent.
  • Suitable excipients include but are not limited to stabilizing agents, wetting and emulsifying agents, salts for varying osmolarity, encapsulating agents, buffers, and skin penetration enhancers. Excipients as well as formulations for parenteral and nonparenteral drug delivery are set forth in Remington, The Science and Practice of Pharmacy 20th Ed. Mack Publishing (2000).
  • these agents are formulated for administration by injection (e.g., intraperitoneally, intravenously, subcutaneously, intramuscularly, etc.). Accordingly, these agents can be combined with pharmaceutically acceptable vehicles such as saline, Ringer's solution, dextrose solution, and the like.
  • pharmaceutically acceptable vehicles such as saline, Ringer's solution, dextrose solution, and the like.
  • the particular dosage regimen, i.e., dose, timing and repetition, will depend on the particular individual and that individual's medical history.
  • an anti-NGF antibody can be administered using any suitable method, including by injection (e.g., intraperitoneally, intravenously, subcutaneously, intramuscularly, etc.). Anti-NGF antibodies can also be administered via inhalation, as described herein. Generally, for administration of anti-NGF antibodies, an initial candidate dosage can be about 2 mg/kg. For the purpose of the present invention, a typical daily dosage might range from about any of 3 ⁇ g/kg to 30 ⁇ g/kg to 300 ⁇ g/kg to 3 mg/kg, to 30 mg/kg to 100 mg/kg or more, depending on the factors mentioned above.
  • An exemplary dosing regimen comprises administering an initial dose of about 2 mg/kg, followed by a weekly maintenance dose of about 1 mg/kg of the anti-NGF antibody, or followed by a maintenance dose of about 1 mg/kg every other week.
  • other dosage regimens may be useful, depending on the pattern of pharmacokinetic decay that the practitioner wishes to achieve. For example, dosing from one-four time a week is contemplated. The progress of this therapy is easily monitored by conventional techniques and assays.
  • the dosing regimen (including the NGF antagonist(s) used) can vary over time.
  • an NGF antagonist when it is not an antibody, may (in some embodiments) be administered at the rate of about 0.1 to 300 mg/kg of the weight of the patient divided into one to three doses, or as disclosed herein. In some embodiments, for an adult patient of normal weight, doses ranging from about 0.3 to 5.00 mg/kg may be administered.
  • the particular dosage regimen i.e., dose, timing and repetition, will depend on the particular individual and that individual's medical history, as well as the properties of the individual agents (such as the half-life of the agent, and other considerations well known in the art).
  • an NGF antagonist for the purpose of the present invention, the appropriate dosage of an NGF antagonist will depend on the NGF antagonist(s) (or compositions thereof) employed, the type and severity of the pain to be treated, whether the agent is administered for preventive or therapeutic purposes, previous therapy, the patient's clinical history and response to the agent, and the discretion of the attending physician.
  • the clinician will administer an NGF antagonist, such as an anti-NGF antibody, until a dosage is reached that achieves the desired result.
  • Empirical considerations such as the half-life, generally will contribute to the determination of the dosage.
  • antibodies that are compatible with the human immune system such as humanized antibodies or fully human antibodies, may be used to prolong half-life of the antibody and to prevent the antibody being attacked by the host's immune system.
  • Frequency of administration may be determined and adjusted over the course of therapy, and is generally, but not necessarily, based on treatment and/or suppression and/or amelioration and/or delay of pain.
  • sustained continuous release formulations of anti-NGF antibodies may be appropriate.
  • formulations and devices for achieving sustained release are known in the art.
  • dosages for an NGF antagonist may be determined empirically in individuals who have been given one or more administration(s) of NGF antagonist (such as an antibody). Individuals are given incremental dosages of an NGF antagonist, e.g., anti-NGF antibody. To assess efficacy of an NGF antagonist, an indicator of pain can be followed.
  • Administration of an NGF antagonist in accordance with the method in the present invention can be continuous or intermittent, depending, for example, upon the recipient's physiological condition, whether the purpose of the administration is therapeutic or prophylactic, and other factors known to skilled practitioners.
  • an NGF antagonist for example if the NGF antagonist is an anti-NGF antibody
  • Administration can be before, during and/or after wound, incision, trauma, surgery, and any other event likely to give rise to post-surgical pain.
  • NGF antagonist such as an antibody
  • the antagonist can be the same or different from each other. At least one, at least two, at least three, at least four, at least five different NGF antagonists can be present. Generally, those NGF antagonists have complementary activities that do not adversely affect each other. NGF antagonists can also be used in conjunction with other agents that serve to enhance and/or complement the effectiveness of the agents.
  • Therapeutic formulations of the NGF antagonist (such as an antibody) used in accordance with the present invention are prepared for storage by mixing an antibody having the desired degree of purity with optional pharmaceutically acceptable carriers, excipients or stabilizers (Remington, The Science and Practice of Pharmacy 20th Ed.
  • Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations employed, and may comprise buffers such as phosphate, citrate, and other organic acids; salts such as sodium chloride; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride, benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens, such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as poly(ethylene glycol) glycerol, glycerin, glyce
  • Liposomes containing the NGF antagonist are prepared by methods known in the art, such as described in Epstein, et al, Proc. Natl. Acad. Sci. USA 82:3688 (1985); Hwang, et al, Proc. Natl Acad. Sci. USA 77:4030 (1980); and U.S. Patent Nos. 4,485,045 and 4,544,545. Liposomes with enhanced circulation time are disclosed in U.S. Patent No. 5,013,556.
  • Particularly useful liposomes can be generated by the reverse phase evaporation method with a lipid composition comprising phosphatidylcholine, cholesterol and PEG-derivatized phosphatidylethanolamine (PEG-PE). Liposomes are extruded through filters of defined pore size to yield liposomes with the desired diameter.
  • PEG-PE PEG-derivatized phosphatidylethanolamine
  • the active ingredients may also be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in macroemulsions.
  • colloidal drug delivery systems for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules
  • Sustained-release preparations may be prepared. Suitable examples of sustained-release preparations include semipermeable matrices of solid hydrophobic polymers containing the antibody, which matrices are in the form of shaped articles, e.g. films, or microcapsules. Examples of sustained- release matrices include polyesters, hydrogels (for example, poly(2-hydroxyethyl- methacrylate), or 'poly(v nylalcohol)), polylactides (U.S. Pat. No.
  • copolymers of L-glutamic acid and 7 ethyl-Lglutamate copolymers of L-glutamic acid and 7 ethyl-Lglutamate, non-degradable ethylene- vinyl acetate, degradable lactic acid-glycolic acid copolymers such as the LUPRON DEPOTTM (injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate), sucrose acetate isobutyrate, and poly-D-(- )-3hydroxybutyric acid.
  • LUPRON DEPOTTM injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate
  • sucrose acetate isobutyrate sucrose acetate isobutyrate
  • poly-D-(- )-3hydroxybutyric acid poly-D-(- )-3hydroxybutyric acid.
  • compositions to be used for in vivo administration must be sterile. This is readily accomplished by, for example, filtration through sterile filtration membranes.
  • Therapeutic anti-NGF antibody compositions are generally placed into a container having a sterile access port, for example, an intravenous solution bag or vial having a stopper pierceable by a hypodermic injection needle.
  • the compositions according to the present invention may be in unit dosage forms such as tablets, pills, capsules, powders, granules, solutions or suspensions, or suppositories, for oral, parenteral or rectal administration, or administration by inhalation or insufflation.
  • the principal active ingredient is mixed with a pharmaceutical carrier, e.g. conventional tableting ingredients such as corn starch, lactose, sucrose, sorbitol, talc, stearic acid, magnesium stearate, dicalcium phosphate or gums, and other pharmaceutical diluents, e.g. water, to form a solid preformulation composition containing a homogeneous mixture of a compound of the present invention, or a non-toxic pharmaceutically acceptable salt thereof.
  • a pharmaceutical carrier e.g. conventional tableting ingredients such as corn starch, lactose, sucrose, sorbitol, talc, stearic acid, magnesium stearate, dicalcium phosphate or gums, and other pharmaceutical diluents, e.g. water, to form a solid preformulation composition containing a homogeneous mixture of a compound of the present invention, or a non-toxic pharmaceutically acceptable salt thereof.
  • preformulation compositions as homogeneous, it is meant that the active ingredient is dispersed evenly throughout the composition so that the composition may be readily subdivided into equally effective unit dosage forms such as tablets, pills and capsules.
  • This solid preformulation composition is then subdivided into unit dosage forms of the type described above containing from 0.1 to about 500 mg of the active ingredient of the present invention.
  • the tablets or pills of the novel composition can be coated or otherwise compounded to provide a dosage form affording the advantage of prolonged action.
  • the tablet or pill can comprise an inner dosage and an outer dosage component, the latter being in the form of an envelope over the former.
  • Suitable surface-active agents include, in particular, non-ionic agents, such as polyoxyethylenesorbitans (e.g. TweenTM 20, 40, 60, 80 or 85) and other sorbitans (e.g. SpanTM 20, 40, 60, 80 or 85).
  • compositions with a surface- active agent will conveniently comprise between 0.05 and 5% surface-active agent, and can be between 0.1 and 2.5%. It will be appreciated that other ingredients may be added, for example mannitol or other pharmaceutically acceptable vehicles, if necessary.
  • Suitable emulsions may be prepared using commercially available fat emulsions, such as Intralipid , Liposyn , Infonutrol , Lipofundin and LipiphysanTM.
  • the active ingredient may be either dissolved in a pre-mixed emulsion composition or alternatively it may be dissolved in an oil (e.g.
  • soybean oil safflower oil, cottonseed oil, sesame oil, corn oil or almond oil
  • an emulsion formed upon mixing with a phospholipid e.g. egg phospholipids, soybean phospholipids or soybean lecithin
  • a phospholipid e.g. egg phospholipids, soybean phospholipids or soybean lecithin
  • other ingredients may be added, for example gylcerol or glucose, to adjust the tonicity of the emulsion.
  • Suitable emulsions will typically contain up to 20% oil, for example, between 5 and 20%.
  • the fat emulsion can comprise fat droplets between 0.1 and 1.0 . ⁇ m, particularly 0.1 and 0.5 . ⁇ m, and have a pH in the range of 5.5 to 8.0.
  • the emulsion compositions can be those prepared by mixing a nerve growth factor antagonist with IntralipidTM' or the components thereof (soybean oil, egg phospholipids, glycerol and water).
  • compositions for inhalation or insufflation include solutions and suspensions in pharmaceutically acceptable, aqueous or organic solvents, or mixtures thereof, and powders.
  • the liquid or solid compositions may contain suitable pharmaceutically acceptable excipients as set out above.
  • the compositions are administered by the oral or nasal respiratory route for local or systemic effect.
  • Compositions in preferably sterile pharmaceutically acceptable solvents may be nebulised by use of gases. Nebulised solutions may be breathed directly from the nebulising device or the nebulising device may be attached to a face mask, tent or intermittent positive pressure breathing machine.
  • Solution, suspension or powder compositions may be administered, preferably orally or nasally, from devices which deliver the formulation in an appropriate manner.
  • Treatment efficacy can be assessed by methods well-known in the art.
  • Example 1 Anti-NGF monoclonal antibody is effective in treating post-surgical pain [0168]
  • the anti-NGF antibody was injected intra peritoneal (i.p.) at various concentratiosn per experiment (35 or 7 milligrams per kilogram) 15 hours pre-incision.
  • the control group received no antibody but was injected i.p. with a saline solution.
  • the wound was closed with two mattress sutures (5-0 ethilon black monofilament). These sutures were knotted 5-6 times, with the first knot loosely tied.
  • the wound site was swabbed with bacitracin solution. Animals were allowed to recover and rest in clean cages for two hours or more before behavioral testing began.
  • Tactile allodynia was measured with Semmes-Weinstein von Frey hairs (Stoelting, Wood Dale, IL). Animals were placed into 12 mm plastic mesh bottom cages, elevated on a platform (h: 18") allowing access to the underside of their paws. The animals were habituated to this environment (over 1-2 days the week prior) before the start of the experiment. After a 15 minute acclimation period, tactile allodynia was tested by touching the skin, medial and proximal to the entry point of the incision, on the heel of the animal's hind paw with von Frey hairs in ascending order of force until a paw- withdrawal response was elicited.
  • Von Frey numbers 4.08 to 5.46 were used; each number correlates with a force in grams, as described below. Each von Frey hair was applied to the surface at a right angle, bending the hair for 2 s, or until a response occurred. Once a withdrawal response was established, the paw was retested for two more trials, starting with the next descending von Frey hair until no response occurred. [0173] The lowest amount of force required to elicit a response over the three trials was recorded as withdrawal threshold in grams. The highest force of 29 g lifted the paw as well as eliciting a response, thus representing the cut-off point. If no response was detected, the next ascending filament "5.88" was recorded. Both left and right paws were tested in this manner.
  • Thermal hyperalgesia was assessed by the rat plantar test (Ugo Basile, Italy) following a modified method of Hargreaves, et al. (1988). Rats were habituated to the apparatus that consisted of four individual plexiglass boxes on an elevated glass table.
  • a mobile radiant heat source was located under the table and focused onto the hind paw. While the animal is still, but not sleeping, the button on the control box is depressed, the radiant heat source comes on and the time taken for the animal to withdraw from the heat source is automatically recorded.
  • This paw withdrawal latency is detected by a light detector embedded in the radiant heat source that senses the movement of the rat paw by a change in reflectance of the radiant source. Paw Withdrawal Latencies, in seconds, were recorded. There was an automatic cut-off point of 22.5 s to prevent tissue damage. PWL were taken three to four times for both hind paws of each animal, the mean of which represented base lines for right and left hind paws.
  • Example 2 Treatment of post-surgical pain using a humanized anti-NGF antibody and comparison with opioid treatment of post-surgical pain
  • a humanized anti-NGF antibody designated E3 was tested in an animal model for post-surgical pain as described in Example 1.
  • the E3 antibody comprises the human heavy chain IgG2a constant region containing the following mutations: A330P331 to S330S331 (amino acid numbering with reference to the wildtype IgG2a sequence; see Eur. J. Immunol. (1999) 29:2613-2624); the human light chain kappa constant region; and the heavy and light chain variable regions shown in Tables 1 and 2.
  • the anti-NGF antibody was injected intra peritoneal (i.p.) at various concentrations of the antibody (0.004, 0.01, 0.02, 0.1, 0.6, and 1 mg per kilogram of animal weight) at 15 hours pre-incision.
  • the negative control group received no antibody but was injected i.p. with a saline solution.
  • Fentanyl at 0.01 mg/kg was injected i.p. as a positive control 30 minutes before testing at 24 hours post-surgery.
  • Surgery was performed and a cumulative pain score was measured as described in Example 1 , except that the male Sprague Dawley rats were purchased from Harlan (Wisconsin).
  • Anti-NGF mouse monoclonal antibody 911 was injected i.p. at various concentrations (1 mg/kg or 5 mg/kg) at 14 days or 21 days pre-incision.
  • the control group was injected i.p. with a saline solution.
  • Surgery was performed and resting pain expressed as a cumulative pain score was assessed 24 hours after surgery as described in Example 1.
  • anti-NGF antibody 911 significantly reduced resting pain at the 5 mg/kg dosage when administered 14 days before surgery, and reduced resting pain when injected 21 days prior to surgery.
  • Ketorolac is known to inhibit wound healing. Haws et al. (1996) Ann Plast Surg. 37(2):147-51; Gerstenfeld et al. (2003) j Orthop Res. 21(4):670-5.
  • NGF antibody 911 was not significantly different from that of animals treated with saline. Thus, anti-NGF treatment showed no apparent effect on wound healing. By contrast, wound healing was significantly inhibited in ketorolac treated animals when compared to saline or anti-NGF antibody 911 treated animal (p ⁇ 0.0005).
  • Example 5 Treatment of post-surgical pain with small molecule NGF antagonist, K252a
  • the efficacy of NGF antagonist K252a in treating post-surgical pain was tested in the incision model described in Example 1.
  • a solution of 25 mg/ml of K252a was made in DMSO.
  • 3500 ⁇ l of a solution of 45% cyclodextrin was added and mixed well.
  • 3750 ⁇ l of saline was added to make a final concentration of 0.8333 mg/ml K252a.
  • Animals (obtained as described in Example 2) received incision and resting pain was assessed as described in Example 1. "Baseline" cumulative resting pain was determined at 24 hours post incision.
  • K252a was then injected i.p. at 4 mg/kg into test animals, and the control animals were injected with a vehicle solution (a solution containing all components of the K252a solution except K252a).
  • a vehicle solution a solution containing all components of the K252a solution except K252a.
  • Cumulative resting pain scores were determined one hour post-K252a or vehicle treatment (marked “lH-P-tmt in the Figure) and three hours after K252 or vehicle treatment (marked "3H-P-Tmt in the Figure) by an experimenter blind to the treatment.
  • treatment with K252a significantly reduced resting pain (p ⁇ 0.005) at three hours after dosing, while treatment with vehicle did not.
  • K252a treatment reduced resting pain to the same extent that treatment with anti-NGF antibody did in similar experiments.
  • Example 6 Comparison of post-surgical pain in animals treated with anti-NGF antibody or isotype matched control antibody [0186]
  • effectiveness of anti-NGF mouse antibody 911 in treating post-surgical pain was compared with effectiveness of the same dose of an isotype-matched control murine antibody that is immunoreactive with the Drosophila protein amnesiac.
  • the experiment was performed as in Example 1, except that the Sprague-Dawley rats were purchased from Harlan (Wisconsin).
  • Rats were treated IP fifteen hours before surgery with 1 mg/kg of either anti-NGF antibody 911 (marked “911” in the Figure) or isotype matched anti-amnesiac antibody (marked “amn ab” in the Figure).
  • resting pain (cumulative pain score) was assessed by an observer blinded to the treatment of the animals.
  • treatment with anti-NGF antibody 911 significantly (p ⁇ 0.005) reduced the resting pain compared to animals treated with the amnesiac antibody.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Immunology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Chemical & Material Sciences (AREA)
  • Molecular Biology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Biochemistry (AREA)
  • Biomedical Technology (AREA)
  • Biophysics (AREA)
  • Hematology (AREA)
  • Genetics & Genomics (AREA)
  • Pain & Pain Management (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Urology & Nephrology (AREA)
  • Microbiology (AREA)
  • Neurology (AREA)
  • Physics & Mathematics (AREA)
  • Cell Biology (AREA)
  • Neurosurgery (AREA)
  • Rheumatology (AREA)
  • Surgery (AREA)
  • Food Science & Technology (AREA)
  • Biotechnology (AREA)
  • Analytical Chemistry (AREA)
  • General Physics & Mathematics (AREA)
  • Pathology (AREA)
  • Mycology (AREA)
  • Epidemiology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
PCT/US2003/032089 2002-10-08 2003-10-08 Methods for treating post-surgical pain by admisnistering a nerve growth factor antagonist and compositions containing the same Ceased WO2004032870A2 (en)

Priority Applications (15)

Application Number Priority Date Filing Date Title
CA002501626A CA2501626A1 (en) 2002-10-08 2003-10-08 Methods for treating post-surgical pain by administering a nerve growth factor antagonist and compositions containing the same
CN2003801053364A CN1723039B (zh) 2002-10-08 2003-10-08 抗神经生长因子抗体拮抗剂在制备治疗手术后疼痛的药物中的应用
NZ539101A NZ539101A (en) 2002-10-08 2003-10-08 Methods for treating post-surgical pain by administering a nerve growth factor antagonist and compositions containing the same
JP2004543631A JP4584713B2 (ja) 2002-10-08 2003-10-08 神経成長因子アンタゴニストを投与することによって術後疼痛を処置するための方法および神経成長因子アンタゴニストを含有する組成物
DK03779091.2T DK1556083T3 (da) 2002-10-08 2003-10-08 Fremgangsmåde til behandling af post-operative smerter ved indgivelse af en antistof mod nervevækstfaktor og sammensætning indeholdende samme
EP03779091A EP1556083B1 (en) 2002-10-08 2003-10-08 Methods for treating post-surgical pain by admisnistering an antibody against nerve growth factor and compositions containing the same
DE60335957T DE60335957D1 (de) 2002-10-08 2003-10-08 Verfahren zur behandlung von postoperativen schmerzen durch verabreichung eines antikörpers gegen nervenwachstumsfaktor und diesen enthaltende zusammensetzungen
AT03779091T ATE497391T1 (de) 2002-10-08 2003-10-08 Verfahren zur behandlung von postoperativen schmerzen durch verabreichung eines antikörpers gegen nervenwachstumsfaktor und diesen enthaltende zusammensetzungen
HK05107956.2A HK1074173B (en) 2002-10-08 2003-10-08 Methods for treating post-surgical pain by administering an antibody against nerve growth factor and compositions containing the same
SI200331974T SI1556083T1 (sl) 2002-10-08 2003-10-08 Postopki za zdravljenje postoperativne bolečine z dajanjem protitelesa proti živčnemu rastnemu faktorju in sestavki, ki ga vsebujejo
MXPA05003502A MXPA05003502A (es) 2002-10-08 2003-10-08 Metodo para tratar dolor post-quirurgico al administrar un antagonista del factor de crecimiento de nervios y composiciones que contienen el mismo.
AU2003285864A AU2003285864C1 (en) 2002-10-08 2003-10-08 Methods for treating post-surgical pain by administering a nerve growth factor antagonist and compositions containing the same
BR0315164-6A BR0315164A (pt) 2002-10-08 2003-10-08 Métodos para tratar dor pós-cirúrgica administrando um antagonista de fator de crescimento nervoso e composições contendo o mesmo
IL167654A IL167654A (en) 2002-10-08 2005-03-24 Use of an antagonist anti-nerve growth factor in the preparation of medicaments for treating post-surgical pain, pharmaceutical compositions and kits comprising the same
NO20052219A NO20052219L (no) 2002-10-08 2005-05-06 Fremgangsmater for behandling av postkirurgisk smerte ved administrering av en nervevekstfaktorantagonist og preparater inneholdende dette

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US41723702P 2002-10-08 2002-10-08
US60/417,237 2002-10-08

Publications (2)

Publication Number Publication Date
WO2004032870A2 true WO2004032870A2 (en) 2004-04-22
WO2004032870A3 WO2004032870A3 (en) 2004-07-01

Family

ID=32093988

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2003/032089 Ceased WO2004032870A2 (en) 2002-10-08 2003-10-08 Methods for treating post-surgical pain by admisnistering a nerve growth factor antagonist and compositions containing the same

Country Status (23)

Country Link
US (1) US7252822B2 (OSRAM)
EP (1) EP1556083B1 (OSRAM)
JP (1) JP4584713B2 (OSRAM)
KR (1) KR101080716B1 (OSRAM)
CN (1) CN1723039B (OSRAM)
AT (1) ATE497391T1 (OSRAM)
AU (1) AU2003285864C1 (OSRAM)
BR (1) BR0315164A (OSRAM)
CA (1) CA2501626A1 (OSRAM)
DE (1) DE60335957D1 (OSRAM)
DK (1) DK1556083T3 (OSRAM)
ES (1) ES2357948T3 (OSRAM)
IL (1) IL167654A (OSRAM)
MX (1) MXPA05003502A (OSRAM)
NO (1) NO20052219L (OSRAM)
NZ (1) NZ539101A (OSRAM)
PL (1) PL211654B1 (OSRAM)
PT (1) PT1556083E (OSRAM)
RU (1) RU2338555C2 (OSRAM)
SI (1) SI1556083T1 (OSRAM)
UA (1) UA89610C2 (OSRAM)
WO (1) WO2004032870A2 (OSRAM)
ZA (1) ZA200502612B (OSRAM)

Cited By (42)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2004101072A1 (en) * 2003-05-16 2004-11-25 Universite Laval Cns chloride modulation and uses thereof
US7252822B2 (en) 2002-10-08 2007-08-07 Rinat Neuroscience Corp. Methods for treating post-surgical pain by administering an anti-nerve growth factor antagonist
US7255860B2 (en) 2002-10-08 2007-08-14 Rinat Neuroscience Corp. Methods for treating post-surgical pain by administering an anti-nerve growth factor antagonist antibody
US7425329B2 (en) 2004-04-07 2008-09-16 Rinat Neuroscience Corp. Methods for treating bone cancer pain by administering a nerve growth factor antagonist
US7449616B2 (en) 2002-12-24 2008-11-11 Pfizer Inc. Anti-NGF antibodies and methods using same
WO2009023540A1 (en) 2007-08-10 2009-02-19 Regeneron Pharmaceuticals, Inc. High affinity human antibodies to human nerve growth factor
US7569364B2 (en) 2002-12-24 2009-08-04 Pfizer Inc. Anti-NGF antibodies and methods using same
WO2009077993A3 (en) * 2007-12-17 2009-08-13 Pfizer Ltd Treatment of interstitial cystitis
US7601818B2 (en) 2003-07-15 2009-10-13 Amgen, Inc. Human anti-NGF neutralizing antibodies as selective NGF pathway inhibitors
WO2009150635A1 (en) 2008-06-13 2009-12-17 Pfizer Inc. Treatment of chronic prostatitis
US7655231B2 (en) 2003-02-19 2010-02-02 Pfizer Inc. Methods for treating pain by administering a nerve growth factor antagonist and an NSAID
WO2010035725A1 (ja) 2008-09-24 2010-04-01 株式会社リボミック Ngfに対するアプタマー及びその使用
US7718382B2 (en) 2004-05-14 2010-05-18 Universite Laval Method for identifying compounds for treatment of pain
WO2010128398A1 (en) 2009-05-04 2010-11-11 Pangenetics 110 B.V. Antibodies against nerve growth factor (ngf) with enhanced in vivo stability
WO2011049758A1 (en) 2009-10-09 2011-04-28 Amgen Inc. Human anti-ngf neutralizing antibodies as selective ngf pathway inhibitors
WO2011116090A1 (en) 2010-03-17 2011-09-22 Abbott Research B.V. Anti-nerve growth factor (ngf) antibody compositions
WO2011118682A1 (ja) 2010-03-24 2011-09-29 株式会社リボミック Ngfに対するアプタマー及びその使用
WO2012024650A2 (en) 2010-08-19 2012-02-23 Abbott Laboratories Anti-ngf antibodies and their use
US8246956B2 (en) 2003-12-24 2012-08-21 Abbott Research B.V. Humanized anti-nerve growth factor antibodies
US8926978B2 (en) 2011-10-25 2015-01-06 Anaptysbio, Inc. Antibodies directed against nerve growth factor (NGF)
US9161735B2 (en) 2005-09-21 2015-10-20 The Regents Of The University Of California Systems, compositions, and methods for local imaging and treatment of pain
US9315571B2 (en) 2005-01-24 2016-04-19 Elan Pharma International Limited Specific binding members for NGF
US9546156B2 (en) 2012-11-13 2017-01-17 Array Biopharma Inc. N-bicyclic aryl,N'-pyrazolyl urea, thiourea, guanidine cyanoguanidine compounds as TrkA kinase inhibitors
US9562055B2 (en) 2011-05-13 2017-02-07 Array Biopharma Inc. Pyrrolidinyl urea, pyrrolidinyl thiourea and pyrrolidinyl guanidine compounds as TrkA kinase inhibitors
US9617334B2 (en) 2012-06-06 2017-04-11 Zoetis Services Llc Caninized anti-NGF antibodies and methods thereof
US9688749B2 (en) 2005-06-07 2017-06-27 Abbvie Inc. Molecules that are able to inhibit the binding between NGF and the TrkA receptor as analgesics with prolonged effect
US9751947B2 (en) 2008-02-04 2017-09-05 Lay Line Genomics S.P.A. Antibodies and derivatives thereof
US9790178B2 (en) 2012-11-13 2017-10-17 Array Biopharma Inc. Pyrrolidinyl urea, thiourea, guanidine and cyanoguanidine compounds as TrkA kinase inhibitors
US9790210B2 (en) 2012-11-13 2017-10-17 Array Biopharma Inc. N-(monocyclic aryl),N'-pyrazolyl-urea, thiourea, guanidine and cyanoguanidine compounds as TrkA kinase inhibitors
US9809578B2 (en) 2012-11-13 2017-11-07 Array Biopharma Inc. Pyrazolyl urea, thiourea, guanidine and cyanoguanidine compounds as trkA kinase inhibitors
US9822118B2 (en) 2012-11-13 2017-11-21 Array Biopharma Inc. Bicyclic heteroaryl urea, thiourea, guanidine and cyanoguanidine compounds as TrkA kinase inhibitors
US9828360B2 (en) 2012-11-13 2017-11-28 Array Biopharma Inc. Pyrrolidinyl urea, thiourea, guanidine and cyanoguanidine compounds as TrkA kinase inhibitors
US9884911B2 (en) 2014-02-02 2018-02-06 Medimmune Limited Compounds and methods for treating pain
US9896435B2 (en) 2012-11-13 2018-02-20 Array Biopharma Inc. N-pyrrolidinyl,N′-pyrazolyl-urea, thiourea, guanidine and cyanoguanidine compounds as TrkA kinase inhibitors
US9969694B2 (en) 2012-11-13 2018-05-15 Array Biopharma Inc. N-(arylalkyl)-N′-pyrazolyl-urea, thiourea, guanidine and cyanoguanidine compounds as TrkA kinase inhibitors
US9981959B2 (en) 2012-11-13 2018-05-29 Array Biopharma Inc. Thiazolyl and oxazolyl urea, thiourea, guanidine and cyanoguanidine compounds as TrkA kinase inhibitors
US10323086B2 (en) 2002-12-24 2019-06-18 Rinat Neuroscience Corp. Methods for treating osteoarthritis pain by administering a nerve growth factor antagonist and compositions containing the same
US10351575B2 (en) 2012-11-13 2019-07-16 Array Biopharma Inc. Bicyclic urea, thiourea, guanidine and cyanoguanidine compounds useful for the treatment of pain
US10835533B2 (en) 2014-05-15 2020-11-17 Array Biopharma Inc. 1 -((3S,4R)-4-(3-fluorophenyl)-1-(2-methoxyethyl)pyrrolidin-3-yl)-3-(4-methyl-3-(2-methylpyrimidin-5-yl)-1-phenyl-1H-pyrazol-5-yl)urea as a TrkA kinase inhibitor
US10982002B2 (en) 2018-03-12 2021-04-20 Zoetis Services Llc Anti-NGF antibodies and methods thereof
WO2022064043A1 (en) 2020-09-28 2022-03-31 Medimmune Limited Compounds and methods for treating pain
WO2023125477A1 (en) * 2021-12-28 2023-07-06 4B Technologies (Beijing) Co., Limited TrkA ANTIBODY AND APPLICATION THEREOF

Families Citing this family (26)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6703047B2 (en) * 2001-02-02 2004-03-09 Incept Llc Dehydrated hydrogel precursor-based, tissue adherent compositions and methods of use
UA80447C2 (en) * 2002-10-08 2007-09-25 Methods for treating pain by administering nerve growth factor antagonist and opioid analgesic
US9789161B2 (en) * 2006-04-28 2017-10-17 Warsaw Orthopedic, Inc. Methods for treating back or neck pain caused by NGF using a therapeutic agent consisting of ReN-1820, ALE-0540 and capsaicin
NZ579010A (en) 2007-02-20 2012-03-30 Anaptysbio Inc Somatic hypermutation systems
US8309088B2 (en) 2007-08-10 2012-11-13 Regeneron Pharmaceuticals, Inc. Method of treating osteoarthritis with an antibody to NGF
US20090286832A1 (en) * 2008-05-15 2009-11-19 Kiichiro Nabeta Narcotic emulsion formulations for treatment of surgical pain
CA2736864C (en) * 2008-09-19 2020-10-13 Pfizer Inc. Stable liquid antibody formulation
CN106336400A (zh) 2008-12-08 2017-01-18 萌蒂制药国际有限公司 酪氨酸激酶蛋白受体拮抗剂
JP5890182B2 (ja) 2009-02-12 2016-03-22 インセプト エルエルシー ヒドロゲルプラグによる薬物送達
KR20110099747A (ko) 2009-02-26 2011-09-08 테이코쿠 팔마 유에스에이, 인코포레이티드 암 통증 치료용 마취 유상액 제제
RS59830B1 (sr) 2010-03-01 2020-02-28 Bayer Healthcare Llc Optimizovana monoklonska antitela protiv inhibitora puta faktora tkiva (tfpi)
US11214610B2 (en) 2010-12-01 2022-01-04 H. Lundbeck A/S High-purity production of multi-subunit proteins such as antibodies in transformed microbes such as Pichia pastoris
US9884909B2 (en) 2010-12-01 2018-02-06 Alderbio Holdings Llc Anti-NGF compositions and use thereof
US9078878B2 (en) 2010-12-01 2015-07-14 Alderbio Holdings Llc Anti-NGF antibodies that selectively inhibit the association of NGF with TrkA, without affecting the association of NGF with p75
US9539324B2 (en) 2010-12-01 2017-01-10 Alderbio Holdings, Llc Methods of preventing inflammation and treating pain using anti-NGF compositions
US9067988B2 (en) 2010-12-01 2015-06-30 Alderbio Holdings Llc Methods of preventing or treating pain using anti-NGF antibodies
NZ611076A (en) * 2010-12-01 2015-09-25 Alderbio Holdings Llc Anti-ngf compositions and use thereof
US10226417B2 (en) 2011-09-16 2019-03-12 Peter Jarrett Drug delivery systems and applications
JP2015503592A (ja) * 2012-01-05 2015-02-02 ビーチ ツリー ラボ、インコーポレイテッド 神経成長因子の投与による疼痛処置方法
US9592297B2 (en) 2012-08-31 2017-03-14 Bayer Healthcare Llc Antibody and protein formulations
US8613919B1 (en) 2012-08-31 2013-12-24 Bayer Healthcare, Llc High concentration antibody and protein formulations
US8999992B2 (en) 2013-03-15 2015-04-07 Vm Pharma Llc Crystalline forms of tryosine kinase inhibitors and their salts
MX378344B (es) * 2014-03-21 2025-03-10 Teva Pharmaceuticals Int Gmbh Anticuerpos antagonistas dirigidos contra el peptido relacionado con el gen de calcitonina y metodos que usan los mismos.
US10301271B2 (en) 2014-09-17 2019-05-28 Purdue Pharma L.P. Crystalline forms of tyrosine kinase inhibitors and their salts
AU2017331593B2 (en) 2016-09-23 2022-04-28 Teva Pharmaceuticals International Gmbh Treating refractory migraine
US10799289B2 (en) 2018-10-15 2020-10-13 Avent, Inc. Compositions, systems, kits, and methods for neural ablation

Citations (35)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3773919A (en) 1969-10-23 1973-11-20 Du Pont Polylactide-drug mixtures
US4485045A (en) 1981-07-06 1984-11-27 Research Corporation Synthetic phosphatidyl cholines useful in forming liposomes
US4544545A (en) 1983-06-20 1985-10-01 Trustees University Of Massachusetts Liposomes containing modified cholesterol for organ targeting
WO1989009225A1 (en) 1988-03-28 1989-10-05 The Regents Of The University Of California Nerve growth factor peptides
US5013556A (en) 1989-10-20 1991-05-07 Liposome Technology, Inc. Liposomes with enhanced circulation time
EP0519596A1 (en) 1991-05-17 1992-12-23 Merck & Co. Inc. A method for reducing the immunogenicity of antibody variable domains
US5342942A (en) 1992-06-09 1994-08-30 Warner-Lambert Company Pyrazoloquinazolone derivatives as neurotrophic agents
US5500362A (en) 1987-01-08 1996-03-19 Xoma Corporation Chimeric antibody with specificity to human B cell surface antigen
US5585089A (en) 1988-12-28 1996-12-17 Protein Design Labs, Inc. Humanized immunoglobulins
WO1997015593A1 (en) 1995-10-25 1997-05-01 Queen's University At Kingston Neurotrophin antagonists
WO1997021732A1 (en) 1995-12-08 1997-06-19 Mcgill University Design of hormone-like antibodies with agonistic and antagonistic functions
WO1998006048A2 (en) 1996-07-31 1998-02-12 Queen's University At Kingston Molecular modelling of neurotrophin-receptor binding
WO1998017278A1 (en) 1996-10-21 1998-04-30 Allelix Biopharmaceuticals Inc. Neurotrophin antagonist compositions
US5766863A (en) 1993-11-23 1998-06-16 Genentech, Inc. Kinase receptor activation assay
US5807715A (en) 1984-08-27 1998-09-15 The Board Of Trustees Of The Leland Stanford Junior University Methods and transformed mammalian lymphocyte cells for producing functional antigen-binding protein including chimeric immunoglobulin
US5866692A (en) 1991-09-18 1999-02-02 Kyowa Hakko Kogyo Co., Ltd. Process for producing humanized chimera antibody
US5891650A (en) 1993-11-23 1999-04-06 Genentech Incorporated Kinase receptor activation assay
WO1999058572A1 (en) 1998-05-08 1999-11-18 Cambridge University Technical Services Limited Binding molecules derived from immunoglobulins which do not trigger complement mediated lysis
US6017878A (en) 1994-02-07 2000-01-25 Mcgill University Nerve growth factor structural analogs and their uses
US6054297A (en) 1991-06-14 2000-04-25 Genentech, Inc. Humanized antibodies and methods for making them
WO2000053211A2 (en) 1999-03-09 2000-09-14 University Of Southern California Method of promoting myocyte proliferation and myocardial tissue repair
US6127401A (en) 1998-06-05 2000-10-03 Cephalon, Inc. Bridged indenopyrrolocarbazoles
WO2000069829A1 (en) 1999-05-17 2000-11-23 Queen's University Method of inhibiting neurotrophin-receptor binding
WO2000073344A2 (en) 1999-05-26 2000-12-07 Lay Line Genomics Spa Monoclonal antibodies, synthetic and biotechnological derivatives thereof acting as ngf-antagonist molecules
US6210671B1 (en) 1992-12-01 2001-04-03 Protein Design Labs, Inc. Humanized antibodies reactive with L-selectin
WO2001027160A1 (en) 1999-10-14 2001-04-19 Applied Molecular Evolution, Inc. Methods of optimizing antibody variable region binding affinity
US6291247B1 (en) 1994-05-11 2001-09-18 Queen's University At Kingston Methods of screening for factors that disrupt neurotrophin conformation and reduce neurotrophin biological activity
US6306849B1 (en) 1996-06-03 2001-10-23 Cephalon, Inc. Selected derivatives of K-252a
US6331415B1 (en) 1983-04-08 2001-12-18 Genentech, Inc. Methods of producing immunoglobulins, vectors and transformed host cells for use therein
WO2002015924A1 (en) 2000-08-18 2002-02-28 The University Of Bristol Pharmaceutical compostion comprising trkaig2 for use in the prevention and/or treatment of cancer
WO2002017914A2 (en) 2000-08-25 2002-03-07 Cephalon, Inc. Fused pyrrolocarbazoles against inflammation
WO2002020479A1 (en) 2000-09-01 2002-03-14 Glaxo Group Limited Substituted oxindole derivatives as tyrosine kinase inhibitors
US6376471B1 (en) 1997-10-10 2002-04-23 Johns Hopkins University Gene delivery compositions and methods
US6413942B1 (en) 1989-03-21 2002-07-02 Vical, Inc. Methods of delivering a physiologically active polypeptide to a mammal
US6436908B1 (en) 1995-05-30 2002-08-20 Duke University Use of exogenous β-adrenergic receptor and β-adrenergic receptor kinase gene constructs to enhance myocardial function

Family Cites Families (116)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
SU975016A1 (ru) 1979-12-17 1982-11-23 Московский научно-исследовательский онкологический институт им.П.А.Герцена Болеутол ющее средство
US4754065A (en) * 1984-12-18 1988-06-28 Cetus Corporation Precursor to nucleic acid probe
US4683195A (en) * 1986-01-30 1987-07-28 Cetus Corporation Process for amplifying, detecting, and/or-cloning nucleic acid sequences
US4683202A (en) * 1985-03-28 1987-07-28 Cetus Corporation Process for amplifying nucleic acid sequences
US4676980A (en) * 1985-09-23 1987-06-30 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Target specific cross-linked heteroantibodies
US4777127A (en) * 1985-09-30 1988-10-11 Labsystems Oy Human retrovirus-related products and methods of diagnosing and treating conditions associated with said retrovirus
GB8601597D0 (en) 1986-01-23 1986-02-26 Wilson R H Nucleotide sequences
US4800159A (en) * 1986-02-07 1989-01-24 Cetus Corporation Process for amplifying, detecting, and/or cloning nucleic acid sequences
US6548640B1 (en) 1986-03-27 2003-04-15 Btg International Limited Altered antibodies
JPH0826036B2 (ja) 1987-01-22 1996-03-13 協和醗酵工業株式会社 生理活性物質k−252の誘導体
GB8702816D0 (en) 1987-02-07 1987-03-11 Al Sumidaie A M K Obtaining retrovirus-containing fraction
US5219740A (en) * 1987-02-13 1993-06-15 Fred Hutchinson Cancer Research Center Retroviral gene transfer into diploid fibroblasts for gene therapy
US5422120A (en) * 1988-05-30 1995-06-06 Depotech Corporation Heterovesicular liposomes
AP129A (en) 1988-06-03 1991-04-17 Smithkline Biologicals S A Expression of retrovirus gag protein eukaryotic cells
GB8823869D0 (en) * 1988-10-12 1988-11-16 Medical Res Council Production of antibodies
US5047335A (en) * 1988-12-21 1991-09-10 The Regents Of The University Of Calif. Process for controlling intracellular glycosylation of proteins
WO1990007936A1 (en) 1989-01-23 1990-07-26 Chiron Corporation Recombinant therapies for infection and hyperproliferative disorders
SE465573B (sv) 1989-03-14 1991-09-30 Lope Medicine Ab Nervtillvaextfaktorpeptider, motsvarande antikroppar och foerfarande foer bestaemning av nativ nervtillvaextfaktor
EP0737750B1 (en) 1989-03-21 2003-05-14 Vical, Inc. Expression of exogenous polynucleotide sequences in a vertebrate
US5703055A (en) * 1989-03-21 1997-12-30 Wisconsin Alumni Research Foundation Generation of antibodies through lipid mediated DNA delivery
EP0479909B1 (en) 1989-06-29 1996-10-30 Medarex, Inc. Bispecific reagents for aids therapy
EP0487587A1 (en) 1989-08-18 1992-06-03 Chiron Corporation Recombinant retroviruses delivering vector constructs to target cells
US5585362A (en) 1989-08-22 1996-12-17 The Regents Of The University Of Michigan Adenovirus vectors for gene therapy
US5656435A (en) 1989-08-28 1997-08-12 Takeda Chemical Industries, Ltd. Antibodies to peptides having NGF-like activity, said antibodies having no substantial cross-reactivity with NGF, and use thereof
DE69031726T2 (de) 1989-08-28 1998-03-12 Takeda Chemical Industries Ltd Antikörper, ihre Herstellung und Verwendung
JPH03163095A (ja) 1989-08-28 1991-07-15 Takeda Chem Ind Ltd ヒト神経成長因子の部分ペプチド、抗体およびその用途
NZ237464A (en) 1990-03-21 1995-02-24 Depotech Corp Liposomes with at least two separate chambers encapsulating two separate biologically active substances
US5427908A (en) * 1990-05-01 1995-06-27 Affymax Technologies N.V. Recombinant library screening methods
US5545806A (en) * 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
AU8507191A (en) * 1990-08-29 1992-03-30 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5625126A (en) 1990-08-29 1997-04-29 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5633425A (en) 1990-08-29 1997-05-27 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5661016A (en) 1990-08-29 1997-08-26 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
JPH06317587A (ja) 1990-08-31 1994-11-15 Takeda Chem Ind Ltd 抗体およびその用途
US5147294A (en) * 1990-10-01 1992-09-15 Trustees Of Boston University Therapeutic method for reducing chronic pain in a living subject
FR2669336B1 (fr) * 1990-11-20 1993-01-22 Adir Nouveaux derives d'oxazolo pyridines, leurs procedes de preparation et les compositions pharmaceutiques qui les contiennent.
ES2113940T3 (es) 1990-12-03 1998-05-16 Genentech Inc Metodo de enriquecimiento para variantes de proteinas con propiedades de union alteradas.
US5278299A (en) * 1991-03-18 1994-01-11 Scripps Clinic And Research Foundation Method and composition for synthesizing sialylated glycosyl compounds
WO1992020373A1 (en) 1991-05-14 1992-11-26 Repligen Corporation Heteroconjugate antibodies for treatment of hiv infection
ATE255131T1 (de) * 1991-06-14 2003-12-15 Genentech Inc Humanisierter heregulin antikörper
GB9115364D0 (en) * 1991-07-16 1991-08-28 Wellcome Found Antibody
WO1993003769A1 (en) 1991-08-20 1993-03-04 THE UNITED STATES OF AMERICA, represented by THE SECRETARY, DEPARTEMENT OF HEALTH AND HUMAN SERVICES Adenovirus mediated transfer of genes to the gastrointestinal tract
JPH0576384A (ja) 1991-09-20 1993-03-30 Hitachi Ltd 抗ヒト神経成長因子モノクローナル抗体
US5565332A (en) * 1991-09-23 1996-10-15 Medical Research Council Production of chimeric antibodies - a combinatorial approach
EP0605522B1 (en) 1991-09-23 1999-06-23 Medical Research Council Methods for the production of humanized antibodies
WO1993010218A1 (en) 1991-11-14 1993-05-27 The United States Government As Represented By The Secretary Of The Department Of Health And Human Services Vectors including foreign genes and negative selective markers
WO1993010260A1 (en) * 1991-11-21 1993-05-27 The Board Of Trustees Of The Leland Stanford Junior University Controlling degradation of glycoprotein oligosaccharides by extracellular glycosisases
GB9125623D0 (en) 1991-12-02 1992-01-29 Dynal As Cell modification
US5714350A (en) * 1992-03-09 1998-02-03 Protein Design Labs, Inc. Increasing antibody affinity by altering glycosylation in the immunoglobulin variable region
FR2688514A1 (fr) 1992-03-16 1993-09-17 Centre Nat Rech Scient Adenovirus recombinants defectifs exprimant des cytokines et medicaments antitumoraux les contenant.
US5733743A (en) 1992-03-24 1998-03-31 Cambridge Antibody Technology Limited Methods for producing members of specific binding pairs
JPH07507689A (ja) 1992-06-08 1995-08-31 ザ リージェンツ オブ ザ ユニバーシティ オブ カリフォルニア 特定組織のターゲティング方法及び組成物
WO1993025698A1 (en) 1992-06-10 1993-12-23 The United States Government As Represented By The Vector particles resistant to inactivation by human serum
GB2269175A (en) 1992-07-31 1994-02-02 Imperial College Retroviral vectors
EP0656064B1 (en) 1992-08-17 1997-03-05 Genentech, Inc. Bispecific immunoadhesins
JPH08503855A (ja) 1992-12-03 1996-04-30 ジェンザイム・コーポレイション 嚢胞性線維症に対する遺伝子治療
US5604260A (en) 1992-12-11 1997-02-18 Merck Frosst Canada Inc. 5-methanesulfonamido-1-indanones as an inhibitor of cyclooxygenase-2
US5981568A (en) * 1993-01-28 1999-11-09 Neorx Corporation Therapeutic inhibitor of vascular smooth muscle cells
US5409944A (en) * 1993-03-12 1995-04-25 Merck Frosst Canada, Inc. Alkanesulfonamido-1-indanone derivatives as inhibitors of cyclooxygenase
EP0695169B1 (en) 1993-04-22 2002-11-20 SkyePharma Inc. Multivesicular cyclodextrin liposomes encapsulating pharmacologic compounds and methods for their use
US6180377B1 (en) * 1993-06-16 2001-01-30 Celltech Therapeutics Limited Humanized antibodies
US5474995A (en) * 1993-06-24 1995-12-12 Merck Frosst Canada, Inc. Phenyl heterocycles as cox-2 inhibitors
US5436265A (en) * 1993-11-12 1995-07-25 Merck Frosst Canada, Inc. 1-aroyl-3-indolyl alkanoic acids and derivatives thereof useful as anti-inflammatory agents
ATE304604T1 (de) 1993-06-24 2005-09-15 Frank L Graham Adenovirus vektoren für gentherapie
EP0711829A3 (en) 1993-09-15 1997-07-09 Viagene Inc Recombinant alphavirus vector
US6015686A (en) * 1993-09-15 2000-01-18 Chiron Viagene, Inc. Eukaryotic layered vector initiation systems
DE69434594T2 (de) 1993-10-25 2006-09-21 Canji, Inc., San Diego Rekombinante adenoviren-vektor und verfahren zur verwendung
JP3002702B2 (ja) 1993-11-16 2000-01-24 スカイファーム インコーポレーテッド 活性物質の制御放出を有する小胞
US5877016A (en) 1994-03-18 1999-03-02 Genentech, Inc. Human trk receptors and neurotrophic factor inhibitors
US5844092A (en) * 1994-03-18 1998-12-01 Genentech, Inc. Human TRK receptors and neurotrophic factor inhibitors
JP4303315B2 (ja) 1994-05-09 2009-07-29 オックスフォード バイオメディカ(ユーケー)リミテッド 非交差性レトロウイルスベクター
US5475995A (en) * 1994-05-16 1995-12-19 Livingston; George G. Truck spare tire locking rod
GB9514160D0 (en) 1994-07-25 1995-09-13 Zeneca Ltd Aromatic compounds
US5616601A (en) 1994-07-28 1997-04-01 Gd Searle & Co 1,2-aryl and heteroaryl substituted imidazolyl compounds for the treatment of inflammation
US5521213A (en) * 1994-08-29 1996-05-28 Merck Frosst Canada, Inc. Diaryl bicyclic heterocycles as inhibitors of cyclooxygenase-2
US5593994A (en) * 1994-09-29 1997-01-14 The Dupont Merck Pharmaceutical Company Prostaglandin synthase inhibitors
WO1996017072A2 (en) 1994-11-30 1996-06-06 Chiron Viagene, Inc. Recombinant alphavirus vectors
WO1996019233A2 (en) * 1994-12-12 1996-06-27 Omeros Medical Systems, Inc. Irrigation solution and method for inhibition of pain, inflammation and spasm
US5552422A (en) * 1995-01-11 1996-09-03 Merck Frosst Canada, Inc. Aryl substituted 5,5 fused aromatic nitrogen compounds as anti-inflammatory agents
US5604253A (en) 1995-05-22 1997-02-18 Merck Frosst Canada, Inc. N-benzylindol-3-yl propanoic acid derivatives as cyclooxygenase inhibitors
US5510368A (en) * 1995-05-22 1996-04-23 Merck Frosst Canada, Inc. N-benzyl-3-indoleacetic acids as antiinflammatory drugs
US5639780A (en) 1995-05-22 1997-06-17 Merck Frosst Canada, Inc. N-benzyl indol-3-yl butanoic acid derivatives as cyclooxygenase inhibitors
US6265150B1 (en) * 1995-06-07 2001-07-24 Becton Dickinson & Company Phage antibodies
AU2998597A (en) 1996-05-06 1997-11-26 Chiron Corporation Crossless retroviral vectors
WO1998019674A2 (en) 1996-11-05 1998-05-14 Head Explorer Aps A method for treating tension-type headache
US6284794B1 (en) 1996-11-05 2001-09-04 Head Explorer Aps Method for treating tension-type headache with inhibitors of nitric oxide and nitric oxide synthase
US6077530A (en) * 1997-07-28 2000-06-20 Weinstein; Robert Analgesic dosage units for coordinated administration
DE19732928C2 (de) 1997-07-31 2000-05-18 Gruenenthal Gmbh Verwendung substituierter Imidazolidin-2,4-dion-Verbindungen als Schmerzmittel
US6506559B1 (en) * 1997-12-23 2003-01-14 Carnegie Institute Of Washington Genetic inhibition by double-stranded RNA
GB9807781D0 (en) 1998-04-09 1998-06-10 Univ Bristol Therapeutic agent
US6492380B1 (en) 1999-05-17 2002-12-10 Queen's University At Kingston Method of inhibiting neurotrophin-receptor binding
US6399780B1 (en) 1999-08-20 2002-06-04 Cephalon, Inc. Isomeric fused pyrrolocarbazoles and isoindolones
EP1235842A4 (en) 1999-10-15 2003-04-23 Univ Massachusetts Rna interference pathway genes as tools for targeted genetic interference
WO2001052843A1 (en) 2000-01-18 2001-07-26 Mcgill University β-TURN PEPTIDOMIMETIC CYCLIC COMPOUNDS
US6548062B2 (en) * 2000-02-29 2003-04-15 Cephalon, Inc. Method of treating cancer with anti-neurotrophin agents
FR2807660A1 (fr) 2000-04-13 2001-10-19 Warner Lambert Co Utilisation d'antagonistes du ngf pour la prevention ou le traitement de douleurs viscerales chroniques
JP4901051B2 (ja) 2000-05-30 2012-03-21 ジョンソン アンド ジョンソン リサーチ プロプライアトリー リミテッド RNAiを増強する因子を使用することによって遺伝子抑制を媒介する方法
US7022484B2 (en) * 2000-06-08 2006-04-04 Board Of Regents, The University Of Texas System Methods for treating neuropathological states and neurogenic inflammatory states and methods for identifying compounds useful therein
US6964977B2 (en) 2000-09-01 2005-11-15 Smithkline Beecham Corporation Oxindole derivatives
KR100872437B1 (ko) 2000-12-01 2008-12-05 막스-플랑크-게젤샤프트 츄어 푀르더룽 데어 비쎈샤프텐 에.파우. Rna 간섭을 매개하는 작은 rna 분자
EP2340849A1 (en) 2001-05-30 2011-07-06 Genentech, Inc. Anti-NGF antibodies for the treatment of various disorders
US20030008807A1 (en) 2001-06-14 2003-01-09 The Regents Of The University Of California Novel signaling pathway for the production of inflammatory pain and neuropathy
EP1434576A4 (en) 2001-09-13 2006-03-29 Kenneth E Miller METHOD FOR RELIEVING PAIN
US20040038874A1 (en) 2002-08-22 2004-02-26 Osemwota Omoigui Method of treatment of persistent pain
AU2003294221A1 (en) 2002-09-13 2004-04-19 Kenneth E. Miller Method of alleviating pain via inhibition of neurotransmitter synthesis
US6919426B2 (en) 2002-09-19 2005-07-19 Amgen Inc. Peptides and related molecules that modulate nerve growth factor activity
CA2500901A1 (en) 2002-10-04 2004-04-22 Rinat Neuroscience Corp. Methods for treating cardiac arrhythmia and preventing death due to cardiac arrhythmia using ngf antagonists
EP1556083B1 (en) 2002-10-08 2011-02-02 Rinat Neuroscience Corp. Methods for treating post-surgical pain by admisnistering an antibody against nerve growth factor and compositions containing the same
US7255860B2 (en) 2002-10-08 2007-08-14 Rinat Neuroscience Corp. Methods for treating post-surgical pain by administering an anti-nerve growth factor antagonist antibody
UA80447C2 (en) * 2002-10-08 2007-09-25 Methods for treating pain by administering nerve growth factor antagonist and opioid analgesic
EP2270048B1 (en) 2002-12-24 2015-11-11 Rinat Neuroscience Corp. Anti-NGF antibodies and methods using same
WO2004065560A2 (en) 2003-01-18 2004-08-05 Rinat Neuroscience Corp. Methods of screening for modulators of nerve growth factor
KR20050111598A (ko) * 2003-02-19 2005-11-25 리나트 뉴로사이언스 코퍼레이션 신경 성장 인자 길항제 및 nsaid를 투여함으로써통증을 치료하는 방법 및 그것을 함유하는 조성물
MEP31508A (hr) 2003-07-15 2010-10-10 Amgen Inc Humana anti-ngf neutrališuća antitijela kao selektivni ihibitori ngf signalne kaskade
AU2005243247B2 (en) 2004-04-07 2012-03-01 Regents Of The University Of Minnesota Methods for treating bone cancer pain by administering a nerve growth factor antagonist
EP2298345A3 (en) 2005-01-24 2012-03-21 MedImmune Limited Specific binding members for NGF

Patent Citations (37)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3773919A (en) 1969-10-23 1973-11-20 Du Pont Polylactide-drug mixtures
US4485045A (en) 1981-07-06 1984-11-27 Research Corporation Synthetic phosphatidyl cholines useful in forming liposomes
US6331415B1 (en) 1983-04-08 2001-12-18 Genentech, Inc. Methods of producing immunoglobulins, vectors and transformed host cells for use therein
US4544545A (en) 1983-06-20 1985-10-01 Trustees University Of Massachusetts Liposomes containing modified cholesterol for organ targeting
US5807715A (en) 1984-08-27 1998-09-15 The Board Of Trustees Of The Leland Stanford Junior University Methods and transformed mammalian lymphocyte cells for producing functional antigen-binding protein including chimeric immunoglobulin
US5500362A (en) 1987-01-08 1996-03-19 Xoma Corporation Chimeric antibody with specificity to human B cell surface antigen
WO1989009225A1 (en) 1988-03-28 1989-10-05 The Regents Of The University Of California Nerve growth factor peptides
US5693761A (en) 1988-12-28 1997-12-02 Protein Design Labs, Inc. Polynucleotides encoding improved humanized immunoglobulins
US5585089A (en) 1988-12-28 1996-12-17 Protein Design Labs, Inc. Humanized immunoglobulins
US6413942B1 (en) 1989-03-21 2002-07-02 Vical, Inc. Methods of delivering a physiologically active polypeptide to a mammal
US5013556A (en) 1989-10-20 1991-05-07 Liposome Technology, Inc. Liposomes with enhanced circulation time
EP0519596A1 (en) 1991-05-17 1992-12-23 Merck & Co. Inc. A method for reducing the immunogenicity of antibody variable domains
US6054297A (en) 1991-06-14 2000-04-25 Genentech, Inc. Humanized antibodies and methods for making them
US5866692A (en) 1991-09-18 1999-02-02 Kyowa Hakko Kogyo Co., Ltd. Process for producing humanized chimera antibody
US5342942A (en) 1992-06-09 1994-08-30 Warner-Lambert Company Pyrazoloquinazolone derivatives as neurotrophic agents
US6210671B1 (en) 1992-12-01 2001-04-03 Protein Design Labs, Inc. Humanized antibodies reactive with L-selectin
US5766863A (en) 1993-11-23 1998-06-16 Genentech, Inc. Kinase receptor activation assay
US5891650A (en) 1993-11-23 1999-04-06 Genentech Incorporated Kinase receptor activation assay
US6017878A (en) 1994-02-07 2000-01-25 Mcgill University Nerve growth factor structural analogs and their uses
US6291247B1 (en) 1994-05-11 2001-09-18 Queen's University At Kingston Methods of screening for factors that disrupt neurotrophin conformation and reduce neurotrophin biological activity
US6436908B1 (en) 1995-05-30 2002-08-20 Duke University Use of exogenous β-adrenergic receptor and β-adrenergic receptor kinase gene constructs to enhance myocardial function
WO1997015593A1 (en) 1995-10-25 1997-05-01 Queen's University At Kingston Neurotrophin antagonists
WO1997021732A1 (en) 1995-12-08 1997-06-19 Mcgill University Design of hormone-like antibodies with agonistic and antagonistic functions
US6306849B1 (en) 1996-06-03 2001-10-23 Cephalon, Inc. Selected derivatives of K-252a
WO1998006048A2 (en) 1996-07-31 1998-02-12 Queen's University At Kingston Molecular modelling of neurotrophin-receptor binding
WO1998017278A1 (en) 1996-10-21 1998-04-30 Allelix Biopharmaceuticals Inc. Neurotrophin antagonist compositions
US6376471B1 (en) 1997-10-10 2002-04-23 Johns Hopkins University Gene delivery compositions and methods
WO1999058572A1 (en) 1998-05-08 1999-11-18 Cambridge University Technical Services Limited Binding molecules derived from immunoglobulins which do not trigger complement mediated lysis
US6359130B1 (en) 1998-06-05 2002-03-19 Cephalon, Inc. Bridged indenopyrrolocarbazoles
US6127401A (en) 1998-06-05 2000-10-03 Cephalon, Inc. Bridged indenopyrrolocarbazoles
WO2000053211A2 (en) 1999-03-09 2000-09-14 University Of Southern California Method of promoting myocyte proliferation and myocardial tissue repair
WO2000069829A1 (en) 1999-05-17 2000-11-23 Queen's University Method of inhibiting neurotrophin-receptor binding
WO2000073344A2 (en) 1999-05-26 2000-12-07 Lay Line Genomics Spa Monoclonal antibodies, synthetic and biotechnological derivatives thereof acting as ngf-antagonist molecules
WO2001027160A1 (en) 1999-10-14 2001-04-19 Applied Molecular Evolution, Inc. Methods of optimizing antibody variable region binding affinity
WO2002015924A1 (en) 2000-08-18 2002-02-28 The University Of Bristol Pharmaceutical compostion comprising trkaig2 for use in the prevention and/or treatment of cancer
WO2002017914A2 (en) 2000-08-25 2002-03-07 Cephalon, Inc. Fused pyrrolocarbazoles against inflammation
WO2002020479A1 (en) 2000-09-01 2002-03-14 Glaxo Group Limited Substituted oxindole derivatives as tyrosine kinase inhibitors

Non-Patent Citations (51)

* Cited by examiner, † Cited by third party
Title
"Remington, The Science and Practice of Pharmacy", 2000, MACK PUBLISHING
BORSANI ET AL., NUC. ACIDS RES., vol. 18, 1990, pages 4020
BROWN ET AL., CANCER RES., vol. 47, 1987, pages 3577 - 3583
BUCHMAN; DAVIES, DEVELOPMENT, vol. 118, 1993, pages 989 - 1001
CARACENI ET AL., J PAIN SYMPTOM MANAGE, vol. 23, no. 3, 2002, pages 239 - 55
CHAO ET AL., SCIENCE, vol. 232, 1986, pages 518 - 521
CHIOU ET AL.: "Gene Therapeutics: Methods And Applications Of Direct Gene Transfer", 1994
CHUN; PATTERSON, DEV. BIOL., vol. 75, 1977, pages 705 - 711
CONNELLY, HUMAN GENE THERAPY, vol. 1, 1995, pages 185
CROWLEY ET AL., CE11, vol. 76, 1994, pages 1001 - 1011
DAUGHERTY ET AL., NUCL. ACIDS RES., vol. 19, 1991, pages 2471 - 2476
DE KOCK ET AL., PAIN, vol. 92, 2001, pages 373 - 80
EIDE ET AL., J. NEUROSCI., vol. 16, 1996, pages 3123
EPSTEIN ET AL., PROC. NATL. ACAD SCI. USA, vol. 82, 1985, pages 3688
EUR. J. IMMUNOL., vol. 29, 1999, pages 2613 - 2624
FINDEIS ET AL., TRENDS BIOTECHNOL., vol. 11, 1993, pages 202
HONGO ET AL., HYBRIDOMA, vol. 19, 2000, pages 215 - 227
HWANG ET AL., PROC. NATL ACAD SCI. USA, vol. 77, 1980, pages 4030
JOLLY, CANCER GENE THERAPY, vol. 1, 1994, pages 51
JONES ET AL., NATURE, vol. 321, 1986, pages 522 - 525
KAPLITT, NATURE GENETICS, vol. 6, 1994, pages 148
KATZ ET AL., SURG CLIN NORTH AM., vol. 79, no. 2, 1999, pages 231 - 52
KIMURA, HUMAN GENE THERAPY, vol. 5, 1994, pages 845
KLEIN ET AL., CELL, vol. 61, 1990, pages 647
KNUSEL ET AL., J NEUROCHEM., vol. 59, 1992, pages 715 - 722
KNUSEL ET AL., J NEUROCHEMISTRY, vol. 57, 1991, pages 955 - 962
KOIZUMI ET AL., J. NEUROSCIENCE, vol. 8, 1988, pages 715 - 721
LAMBALLE ET AL., EMBO.J., vol. 12, 1993, pages 3083
LEVI-MONTALCINI, R.; ANGELETTI, P.: "Nerve growth factor.", PHYSIOL. REV., vol. 48, 1968, pages 534 - 569
LI ET AL., PROC. NATL. ACAD SET USA, vol. 95, 1998, pages 10884
LINDSAY ET AL., NATURE, vol. 337, 1989, pages 362 - 364
LIU ET AL., J. NEUROSCI, vol. 17, 1997, pages 8749
LOBUGLIO ET AL., PROC. NAT. ACAD SCI. USA, vol. 86, 1989, pages 4220 - 4224
REMINGTON: "The Science and Practice of Pharmacy", 2000, MACK PUBLISHING
RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323 - 327
SHAW ET AL., JLMMUNOL., vol. 138, 1987, pages 4534 - 4538
SMEYNE ET AL., NATURE, vol. 368, 1994, pages 246 - 249
SOCIETY FOR NEUROSCIENCE ABSTRACTS, vol. 24, no. 1-2, 1998, pages 880
TAGLIALETELA ET AL., J NEUROCHEM, vol. 66, no. 5, 1996, pages 1826 - 35
TSOULFAS ET AL., NEURON, vol. 10, 1993, pages 975
TSOULFAS ET AL., NEURON, vol. 10, 1993, pages 975 - 990
ULLRICH ET AL., NATURE, vol. 303, 1983, pages 821 - 825
URFER ET AL., BIOCHEM., vol. 36, 1997, pages 4775 - 4781
VALENZUELA ET AL., NEURON, vol. 10, 1993, pages 963
VERHOEYEN ET AL., SCIENCE, vol. 239, 1988, pages 1534 - 1536
WINTER ET AL., NATURE, vol. 349, 1991, pages 293 - 299
WOOLF ET AL., J. NEUROSCIE, vol. 21, no. 3, 2001, pages 1047 - 55
WU ET AL., J BIOL. CHEM., vol. 263, 1988, pages 621
WU ET AL., J BIOL. CHEM., vol. 269, 1994, pages 542
WU ET AL., J. BIOL. CHEM., vol. 266, 1991, pages 338
ZENKE ET AL., PROC. NATL. ACAD. SCI. USA, vol. 87, 1990, pages 3655

Cited By (92)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7252822B2 (en) 2002-10-08 2007-08-07 Rinat Neuroscience Corp. Methods for treating post-surgical pain by administering an anti-nerve growth factor antagonist
US7255860B2 (en) 2002-10-08 2007-08-14 Rinat Neuroscience Corp. Methods for treating post-surgical pain by administering an anti-nerve growth factor antagonist antibody
US11008386B2 (en) 2002-12-24 2021-05-18 Rinat Neuroscience Corp. Anti-NGF antibodies and methods using same
US8088384B2 (en) 2002-12-24 2012-01-03 Rinat Neuroscience Corp. Anti-NGF antibodies and methods using same
US7449616B2 (en) 2002-12-24 2008-11-11 Pfizer Inc. Anti-NGF antibodies and methods using same
US7655232B2 (en) 2002-12-24 2010-02-02 Pfizer Inc. Anti-NGF antibodies and methods using same
US7569364B2 (en) 2002-12-24 2009-08-04 Pfizer Inc. Anti-NGF antibodies and methods using same
US10323086B2 (en) 2002-12-24 2019-06-18 Rinat Neuroscience Corp. Methods for treating osteoarthritis pain by administering a nerve growth factor antagonist and compositions containing the same
US7655231B2 (en) 2003-02-19 2010-02-02 Pfizer Inc. Methods for treating pain by administering a nerve growth factor antagonist and an NSAID
US8173376B2 (en) 2003-05-16 2012-05-08 Universite Laval Method for identifying compounds for treatment of pain
US7709207B2 (en) 2003-05-16 2010-05-04 Universite Laval Method for identifying compounds for treatment of pain
EP2198922A1 (en) * 2003-05-16 2010-06-23 Universite Laval CNS chloride modulation and uses thereof
WO2004101072A1 (en) * 2003-05-16 2004-11-25 Universite Laval Cns chloride modulation and uses thereof
US8198410B2 (en) 2003-07-15 2012-06-12 Amgen Inc. Human anti-NGF neutralizing antibodies as selective NGF pathway inhibitors
US7601818B2 (en) 2003-07-15 2009-10-13 Amgen, Inc. Human anti-NGF neutralizing antibodies as selective NGF pathway inhibitors
US8106167B2 (en) 2003-07-15 2012-01-31 Amgen Inc. Human anti-NGF neutralizing antibodies as selective NGF pathway inhibitors
US9260514B2 (en) 2003-07-15 2016-02-16 Amgen Inc. Methods of treating conditions caused by increased expression of nerve growth factor (NGF) or increased sensitivity to NGF using anti-NGF neutralizing antibodies as selective NGF pathway inhibitors
US7795413B2 (en) 2003-07-15 2010-09-14 Amgen, Inc. Nucleic acids encoding human anti-NGF neutralizing antibodies as selective NGF pathway inhibitors
US8877491B2 (en) 2003-12-24 2014-11-04 Abbvie Inc. Polynucleotides encoding humanized anti-NGF antibodies
US8257710B2 (en) 2003-12-24 2012-09-04 Abbott Research, B.V. Method for the treatment of pain with humanized anti-nerve growth factor antibodies
US8246956B2 (en) 2003-12-24 2012-08-21 Abbott Research B.V. Humanized anti-nerve growth factor antibodies
EP2206728A1 (en) 2004-04-07 2010-07-14 Rinat Neuroscience Corp. Methods for treating bone cancer pain by administering a nerve growth factor antagonistic antibody
US8226951B2 (en) 2004-04-07 2012-07-24 Pfizer Inc. Methods for treating bone cancer by administering a nerve growth factor antagonist antibody
US8007800B2 (en) 2004-04-07 2011-08-30 Pfizer Inc. Methods for treating bone cancer pain by administering a nerve growth factor antagonist antibody
US7425329B2 (en) 2004-04-07 2008-09-16 Rinat Neuroscience Corp. Methods for treating bone cancer pain by administering a nerve growth factor antagonist
EP3372614A1 (en) 2004-04-07 2018-09-12 Rinat Neuroscience Corp. Methods for treating bone cancer pain by administering a nerve growth factor antagonist
US7718382B2 (en) 2004-05-14 2010-05-18 Universite Laval Method for identifying compounds for treatment of pain
US9701746B2 (en) 2005-01-24 2017-07-11 Medimmune Limited Methods of treating neuropathic pain with specific binding members for NGF
US9315571B2 (en) 2005-01-24 2016-04-19 Elan Pharma International Limited Specific binding members for NGF
US9688749B2 (en) 2005-06-07 2017-06-27 Abbvie Inc. Molecules that are able to inhibit the binding between NGF and the TrkA receptor as analgesics with prolonged effect
US9161735B2 (en) 2005-09-21 2015-10-20 The Regents Of The University Of California Systems, compositions, and methods for local imaging and treatment of pain
US10123759B2 (en) 2005-09-21 2018-11-13 The Regents Of The University Of California Systems, compositions, and methods for local imaging and treatment of pain
WO2009023540A1 (en) 2007-08-10 2009-02-19 Regeneron Pharmaceuticals, Inc. High affinity human antibodies to human nerve growth factor
EP2572729A2 (en) 2007-08-10 2013-03-27 Regeneron Pharmaceuticals, Inc. High affinity human antibodies to human nerve growth factor
US8591898B2 (en) 2007-12-17 2013-11-26 Pfizer Limited Treatment of interstitial cystitis
EP3587450A1 (en) * 2007-12-17 2020-01-01 Pfizer Limited Treatment of interstitial cystitis with ngf inhibitors
WO2009077993A3 (en) * 2007-12-17 2009-08-13 Pfizer Ltd Treatment of interstitial cystitis
US9751947B2 (en) 2008-02-04 2017-09-05 Lay Line Genomics S.P.A. Antibodies and derivatives thereof
US8481036B2 (en) 2008-06-13 2013-07-09 Pfizer Inc. Treatment of chronic prostatitis
WO2009150623A1 (en) * 2008-06-13 2009-12-17 Pfizer Inc Treatment of chronic prostatitis
EP3321283A1 (en) * 2008-06-13 2018-05-16 Pfizer Inc Treatment of chronic prostatitis
WO2009150635A1 (en) 2008-06-13 2009-12-17 Pfizer Inc. Treatment of chronic prostatitis
US10260070B2 (en) 2008-09-24 2019-04-16 Ribomic Inc. Aptamer for NGF and use thereof
WO2010035725A1 (ja) 2008-09-24 2010-04-01 株式会社リボミック Ngfに対するアプタマー及びその使用
WO2010128398A1 (en) 2009-05-04 2010-11-11 Pangenetics 110 B.V. Antibodies against nerve growth factor (ngf) with enhanced in vivo stability
US9447181B2 (en) 2009-05-04 2016-09-20 Abbvie Research B.V. Antibodies against nerve growth factor (NGF) with enhanced in vivo stability
WO2011049758A1 (en) 2009-10-09 2011-04-28 Amgen Inc. Human anti-ngf neutralizing antibodies as selective ngf pathway inhibitors
EP3028717A1 (en) 2009-10-09 2016-06-08 Amgen, Inc Human anti-ngf neutralizing antibodies as selective ngf pathway inhibitors
WO2011116090A1 (en) 2010-03-17 2011-09-22 Abbott Research B.V. Anti-nerve growth factor (ngf) antibody compositions
US9175292B2 (en) 2010-03-24 2015-11-03 Fujimoto Pharmaceutical Corporation Aptamer for NGF and use thereof
WO2011118682A1 (ja) 2010-03-24 2011-09-29 株式会社リボミック Ngfに対するアプタマー及びその使用
US9505829B2 (en) 2010-08-19 2016-11-29 Zoetis Belgium S.A. Anti-NGF antibodies and their use
WO2012024650A2 (en) 2010-08-19 2012-02-23 Abbott Laboratories Anti-ngf antibodies and their use
EP4056589A1 (en) 2010-08-19 2022-09-14 Zoetis Belgium S.A. Anti-ngf antibodies and their use
US10125192B2 (en) 2010-08-19 2018-11-13 Zoetis Belgium S.A. Caninized anti-NGF antibodies and their use
US10093725B2 (en) 2010-08-19 2018-10-09 Zoetis Belgium S.A. Anti-NGF antibodies and their use
US9562055B2 (en) 2011-05-13 2017-02-07 Array Biopharma Inc. Pyrrolidinyl urea, pyrrolidinyl thiourea and pyrrolidinyl guanidine compounds as TrkA kinase inhibitors
US9878997B2 (en) 2011-05-13 2018-01-30 Array Biopharma Inc. Pyrrolidinyl urea, pyrrolidinyl thiourea and pyrrolidinyl guanidine compounds as TrkA kinase inhibitors
US10323022B2 (en) 2011-05-13 2019-06-18 Array Biopharma Inc. Pyrrolidinyl urea, pyrrolidinyl thiourea and pyrrolidinyl guanidine compounds as TrkA kinase inhibitors
US9951126B2 (en) 2011-10-25 2018-04-24 Anaptysbio, Inc. Antibodies directed against nerve growth factor (NGF)
US8926978B2 (en) 2011-10-25 2015-01-06 Anaptysbio, Inc. Antibodies directed against nerve growth factor (NGF)
US9951128B2 (en) 2012-06-06 2018-04-24 Zoetis Services Llc Caninized anti-NGF antibodies and methods thereof
US9617334B2 (en) 2012-06-06 2017-04-11 Zoetis Services Llc Caninized anti-NGF antibodies and methods thereof
US9822118B2 (en) 2012-11-13 2017-11-21 Array Biopharma Inc. Bicyclic heteroaryl urea, thiourea, guanidine and cyanoguanidine compounds as TrkA kinase inhibitors
US10851080B2 (en) 2012-11-13 2020-12-01 Array Biopharma Inc. Methods of treatment using pyrrolidinyl urea, thiourea, guanidine and cyanoguanidine compounds
US9896435B2 (en) 2012-11-13 2018-02-20 Array Biopharma Inc. N-pyrrolidinyl,N′-pyrazolyl-urea, thiourea, guanidine and cyanoguanidine compounds as TrkA kinase inhibitors
US9809578B2 (en) 2012-11-13 2017-11-07 Array Biopharma Inc. Pyrazolyl urea, thiourea, guanidine and cyanoguanidine compounds as trkA kinase inhibitors
US9790210B2 (en) 2012-11-13 2017-10-17 Array Biopharma Inc. N-(monocyclic aryl),N'-pyrazolyl-urea, thiourea, guanidine and cyanoguanidine compounds as TrkA kinase inhibitors
US9981959B2 (en) 2012-11-13 2018-05-29 Array Biopharma Inc. Thiazolyl and oxazolyl urea, thiourea, guanidine and cyanoguanidine compounds as TrkA kinase inhibitors
US9790178B2 (en) 2012-11-13 2017-10-17 Array Biopharma Inc. Pyrrolidinyl urea, thiourea, guanidine and cyanoguanidine compounds as TrkA kinase inhibitors
US10351575B2 (en) 2012-11-13 2019-07-16 Array Biopharma Inc. Bicyclic urea, thiourea, guanidine and cyanoguanidine compounds useful for the treatment of pain
US9828360B2 (en) 2012-11-13 2017-11-28 Array Biopharma Inc. Pyrrolidinyl urea, thiourea, guanidine and cyanoguanidine compounds as TrkA kinase inhibitors
US9969694B2 (en) 2012-11-13 2018-05-15 Array Biopharma Inc. N-(arylalkyl)-N′-pyrazolyl-urea, thiourea, guanidine and cyanoguanidine compounds as TrkA kinase inhibitors
US9546156B2 (en) 2012-11-13 2017-01-17 Array Biopharma Inc. N-bicyclic aryl,N'-pyrazolyl urea, thiourea, guanidine cyanoguanidine compounds as TrkA kinase inhibitors
US10889589B2 (en) 2012-11-13 2021-01-12 Array Biopharma Inc. Bicyclic urea, thiourea, guanidine and cyanoguanidine compounds useful for the treatment of pain
US10457728B2 (en) 2014-02-02 2019-10-29 Medimmune Limited Compounds and methods for treating pain
US9884911B2 (en) 2014-02-02 2018-02-06 Medimmune Limited Compounds and methods for treating pain
EP3696193A1 (en) 2014-02-02 2020-08-19 MedImmune Limited Chimeric protein composed of ngf antagonist domain and a tnfa antagonist domain
US11053307B2 (en) 2014-02-02 2021-07-06 Medimmune Limited Compounds and methods for treating pain
US11897949B2 (en) 2014-02-02 2024-02-13 Medimmune Limited Compounds and methods for treating pain
US10835533B2 (en) 2014-05-15 2020-11-17 Array Biopharma Inc. 1 -((3S,4R)-4-(3-fluorophenyl)-1-(2-methoxyethyl)pyrrolidin-3-yl)-3-(4-methyl-3-(2-methylpyrimidin-5-yl)-1-phenyl-1H-pyrazol-5-yl)urea as a TrkA kinase inhibitor
US12084506B2 (en) 2018-03-12 2024-09-10 Zoetis Services Llc Methods of treating a canine and inhibiting NGF activity through use of anti-NGF antibodies
US12049509B2 (en) 2018-03-12 2024-07-30 Zoetis Services Llc Nucleic acids encoding a canine antibody which binds nerve growth factor and vectors and host cells thereof
US12049508B2 (en) 2018-03-12 2024-07-30 Zoetis Services Llc Canine anti-NGF antibodies and methods of treating pain thereof
US12049507B2 (en) 2018-03-12 2024-07-30 Zoetis Services Llc Felinized anti-NGF antibodies and methods of treating pain
US10982002B2 (en) 2018-03-12 2021-04-20 Zoetis Services Llc Anti-NGF antibodies and methods thereof
US12084507B2 (en) 2018-03-12 2024-09-10 Zoetis Services Llc Humanized anti-NGF antibodies and methods of treating pain thereof
US12497459B2 (en) 2018-03-12 2025-12-16 Zoetis Services Llc Nucleic acids encoding canine anti-NGF antibodies and methods thereof
US12552871B2 (en) 2018-03-12 2026-02-17 Zoetis Services Llc Nucleic acids encoding humanized anti-NGF antibodies
WO2022064043A1 (en) 2020-09-28 2022-03-31 Medimmune Limited Compounds and methods for treating pain
WO2023125477A1 (en) * 2021-12-28 2023-07-06 4B Technologies (Beijing) Co., Limited TrkA ANTIBODY AND APPLICATION THEREOF
US12077591B2 (en) 2021-12-28 2024-09-03 4B Technologies (Suzhou) Limited TrkA antibody and application thereof

Also Published As

Publication number Publication date
HK1074173A1 (en) 2005-11-04
MXPA05003502A (es) 2005-09-30
KR101080716B1 (ko) 2011-11-07
ZA200502612B (en) 2007-07-25
JP4584713B2 (ja) 2010-11-24
EP1556083A4 (en) 2006-10-11
PT1556083E (pt) 2011-03-17
PL211654B1 (pl) 2012-06-29
AU2003285864A1 (en) 2004-05-04
ES2357948T3 (es) 2011-05-04
CA2501626A1 (en) 2004-04-22
ATE497391T1 (de) 2011-02-15
UA89610C2 (ru) 2010-02-25
NO20052219L (no) 2005-07-04
US7252822B2 (en) 2007-08-07
NO20052219D0 (no) 2005-05-06
AU2003285864B2 (en) 2009-10-01
JP2006504744A (ja) 2006-02-09
RU2005113997A (ru) 2005-10-27
CN1723039A (zh) 2006-01-18
KR20050071559A (ko) 2005-07-07
NZ539101A (en) 2008-08-29
EP1556083B1 (en) 2011-02-02
DK1556083T3 (da) 2011-04-04
WO2004032870A3 (en) 2004-07-01
SI1556083T1 (sl) 2011-05-31
CN1723039B (zh) 2013-01-16
AU2003285864C1 (en) 2010-07-01
IL167654A (en) 2012-07-31
BR0315164A (pt) 2005-08-23
RU2338555C2 (ru) 2008-11-20
US20040228862A1 (en) 2004-11-18
EP1556083A2 (en) 2005-07-27
DE60335957D1 (de) 2011-03-17
PL375303A1 (en) 2005-11-28

Similar Documents

Publication Publication Date Title
EP1556083B1 (en) Methods for treating post-surgical pain by admisnistering an antibody against nerve growth factor and compositions containing the same
EP1575522B1 (en) Methods for treating pain by administering an antagonist antibody against the nerve growth factor and an opioid analgesic and compositions containing the same
US7655231B2 (en) Methods for treating pain by administering a nerve growth factor antagonist and an NSAID
US7255860B2 (en) Methods for treating post-surgical pain by administering an anti-nerve growth factor antagonist antibody
JP2006504744A5 (OSRAM)
JP2006517524A5 (OSRAM)
ZA200506509B (en) Methods for treating pain by administering a nerve growth factor antagonist and an nsaid and compositions containing the same
HK1074173B (en) Methods for treating post-surgical pain by administering an antibody against nerve growth factor and compositions containing the same

Legal Events

Date Code Title Description
AK Designated states

Kind code of ref document: A2

Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE EG ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NI NO NZ OM PG PH PL PT RO RU SC SD SE SG SK SL SY TJ TM TN TR TT TZ UA UG US UZ VC VN YU ZA ZM ZW

AL Designated countries for regional patents

Kind code of ref document: A2

Designated state(s): GH GM KE LS MW MZ SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IT LU MC NL PT RO SE SI SK TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG

121 Ep: the epo has been informed by wipo that ep was designated in this application
DFPE Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101)
WWE Wipo information: entry into national phase

Ref document number: 167654

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: 539101

Country of ref document: NZ

WWE Wipo information: entry into national phase

Ref document number: 2005/02612

Country of ref document: ZA

Ref document number: 200502612

Country of ref document: ZA

WWE Wipo information: entry into national phase

Ref document number: PA/a/2005/003502

Country of ref document: MX

WWE Wipo information: entry into national phase

Ref document number: 375303

Country of ref document: PL

WWE Wipo information: entry into national phase

Ref document number: 2501626

Country of ref document: CA

Ref document number: 2004543631

Country of ref document: JP

WWE Wipo information: entry into national phase

Ref document number: 1020057006104

Country of ref document: KR

WWE Wipo information: entry into national phase

Ref document number: 2003285864

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 2003779091

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2005113997

Country of ref document: RU

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 20038A53364

Country of ref document: CN

WWP Wipo information: published in national office

Ref document number: 1020057006104

Country of ref document: KR

WWP Wipo information: published in national office

Ref document number: 2003779091

Country of ref document: EP