US20160024169A1 - Insulin-incretin conjugates - Google Patents
Insulin-incretin conjugates Download PDFInfo
- Publication number
- US20160024169A1 US20160024169A1 US14/774,357 US201414774357A US2016024169A1 US 20160024169 A1 US20160024169 A1 US 20160024169A1 US 201414774357 A US201414774357 A US 201414774357A US 2016024169 A1 US2016024169 A1 US 2016024169A1
- Authority
- US
- United States
- Prior art keywords
- amino acid
- seq
- acid
- group
- chain
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 239000000859 incretin Substances 0.000 title claims abstract description 16
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 claims abstract description 359
- 108090000765 processed proteins & peptides Proteins 0.000 claims abstract description 241
- 108090001061 Insulin Proteins 0.000 claims abstract description 199
- 229940125396 insulin Drugs 0.000 claims abstract description 170
- 102000004877 Insulin Human genes 0.000 claims abstract description 135
- 230000000694 effects Effects 0.000 claims abstract description 81
- 239000000556 agonist Substances 0.000 claims abstract description 32
- MGXWVYUBJRZYPE-YUGYIWNOSA-N incretin Chemical class C([C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(N)=O)C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1C=CC(O)=CC=1)[C@@H](C)O)[C@@H](C)CC)C1=CC=C(O)C=C1 MGXWVYUBJRZYPE-YUGYIWNOSA-N 0.000 claims abstract description 6
- 235000001014 amino acid Nutrition 0.000 claims description 408
- 229940024606 amino acid Drugs 0.000 claims description 358
- 150000001413 amino acids Chemical class 0.000 claims description 298
- MASNOZXLGMXCHN-ZLPAWPGGSA-N glucagon Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O)C(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C1=CC=CC=C1 MASNOZXLGMXCHN-ZLPAWPGGSA-N 0.000 claims description 190
- 108060003199 Glucagon Proteins 0.000 claims description 176
- 102000051325 Glucagon Human genes 0.000 claims description 175
- 229960004666 glucagon Drugs 0.000 claims description 175
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 155
- 125000005647 linker group Chemical group 0.000 claims description 132
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 claims description 107
- 238000006467 substitution reaction Methods 0.000 claims description 102
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 claims description 98
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 claims description 85
- 235000004279 alanine Nutrition 0.000 claims description 85
- 229960003767 alanine Drugs 0.000 claims description 85
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 claims description 79
- 239000004220 glutamic acid Substances 0.000 claims description 79
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 claims description 78
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 claims description 74
- 235000013922 glutamic acid Nutrition 0.000 claims description 72
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 claims description 70
- -1 His Chemical compound 0.000 claims description 61
- 239000004475 Arginine Substances 0.000 claims description 58
- 239000004472 Lysine Substances 0.000 claims description 58
- 229960003121 arginine Drugs 0.000 claims description 58
- 239000004026 insulin derivative Substances 0.000 claims description 57
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 claims description 55
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 claims description 55
- 235000009697 arginine Nutrition 0.000 claims description 55
- 235000018977 lysine Nutrition 0.000 claims description 55
- 230000004048 modification Effects 0.000 claims description 54
- 238000012986 modification Methods 0.000 claims description 54
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 claims description 52
- 235000003704 aspartic acid Nutrition 0.000 claims description 52
- 229960005261 aspartic acid Drugs 0.000 claims description 52
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Chemical group OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 claims description 52
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 claims description 51
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 claims description 51
- 235000014304 histidine Nutrition 0.000 claims description 51
- 229960002885 histidine Drugs 0.000 claims description 51
- AHLPHDHHMVZTML-BYPYZUCNSA-N L-Ornithine Chemical compound NCCC[C@H](N)C(O)=O AHLPHDHHMVZTML-BYPYZUCNSA-N 0.000 claims description 50
- AHLPHDHHMVZTML-UHFFFAOYSA-N Orn-delta-NH2 Natural products NCCCC(N)C(O)=O AHLPHDHHMVZTML-UHFFFAOYSA-N 0.000 claims description 50
- UTJLXEIPEHZYQJ-UHFFFAOYSA-N Ornithine Natural products OC(=O)C(C)CCCN UTJLXEIPEHZYQJ-UHFFFAOYSA-N 0.000 claims description 50
- 229960003104 ornithine Drugs 0.000 claims description 50
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 claims description 49
- 239000004473 Threonine Substances 0.000 claims description 48
- 229960002898 threonine Drugs 0.000 claims description 48
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 claims description 47
- 235000008521 threonine Nutrition 0.000 claims description 47
- 125000000217 alkyl group Chemical group 0.000 claims description 45
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 claims description 42
- 102100040918 Pro-glucagon Human genes 0.000 claims description 42
- XVOYSCVBGLVSOL-UHFFFAOYSA-N cysteic acid Chemical compound OC(=O)C(N)CS(O)(=O)=O XVOYSCVBGLVSOL-UHFFFAOYSA-N 0.000 claims description 42
- 210000004899 c-terminal region Anatomy 0.000 claims description 41
- DTHNMHAUYICORS-KTKZVXAJSA-N Glucagon-like peptide 1 Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1N=CNC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 DTHNMHAUYICORS-KTKZVXAJSA-N 0.000 claims description 39
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 claims description 38
- 150000001412 amines Chemical class 0.000 claims description 38
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 claims description 37
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 claims description 35
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 claims description 34
- 235000009582 asparagine Nutrition 0.000 claims description 34
- 229960001230 asparagine Drugs 0.000 claims description 34
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 claims description 32
- 235000004554 glutamine Nutrition 0.000 claims description 32
- 229960004441 tyrosine Drugs 0.000 claims description 32
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 claims description 32
- 235000002374 tyrosine Nutrition 0.000 claims description 32
- 229960001153 serine Drugs 0.000 claims description 31
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 claims description 30
- 235000004400 serine Nutrition 0.000 claims description 30
- 101710198884 GATA-type zinc finger protein 1 Proteins 0.000 claims description 29
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 claims description 29
- 108010016626 Dipeptides Proteins 0.000 claims description 28
- 239000004471 Glycine Substances 0.000 claims description 27
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 claims description 26
- VBOQYPQEPHKASR-VKHMYHEASA-N L-homocysteic acid Chemical compound OC(=O)[C@@H](N)CCS(O)(=O)=O VBOQYPQEPHKASR-VKHMYHEASA-N 0.000 claims description 22
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Chemical compound CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 claims description 22
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 claims description 21
- 125000002252 acyl group Chemical group 0.000 claims description 21
- 108010086246 Glucagon-Like Peptide-1 Receptor Proteins 0.000 claims description 20
- 229960005190 phenylalanine Drugs 0.000 claims description 20
- 108010004460 Gastric Inhibitory Polypeptide Proteins 0.000 claims description 19
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 claims description 19
- 235000005772 leucine Nutrition 0.000 claims description 19
- 229960003136 leucine Drugs 0.000 claims description 19
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 claims description 19
- 235000008729 phenylalanine Nutrition 0.000 claims description 19
- 102100039994 Gastric inhibitory polypeptide Human genes 0.000 claims description 18
- 101000930822 Giardia intestinalis Dipeptidyl-peptidase 4 Proteins 0.000 claims description 17
- CMUHFUGDYMFHEI-QMMMGPOBSA-N 4-amino-L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(N)C=C1 CMUHFUGDYMFHEI-QMMMGPOBSA-N 0.000 claims description 16
- 125000003295 alanine group Chemical group N[C@@H](C)C(=O)* 0.000 claims description 16
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 claims description 16
- 235000014705 isoleucine Nutrition 0.000 claims description 16
- 229960000310 isoleucine Drugs 0.000 claims description 16
- 238000000034 method Methods 0.000 claims description 16
- FUOOLUPWFVMBKG-UHFFFAOYSA-N 2-Aminoisobutyric acid Chemical compound CC(C)(N)C(O)=O FUOOLUPWFVMBKG-UHFFFAOYSA-N 0.000 claims description 15
- 102000007446 Glucagon-Like Peptide-1 Receptor Human genes 0.000 claims description 15
- 125000003917 carbamoyl group Chemical group [H]N([H])C(*)=O 0.000 claims description 14
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims description 13
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 claims description 13
- GEYBMYRBIABFTA-UHFFFAOYSA-N O-methyltyrosine Chemical compound COC1=CC=C(CC(N)C(O)=O)C=C1 GEYBMYRBIABFTA-UHFFFAOYSA-N 0.000 claims description 13
- 150000003839 salts Chemical class 0.000 claims description 13
- 235000014393 valine Nutrition 0.000 claims description 13
- 229960004295 valine Drugs 0.000 claims description 13
- 239000004474 valine Substances 0.000 claims description 13
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 claims description 12
- 125000000404 glutamine group Chemical group N[C@@H](CCC(N)=O)C(=O)* 0.000 claims description 12
- 238000003780 insertion Methods 0.000 claims description 12
- 230000037431 insertion Effects 0.000 claims description 12
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 claims description 11
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 claims description 11
- 229930182817 methionine Natural products 0.000 claims description 11
- 235000006109 methionine Nutrition 0.000 claims description 11
- 238000003776 cleavage reaction Methods 0.000 claims description 9
- 108010036598 gastric inhibitory polypeptide receptor Proteins 0.000 claims description 9
- 125000000291 glutamic acid group Chemical group N[C@@H](CCC(O)=O)C(=O)* 0.000 claims description 9
- 230000007017 scission Effects 0.000 claims description 9
- 125000001360 methionine group Chemical group N[C@@H](CCSC)C(=O)* 0.000 claims description 8
- 239000000203 mixture Substances 0.000 claims description 8
- 125000001493 tyrosinyl group Chemical group [H]OC1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 claims description 8
- 125000003277 amino group Chemical group 0.000 claims description 7
- QCKMEYKASJTMKI-ILCMOUOISA-N 2-aminoacetic acid;(2s)-2-aminopentanedioic acid;(2s)-pyrrolidine-2-carboxylic acid Chemical compound NCC(O)=O.OC(=O)[C@@H]1CCCN1.OC(=O)[C@@H](N)CCC(O)=O QCKMEYKASJTMKI-ILCMOUOISA-N 0.000 claims description 6
- 150000001408 amides Chemical class 0.000 claims description 6
- 239000008194 pharmaceutical composition Substances 0.000 claims description 6
- RHGKLRLOHDJJDR-BYPYZUCNSA-N L-citrulline Chemical compound NC(=O)NCCC[C@H]([NH3+])C([O-])=O RHGKLRLOHDJJDR-BYPYZUCNSA-N 0.000 claims description 5
- RHGKLRLOHDJJDR-UHFFFAOYSA-N Ndelta-carbamoyl-DL-ornithine Natural products OC(=O)C(N)CCCNC(N)=O RHGKLRLOHDJJDR-UHFFFAOYSA-N 0.000 claims description 5
- 235000013477 citrulline Nutrition 0.000 claims description 5
- 229960002173 citrulline Drugs 0.000 claims description 5
- GOJUJUVQIVIZAV-UHFFFAOYSA-N 2-amino-4,6-dichloropyrimidine-5-carbaldehyde Chemical group NC1=NC(Cl)=C(C=O)C(Cl)=N1 GOJUJUVQIVIZAV-UHFFFAOYSA-N 0.000 claims description 4
- 125000001433 C-terminal amino-acid group Chemical group 0.000 claims description 4
- 239000003937 drug carrier Substances 0.000 claims description 4
- 238000005304 joining Methods 0.000 claims description 4
- 230000002829 reductive effect Effects 0.000 claims description 4
- CPYVQXAASIFAMD-KNIFDHDWSA-N (2s)-2-aminobutanedioic acid;(2s)-2,6-diaminohexanoic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O.NCCCC[C@H](N)C(O)=O CPYVQXAASIFAMD-KNIFDHDWSA-N 0.000 claims description 3
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 claims description 3
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 claims description 3
- 230000004913 activation Effects 0.000 claims description 3
- QWCKQJZIFLGMSD-UHFFFAOYSA-N alpha-aminobutyric acid Chemical compound CCC(N)C(O)=O QWCKQJZIFLGMSD-UHFFFAOYSA-N 0.000 claims description 3
- 150000001732 carboxylic acid derivatives Chemical class 0.000 claims description 3
- 206010012601 diabetes mellitus Diseases 0.000 claims description 3
- 125000001072 heteroaryl group Chemical group 0.000 claims description 3
- 239000000126 substance Substances 0.000 claims description 3
- 125000000041 C6-C10 aryl group Chemical group 0.000 claims description 2
- QNAYBMKLOCPYGJ-UWTATZPHSA-N D-alanine Chemical compound C[C@@H](N)C(O)=O QNAYBMKLOCPYGJ-UWTATZPHSA-N 0.000 claims description 2
- IKAIKUBBJHFNBZ-LURJTMIESA-N Gly-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)CN IKAIKUBBJHFNBZ-LURJTMIESA-N 0.000 claims description 2
- NVGBPTNZLWRQSY-UWVGGRQHSA-N Lys-Lys Chemical compound NCCCC[C@H](N)C(=O)N[C@H](C(O)=O)CCCCN NVGBPTNZLWRQSY-UWVGGRQHSA-N 0.000 claims description 2
- 125000000613 asparagine group Chemical group N[C@@H](CC(N)=O)C(=O)* 0.000 claims description 2
- 108010015792 glycyllysine Proteins 0.000 claims description 2
- 125000002883 imidazolyl group Chemical group 0.000 claims description 2
- 108010054155 lysyllysine Proteins 0.000 claims description 2
- 229960002989 glutamic acid Drugs 0.000 claims 18
- 229960002743 glutamine Drugs 0.000 claims 14
- 229960003646 lysine Drugs 0.000 claims 10
- 102000016622 Dipeptidyl Peptidase 4 Human genes 0.000 claims 7
- 125000006702 (C1-C18) alkyl group Chemical group 0.000 claims 4
- 229960002449 glycine Drugs 0.000 claims 4
- 229960004452 methionine Drugs 0.000 claims 2
- 125000004178 (C1-C4) alkyl group Chemical group 0.000 claims 1
- 125000005913 (C3-C6) cycloalkyl group Chemical group 0.000 claims 1
- OGNSCSPNOLGXSM-UHFFFAOYSA-N 2,4-diaminobutyric acid Chemical compound NCCC(N)C(O)=O OGNSCSPNOLGXSM-UHFFFAOYSA-N 0.000 claims 1
- 125000000734 D-serino group Chemical group [H]N([H])[C@@]([H])(C(=O)[*])C(O[H])([H])[H] 0.000 claims 1
- 125000000623 heterocyclic group Chemical group 0.000 claims 1
- 150000001261 hydroxy acids Chemical class 0.000 claims 1
- 230000004962 physiological condition Effects 0.000 claims 1
- 125000000341 threoninyl group Chemical group [H]OC([H])(C([H])([H])[H])C([H])(N([H])[H])C(*)=O 0.000 claims 1
- 229960004799 tryptophan Drugs 0.000 claims 1
- 102000004196 processed proteins & peptides Human genes 0.000 abstract description 43
- 108010001127 Insulin Receptor Proteins 0.000 abstract description 31
- 102000003746 Insulin Receptor Human genes 0.000 abstract description 28
- 102000005962 receptors Human genes 0.000 abstract description 18
- 108020003175 receptors Proteins 0.000 abstract description 18
- 108010075254 C-Peptide Proteins 0.000 abstract description 12
- 108010076181 Proinsulin Proteins 0.000 abstract description 6
- 238000011282 treatment Methods 0.000 abstract description 6
- 206010067584 Type 1 diabetes mellitus Diseases 0.000 abstract description 3
- 239000002243 precursor Substances 0.000 abstract description 3
- 208000001072 type 2 diabetes mellitus Diseases 0.000 abstract description 3
- 238000002560 therapeutic procedure Methods 0.000 abstract description 2
- 239000000562 conjugate Substances 0.000 description 106
- 125000006850 spacer group Chemical group 0.000 description 59
- 239000002202 Polyethylene glycol Substances 0.000 description 54
- 229920001223 polyethylene glycol Polymers 0.000 description 54
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 38
- 108090000723 Insulin-Like Growth Factor I Proteins 0.000 description 32
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 25
- 150000003573 thiols Chemical class 0.000 description 22
- 230000010933 acylation Effects 0.000 description 19
- 238000005917 acylation reaction Methods 0.000 description 19
- 150000001335 aliphatic alkanes Chemical class 0.000 description 19
- 230000001588 bifunctional effect Effects 0.000 description 19
- 230000013595 glycosylation Effects 0.000 description 19
- 102000013275 Somatomedins Human genes 0.000 description 18
- 238000006206 glycosylation reaction Methods 0.000 description 18
- 108090000623 proteins and genes Proteins 0.000 description 16
- 108010063919 Glucagon Receptors Proteins 0.000 description 15
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 15
- 230000029936 alkylation Effects 0.000 description 15
- 238000005804 alkylation reaction Methods 0.000 description 15
- 235000014113 dietary fatty acids Nutrition 0.000 description 15
- 229930195729 fatty acid Natural products 0.000 description 15
- 239000000194 fatty acid Substances 0.000 description 15
- 239000008103 glucose Substances 0.000 description 15
- 229920001184 polypeptide Polymers 0.000 description 15
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 14
- 125000004429 atom Chemical group 0.000 description 14
- 150000001875 compounds Chemical class 0.000 description 14
- 235000018102 proteins Nutrition 0.000 description 14
- 102000004169 proteins and genes Human genes 0.000 description 14
- 238000012217 deletion Methods 0.000 description 13
- 230000037430 deletion Effects 0.000 description 13
- 230000036515 potency Effects 0.000 description 13
- 102000004218 Insulin-Like Growth Factor I Human genes 0.000 description 12
- 210000004369 blood Anatomy 0.000 description 12
- 239000008280 blood Substances 0.000 description 12
- 101150088952 IGF1 gene Proteins 0.000 description 11
- ODKSFYDXXFIFQN-BYPYZUCNSA-N L-arginine Chemical compound OC(=O)[C@@H](N)CCCN=C(N)N ODKSFYDXXFIFQN-BYPYZUCNSA-N 0.000 description 11
- FFFHZYDWPBMWHY-VKHMYHEASA-N L-homocysteine Chemical compound OC(=O)[C@@H](N)CCS FFFHZYDWPBMWHY-VKHMYHEASA-N 0.000 description 11
- 101500021084 Locusta migratoria 5 kDa peptide Proteins 0.000 description 11
- 239000002253 acid Substances 0.000 description 11
- 150000004665 fatty acids Chemical class 0.000 description 11
- 239000000178 monomer Substances 0.000 description 11
- 102100025012 Dipeptidyl peptidase 4 Human genes 0.000 description 10
- 102100040890 Glucagon receptor Human genes 0.000 description 10
- 150000007942 carboxylates Chemical group 0.000 description 10
- 210000004027 cell Anatomy 0.000 description 10
- GQHBHKILJGTNGL-UHFFFAOYSA-N N-[4-[[3,5-dicyano-4-ethyl-6-[methyl-[2-(methylamino)ethyl]amino]pyridin-2-yl]sulfanylmethyl]phenyl]-N-methylmethanesulfonamide Chemical compound C(#N)C=1C(=NC(=C(C=1CC)C#N)N(CCNC)C)SCC1=CC=C(C=C1)N(S(=O)(=O)C)C GQHBHKILJGTNGL-UHFFFAOYSA-N 0.000 description 9
- 230000009471 action Effects 0.000 description 9
- 238000000338 in vitro Methods 0.000 description 9
- 229920000642 polymer Polymers 0.000 description 9
- 125000003827 glycol group Chemical group 0.000 description 8
- 238000001727 in vivo Methods 0.000 description 8
- PBGKTOXHQIOBKM-FHFVDXKLSA-N insulin (human) Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@H]1CSSC[C@H]2C(=O)N[C@H](C(=O)N[C@@H](CO)C(=O)N[C@H](C(=O)N[C@H](C(N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=3C=CC(O)=CC=3)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=3C=CC(O)=CC=3)C(=O)N[C@@H](CSSC[C@H](NC(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=3C=CC(O)=CC=3)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=3NC=NC=3)NC(=O)[C@H](CO)NC(=O)CNC1=O)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(O)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O)=O)CSSC[C@@H](C(N2)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@@H](NC(=O)CN)[C@@H](C)CC)[C@@H](C)CC)[C@@H](C)O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)CC=1C=CC=CC=1)C(C)C)C1=CN=CN1 PBGKTOXHQIOBKM-FHFVDXKLSA-N 0.000 description 8
- 239000000816 peptidomimetic Substances 0.000 description 8
- 101000976075 Homo sapiens Insulin Proteins 0.000 description 7
- LRQKBLKVPFOOQJ-YFKPBYRVSA-N L-norleucine Chemical compound CCCC[C@H]([NH3+])C([O-])=O LRQKBLKVPFOOQJ-YFKPBYRVSA-N 0.000 description 7
- CBQJSKKFNMDLON-JTQLQIEISA-N N-acetyl-L-phenylalanine Chemical compound CC(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 CBQJSKKFNMDLON-JTQLQIEISA-N 0.000 description 7
- 125000003118 aryl group Chemical group 0.000 description 7
- 235000018417 cysteine Nutrition 0.000 description 7
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 7
- JJMDCOVWQOJGCB-UHFFFAOYSA-N 5-aminopentanoic acid Chemical compound [NH3+]CCCCC([O-])=O JJMDCOVWQOJGCB-UHFFFAOYSA-N 0.000 description 6
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 6
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 6
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 6
- 125000000570 L-alpha-aspartyl group Chemical group [H]OC(=O)C([H])([H])[C@]([H])(N([H])[H])C(*)=O 0.000 description 6
- 125000000510 L-tryptophano group Chemical group [H]C1=C([H])C([H])=C2N([H])C([H])=C(C([H])([H])[C@@]([H])(C(O[H])=O)N([H])[*])C2=C1[H] 0.000 description 6
- 230000002378 acidificating effect Effects 0.000 description 6
- 238000007792 addition Methods 0.000 description 6
- 125000000539 amino acid group Chemical group 0.000 description 6
- 230000027455 binding Effects 0.000 description 6
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 6
- 150000002148 esters Chemical class 0.000 description 6
- 230000001965 increasing effect Effects 0.000 description 6
- 229920002307 Dextran Polymers 0.000 description 5
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical compound OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 5
- 108091027305 Heteroduplex Proteins 0.000 description 5
- 230000004989 O-glycosylation Effects 0.000 description 5
- 230000004071 biological effect Effects 0.000 description 5
- 230000002209 hydrophobic effect Effects 0.000 description 5
- 210000004185 liver Anatomy 0.000 description 5
- 230000003389 potentiating effect Effects 0.000 description 5
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 5
- HSINOMROUCMIEA-FGVHQWLLSA-N (2s,4r)-4-[(3r,5s,6r,7r,8s,9s,10s,13r,14s,17r)-6-ethyl-3,7-dihydroxy-10,13-dimethyl-2,3,4,5,6,7,8,9,11,12,14,15,16,17-tetradecahydro-1h-cyclopenta[a]phenanthren-17-yl]-2-methylpentanoic acid Chemical group C([C@@]12C)C[C@@H](O)C[C@H]1[C@@H](CC)[C@@H](O)[C@@H]1[C@@H]2CC[C@]2(C)[C@@H]([C@H](C)C[C@H](C)C(O)=O)CC[C@H]21 HSINOMROUCMIEA-FGVHQWLLSA-N 0.000 description 4
- VOUAQYXWVJDEQY-QENPJCQMSA-N 33017-11-7 Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)NCC(=O)NCC(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N1[C@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(O)=O)CCC1 VOUAQYXWVJDEQY-QENPJCQMSA-N 0.000 description 4
- ALYNCZNDIQEVRV-UHFFFAOYSA-N 4-aminobenzoic acid Chemical compound NC1=CC=C(C(O)=O)C=C1 ALYNCZNDIQEVRV-UHFFFAOYSA-N 0.000 description 4
- SLXKOJJOQWFEFD-UHFFFAOYSA-N 6-aminohexanoic acid Chemical compound NCCCCCC(O)=O SLXKOJJOQWFEFD-UHFFFAOYSA-N 0.000 description 4
- 101000599951 Homo sapiens Insulin-like growth factor I Proteins 0.000 description 4
- 102000038455 IGF Type 1 Receptor Human genes 0.000 description 4
- 108010031794 IGF Type 1 Receptor Proteins 0.000 description 4
- 102000048143 Insulin-Like Growth Factor II Human genes 0.000 description 4
- 108090001117 Insulin-Like Growth Factor II Proteins 0.000 description 4
- 125000000174 L-prolyl group Chemical group [H]N1C([H])([H])C([H])([H])C([H])([H])[C@@]1([H])C(*)=O 0.000 description 4
- 102400000319 Oxyntomodulin Human genes 0.000 description 4
- 101800001388 Oxyntomodulin Proteins 0.000 description 4
- 108010058003 Proglucagon Proteins 0.000 description 4
- 239000003613 bile acid Substances 0.000 description 4
- 229910052799 carbon Inorganic materials 0.000 description 4
- 125000004112 carboxyamino group Chemical group [H]OC(=O)N([H])[*] 0.000 description 4
- 238000007385 chemical modification Methods 0.000 description 4
- 229920001577 copolymer Polymers 0.000 description 4
- 239000012634 fragment Substances 0.000 description 4
- 230000014509 gene expression Effects 0.000 description 4
- TWSALRJGPBVBQU-PKQQPRCHSA-N glucagon-like peptide 2 Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(O)=O)[C@@H](C)CC)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)CC)C1=CC=CC=C1 TWSALRJGPBVBQU-PKQQPRCHSA-N 0.000 description 4
- 230000010030 glucose lowering effect Effects 0.000 description 4
- 125000003396 thiol group Chemical group [H]S* 0.000 description 4
- UKAUYVFTDYCKQA-UHFFFAOYSA-N -2-Amino-4-hydroxybutanoic acid Natural products OC(=O)C(N)CCO UKAUYVFTDYCKQA-UHFFFAOYSA-N 0.000 description 3
- XDOLZJYETYVRKV-UHFFFAOYSA-N 7-Aminoheptanoic acid Chemical compound NCCCCCCC(O)=O XDOLZJYETYVRKV-UHFFFAOYSA-N 0.000 description 3
- UQXNEWQGGVUVQA-UHFFFAOYSA-N 8-aminooctanoic acid Chemical compound NCCCCCCCC(O)=O UQXNEWQGGVUVQA-UHFFFAOYSA-N 0.000 description 3
- 102400000326 Glucagon-like peptide 2 Human genes 0.000 description 3
- 101800000221 Glucagon-like peptide 2 Proteins 0.000 description 3
- 108091016366 Histone-lysine N-methyltransferase EHMT1 Proteins 0.000 description 3
- 241000282412 Homo Species 0.000 description 3
- 208000013016 Hypoglycemia Diseases 0.000 description 3
- 102100037852 Insulin-like growth factor I Human genes 0.000 description 3
- OYIFNHCXNCRBQI-BYPYZUCNSA-N L-2-aminoadipic acid Chemical compound OC(=O)[C@@H](N)CCCC(O)=O OYIFNHCXNCRBQI-BYPYZUCNSA-N 0.000 description 3
- OFOBLEOULBTSOW-UHFFFAOYSA-N Malonic acid Chemical compound OC(=O)CC(O)=O OFOBLEOULBTSOW-UHFFFAOYSA-N 0.000 description 3
- 241001465754 Metazoa Species 0.000 description 3
- MUBZPKHOEPUJKR-UHFFFAOYSA-N Oxalic acid Chemical compound OC(=O)C(O)=O MUBZPKHOEPUJKR-UHFFFAOYSA-N 0.000 description 3
- 239000004372 Polyvinyl alcohol Substances 0.000 description 3
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 3
- 108010029485 Protein Isoforms Proteins 0.000 description 3
- 102000001708 Protein Isoforms Human genes 0.000 description 3
- 125000002777 acetyl group Chemical group [H]C([H])([H])C(*)=O 0.000 description 3
- 150000001294 alanine derivatives Chemical class 0.000 description 3
- 150000001299 aldehydes Chemical class 0.000 description 3
- 229960002684 aminocaproic acid Drugs 0.000 description 3
- 230000003466 anti-cipated effect Effects 0.000 description 3
- 238000013459 approach Methods 0.000 description 3
- UCMIRNVEIXFBKS-UHFFFAOYSA-N beta-alanine Chemical compound NCCC(O)=O UCMIRNVEIXFBKS-UHFFFAOYSA-N 0.000 description 3
- 150000001720 carbohydrates Chemical class 0.000 description 3
- 125000004432 carbon atom Chemical group C* 0.000 description 3
- 235000012000 cholesterol Nutrition 0.000 description 3
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 description 3
- KXGVEGMKQFWNSR-UHFFFAOYSA-N deoxycholic acid Natural products C1CC2CC(O)CCC2(C)C2C1C1CCC(C(CCC(O)=O)C)C1(C)C(O)C2 KXGVEGMKQFWNSR-UHFFFAOYSA-N 0.000 description 3
- 239000003814 drug Substances 0.000 description 3
- 230000006870 function Effects 0.000 description 3
- 230000004927 fusion Effects 0.000 description 3
- 230000009229 glucose formation Effects 0.000 description 3
- 230000002218 hypoglycaemic effect Effects 0.000 description 3
- 238000010348 incorporation Methods 0.000 description 3
- 230000003914 insulin secretion Effects 0.000 description 3
- PXZWGQLGAKCNKD-DPNMSELWSA-N molport-023-276-326 Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(O)=O)[C@@H](C)O)C(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C1=CC=CC=C1 PXZWGQLGAKCNKD-DPNMSELWSA-N 0.000 description 3
- 230000006320 pegylation Effects 0.000 description 3
- 229920002451 polyvinyl alcohol Polymers 0.000 description 3
- 125000001424 substituent group Chemical group 0.000 description 3
- 230000008685 targeting Effects 0.000 description 3
- BHQCQFFYRZLCQQ-UHFFFAOYSA-N (3alpha,5alpha,7alpha,12alpha)-3,7,12-trihydroxy-cholan-24-oic acid Natural products OC1CC2CC(O)CCC2(C)C2C1C1CCC(C(CCC(O)=O)C)C1(C)C(O)C2 BHQCQFFYRZLCQQ-UHFFFAOYSA-N 0.000 description 2
- UQWNNUPJBDWRHC-UWVGGRQHSA-N (3s,4s)-4-amino-5-cyclohexyl-3-hydroxypentanoic acid Chemical compound OC(=O)C[C@H](O)[C@@H](N)CC1CCCCC1 UQWNNUPJBDWRHC-UWVGGRQHSA-N 0.000 description 2
- SNPQRYOQWLOTFA-UHFFFAOYSA-N 2,2-dimethyl-1,3-thiazolidine Chemical compound CC1(C)NCCS1 SNPQRYOQWLOTFA-UHFFFAOYSA-N 0.000 description 2
- RUVRGYVESPRHSZ-UHFFFAOYSA-N 2-[2-(2-azaniumylethoxy)ethoxy]acetate Chemical compound NCCOCCOCC(O)=O RUVRGYVESPRHSZ-UHFFFAOYSA-N 0.000 description 2
- 125000003903 2-propenyl group Chemical group [H]C([*])([H])C([H])=C([H])[H] 0.000 description 2
- JAJQQUQHMLWDFB-UHFFFAOYSA-N 4-azaniumyl-3-hydroxy-5-phenylpentanoate Chemical compound OC(=O)CC(O)C(N)CC1=CC=CC=C1 JAJQQUQHMLWDFB-UHFFFAOYSA-N 0.000 description 2
- DFVFTMTWCUHJBL-UHFFFAOYSA-N 4-azaniumyl-3-hydroxy-6-methylheptanoate Chemical compound CC(C)CC(N)C(O)CC(O)=O DFVFTMTWCUHJBL-UHFFFAOYSA-N 0.000 description 2
- HQVPMTNBBFHLBR-UHFFFAOYSA-N 4-azanylbutanoic acid Chemical compound NCCCC(O)=O.NCCCC(O)=O HQVPMTNBBFHLBR-UHFFFAOYSA-N 0.000 description 2
- ZCYVEMRRCGMTRW-UHFFFAOYSA-N 7553-56-2 Chemical compound [I] ZCYVEMRRCGMTRW-UHFFFAOYSA-N 0.000 description 2
- 108010088751 Albumins Proteins 0.000 description 2
- 102000009027 Albumins Human genes 0.000 description 2
- 101800001415 Bri23 peptide Proteins 0.000 description 2
- 102400000107 C-terminal peptide Human genes 0.000 description 2
- 101800000655 C-terminal peptide Proteins 0.000 description 2
- 238000011740 C57BL/6 mouse Methods 0.000 description 2
- 241000282472 Canis lupus familiaris Species 0.000 description 2
- 239000004380 Cholic acid Substances 0.000 description 2
- SRBFZHDQGSBBOR-IOVATXLUSA-N D-xylopyranose Chemical compound O[C@@H]1COC(O)[C@H](O)[C@H]1O SRBFZHDQGSBBOR-IOVATXLUSA-N 0.000 description 2
- 108010002156 Depsipeptides Proteins 0.000 description 2
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 2
- 241000283086 Equidae Species 0.000 description 2
- IAYPIBMASNFSPL-UHFFFAOYSA-N Ethylene oxide Chemical compound C1CO1 IAYPIBMASNFSPL-UHFFFAOYSA-N 0.000 description 2
- 241000282326 Felis catus Species 0.000 description 2
- VZCYOOQTPOCHFL-OWOJBTEDSA-N Fumaric acid Chemical compound OC(=O)\C=C\C(O)=O VZCYOOQTPOCHFL-OWOJBTEDSA-N 0.000 description 2
- 101150039312 GIP gene Proteins 0.000 description 2
- 229940089838 Glucagon-like peptide 1 receptor agonist Drugs 0.000 description 2
- 102400000324 Glucagon-like peptide 1(7-37) Human genes 0.000 description 2
- 101800004266 Glucagon-like peptide 1(7-37) Proteins 0.000 description 2
- AEMRFAOFKBGASW-UHFFFAOYSA-N Glycolic acid Chemical compound OCC(O)=O AEMRFAOFKBGASW-UHFFFAOYSA-N 0.000 description 2
- 102000003886 Glycoproteins Human genes 0.000 description 2
- 108090000288 Glycoproteins Proteins 0.000 description 2
- 101500028775 Homo sapiens Glucagon Proteins 0.000 description 2
- 108090000144 Human Proteins Proteins 0.000 description 2
- 102000003839 Human Proteins Human genes 0.000 description 2
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 2
- PMMYEEVYMWASQN-DMTCNVIQSA-N Hydroxyproline Chemical compound O[C@H]1CN[C@H](C(O)=O)C1 PMMYEEVYMWASQN-DMTCNVIQSA-N 0.000 description 2
- 229940127519 Insulin Receptor Agonists Drugs 0.000 description 2
- WTDRDQBEARUVNC-LURJTMIESA-N L-DOPA Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C(O)=C1 WTDRDQBEARUVNC-LURJTMIESA-N 0.000 description 2
- DEFJQIDDEAULHB-IMJSIDKUSA-N L-alanyl-L-alanine Chemical compound C[C@H](N)C(=O)N[C@@H](C)C(O)=O DEFJQIDDEAULHB-IMJSIDKUSA-N 0.000 description 2
- SNDPXSYFESPGGJ-UHFFFAOYSA-N L-norVal-OH Natural products CCCC(N)C(O)=O SNDPXSYFESPGGJ-UHFFFAOYSA-N 0.000 description 2
- LCPYQJIKPJDLLB-UWVGGRQHSA-N Leu-Leu Chemical compound CC(C)C[C@H](N)C(=O)N[C@H](C(O)=O)CC(C)C LCPYQJIKPJDLLB-UWVGGRQHSA-N 0.000 description 2
- AFVFQIVMOAPDHO-UHFFFAOYSA-N Methanesulfonic acid Chemical compound CS(O)(=O)=O AFVFQIVMOAPDHO-UHFFFAOYSA-N 0.000 description 2
- 241000699670 Mus sp. Species 0.000 description 2
- 101001055320 Myxine glutinosa Insulin-like growth factor Proteins 0.000 description 2
- AUEJLPRZGVVDNU-UHFFFAOYSA-N N-L-tyrosyl-L-leucine Natural products CC(C)CC(C(O)=O)NC(=O)C(N)CC1=CC=C(O)C=C1 AUEJLPRZGVVDNU-UHFFFAOYSA-N 0.000 description 2
- 230000004988 N-glycosylation Effects 0.000 description 2
- AKCRVYNORCOYQT-YFKPBYRVSA-N N-methyl-L-valine Chemical compound CN[C@@H](C(C)C)C(O)=O AKCRVYNORCOYQT-YFKPBYRVSA-N 0.000 description 2
- 102000035195 Peptidases Human genes 0.000 description 2
- 108091005804 Peptidases Proteins 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-N Phosphoric acid Chemical compound OP(O)(O)=O NBIIXXVUZAFLBC-UHFFFAOYSA-N 0.000 description 2
- 229920000954 Polyglycolide Polymers 0.000 description 2
- RWCOTTLHDJWHRS-YUMQZZPRSA-N Pro-Pro Chemical compound OC(=O)[C@@H]1CCCN1C(=O)[C@H]1NCCC1 RWCOTTLHDJWHRS-YUMQZZPRSA-N 0.000 description 2
- NBBJYMSMWIIQGU-UHFFFAOYSA-N Propionic aldehyde Chemical compound CCC=O NBBJYMSMWIIQGU-UHFFFAOYSA-N 0.000 description 2
- 239000004365 Protease Substances 0.000 description 2
- LCTONWCANYUPML-UHFFFAOYSA-N Pyruvic acid Chemical compound CC(=O)C(O)=O LCTONWCANYUPML-UHFFFAOYSA-N 0.000 description 2
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 2
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 2
- 108010056243 alanylalanine Proteins 0.000 description 2
- 125000001931 aliphatic group Chemical group 0.000 description 2
- DSLZVSRJTYRBFB-GNSDDBTRSA-N allaric acid Chemical compound OC(=O)[C@@H](O)[C@@H](O)[C@@H](O)[C@@H](O)C(O)=O DSLZVSRJTYRBFB-GNSDDBTRSA-N 0.000 description 2
- 125000003368 amide group Chemical group 0.000 description 2
- 230000036528 appetite Effects 0.000 description 2
- 235000019789 appetite Nutrition 0.000 description 2
- 239000007864 aqueous solution Substances 0.000 description 2
- 210000000227 basophil cell of anterior lobe of hypophysis Anatomy 0.000 description 2
- 230000009286 beneficial effect Effects 0.000 description 2
- WPYMKLBDIGXBTP-UHFFFAOYSA-N benzoic acid Chemical compound OC(=O)C1=CC=CC=C1 WPYMKLBDIGXBTP-UHFFFAOYSA-N 0.000 description 2
- 125000002843 carboxylic acid group Chemical group 0.000 description 2
- 230000001413 cellular effect Effects 0.000 description 2
- RUDATBOHQWOJDD-BSWAIDMHSA-N chenodeoxycholic acid Chemical compound C([C@H]1C[C@H]2O)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(O)=O)C)[C@@]2(C)CC1 RUDATBOHQWOJDD-BSWAIDMHSA-N 0.000 description 2
- 229960001091 chenodeoxycholic acid Drugs 0.000 description 2
- BHQCQFFYRZLCQQ-OELDTZBJSA-N cholic acid Chemical compound C([C@H]1C[C@H]2O)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(O)=O)C)[C@@]2(C)[C@@H](O)C1 BHQCQFFYRZLCQQ-OELDTZBJSA-N 0.000 description 2
- 235000019416 cholic acid Nutrition 0.000 description 2
- 229960002471 cholic acid Drugs 0.000 description 2
- 230000021615 conjugation Effects 0.000 description 2
- 230000003111 delayed effect Effects 0.000 description 2
- 239000000539 dimer Substances 0.000 description 2
- XBDQKXXYIPTUBI-UHFFFAOYSA-N dimethylselenoniopropionate Natural products CCC(O)=O XBDQKXXYIPTUBI-UHFFFAOYSA-N 0.000 description 2
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 2
- 208000035475 disorder Diseases 0.000 description 2
- 238000012377 drug delivery Methods 0.000 description 2
- 239000000839 emulsion Substances 0.000 description 2
- 230000002255 enzymatic effect Effects 0.000 description 2
- 238000013467 fragmentation Methods 0.000 description 2
- 238000006062 fragmentation reaction Methods 0.000 description 2
- 108010063245 glucagon-like peptide 1 (7-36)amide Proteins 0.000 description 2
- 230000014101 glucose homeostasis Effects 0.000 description 2
- 150000004676 glycans Chemical class 0.000 description 2
- 102000035122 glycosylated proteins Human genes 0.000 description 2
- 108091005608 glycosylated proteins Proteins 0.000 description 2
- 229940093915 gynecological organic acid Drugs 0.000 description 2
- IPCSVZSSVZVIGE-UHFFFAOYSA-N hexadecanoic acid Chemical compound CCCCCCCCCCCCCCCC(O)=O IPCSVZSSVZVIGE-UHFFFAOYSA-N 0.000 description 2
- 125000004051 hexyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])* 0.000 description 2
- 229920001519 homopolymer Polymers 0.000 description 2
- 125000000717 hydrazino group Chemical group [H]N([*])N([H])[H] 0.000 description 2
- 150000007529 inorganic bases Chemical class 0.000 description 2
- 239000011630 iodine Substances 0.000 description 2
- 229910052740 iodine Inorganic materials 0.000 description 2
- 108010091798 leucylleucine Proteins 0.000 description 2
- 229960004502 levodopa Drugs 0.000 description 2
- 244000144972 livestock Species 0.000 description 2
- 238000004519 manufacturing process Methods 0.000 description 2
- 150000007522 mineralic acids Chemical class 0.000 description 2
- SCIFESDRCALIIM-UHFFFAOYSA-N n-methylphenylalanine Chemical compound CNC(C(O)=O)CC1=CC=CC=C1 SCIFESDRCALIIM-UHFFFAOYSA-N 0.000 description 2
- 150000007524 organic acids Chemical class 0.000 description 2
- 235000005985 organic acids Nutrition 0.000 description 2
- 150000007530 organic bases Chemical class 0.000 description 2
- 238000010647 peptide synthesis reaction Methods 0.000 description 2
- 239000004633 polyglycolic acid Substances 0.000 description 2
- 229920001451 polypropylene glycol Polymers 0.000 description 2
- 229920001282 polysaccharide Polymers 0.000 description 2
- 239000005017 polysaccharide Substances 0.000 description 2
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 2
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 2
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 2
- 238000002360 preparation method Methods 0.000 description 2
- 150000003141 primary amines Chemical class 0.000 description 2
- 229940002612 prodrug Drugs 0.000 description 2
- 239000000651 prodrug Substances 0.000 description 2
- 230000002035 prolonged effect Effects 0.000 description 2
- 108010077112 prolyl-proline Proteins 0.000 description 2
- 238000005932 reductive alkylation reaction Methods 0.000 description 2
- 230000001105 regulatory effect Effects 0.000 description 2
- 238000009877 rendering Methods 0.000 description 2
- 230000000717 retained effect Effects 0.000 description 2
- YGSDEFSMJLZEOE-UHFFFAOYSA-N salicylic acid Chemical compound OC(=O)C1=CC=CC=C1O YGSDEFSMJLZEOE-UHFFFAOYSA-N 0.000 description 2
- FSYKKLYZXJSNPZ-UHFFFAOYSA-N sarcosine Chemical compound C[NH2+]CC([O-])=O FSYKKLYZXJSNPZ-UHFFFAOYSA-N 0.000 description 2
- 208000024891 symptom Diseases 0.000 description 2
- 150000003568 thioethers Chemical class 0.000 description 2
- 210000001519 tissue Anatomy 0.000 description 2
- JOXIMZWYDAKGHI-UHFFFAOYSA-N toluene-4-sulfonic acid Chemical compound CC1=CC=C(S(O)(=O)=O)C=C1 JOXIMZWYDAKGHI-UHFFFAOYSA-N 0.000 description 2
- VZCYOOQTPOCHFL-UHFFFAOYSA-N trans-butenedioic acid Natural products OC(=O)C=CC(O)=O VZCYOOQTPOCHFL-UHFFFAOYSA-N 0.000 description 2
- QBYIENPQHBMVBV-HFEGYEGKSA-N (2R)-2-hydroxy-2-phenylacetic acid Chemical compound O[C@@H](C(O)=O)c1ccccc1.O[C@@H](C(O)=O)c1ccccc1 QBYIENPQHBMVBV-HFEGYEGKSA-N 0.000 description 1
- DNDVHMGBCGSRIY-ZCFIWIBFSA-N (2r)-2-amino-3-(1,3-benzothiazol-2-yl)propanoic acid Chemical compound C1=CC=C2SC(C[C@@H](N)C(O)=O)=NC2=C1 DNDVHMGBCGSRIY-ZCFIWIBFSA-N 0.000 description 1
- QFQYGJMNIDGZSG-YFKPBYRVSA-N (2r)-3-(acetamidomethylsulfanyl)-2-azaniumylpropanoate Chemical compound CC(=O)NCSC[C@H]([NH3+])C([O-])=O QFQYGJMNIDGZSG-YFKPBYRVSA-N 0.000 description 1
- WBNIBXIBXCPMOW-JTQLQIEISA-N (2s)-2-(ethoxyamino)-3-(4-hydroxyphenyl)propanoic acid Chemical compound CCON[C@H](C(O)=O)CC1=CC=C(O)C=C1 WBNIBXIBXCPMOW-JTQLQIEISA-N 0.000 description 1
- FPDYKABXINADKS-LURJTMIESA-N (2s)-2-(methylazaniumyl)hexanoate Chemical compound CCCC[C@H](NC)C(O)=O FPDYKABXINADKS-LURJTMIESA-N 0.000 description 1
- XQBUAEBDRUXSPI-ZETCQYMHSA-N (2s)-2-(piperidin-1-ylamino)propanoic acid Chemical compound OC(=O)[C@H](C)NN1CCCCC1 XQBUAEBDRUXSPI-ZETCQYMHSA-N 0.000 description 1
- WTYDPHLGAWMABS-LURJTMIESA-N (2s)-2-(pyrrolidin-1-ylamino)propanoic acid Chemical compound OC(=O)[C@H](C)NN1CCCC1 WTYDPHLGAWMABS-LURJTMIESA-N 0.000 description 1
- KWIPUXXIFQQMKN-VIFPVBQESA-N (2s)-2-amino-3-(4-cyanophenyl)propanoic acid Chemical compound OC(=O)[C@@H](N)CC1=CC=C(C#N)C=C1 KWIPUXXIFQQMKN-VIFPVBQESA-N 0.000 description 1
- CBNRCFKJVUHIRM-LBPRGKRZSA-N (2s)-2-amino-3-[4-[bis(dimethylaminooxy)phosphoryloxy]phenyl]propanoic acid Chemical compound CN(C)OP(=O)(ON(C)C)OC1=CC=C(C[C@H](N)C(O)=O)C=C1 CBNRCFKJVUHIRM-LBPRGKRZSA-N 0.000 description 1
- XGUXJMWPVJQIHI-YFKPBYRVSA-N (2s)-2-azaniumyl-3-cyclopropylpropanoate Chemical compound [O-]C(=O)[C@@H]([NH3+])CC1CC1 XGUXJMWPVJQIHI-YFKPBYRVSA-N 0.000 description 1
- SJTPYAOZAPSOLO-REOHCLBHSA-N (2s)-2-hydrazinyl-3-hydroxypropanoic acid Chemical compound NN[C@@H](CO)C(O)=O SJTPYAOZAPSOLO-REOHCLBHSA-N 0.000 description 1
- UTEYHKAJNNCEDX-VIFPVBQESA-N (2s)-3-(4-hydroxyphenyl)-2-(methoxyamino)propanoic acid Chemical compound CON[C@H](C(O)=O)CC1=CC=C(O)C=C1 UTEYHKAJNNCEDX-VIFPVBQESA-N 0.000 description 1
- XJODGRWDFZVTKW-LURJTMIESA-N (2s)-4-methyl-2-(methylamino)pentanoic acid Chemical compound CN[C@H](C(O)=O)CC(C)C XJODGRWDFZVTKW-LURJTMIESA-N 0.000 description 1
- KYBXNPIASYUWLN-WUCPZUCCSA-N (2s)-5-hydroxypyrrolidine-2-carboxylic acid Chemical compound OC1CC[C@@H](C(O)=O)N1 KYBXNPIASYUWLN-WUCPZUCCSA-N 0.000 description 1
- WCYLQLNJSDTVPN-BQBZGAKWSA-N (2s,3s)-2-amino-n-methoxy-n,3-dimethylpentanamide Chemical compound CC[C@H](C)[C@H](N)C(=O)N(C)OC WCYLQLNJSDTVPN-BQBZGAKWSA-N 0.000 description 1
- LJRDOKAZOAKLDU-UDXJMMFXSA-N (2s,3s,4r,5r,6r)-5-amino-2-(aminomethyl)-6-[(2r,3s,4r,5s)-5-[(1r,2r,3s,5r,6s)-3,5-diamino-2-[(2s,3r,4r,5s,6r)-3-amino-4,5-dihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-6-hydroxycyclohexyl]oxy-4-hydroxy-2-(hydroxymethyl)oxolan-3-yl]oxyoxane-3,4-diol;sulfuric ac Chemical compound OS(O)(=O)=O.N[C@@H]1[C@@H](O)[C@H](O)[C@H](CN)O[C@@H]1O[C@H]1[C@@H](O)[C@H](O[C@H]2[C@@H]([C@@H](N)C[C@@H](N)[C@@H]2O)O[C@@H]2[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O2)N)O[C@@H]1CO LJRDOKAZOAKLDU-UDXJMMFXSA-N 0.000 description 1
- RUDATBOHQWOJDD-UHFFFAOYSA-N (3beta,5beta,7alpha)-3,7-Dihydroxycholan-24-oic acid Natural products OC1CC2CC(O)CCC2(C)C2C1C1CCC(C(CCC(O)=O)C)C1(C)CC2 RUDATBOHQWOJDD-UHFFFAOYSA-N 0.000 description 1
- LDXFNKACRSEQND-ULUSZKPHSA-N (5R)-1-azabicyclo[3.1.0]hexane-5-carboxylic acid Chemical compound C1CC[C@@]2(C(=O)O)N1C2 LDXFNKACRSEQND-ULUSZKPHSA-N 0.000 description 1
- 125000006273 (C1-C3) alkyl group Chemical group 0.000 description 1
- 125000004169 (C1-C6) alkyl group Chemical group 0.000 description 1
- 125000006570 (C5-C6) heteroaryl group Chemical group 0.000 description 1
- IADUEWIQBXOCDZ-VKHMYHEASA-N (S)-azetidine-2-carboxylic acid Chemical compound OC(=O)[C@@H]1CCN1 IADUEWIQBXOCDZ-VKHMYHEASA-N 0.000 description 1
- BJEPYKJPYRNKOW-REOHCLBHSA-N (S)-malic acid Chemical compound OC(=O)[C@@H](O)CC(O)=O BJEPYKJPYRNKOW-REOHCLBHSA-N 0.000 description 1
- WBYWAXJHAXSJNI-VOTSOKGWSA-M .beta-Phenylacrylic acid Natural products [O-]C(=O)\C=C\C1=CC=CC=C1 WBYWAXJHAXSJNI-VOTSOKGWSA-M 0.000 description 1
- WNXJIVFYUVYPPR-UHFFFAOYSA-N 1,3-dioxolane Chemical compound C1COCO1 WNXJIVFYUVYPPR-UHFFFAOYSA-N 0.000 description 1
- FVTVMQPGKVHSEY-UHFFFAOYSA-N 1-AMINOCYCLOBUTANE CARBOXYLIC ACID Chemical compound OC(=O)C1(N)CCC1 FVTVMQPGKVHSEY-UHFFFAOYSA-N 0.000 description 1
- WOXWUZCRWJWTRT-UHFFFAOYSA-N 1-amino-1-cyclohexanecarboxylic acid Chemical compound OC(=O)C1(N)CCCCC1 WOXWUZCRWJWTRT-UHFFFAOYSA-N 0.000 description 1
- NILQLFBWTXNUOE-UHFFFAOYSA-N 1-aminocyclopentanecarboxylic acid Chemical compound OC(=O)C1(N)CCCC1 NILQLFBWTXNUOE-UHFFFAOYSA-N 0.000 description 1
- PAJPWUMXBYXFCZ-UHFFFAOYSA-N 1-aminocyclopropanecarboxylic acid Chemical compound OC(=O)C1(N)CC1 PAJPWUMXBYXFCZ-UHFFFAOYSA-N 0.000 description 1
- 125000004973 1-butenyl group Chemical group C(=CCC)* 0.000 description 1
- 125000004972 1-butynyl group Chemical group [H]C([H])([H])C([H])([H])C#C* 0.000 description 1
- 125000006017 1-propenyl group Chemical group 0.000 description 1
- 125000000530 1-propynyl group Chemical group [H]C([H])([H])C#C* 0.000 description 1
- YBYIRNPNPLQARY-UHFFFAOYSA-N 1H-indene Natural products C1=CC=C2CC=CC2=C1 YBYIRNPNPLQARY-UHFFFAOYSA-N 0.000 description 1
- BLCJBICVQSYOIF-UHFFFAOYSA-N 2,2-diaminobutanoic acid Chemical compound CCC(N)(N)C(O)=O BLCJBICVQSYOIF-UHFFFAOYSA-N 0.000 description 1
- OMGHIGVFLOPEHJ-UHFFFAOYSA-N 2,5-dihydro-1h-pyrrol-1-ium-2-carboxylate Chemical compound OC(=O)C1NCC=C1 OMGHIGVFLOPEHJ-UHFFFAOYSA-N 0.000 description 1
- GVNVAWHJIKLAGL-UHFFFAOYSA-N 2-(cyclohexen-1-yl)cyclohexan-1-one Chemical compound O=C1CCCCC1C1=CCCCC1 GVNVAWHJIKLAGL-UHFFFAOYSA-N 0.000 description 1
- PRSWALMQXKFZFA-UHFFFAOYSA-N 2-(piperidin-1-ylamino)acetic acid Chemical compound OC(=O)CNN1CCCCC1 PRSWALMQXKFZFA-UHFFFAOYSA-N 0.000 description 1
- TXHAHOVNFDVCCC-UHFFFAOYSA-N 2-(tert-butylazaniumyl)acetate Chemical compound CC(C)(C)NCC(O)=O TXHAHOVNFDVCCC-UHFFFAOYSA-N 0.000 description 1
- YXQOVXILWFIANY-UHFFFAOYSA-N 2-amino-2-cyclohexylpropanoic acid Chemical compound OC(=O)C(N)(C)C1CCCCC1 YXQOVXILWFIANY-UHFFFAOYSA-N 0.000 description 1
- ICBKJQDJWHBQAX-UHFFFAOYSA-N 2-aminooxane-4-carboxylic acid Chemical compound NC1CC(C(O)=O)CCO1 ICBKJQDJWHBQAX-UHFFFAOYSA-N 0.000 description 1
- VRFJLUHAQPBTLE-UHFFFAOYSA-N 2-aminopiperidine-1-carboxylic acid Chemical compound NC1CCCCN1C(O)=O VRFJLUHAQPBTLE-UHFFFAOYSA-N 0.000 description 1
- WTOFYLAWDLQMBZ-UHFFFAOYSA-N 2-azaniumyl-3-thiophen-2-ylpropanoate Chemical compound OC(=O)C(N)CC1=CC=CS1 WTOFYLAWDLQMBZ-UHFFFAOYSA-N 0.000 description 1
- 125000000069 2-butynyl group Chemical group [H]C([H])([H])C#CC([H])([H])* 0.000 description 1
- 125000001494 2-propynyl group Chemical group [H]C#CC([H])([H])* 0.000 description 1
- YHFKJGZDKILHTL-UHFFFAOYSA-N 3-(aminomethyl)-1h-pyrrole-2-carboxylic acid Chemical compound NCC=1C=CNC=1C(O)=O YHFKJGZDKILHTL-UHFFFAOYSA-N 0.000 description 1
- PECYZEOJVXMISF-UHFFFAOYSA-N 3-aminoalanine Chemical compound [NH3+]CC(N)C([O-])=O PECYZEOJVXMISF-UHFFFAOYSA-N 0.000 description 1
- BMYNFMYTOJXKLE-UHFFFAOYSA-N 3-azaniumyl-2-hydroxypropanoate Chemical compound NCC(O)C(O)=O BMYNFMYTOJXKLE-UHFFFAOYSA-N 0.000 description 1
- BXRLWGXPSRYJDZ-UHFFFAOYSA-N 3-cyanoalanine Chemical compound OC(=O)C(N)CC#N BXRLWGXPSRYJDZ-UHFFFAOYSA-N 0.000 description 1
- DKIDEFUBRARXTE-UHFFFAOYSA-N 3-mercaptopropanoic acid Chemical class OC(=O)CCS DKIDEFUBRARXTE-UHFFFAOYSA-N 0.000 description 1
- XWHHYOYVRVGJJY-QMMMGPOBSA-N 4-fluoro-L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(F)C=C1 XWHHYOYVRVGJJY-QMMMGPOBSA-N 0.000 description 1
- GTVVZTAFGPQSPC-UHFFFAOYSA-N 4-nitrophenylalanine Chemical compound OC(=O)C(N)CC1=CC=C([N+]([O-])=O)C=C1 GTVVZTAFGPQSPC-UHFFFAOYSA-N 0.000 description 1
- 229940117976 5-hydroxylysine Drugs 0.000 description 1
- 125000004938 5-pyridyl group Chemical group N1=CC=CC(=C1)* 0.000 description 1
- QGZKDVFQNNGYKY-UHFFFAOYSA-O Ammonium Chemical compound [NH4+] QGZKDVFQNNGYKY-UHFFFAOYSA-O 0.000 description 1
- 210000002237 B-cell of pancreatic islet Anatomy 0.000 description 1
- 239000005711 Benzoic acid Substances 0.000 description 1
- 102000004506 Blood Proteins Human genes 0.000 description 1
- 108010017384 Blood Proteins Proteins 0.000 description 1
- WKBOTKDWSSQWDR-UHFFFAOYSA-N Bromine atom Chemical compound [Br] WKBOTKDWSSQWDR-UHFFFAOYSA-N 0.000 description 1
- 125000006539 C12 alkyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])* 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- 229920002134 Carboxymethyl cellulose Polymers 0.000 description 1
- ZAMOUSCENKQFHK-UHFFFAOYSA-N Chlorine atom Chemical compound [Cl] ZAMOUSCENKQFHK-UHFFFAOYSA-N 0.000 description 1
- 101150065749 Churc1 gene Proteins 0.000 description 1
- WBYWAXJHAXSJNI-SREVYHEPSA-N Cinnamic acid Chemical compound OC(=O)\C=C/C1=CC=CC=C1 WBYWAXJHAXSJNI-SREVYHEPSA-N 0.000 description 1
- CKLJMWTZIZZHCS-UHFFFAOYSA-N D-OH-Asp Natural products OC(=O)C(N)CC(O)=O CKLJMWTZIZZHCS-UHFFFAOYSA-N 0.000 description 1
- FDKWRPBBCBCIGA-UWTATZPHSA-N D-Selenocysteine Natural products [Se]C[C@@H](N)C(O)=O FDKWRPBBCBCIGA-UWTATZPHSA-N 0.000 description 1
- MTCFGRXMJLQNBG-UWTATZPHSA-N D-Serine Chemical compound OC[C@@H](N)C(O)=O MTCFGRXMJLQNBG-UWTATZPHSA-N 0.000 description 1
- QNAYBMKLOCPYGJ-UHFFFAOYSA-N D-alpha-Ala Natural products CC([NH3+])C([O-])=O QNAYBMKLOCPYGJ-UHFFFAOYSA-N 0.000 description 1
- QWCKQJZIFLGMSD-GSVOUGTGSA-N D-alpha-aminobutyric acid Chemical compound CC[C@@H](N)C(O)=O QWCKQJZIFLGMSD-GSVOUGTGSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Polymers OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- HNDVDQJCIGZPNO-RXMQYKEDSA-N D-histidine Chemical compound OC(=O)[C@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-RXMQYKEDSA-N 0.000 description 1
- FEWJPZIEWOKRBE-JCYAYHJZSA-N Dextrotartaric acid Chemical compound OC(=O)[C@H](O)[C@@H](O)C(O)=O FEWJPZIEWOKRBE-JCYAYHJZSA-N 0.000 description 1
- MYMOFIZGZYHOMD-UHFFFAOYSA-N Dioxygen Chemical group O=O MYMOFIZGZYHOMD-UHFFFAOYSA-N 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 108010011459 Exenatide Proteins 0.000 description 1
- NIGWMJHCCYYCSF-UHFFFAOYSA-N Fenclonine Chemical compound OC(=O)C(N)CC1=CC=C(Cl)C=C1 NIGWMJHCCYYCSF-UHFFFAOYSA-N 0.000 description 1
- 229920001917 Ficoll Polymers 0.000 description 1
- PXGOKWXKJXAPGV-UHFFFAOYSA-N Fluorine Chemical compound FF PXGOKWXKJXAPGV-UHFFFAOYSA-N 0.000 description 1
- VHLZDSUANXBJHW-QWRGUYRKSA-N Gln-Phe Chemical compound NC(=O)CC[C@H](N)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 VHLZDSUANXBJHW-QWRGUYRKSA-N 0.000 description 1
- 108010024044 Glucagon-Like Peptide-2 Receptor Proteins 0.000 description 1
- 101800000224 Glucagon-like peptide 1 Proteins 0.000 description 1
- 108010007979 Glycocholic Acid Proteins 0.000 description 1
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 description 1
- 101500025353 Homo sapiens Insulin A chain Proteins 0.000 description 1
- 239000004354 Hydroxyethyl cellulose Substances 0.000 description 1
- 229920000663 Hydroxyethyl cellulose Polymers 0.000 description 1
- 101150002416 Igf2 gene Proteins 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- 102100039688 Insulin-like growth factor 1 receptor Human genes 0.000 description 1
- 101710184277 Insulin-like growth factor 1 receptor Proteins 0.000 description 1
- 241000235058 Komagataella pastoris Species 0.000 description 1
- SNDPXSYFESPGGJ-BYPYZUCNSA-N L-2-aminopentanoic acid Chemical compound CCC[C@H](N)C(O)=O SNDPXSYFESPGGJ-BYPYZUCNSA-N 0.000 description 1
- ZGUNAGUHMKGQNY-ZETCQYMHSA-N L-alpha-phenylglycine zwitterion Chemical compound OC(=O)[C@@H](N)C1=CC=CC=C1 ZGUNAGUHMKGQNY-ZETCQYMHSA-N 0.000 description 1
- ULEBESPCVWBNIF-BYPYZUCNSA-N L-arginine amide Chemical compound NC(=O)[C@@H](N)CCCNC(N)=N ULEBESPCVWBNIF-BYPYZUCNSA-N 0.000 description 1
- UKAUYVFTDYCKQA-VKHMYHEASA-N L-homoserine Chemical compound OC(=O)[C@@H](N)CCO UKAUYVFTDYCKQA-VKHMYHEASA-N 0.000 description 1
- QEFRNWWLZKMPFJ-ZXPFJRLXSA-N L-methionine (R)-S-oxide Chemical compound C[S@@](=O)CC[C@H]([NH3+])C([O-])=O QEFRNWWLZKMPFJ-ZXPFJRLXSA-N 0.000 description 1
- QEFRNWWLZKMPFJ-YGVKFDHGSA-N L-methionine S-oxide Chemical compound CS(=O)CC[C@H](N)C(O)=O QEFRNWWLZKMPFJ-YGVKFDHGSA-N 0.000 description 1
- UCUNFLYVYCGDHP-BYPYZUCNSA-N L-methionine sulfone Chemical compound CS(=O)(=O)CC[C@H](N)C(O)=O UCUNFLYVYCGDHP-BYPYZUCNSA-N 0.000 description 1
- QEFRNWWLZKMPFJ-UHFFFAOYSA-N L-methionine sulphoxide Natural products CS(=O)CCC(N)C(O)=O QEFRNWWLZKMPFJ-UHFFFAOYSA-N 0.000 description 1
- DGYHPLMPMRKMPD-UHFFFAOYSA-N L-propargyl glycine Natural products OC(=O)C(N)CC#C DGYHPLMPMRKMPD-UHFFFAOYSA-N 0.000 description 1
- ZKZBPNGNEQAJSX-REOHCLBHSA-N L-selenocysteine Chemical compound [SeH]C[C@H](N)C(O)=O ZKZBPNGNEQAJSX-REOHCLBHSA-N 0.000 description 1
- RQVLGLPAZTUBKX-VKHMYHEASA-N L-vinylglycine Chemical compound C=C[C@H](N)C(O)=O RQVLGLPAZTUBKX-VKHMYHEASA-N 0.000 description 1
- WHXSMMKQMYFTQS-UHFFFAOYSA-N Lithium Chemical compound [Li] WHXSMMKQMYFTQS-UHFFFAOYSA-N 0.000 description 1
- SMEROWZSTRWXGI-UHFFFAOYSA-N Lithocholsaeure Natural products C1CC2CC(O)CCC2(C)C2C1C1CCC(C(CCC(O)=O)C)C1(C)CC2 SMEROWZSTRWXGI-UHFFFAOYSA-N 0.000 description 1
- PEEHTFAAVSWFBL-UHFFFAOYSA-N Maleimide Chemical compound O=C1NC(=O)C=C1 PEEHTFAAVSWFBL-UHFFFAOYSA-N 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 238000006845 Michael addition reaction Methods 0.000 description 1
- OLYPWXRMOFUVGH-LURJTMIESA-N N(2)-methyl-L-lysine Chemical compound CN[C@H](C(O)=O)CCCCN OLYPWXRMOFUVGH-LURJTMIESA-N 0.000 description 1
- MXNRLFUSFKVQSK-QMMMGPOBSA-O N(6),N(6),N(6)-trimethyl-L-lysine Chemical compound C[N+](C)(C)CCCC[C@H]([NH3+])C([O-])=O MXNRLFUSFKVQSK-QMMMGPOBSA-O 0.000 description 1
- RYFOQDQDVYIEHN-ZETCQYMHSA-N N,N-Dimethyllysine Chemical compound CN(C)[C@H](C(O)=O)CCCCN RYFOQDQDVYIEHN-ZETCQYMHSA-N 0.000 description 1
- KSPIYJQBLVDRRI-WDSKDSINSA-N N-methyl-L-isoleucine Chemical compound CC[C@H](C)[C@H](NC)C(O)=O KSPIYJQBLVDRRI-WDSKDSINSA-N 0.000 description 1
- RFDAIACWWDREDC-UHFFFAOYSA-N Na salt-Glycocholic acid Natural products OC1CC2CC(O)CCC2(C)C2C1C1CCC(C(CCC(=O)NCC(O)=O)C)C1(C)C(O)C2 RFDAIACWWDREDC-UHFFFAOYSA-N 0.000 description 1
- GRYLNZFGIOXLOG-UHFFFAOYSA-N Nitric acid Chemical compound O[N+]([O-])=O GRYLNZFGIOXLOG-UHFFFAOYSA-N 0.000 description 1
- CIQHWLTYGMYQQR-QMMMGPOBSA-N O(4')-sulfo-L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(OS(O)(=O)=O)C=C1 CIQHWLTYGMYQQR-QMMMGPOBSA-N 0.000 description 1
- 101800005149 Peptide B Proteins 0.000 description 1
- OGNKZWAQLJPNLL-STQMWFEESA-N Phe(4-NO2)-Gln Chemical compound NC(=O)CC[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)C)CC1=CC=C([N+]([O-])=O)C=C1 OGNKZWAQLJPNLL-STQMWFEESA-N 0.000 description 1
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 1
- 102000035554 Proglucagon Human genes 0.000 description 1
- 102100038239 Protein Churchill Human genes 0.000 description 1
- IWYDHOAUDWTVEP-UHFFFAOYSA-N R-2-phenyl-2-hydroxyacetic acid Natural products OC(=O)C(O)C1=CC=CC=C1 IWYDHOAUDWTVEP-UHFFFAOYSA-N 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- 235000014680 Saccharomyces cerevisiae Nutrition 0.000 description 1
- 108010077895 Sarcosine Proteins 0.000 description 1
- 102100037505 Secretin Human genes 0.000 description 1
- 108010086019 Secretin Proteins 0.000 description 1
- FBPFZTCFMRRESA-NQAPHZHOSA-N Sorbitol Polymers OCC(O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-NQAPHZHOSA-N 0.000 description 1
- KDYFGRWQOYBRFD-UHFFFAOYSA-N Succinic acid Natural products OC(=O)CCC(O)=O KDYFGRWQOYBRFD-UHFFFAOYSA-N 0.000 description 1
- FEWJPZIEWOKRBE-UHFFFAOYSA-N Tartaric acid Natural products [H+].[H+].[O-]C(=O)C(O)C(O)C([O-])=O FEWJPZIEWOKRBE-UHFFFAOYSA-N 0.000 description 1
- WBWWGRHZICKQGZ-UHFFFAOYSA-N Taurocholic acid Natural products OC1CC2CC(O)CCC2(C)C2C1C1CCC(C(CCC(=O)NCCS(O)(=O)=O)C)C1(C)C(O)C2 WBWWGRHZICKQGZ-UHFFFAOYSA-N 0.000 description 1
- AUEJLPRZGVVDNU-STQMWFEESA-N Tyr-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 AUEJLPRZGVVDNU-STQMWFEESA-N 0.000 description 1
- 238000006959 Williamson synthesis reaction Methods 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 230000003213 activating effect Effects 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 125000003342 alkenyl group Chemical group 0.000 description 1
- 150000001350 alkyl halides Chemical class 0.000 description 1
- 230000002152 alkylating effect Effects 0.000 description 1
- 125000000304 alkynyl group Chemical group 0.000 description 1
- WNNNWFKQCKFSDK-UHFFFAOYSA-N allylglycine Chemical compound OC(=O)C(N)CC=C WNNNWFKQCKFSDK-UHFFFAOYSA-N 0.000 description 1
- WQZGKKKJIJFFOK-PHYPRBDBSA-N alpha-D-galactose Chemical compound OC[C@H]1O[C@H](O)[C@H](O)[C@@H](O)[C@H]1O WQZGKKKJIJFFOK-PHYPRBDBSA-N 0.000 description 1
- 125000000266 alpha-aminoacyl group Chemical group 0.000 description 1
- BJEPYKJPYRNKOW-UHFFFAOYSA-N alpha-hydroxysuccinic acid Natural products OC(=O)C(O)CC(O)=O BJEPYKJPYRNKOW-UHFFFAOYSA-N 0.000 description 1
- 229910000147 aluminium phosphate Inorganic materials 0.000 description 1
- 229940124277 aminobutyric acid Drugs 0.000 description 1
- 230000001195 anabolic effect Effects 0.000 description 1
- 239000005557 antagonist Substances 0.000 description 1
- 229920006187 aquazol Polymers 0.000 description 1
- PYMYPHUHKUWMLA-UHFFFAOYSA-N arabinose Natural products OCC(O)C(O)C(O)C=O PYMYPHUHKUWMLA-UHFFFAOYSA-N 0.000 description 1
- 238000003556 assay Methods 0.000 description 1
- RXQNHIDQIJXKTK-UHFFFAOYSA-N azane;pentanoic acid Chemical compound [NH4+].CCCCC([O-])=O RXQNHIDQIJXKTK-UHFFFAOYSA-N 0.000 description 1
- 238000002869 basic local alignment search tool Methods 0.000 description 1
- 235000010233 benzoic acid Nutrition 0.000 description 1
- SRBFZHDQGSBBOR-UHFFFAOYSA-N beta-D-Pyranose-Lyxose Natural products OC1COC(O)C(O)C1O SRBFZHDQGSBBOR-UHFFFAOYSA-N 0.000 description 1
- 229940000635 beta-alanine Drugs 0.000 description 1
- 150000001576 beta-amino acids Chemical class 0.000 description 1
- 230000000975 bioactive effect Effects 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 229920001222 biopolymer Polymers 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 230000036765 blood level Effects 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- GDTBXPJZTBHREO-UHFFFAOYSA-N bromine Substances BrBr GDTBXPJZTBHREO-UHFFFAOYSA-N 0.000 description 1
- 229910052794 bromium Inorganic materials 0.000 description 1
- 239000000872 buffer Substances 0.000 description 1
- 230000003139 buffering effect Effects 0.000 description 1
- KDYFGRWQOYBRFD-NUQCWPJISA-N butanedioic acid Chemical compound O[14C](=O)CC[14C](O)=O KDYFGRWQOYBRFD-NUQCWPJISA-N 0.000 description 1
- 125000000484 butyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- ZTQSAGDEMFDKMZ-UHFFFAOYSA-N butyric aldehyde Natural products CCCC=O ZTQSAGDEMFDKMZ-UHFFFAOYSA-N 0.000 description 1
- 230000003491 cAMP production Effects 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- 235000014633 carbohydrates Nutrition 0.000 description 1
- 239000001768 carboxy methyl cellulose Substances 0.000 description 1
- 235000010948 carboxy methyl cellulose Nutrition 0.000 description 1
- 239000008112 carboxymethyl-cellulose Substances 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 235000010980 cellulose Nutrition 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- JUFFVKRROAPVBI-PVOYSMBESA-N chembl1210015 Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(=O)N[C@H]1[C@@H]([C@@H](O)[C@H](O[C@H]2[C@@H]([C@@H](O)[C@@H](O)[C@@H](CO[C@]3(O[C@@H](C[C@H](O)[C@H](O)CO)[C@H](NC(C)=O)[C@@H](O)C3)C(O)=O)O2)O)[C@@H](CO)O1)NC(C)=O)C(=O)NCC(=O)NCC(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CO)C(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)CNC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 JUFFVKRROAPVBI-PVOYSMBESA-N 0.000 description 1
- 125000003636 chemical group Chemical group 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 239000000460 chlorine Substances 0.000 description 1
- 229910052801 chlorine Inorganic materials 0.000 description 1
- 235000013985 cinnamic acid Nutrition 0.000 description 1
- 229930016911 cinnamic acid Natural products 0.000 description 1
- 235000015165 citric acid Nutrition 0.000 description 1
- 210000001072 colon Anatomy 0.000 description 1
- 230000000112 colonic effect Effects 0.000 description 1
- 238000004590 computer program Methods 0.000 description 1
- 238000009833 condensation Methods 0.000 description 1
- 230000005494 condensation Effects 0.000 description 1
- 239000000356 contaminant Substances 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 125000002704 decyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])* 0.000 description 1
- YSMODUONRAFBET-UHFFFAOYSA-N delta-DL-hydroxylysine Natural products NCC(O)CCC(N)C(O)=O YSMODUONRAFBET-UHFFFAOYSA-N 0.000 description 1
- KXGVEGMKQFWNSR-LLQZFEROSA-N deoxycholic acid Chemical compound C([C@H]1CC2)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(O)=O)C)[C@@]2(C)[C@@H](O)C1 KXGVEGMKQFWNSR-LLQZFEROSA-N 0.000 description 1
- 229960003964 deoxycholic acid Drugs 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000009795 derivation Methods 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 229950006137 dexfosfoserine Drugs 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 1
- PMMYEEVYMWASQN-UHFFFAOYSA-N dl-hydroxyproline Natural products OC1C[NH2+]C(C([O-])=O)C1 PMMYEEVYMWASQN-UHFFFAOYSA-N 0.000 description 1
- POULHZVOKOAJMA-UHFFFAOYSA-N dodecanoic acid Chemical compound CCCCCCCCCCCC(O)=O POULHZVOKOAJMA-UHFFFAOYSA-N 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- YSMODUONRAFBET-UHNVWZDZSA-N erythro-5-hydroxy-L-lysine Chemical compound NC[C@H](O)CC[C@H](N)C(O)=O YSMODUONRAFBET-UHNVWZDZSA-N 0.000 description 1
- 125000004185 ester group Chemical group 0.000 description 1
- CCIVGXIOQKPBKL-UHFFFAOYSA-M ethanesulfonate Chemical compound CCS([O-])(=O)=O CCIVGXIOQKPBKL-UHFFFAOYSA-M 0.000 description 1
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 description 1
- 229960001519 exenatide Drugs 0.000 description 1
- 239000011737 fluorine Substances 0.000 description 1
- 229910052731 fluorine Inorganic materials 0.000 description 1
- 230000037406 food intake Effects 0.000 description 1
- 235000012631 food intake Nutrition 0.000 description 1
- 125000002485 formyl group Chemical group [H]C(*)=O 0.000 description 1
- 239000001530 fumaric acid Substances 0.000 description 1
- 235000011087 fumaric acid Nutrition 0.000 description 1
- 125000000524 functional group Chemical group 0.000 description 1
- 108020001507 fusion proteins Proteins 0.000 description 1
- 102000037865 fusion proteins Human genes 0.000 description 1
- 229930182830 galactose Natural products 0.000 description 1
- BTCSSZJGUNDROE-UHFFFAOYSA-N gamma-aminobutyric acid Chemical compound NCCCC(O)=O BTCSSZJGUNDROE-UHFFFAOYSA-N 0.000 description 1
- 229940083124 ganglion-blocking antiadrenergic secondary and tertiary amines Drugs 0.000 description 1
- 230000027119 gastric acid secretion Effects 0.000 description 1
- 230000030136 gastric emptying Effects 0.000 description 1
- 239000003629 gastrointestinal hormone Substances 0.000 description 1
- 239000003877 glucagon like peptide 1 receptor agonist Substances 0.000 description 1
- 150000002303 glucose derivatives Polymers 0.000 description 1
- 150000002304 glucoses Polymers 0.000 description 1
- 125000002791 glucosyl group Polymers C1([C@H](O)[C@@H](O)[C@H](O)[C@H](O1)CO)* 0.000 description 1
- 150000002314 glycerols Polymers 0.000 description 1
- RFDAIACWWDREDC-FRVQLJSFSA-N glycocholic acid Chemical compound C([C@H]1C[C@H]2O)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(=O)NCC(O)=O)C)[C@@]2(C)[C@@H](O)C1 RFDAIACWWDREDC-FRVQLJSFSA-N 0.000 description 1
- 229940099347 glycocholic acid Drugs 0.000 description 1
- 125000003147 glycosyl group Chemical group 0.000 description 1
- 125000001475 halogen functional group Chemical group 0.000 description 1
- 229920000669 heparin Polymers 0.000 description 1
- 229960002897 heparin Drugs 0.000 description 1
- 239000000833 heterodimer Substances 0.000 description 1
- 125000006038 hexenyl group Chemical group 0.000 description 1
- 239000000710 homodimer Substances 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- 102000044162 human IGF1 Human genes 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- 229920001477 hydrophilic polymer Polymers 0.000 description 1
- WGCNASOHLSPBMP-UHFFFAOYSA-N hydroxyacetaldehyde Natural products OCC=O WGCNASOHLSPBMP-UHFFFAOYSA-N 0.000 description 1
- 125000002349 hydroxyamino group Chemical group [H]ON([H])[*] 0.000 description 1
- 235000019447 hydroxyethyl cellulose Nutrition 0.000 description 1
- 229920003063 hydroxymethyl cellulose Polymers 0.000 description 1
- 229940031574 hydroxymethyl cellulose Drugs 0.000 description 1
- 229960002591 hydroxyproline Drugs 0.000 description 1
- 201000001421 hyperglycemia Diseases 0.000 description 1
- 210000003016 hypothalamus Anatomy 0.000 description 1
- PRJKNHOMHKJCEJ-UHFFFAOYSA-N imidazol-4-ylacetic acid Chemical compound OC(=O)CC1=CN=CN1 PRJKNHOMHKJCEJ-UHFFFAOYSA-N 0.000 description 1
- 238000010874 in vitro model Methods 0.000 description 1
- 125000003392 indanyl group Chemical group C1(CCC2=CC=CC=C12)* 0.000 description 1
- 125000003454 indenyl group Chemical group C1(C=CC2=CC=CC=C12)* 0.000 description 1
- 239000003112 inhibitor Substances 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 230000000968 intestinal effect Effects 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 125000000959 isobutyl group Chemical group [H]C([H])([H])C([H])(C([H])([H])[H])C([H])([H])* 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- SRJOCJYGOFTFLH-UHFFFAOYSA-N isonipecotic acid Chemical compound OC(=O)C1CCNCC1 SRJOCJYGOFTFLH-UHFFFAOYSA-N 0.000 description 1
- 125000001449 isopropyl group Chemical group [H]C([H])([H])C([H])(*)C([H])([H])[H] 0.000 description 1
- 125000001909 leucine group Chemical group [H]N(*)C(C(*)=O)C([H])([H])C(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- 150000002632 lipids Chemical class 0.000 description 1
- 229910052744 lithium Inorganic materials 0.000 description 1
- SMEROWZSTRWXGI-HVATVPOCSA-N lithocholic acid Chemical compound C([C@H]1CC2)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(O)=O)C)[C@@]2(C)CC1 SMEROWZSTRWXGI-HVATVPOCSA-N 0.000 description 1
- 239000008176 lyophilized powder Substances 0.000 description 1
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- 159000000003 magnesium salts Chemical class 0.000 description 1
- VZCYOOQTPOCHFL-UPHRSURJSA-N maleic acid Chemical compound OC(=O)\C=C/C(O)=O VZCYOOQTPOCHFL-UPHRSURJSA-N 0.000 description 1
- 239000011976 maleic acid Substances 0.000 description 1
- 239000001630 malic acid Substances 0.000 description 1
- 235000011090 malic acid Nutrition 0.000 description 1
- 229960002510 mandelic acid Drugs 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- FQPSGWSUVKBHSU-UHFFFAOYSA-N methacrylamide Chemical compound CC(=C)C(N)=O FQPSGWSUVKBHSU-UHFFFAOYSA-N 0.000 description 1
- 229940098779 methanesulfonic acid Drugs 0.000 description 1
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 1
- WBYWAXJHAXSJNI-UHFFFAOYSA-N methyl p-hydroxycinnamate Natural products OC(=O)C=CC1=CC=CC=C1 WBYWAXJHAXSJNI-UHFFFAOYSA-N 0.000 description 1
- 125000002950 monocyclic group Chemical group 0.000 description 1
- 210000003205 muscle Anatomy 0.000 description 1
- 230000035772 mutation Effects 0.000 description 1
- KRKPYFLIYNGWTE-UHFFFAOYSA-N n,o-dimethylhydroxylamine Chemical compound CNOC KRKPYFLIYNGWTE-UHFFFAOYSA-N 0.000 description 1
- 125000004123 n-propyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])* 0.000 description 1
- 125000001624 naphthyl group Chemical group 0.000 description 1
- 229920005615 natural polymer Polymers 0.000 description 1
- 229910017604 nitric acid Inorganic materials 0.000 description 1
- 125000000449 nitro group Chemical group [O-][N+](*)=O 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- IJGRMHOSHXDMSA-UHFFFAOYSA-N nitrogen Substances N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 1
- QJGQUHMNIGDVPM-UHFFFAOYSA-N nitrogen group Chemical group [N] QJGQUHMNIGDVPM-UHFFFAOYSA-N 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 108020004707 nucleic acids Proteins 0.000 description 1
- 102000039446 nucleic acids Human genes 0.000 description 1
- 150000007523 nucleic acids Chemical class 0.000 description 1
- 238000010534 nucleophilic substitution reaction Methods 0.000 description 1
- 125000002347 octyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 150000002482 oligosaccharides Polymers 0.000 description 1
- 235000006408 oxalic acid Nutrition 0.000 description 1
- 230000003647 oxidation Effects 0.000 description 1
- 238000007254 oxidation reaction Methods 0.000 description 1
- 229910052760 oxygen Inorganic materials 0.000 description 1
- 239000001301 oxygen Chemical group 0.000 description 1
- 125000001312 palmitoyl group Chemical group O=C([*])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 210000000496 pancreas Anatomy 0.000 description 1
- FJKROLUGYXJWQN-UHFFFAOYSA-N papa-hydroxy-benzoic acid Natural products OC(=O)C1=CC=C(O)C=C1 FJKROLUGYXJWQN-UHFFFAOYSA-N 0.000 description 1
- 229960001639 penicillamine Drugs 0.000 description 1
- 125000002255 pentenyl group Chemical group C(=CCCC)* 0.000 description 1
- 125000001147 pentyl group Chemical group C(CCCC)* 0.000 description 1
- 239000000863 peptide conjugate Substances 0.000 description 1
- 239000000813 peptide hormone Substances 0.000 description 1
- 102000014187 peptide receptors Human genes 0.000 description 1
- 108010011903 peptide receptors Proteins 0.000 description 1
- 239000000546 pharmaceutical excipient Substances 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- 125000001997 phenyl group Chemical group [H]C1=C([H])C([H])=C(*)C([H])=C1[H] 0.000 description 1
- 239000002953 phosphate buffered saline Substances 0.000 description 1
- DCWXELXMIBXGTH-QMMMGPOBSA-N phosphonotyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(OP(O)(O)=O)C=C1 DCWXELXMIBXGTH-QMMMGPOBSA-N 0.000 description 1
- 230000035790 physiological processes and functions Effects 0.000 description 1
- 229920000191 poly(N-vinyl pyrrolidone) Polymers 0.000 description 1
- 229920000747 poly(lactic acid) Polymers 0.000 description 1
- 229920001583 poly(oxyethylated polyols) Polymers 0.000 description 1
- 229920002338 polyhydroxyethylmethacrylate Polymers 0.000 description 1
- 239000004626 polylactic acid Substances 0.000 description 1
- 238000006116 polymerization reaction Methods 0.000 description 1
- 229920006324 polyoxymethylene Polymers 0.000 description 1
- 230000004481 post-translational protein modification Effects 0.000 description 1
- 239000011591 potassium Substances 0.000 description 1
- 229910052700 potassium Inorganic materials 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 239000000047 product Substances 0.000 description 1
- 125000001500 prolyl group Chemical group [H]N1C([H])(C(=O)[*])C([H])([H])C([H])([H])C1([H])[H] 0.000 description 1
- 238000011321 prophylaxis Methods 0.000 description 1
- 235000019260 propionic acid Nutrition 0.000 description 1
- OSFBJERFMQCEQY-UHFFFAOYSA-N propylidene Chemical compound [CH]CC OSFBJERFMQCEQY-UHFFFAOYSA-N 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 229940107700 pyruvic acid Drugs 0.000 description 1
- IUVKMZGDUIUOCP-BTNSXGMBSA-N quinbolone Chemical compound O([C@H]1CC[C@H]2[C@H]3[C@@H]([C@]4(C=CC(=O)C=C4CC3)C)CC[C@@]21C)C1=CCCC1 IUVKMZGDUIUOCP-BTNSXGMBSA-N 0.000 description 1
- 229920005604 random copolymer Polymers 0.000 description 1
- 229940044601 receptor agonist Drugs 0.000 description 1
- 239000000018 receptor agonist Substances 0.000 description 1
- 238000010188 recombinant method Methods 0.000 description 1
- 230000001603 reducing effect Effects 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 238000006722 reduction reaction Methods 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- OHRURASPPZQGQM-GCCNXGTGSA-N romidepsin Chemical compound O1C(=O)[C@H](C(C)C)NC(=O)C(=C/C)/NC(=O)[C@H]2CSSCC\C=C\[C@@H]1CC(=O)N[C@H](C(C)C)C(=O)N2 OHRURASPPZQGQM-GCCNXGTGSA-N 0.000 description 1
- 229960004889 salicylic acid Drugs 0.000 description 1
- 210000003079 salivary gland Anatomy 0.000 description 1
- 229940043230 sarcosine Drugs 0.000 description 1
- 125000002914 sec-butyl group Chemical group [H]C([H])([H])C([H])([H])C([H])(*)C([H])([H])[H] 0.000 description 1
- 150000003335 secondary amines Chemical class 0.000 description 1
- 229960002101 secretin Drugs 0.000 description 1
- OWMZNFCDEHGFEP-NFBCVYDUSA-N secretin human Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(N)=O)[C@@H](C)O)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)C1=CC=CC=C1 OWMZNFCDEHGFEP-NFBCVYDUSA-N 0.000 description 1
- 229940055619 selenocysteine Drugs 0.000 description 1
- 235000016491 selenocysteine Nutrition 0.000 description 1
- ZKZBPNGNEQAJSX-UHFFFAOYSA-N selenocysteine Natural products [SeH]CC(N)C(O)=O ZKZBPNGNEQAJSX-UHFFFAOYSA-N 0.000 description 1
- 125000003607 serino group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(O[H])([H])[H] 0.000 description 1
- 210000000813 small intestine Anatomy 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- 239000000243 solution Substances 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 230000009870 specific binding Effects 0.000 description 1
- 230000000087 stabilizing effect Effects 0.000 description 1
- 150000003431 steroids Chemical group 0.000 description 1
- 210000002784 stomach Anatomy 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 150000003457 sulfones Chemical class 0.000 description 1
- 125000000542 sulfonic acid group Chemical group 0.000 description 1
- 229910052717 sulfur Chemical group 0.000 description 1
- 125000004434 sulfur atom Chemical group 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 239000011975 tartaric acid Substances 0.000 description 1
- 235000002906 tartaric acid Nutrition 0.000 description 1
- WBWWGRHZICKQGZ-GIHLXUJPSA-N taurocholic acid Chemical compound C([C@@H]1C[C@H]2O)[C@@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@@H]([C@@H](CCC(=O)NCCS(O)(=O)=O)C)[C@@]2(C)[C@H](O)C1 WBWWGRHZICKQGZ-GIHLXUJPSA-N 0.000 description 1
- 125000000999 tert-butyl group Chemical group [H]C([H])([H])C(*)(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- NPDBDJFLKKQMCM-UHFFFAOYSA-N tert-butylglycine Chemical compound CC(C)(C)C(N)C(O)=O NPDBDJFLKKQMCM-UHFFFAOYSA-N 0.000 description 1
- 125000001712 tetrahydronaphthyl group Chemical group C1(CCCC2=CC=CC=C12)* 0.000 description 1
- 231100001274 therapeutic index Toxicity 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- FGMPLJWBKKVCDB-UHFFFAOYSA-N trans-L-hydroxy-proline Natural products ON1CCCC1C(O)=O FGMPLJWBKKVCDB-UHFFFAOYSA-N 0.000 description 1
- 230000014616 translation Effects 0.000 description 1
- ITMCEJHCFYSIIV-UHFFFAOYSA-M triflate Chemical compound [O-]S(=O)(=O)C(F)(F)F ITMCEJHCFYSIIV-UHFFFAOYSA-M 0.000 description 1
- 108010078580 tyrosylleucine Proteins 0.000 description 1
- 229920003169 water-soluble polymer Polymers 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
- ORQXBVXKBGUSBA-QMMMGPOBSA-N β-cyclohexyl-alanine Chemical compound OC(=O)[C@@H](N)CC1CCCCC1 ORQXBVXKBGUSBA-QMMMGPOBSA-N 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
- C07K14/62—Insulins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
- C07K14/605—Glucagons
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
Definitions
- Insulin is a proven therapy for the treatment of juvenile-onset diabetes and later stage adult-onset diabetes.
- the peptide is biosynthesized as a larger linear precursor of low potency (approximately 2% to 9% of native insulin), named proinsulin.
- Proinsulin is proteolytically converted to insulin by the selective removal of a 35-residue connecting peptide (C peptide).
- C peptide 35-residue connecting peptide
- the resultant heteroduplex formed by disulfide links between the insulin “A chain” (SEQ ID NO: 1) and “B chain” (SEQ ID NO: 2) chain, representing a total of 51 amino acids, has high potency for the insulin receptor (nM range).
- Native insulin has approximately one hundredfold selective affinity for the insulin receptor relative to the related insulin-like growth factor 1 receptor, but demonstrates little selectively for the two different insulin receptor isoforms, named A & B.
- the insulin-like growth factors 1 and 2 are single chain liner peptide hormones that are highly homologous in their A and B chain sequences, sharing approximately fifty percent homology with native insulin.
- the IGF A and B chains are linked by a “C-peptide”, wherein the C-peptides of the two IGFs differ in size and amino acid sequence, the first being twelve and the second being eight amino acids in length.
- Human IGF-1 is a 70 aa basic peptide having the protein sequence shown in SEQ ID NO: 3, and has a 43% homology with proinsulin (Rinderknecht et al. (1978) J. Biol. Chem. 253:2769-2776).
- Human IGF-2 is a 67 amino acid basic peptide having the protein sequence shown in SEQ ID NO: 4. The IGFs demonstrate considerably less activity at the insulin B receptor isoform than the A-receptor isoform.
- IGF-1 based insulin peptides analogs (wherein the native Gln-Phe dipeptide of the B-chain is replaced by Tyr-Leu) that display high activity at the insulin receptor (see PCT/US2009/068713, the disclosure of which is incorporated herein).
- IGF YL analog peptides are more readily synthesized than insulin and enable the development of co-agonist analogs for insulin and IGF-1 receptors, and selective insulin receptor specific analogs.
- these insulin analogs can also be formulated as single chain insulin agonists in accordance with the present disclosure.
- Single chain insulin analogs comprising the insulin A and B chains have been previously prepared (see EP 1,193,272 and US 2007/0129284).
- single chain high potency insulin agonists can also be prepared by insertion of the IGF-1 C-peptide, or analogs thereof, as a connecting peptide linking the insulin B and A peptides.
- the selective mutation of individual amino acids in the C-peptide sequence yields peptides that are highly selective for insulin relative to IGF-1 receptor.
- Incretins are a group of gastrointestinal hormones that that are involved in a wide variety of physiological functions, including glucose homeostasis, insulin secretion, gastric emptying, and intestinal growth, as well as the regulation of food intake.
- Pre-proglucagon is a 158 amino acid precursor polypeptide that is processed in different tissues to form a number of different peptides.
- Incretins include a number of proglucagon-derived peptides, including glucagon (SEQ ID NO: 701), glucagon-like peptide-1 (GLP-1; amino acids 7-36 are provided as SEQ ID NO: 703 and amino acids 7-35 as SEQ ID NO: 704), glucagon-like peptide-2 (GLP-2; SEQ ID NO: 708) and oxyntomodulin (OXM; SEQ ID NO: 706).
- glucagon SEQ ID NO: 701
- GLP-1 glucagon-like peptide-1
- amino acids 7-36 are provided as SEQ ID NO: 703 and amino acids 7-35 as SEQ ID NO: 704
- glucagon-like peptide-2 GLP-2
- OXM oxyntomodulin
- Glucagon is a 29-amino acid peptide that corresponds to amino acids 33 through 61 of pre-proglucagon, while GLP-1 is produced as a 37-amino acid peptide that corresponds to amino acids 72 through 108 of pre-proglucagon.
- GLP-1(7-36) amide SEQ ID NO: 703; the C terminus is an arginine amide
- GLP-1(7-37) acid SEQ ID NO: 704; C terminus is a glycine
- Glucagon is a life-saving medicine that is used in the acute treatment of severe hypoglycemia.
- Oxyntomodulin has been reported to have pharmacological ability to suppress appetite and lower body weight.
- Clinical studies with GLP-1 receptor agonists or stabilized GLP-1 analogs have proven this family of peptides to be an effective treatment for Type II diabetes.
- gastric inhibitory polypeptide is also known as a glucose-dependent insulinotropic peptide, and is a member of the secretin family of hormones.
- GIP is derived from a 153-amino acid proprotein encoded by the GIP gene and circulates as a biologically active 42-amino acid peptide (SEQ ID NO: 707).
- the GIP gene is expressed in the small intestine as well as the salivary glands and is a weak inhibitor of gastric acid secretion.
- GIP enhances insulin release by pancreatic beta islet cells when administered in physiological doses.
- GIP is believed to function as an enteric factor that stimulates the release of pancreatic insulin and that may play a physiological role in maintaining glucose homeostasis.
- conjugates are formed between an insulin peptide and an incretin, including for example a glucagon related peptide, wherein the conjugate has agonist activity at both the insulin receptor and the corresponding incretin receptor.
- a glucagon related peptide e.g., GIP, GLP-1 or glucagon
- the conjugation of a glucagon related peptide is anticipated to produce a beneficial modification of the insulin peptide activity.
- a glucagon related peptide e.g., GIP, GLP-1 or glucagon
- linking a peptide having agonist activity at the glucagon receptor to an insulin peptide is anticipated to enhance targeting of the conjugate to the liver since the glucagon receptor is predominately located in the liver.
- Targeting of the conjugate to the liver is desirable since the liver is primarily involved in glucose production not utilization.
- targeting the liver may be a safer approach to shutting off glucose production than occurs when insulin contact other tissues such as muscle or fat, where in addition to turning off glucose production it also stimulates glucose use leading to a higher risk of hypoglycemia.
- glucagon receptors present on the alpha cells of the pancreas. Delivering the complex to the alpha cells may suppress additional glucagon production or make the alpha cell more sensitive to hypoglycemia.
- Applicants also anticipate that the presence of glucagon in the glucagon-insulin conjugates may serve as a buffer on the activity of the coupled insulin to provide a more baseline activity and thus avoid spikes in blood glucose levels.
- conjugates of insulin peptides with other glucagon related peptides including the incretins GLP-1 and GIP and other related peptides having activity at the GLP-1 and/or GIP receptors will produce conjugates having beneficial properties.
- GLP-insulin conjugate may be targeted to the hypothalamus, to decrease appetite as well as reduce blood glucose.
- the GLP-insulin conjugate may be targeted to the beta cells to drive anabolic response (increase islet beta cells production of insulin).
- the glucagon related peptide-insulin peptide conjugates are also suitable for further structural enhancements that are envisioned to yield improved therapeutic index, through the use of prodrug chemistry; extended duration of action, by linkage of plasma proteins such as albumin, or other modifications, including pegylation and acylation; and enhanced physical stability, by glycosylation.
- the preparation of single chain insulin analogs using a C-peptide linker also provides a novel structural location for where many of these chemical modifications can be successfully deployed. The primary use of the insulin conjugates would be in the treatment of insulin-dependent diabetes.
- an insulin agonist/incretin conjugate wherein the conjugate has agonist activity at both the insulin receptor and the corresponding incretin receptor.
- the insulin peptide component of the conjugate can be native insulin or any known insulin analog that has activity at the insulin receptor including for example any insulin peptide disclosed in published international applications WO96/34882, WO 2010/080607, WO 2010/080609, WO 2011/159882, WO/2011/159895 and U.S. Pat. No. 6,630,348, the disclosures of which are incorporated herein by reference.
- the incretin component of the conjugate can be any glucagon related peptide as disclosed herein including for example native glucagon, GLP-1, GIP or any known incretin or glucagon related peptide that has activity at one or more incretin receptors.
- Glucagon related peptides suitable for use in accordance with this disclosure include, for example, any glucagon related peptide disclosed in published international applications WO 2009/155258, WO 2009/058734, WO 2011/094337, WO 2009/148089, WO 2011/163473 and WO 2010/071807, the disclosures of which are expressly incorporated herein in their entirety.
- the carboxy terminus of a glucagon related peptide is linked to the N-terminus of an insulin peptide either directly via a peptide bond (forming a fusion peptide), or indirectly through a spacer.
- conjugates formed by the fusions of glucagon or GLP-1 with insulin are provided that demonstrate high potency, balanced activity at the respective receptors of the conjugate, and glucose lowering capability when injected in normal mice.
- the C-terminal region of the glucagon related peptides is covalently linked to the insulin peptide through a position independently selected from the side chain of an amino acid at a position selected from the group consisting of A9, A14 and A15 of the A chain, positions B1, B2, B10, B22, B28 or B29 of the B chain, the N-terminal alpha amine of the B chain, the carboxy terminus of the A or B chain and at the side chain of an amino acid at any position of a linking moiety that links the A chain and B chain of a single chain insulin analog.
- the C-terminal region of the glucagon related peptide is intended to encompass the native C-terminus of a glucagon peptide or any amino acid added to the native C-terminus of a glucagon analog or to the C-terminal amino acid of a glucagon analog that has been shortened by the deletion amino acids at the C-terminus, respectively, relative to the native glucagon sequence.
- the C-terminus of the native glucagon related peptide can be extended by 1 to 3 amino acids which are then linked to the insulin peptide either through the side chain of an amino acid of the C-terminal region or through the C-terminal carboxy group.
- the carboxy terminal region of the glucagon related peptide is covalently linked to the amino terminal region of the B chain of the insulin peptide.
- the insulin peptide is a single chain insulin analog.
- the insulin peptide is a single chain insulin analog wherein the carboxy terminal region of the glucagon related peptide is covalently linked to the amino terminus of the B chain of the insulin peptide.
- the insulin peptide of the conjugate is a two chain insulin analog comprising an A chain and B chain linked to one another via intermolecular disulfide bonds.
- the conjugate comprises a two chain insulin analog wherein a first and second glucagon related peptide are covalently linked to the insulin peptide at a position selected from the group consisting of the amino terminus of the B chain, the carboxy terminal region of the A chain, and the carboxy terminal region of the B chain.
- the first and second glucagon related peptides have different affinities/selectivity for the glucagon, GLP-1 and GIP receptors.
- the glucagon related peptide is selected from the group consisting of native glucagon, native GLP-1 and native GIP. In one embodiment the glucagon related peptide is a native glucagon or a glucagon analog having activity at one or more incretin receptors selected from the glucagon receptor, the GLP-1 receptor or the GIP receptor. In one embodiment the glucagon related peptide component of the conjugate comprises
- glucagon related peptide has glucagon agonist activity
- amino acid sequence of SEQ ID NO: 701 modified to comprise at least one amino acid modification selected from the group consisting of:
- Group A is an amino acid modification selected from the group consisting of substitution of Asp at position 15 with Glu, and substitution of Ser at position 16 with Thr or AIB;
- Group B is an amino acid modification selected from the group consisting of:
- DPP-IV dipeptidyl peptidase IV
- EC50 of the analog for GIP receptor activation is about 10 nM or less
- X 1 is selected from the group consisting of His, D-His, (Des-amino)His, hydroxyl-His, acetyl-His, homo-His or alpha, alpha-dimethyl imidiazole acetic acid (DMIA), N-methyl His, alpha-methyl His, and imidazole acetic acid;
- X 2 is selected from the group consisting of Ser, D-Ser, Ala, D-Ala, Val, Gly, N-methyl Ser, aminoisobutyric acid (Aib) and N-methyl Ala;
- X 3 is selected from the group consisting of Gln, Glu, Orn and Nle;
- X 10 is selected from the group consisting of Tyr, Val and Trp;
- X 12 is selected from the group consisting of Ser, Lys, Citrulline, Orn and Arg;
- X 15 is selected from the group consisting of Asp, Glu, cysteic acid, homoglutamic acid and homocysteic acid;
- X 16 is selected from the group consisting of Ser, Gly, Glu, Gln, homoglutamic acid and homocysteic acid;
- X 17 is selected from the group consisting of Arg, Gln, Lys, Cys, Orn, homocysteine and acetyl phenylalanine;
- X 18 is selected from the group consisting of Arg, Ala, Lys, Cys, Orn, homocysteine and acetyl phenylalanine;
- X 20 is selected from the group consisting of Gln, Lys, Arg, Orn and Citrulline;
- X 21 is selected from the group consisting of Gln, Glu, Asp, Lys, Cys, Orn, homocysteine and acetyl phenyalanine;
- X 23 is selected from the group consisting of Val and Ile;
- X 24 is selected from the group consisting of Ala, Gln, Glu, Lys, Cys, Orn, homocysteine and acetyl phenyalanine;
- X 27 is selected from the group consisting of Met, Val, Leu and Nle;
- X 28 is selected from the group consisting of Asn, Arg, Citrulline, Orn, Lys and Asp;
- X 29 is selected from the group consisting of Thr, Gly, Lys, Cys, Orn, homocysteine and acetyl phenyalanine; or an analog of SEQ ID NO: 72, wherein said analog differs from SEQ ID NO: 72 by 1 to 3 amino acid modifications, selected from positions 1, 2, 3, 5, 7, 10, 11, 13, 14, 17, 18, 19, 21, 24, 27, 28, and 29, wherein said glucagon related peptide exhibits at least 20% of the activity of native GLP-1 at the GLP-1 receptor;
- an amino acid that differs from SEQ ID NO: 701 by no more than ten amino acid modifications comprising one or more amino acid substitutions with AIB at positions 16, 20, 21, and/or 24, and an amino acid modification at position 1 and/or 2 that provides reduced susceptibility to cleavage by dipeptidyl peptidase IV, wherein said glucagon related peptide exhibits at least 20% of the activity of native GLP-1 at the GLP-1 receptor.
- the insulin peptide of the conjugate comprises an A chain and a B chain wherein said A chain comprises a sequence GIVX 4 X 5 CCX 8 X 9 X 10 CX 12 LX 14 X 15 LX 17 X 15 YCX 21 -R 13 (SEQ ID NO: 19), and said B chain comprises a sequence R 22 -X 25 LCGX 29 X 30 LVX 33 X 34 LYLVCGX 41 X 42 GFX 45 (SEQ ID NO: 20), wherein
- X 4 is glutamic acid or aspartic acid
- X 5 is glutamine or glutamic acid
- X 8 is histidine, threonine or phenylalanine
- X 9 is serine, arginine, lysine, ornithine or alanine
- X 10 is isoleucine or serine
- X 12 is serine or aspartic acid
- X 14 is tyrosine, arginine, lysine, ornithine or alanine;
- X 15 is glutamine, glutamic acid, arginine, alanine, lysine, ornithine or leucine;
- X 17 is glutamic acid, aspartic acid, asparagine, lysine, ornithine or glutamine;
- X 18 is methionine, asparagine, glutamine, aspartic acid, glutamic acid or threonine;
- X 21 is selected from the group consisting of alanine, glycine, serine, valine, threonine, isoleucine, leucine, glutamine, glutamic acid, asparagine, aspartic acid, histidine, tryptophan, tyrosine, and methionine;
- X 25 is histidine or threonine
- X 29 is selected from the group consisting of alanine, glycine and serine;
- X 30 is selected from the group consisting of histidine, aspartic acid, glutamic acid, homocysteic acid and cysteic acid;
- X 33 is selected from the group consisting of aspartic acid and glutamic acid;
- X 34 is selected from the group consisting of alanine and threonine
- X 41 is selected from the group consisting of glutamic acid, aspartic acid or asparagine;
- X 42 is selected from the group consisting of alanine, ornithine, lysine and arginine;
- X 45 is tyrosine or phenylalanine
- R 22 is selected from the group consisting of AYRPSE (SEQ ID NO: 14), FVNQ (SEQ ID NO: 12), PGPE (SEQ ID NO: 11), a tripeptide glycine-proline-glutamic acid, a tripeptide valine-asparagine-glutamine, a dipeptide proline-glutamic acid, a dipeptide asparagine-glutamine, glutamine, glutamic acid and an N-terminal amine; and
- R 13 is COOH or CONH 2 .
- the conjugate comprises a sequence selected from the group consisting of SEQ ID NO: 132, SEQ ID NO: 135, SEQ ID NO: 139 and SEQ ID NO: 140 or an analog thereof that differs from SEQ ID NO: 132, SEQ ID NO: 135, SEQ ID NO: 139 or SEQ ID NO: 140 by 1, 2, 3, 4 or 5 amino acid modifications.
- the conjugate comprises a sequence that differs from SEQ ID NO: 132, SEQ ID NO: 135, SEQ ID NO: 139 or SEQ ID NO: 140 by 1, 2 or 3 amino acid substitutions.
- the glucagon related peptide-insulin conjugate comprises a hydrophilic moiety linked to the N-terminal alpha amine of the B chain or to the side chain of an amino acid at a position selected from the group consisting of A9, A14 and A15 of the A chain or positions B1, B2, B10, B22, B28 or B29 of the B chain or to a side chain of an amino acid of the linking moiety in a single chain insulin analog.
- a hydrophilic moiety can be linked to the glucagon related peptide at any of amino acid positions 19, 20, 23, 24, 27, 32, 43 or the C-terminal region.
- the hydrophilic moiety is a polyethylene chain and in a further embodiment the polyethylene chain is covalently bound to the side chain of an amino acid of the linking moiety of the insulin peptide component, when the insulin peptide is a single chain insulin analog.
- the insulin peptide is a single chain insulin wherein linking moiety joining the B and A chains comprises an amino acid sequence of no more than 17 amino acids in length and comprising the sequence GYGSSSX 57 X 58 (SEQ ID NO: 21), GAGSSSRR (SEQ ID NO: 22) or GYGSSSX 57 X 58 APQT; (SEQ ID NO: 69) wherein X 57 and X 58 are independently arginine, lysine or ornithine and the amino acid designated by X 57 or X 58 optionally further comprises a hydrophilic moiety linked to the side chain of the amino acid at that position.
- the hydrophilic moiety is a polyethylene glycol chain.
- Acylation or alkylation can increase the half-life of the glucagon related peptide-insulin conjugate peptides in circulation. Acylation or alkylation can advantageously delay the onset of action and/or extend the duration of action at the insulin receptors.
- the glucagon related peptide-insulin conjugate peptides may be acylated or alkylated at the same amino acid position where a hydrophilic moiety is linked (including, for example at position 8 of the linking moiety), or at a different amino acid position.
- compositions comprising the glucagon related peptide-insulin conjugates and a pharmaceutically acceptable carrier.
- a pharmaceutical composition comprising any of the glucagon related peptide-insulin conjugates disclosed herein preferably at a purity level of at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%, and a pharmaceutically acceptable diluent, carrier or excipient.
- compositions may contain a single chain insulin agonist peptide as disclosed herein at a concentration of at least 0.5 mg/ml, 1 mg/ml, 2 mg/ml, 3 mg/ml, 4 mg/ml, 5 mg/ml, 6 mg/ml, 7 mg/ml, 8 mg/ml, 9 mg/ml, 10 mg/ml, 11 mg/ml, 12 mg/ml, 13 mg/ml, 14 mg/ml, 15 mg/ml, 16 mg/ml, 17 mg/ml, 18 mg/ml, 19 mg/ml, 20 mg/ml, 21 mg/ml, 22 mg/ml, 23 mg/ml, 24 mg/ml, 25 mg/ml or higher.
- the pharmaceutical compositions comprise aqueous solutions that are sterilized and optionally stored within various package containers.
- the pharmaceutical compositions comprise a lyophilized powder.
- the pharmaceutical compositions can be further packaged as part of a kit that includes a disposable device for administering the composition to a patient.
- the containers or kits may be labeled for storage at ambient room temperature or at refrigerated temperature.
- an improved method of regulating blood glucose levels in insulin dependent patients comprises the steps of administering to a patient a single chain insulin agonist peptide, or derivative thereof, in an amount therapeutically effective for the control of diabetes.
- FIG. 1 is a schematic overview of the two step synthetic strategy for preparing human insulin. Details of the procedure are provided in Example 1.
- FIG. 2 is a graph comparing insulin receptor specific binding of synthetic human insulin relative to purified native insulin.
- the synthetic insulin was produced by the approach detailed in FIG. 1 where the A 7 -B 7 bond is the first disulfide formed. As indicated by the data presented in the graph, the two molecules have similar binding activities.
- FIG. 3 is a graph comparing relative insulin receptor binding of native insulin and the A19 insulin analog (Insulin(p-NH 2 —F) 19 ). As indicated by the data presented in the graph, the two molecules have similar binding activities.
- FIG. 4 is a graph comparing relative insulin receptor binding of native insulin and the IGF1(Y B16 L B17 ) analog. As indicated by the data presented in the graph, the two molecules have similar binding activities.
- FIG. 5 is an alignment of the human proinsulin (A chain, SEQ ID NO: 1; B chain, SEQ ID NO: 2 and the C chain, SEQ ID NO: 141) and insulin-like growth factors I and II (IGF I; SEQ ID NO: 3 and IGF II; SEQ ID NO: 4) amino acid sequences.
- the alignment demonstrates that these three peptides share a high level of sequence identity (* indicates a space with no corresponding amino acid and a dash (-) indicates the identical amino acid as present in insulin).
- FIG. 6 presents the sequence of a set of GLP1 and glucagon fusion peptides formed with a single chain insulin analog. More particularly, the sequences are presented showing a GLP-1-insulin conjugate (GLP1-DP8; SEQ ID NO: 132) and a glucagon-insulin conjugate (Glu-DP8; SEQ ID NO: 135).
- GLP1-DP8 GLP-1-insulin conjugate
- Glu-DP8 glucagon-insulin conjugate
- FIG. 7 presents the EC 50 values of chromatographically isolated pool fractions of the synthesized GLP1-DP8 conjugate at the insulin and GLP1 receptors relative to native insulin, IGF-1 and native glucagon.
- the structure of the GLP1-DP8 conjugate is shown in FIG. 6 .
- Pool 1 demonstrates almost identical activity as native insulin at the insulin receptor. All three pools demonstrated high activity at the GLP1 receptor. Accordingly, the conjugate of pool 1 demonstrates potency as high as native insulin and native GLP1 at their two respective receptors.
- FIG. 8 presents the EC 50 values of chromatographically isolated pool fractions of the synthesized Glu-DP8 conjugate at the insulin, glucagon and GLP1 receptors relative to native insulin, IGF-1 and native glucagon.
- the structure of the Glu-DP8 conjugate is shown in FIG. 6 .
- Pool 1 demonstrates similar activity as native insulin at the insulin receptor, with the presence of the glucagon sequence moderating the activity of the conjugate at the insulin receptor.
- Pools 1 and 3 demonstrated high activity at the glucagon receptor. All three pools demonstrate poor activity at the GLP-1 receptor. Accordingly, the conjugate of pool 1 demonstrates high potency at the insulin and glucagon, but retaining selectivity with regard to the GLP1 receptor.
- FIGS. 9A-9C demonstrate the in vivo effect of native insulin and the Glu-DP8 and GLP1-DP8 conjugates on blood glucose levels.
- Mice were subcutaneously injected with either native insulin ( FIG. 9A ) at two doses (12 nmol/kg or 60 nmol/kg), or one of the conjugates, GLP1-DP8 ( FIG. 9B ) or Glu-DP8 ( FIG. 9C ) administered at three different concentrations (12 nmol/kg, 60 nmol/kg and 300 nmol/kg).
- the conjugates demonstrated a less steep drop in blood glucose and a longer half life than native insulin (greater duration of action).
- GLP1-DP8 FIG. 9B
- Glu-DP8 FIG. 9C
- this is believed to result from glucagon buffering against insulin activity.
- FIG. 10 provides the in vitro activity of GLP1-DP8 and GLP1-DP8A19 (GLP1-DP8 wherein position 19 of the insulin A chain has been modified to alanine) at the insulin receptor. Substitution of alanine at the A19 position effectively eliminates insulin's activity at the insulin receptor.
- EC 50 values indicate that both insulin and GLP1-DP8 are potent insulin receptor agonists, whereas GLP-1 and GLP1-DP8A19 have poor activity at the insulin receptor.
- FIG. 11 presents the in vitro insulin receptor activity (EC 50 values) of Glu-DP8 and Glu-DP8A19, a glucagon-insulin conjugate modified to eliminate glucagon activity (GluE3-DP8; wherein position 3 of the glucagon peptide has been modified to glutamic acid), and a modification that maintains activity at the glucagon receptor (GluE16-DP8; wherein position 16 has been modified to glutamic acid).
- the glutamic acid substitution at position 3 glucagon is known to effectively eliminate glucagon activity.
- Substitution of alanine at the A19 position of insulin is known to effectively eliminate insulin activity at the insulin receptor.
- EC 50 values indicate that both insulin and Glu-DP8 are potent insulin receptor agonists, whereas glucagon and Glu-DP8A19 have poor activity at the insulin receptor. GluE3-DP8 and GluE16-DP8 also showed high potency at the insulin receptor.
- FIG. 12 presents the in vitro glucagon receptor activity (EC 50 values) of Glu-DP8, GluE3-DP8 and GluE16-DP8, Glu-DP8A19, and GLP-1-DP8.
- the glutamic acid substitution at position 3 of glucagon is known to effectively eliminate glucagon activity, and substitution of alanine at the A19 position of insulin is known to effectively eliminate insulin activity at the insulin receptor.
- the glutamic acid substitution at position 16 of glucagon produces a co-agonist of glucagon and GLP-1.
- the EC 50 values indicate that glucagon, Glu-DP8 and GluE16-DP8 are potent glucagon receptor agonists, whereas GLP-1 and GLP1-DP8, and GluE3-DP8 have poor activity at the glucagon receptor. Accordingly, the conjugates exhibit the expected activities.
- FIG. 13 presents the in vitro GLP-1 receptor activity (EC 50 values) of GLP-1, GLP-1-DP8, GLP-1A22-DP8, GLP-1-DP8A19, Glu-DP8, and GluE16-DP8.
- GLP-1A22-DP8 represents a conjugate of insulin and GLP-1 wherein position 22 has been substituted with alanine, a modification known to effectively eliminate GLP-1 activity.
- EC 50 values indicate that GLP-1, GLP1-DP8 and GLP1-DP8A19 are potent GLP-1 receptor agonists, whereas GLP-1A22-DP8, Glu-DP8, and GluE16-DP8 have poor activity at the GLP-1 receptor. Accordingly, the conjugates exhibit the expected activities.
- FIG. 14A-14B present the in vivo effect of the listed conjugates on blood glucose levels in C57BL/6 mice administered DP8 ( FIG. 14A ) or GLP1-DP8A19 ( FIG. 14B ) relative to native insulin.
- DP8 or GLP1-DP8A19 was administered at two concentrations (60 nmoles/kg or 300 nmoles/kg).
- DP8 successfully lowered blood glucose whereas GLP1-DP8A19 failed to significantly lower blood glucose levels.
- FIG. 15A-15C present the in vivo effect of the listed conjugates on blood glucose levels in C57BL/6 mice administered Glu-DP8A19 ( FIG. 15A ) or GLP1A22-DP8 ( FIG. 15B ) or GluE3/DP8 ( FIG. 15C ), relative to native insulin.
- the Glu-DP8A19 conjugate lacks insulin activity, yet still induces blood glucose lowering in vivo resulting from glucagon stimulated insulin secretion.
- GLP1A22-DP8 has reduced glucagon activity as a result of the substitution at position 22, however the insulin component of the conjugate provides blood glucose reducing activity such that the conjugate has approximately one fifth the activity of insulin.
- GluE3/DP8 has reduced glucagon activity due to the substitution at position E3, however the conjugate has glucose lowering activity that is slightly blunted relative to native insulin.
- amino acid encompasses any molecule containing both amino and carboxyl functional groups, wherein the amino and carboxylate groups are attached to the same carbon (the alpha carbon).
- the alpha carbon optionally may have one or two further organic substituents.
- designation of an amino acid without specifying its stereochemistry is intended to encompass either the L or D form of the amino acid, or a racemic mixture.
- the D form of the amino acid is specified by inclusion of a lower case d before the three letter code and superscript number (e.g., dLys ⁇ 1 ), wherein the designation lacking the lower case d (e.g., Lys ⁇ 1 ) is intended to specify the native L form of the amino acid.
- the inclusion of the superscript number designates the position of the amino acid in the insulin analog sequence, wherein amino acids that are located within the insulin analog sequence are designated by positive superscript numbers numbered consecutively from the N-terminus. Additional amino acids linked to the insulin analog peptide either at the N-terminus or through a side chain are numbered starting with 0 and increasing in negative integer value as they are further removed from the insulin analog sequence.
- hydroxyl acid refers to amino acids that have been modified to replace the alpha carbon amino group with a hydroxyl group.
- non-coded amino acid encompasses any amino acid that is not an L-isomer of any of the following 20 amino acids: Ala, Cys, Asp, Glu, Phe, Gly, His, Ile, Lys, Leu, Met, Asn, Pro, Gln, Arg, Ser, Thr, Val, Trp, Tyr.
- bioactive polypeptide refers to polypeptides which are capable of exerting a biological effect in vitro and/or in vivo.
- a general reference to a peptide is intended to encompass peptides that have modified amino and carboxy termini.
- an amino acid sequence designating the standard amino acids is intended to encompass standard amino acids at the N- and C-terminus as well as a corresponding hydroxyl acid at the N-terminus and/or a corresponding C-terminal amino acid modified to comprise an amide group in place of the terminal carboxylic acid.
- an “acylated” amino acid is an amino acid comprising an acyl group which is non-native to a naturally-occurring amino acid, regardless by the means by which it is produced.
- exemplary methods of producing acylated amino acids and acylated peptides are known in the art and include acylating an amino acid before inclusion in the peptide or peptide synthesis followed by chemical acylation of the peptide.
- the acyl group causes the peptide to have one or more of (i) a prolonged half-life in circulation, (ii) a delayed onset of action, (iii) an extended duration of action, (iv) an improved resistance to proteases, such as DPP-IV, and (v) increased potency at the IGF and/or insulin peptide receptors.
- an “alkylated” amino acid is an amino acid comprising an alkyl group which is non-native to a naturally-occurring amino acid, regardless of the means by which it is produced.
- exemplary methods of producing alkylated amino acids and alkylated peptides are known in the art and including alkylating an amino acid before inclusion in the peptide or peptide synthesis followed by chemical alkylation of the peptide.
- alkylation of peptides will achieve similar, if not the same, effects as acylation of the peptides, e.g., a prolonged half-life in circulation, a delayed onset of action, an extended duration of action, an improved resistance to proteases, such as DPP-IV, and increased potency at the IGF and/or insulin receptors.
- the term “pharmaceutically acceptable carrier” includes any of the standard pharmaceutical carriers, such as a phosphate buffered saline solution, water, emulsions such as an oil/water or water/oil emulsion, and various types of wetting agents.
- the term also encompasses any of the agents approved by a regulatory agency of the US Federal government or listed in the US Pharmacopeia for use in animals, including humans.
- pharmaceutically acceptable salt refers to salts of compounds that retain the biological activity of the parent compound, and which are not biologically or otherwise undesirable. Many of the compounds disclosed herein are capable of forming acid and/or base salts by virtue of the presence of amino and/or carboxyl groups or groups similar thereto.
- Pharmaceutically acceptable base addition salts can be prepared from inorganic and organic bases.
- Salts derived from inorganic bases include by way of example only, sodium, potassium, lithium, ammonium, calcium and magnesium salts.
- Salts derived from organic bases include, but are not limited to, salts of primary, secondary and tertiary amines.
- Salts derived from inorganic acids include hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, phosphoric acid, and the like.
- Salts derived from organic acids include acetic acid, propionic acid, glycolic acid, pyruvic acid, oxalic acid, malic acid, malonic acid, succinic acid, maleic acid, fumaric acid, tartaric acid, citric acid, benzoic acid, cinnamic acid, mandelic acid, methanesulfonic acid, ethanesulfonic acid, p-toluene-sulfonic acid, salicylic acid, and the like.
- hydrophilic moiety refers to any compound that is readily water-soluble or readily absorbs water, and which are tolerated in vivo by mammalian species without toxic effects (i.e. are biocompatible).
- hydrophilic moieties include polyethylene glycol (PEG), polylactic acid, polyglycolic acid, a polylactic-polyglycolic acid copolymer, polyvinyl alcohol, polyvinylpyrrolidone, polymethoxazoline, polyethyloxazoline, polyhydroxyethyl methacrylate, polyhydroxypropyl methacrylamide, polymethacrylamide, polydimethylacrylamide, and derivatised celluloses such as hydroxymethylcellulose or hydroxyethylcellulose and co-polymers thereof, as well as natural polymers including, for example, albumin, heparin and dextran.
- treating includes prophylaxis of the specific disorder or condition, or alleviation of the symptoms associated with a specific disorder or condition and/or preventing or eliminating said symptoms.
- treating diabetes will refer in general to maintaining glucose blood levels near normal levels and may include increasing or decreasing blood glucose levels depending on a given situation.
- an “effective” amount or a “therapeutically effective amount” of an insulin analog refers to a nontoxic but sufficient amount of an insulin analog to provide the desired effect.
- one desired effect would be the prevention or treatment of hyperglycemia.
- the amount that is “effective” will vary from subject to subject, depending on the age and general condition of the individual, mode of administration, and the like. Thus, it is not always possible to specify an exact “effective amount.” However, an appropriate “effective” amount in any individual case may be determined by one of ordinary skill in the art using routine experimentation.
- parenteral means not through the alimentary canal but by some other route such as intranasal, inhalation, subcutaneous, intramuscular, intraspinal, or intravenous.
- references to a particular amino acid position by letter and number refer to the amino acid at that position of either the A chain (e.g. position A5) or the B chain (e.g. position B5) in the respective native human insulin A chain (SEQ ID NO: 1) or B chain (SEQ ID NO: 2), or the corresponding amino acid position in any analogs thereof.
- a reference herein to “position B28” absent any further elaboration would mean the corresponding position B27 of the B chain of an insulin analog in which the first amino acid of SEQ ID NO: 2 has been deleted.
- amino acids added to the N-terminus of the native B chain are numbered starting with B0, followed by numbers of increasing negative value (e.g., B-1, B-2 . . . ) as amino acids are added to the N-terminus.
- any reference to an amino acid position in the linking moiety of a single chain analog is made in reference to the native C chain of IGF 1 (SEQ ID NO: 17).
- position 9 of the native C chain (or the “position C9”) has an alanine residue.
- the term “native insulin peptide” is intended to designate the 51 amino acid heteroduplex comprising the A chain of SEQ ID NO: 1 and the B chain of SEQ ID NO: 2, as well as single-chain insulin analogs that comprise SEQ ID NOS: 1 and 2.
- insulin peptide as used herein, absent further descriptive language is intended to encompass the 51 amino acid heteroduplex comprising the A chain of SEQ ID NO: 1 and the B chain of SEQ ID NO: 2, as well as single-chain insulin analogs thereof (including for example those disclosed in published international application WO96/34882 and U.S. Pat. No.
- modified analogs include modification of the amino acid at position A19, B16 or B25 to a 4-amino phenylalanine or one or more amino acid substitutions at positions selected from A5, A8, A9, A10, A12, A14, A15, A17, A18, A21, B1, B2, B3, B4, B5, B9, B10, B13, B14, B17, B20, B21, B22, B23, B26, B27, B28, B29 and B30 or deletions of any or all of positions B1-4 and B26-30.
- Insulin peptides as defined herein can also be analogs derived from a naturally occurring insulin by insertion or substitution of a non-peptide moiety, e.g. a retroinverso fragment, or incorporation of non-peptide bonds such as an azapeptide bond (CO substituted by NH) or pseudo-peptide bond (e.g. NH substituted with CH 2 ) or an ester bond (e.g., a depsipeptide, wherein one or more of the amide (—CONHR—) bonds are replaced by ester (COOR) bonds).
- a non-peptide moiety e.g. a retroinverso fragment
- non-peptide bonds such as an azapeptide bond (CO substituted by NH) or pseudo-peptide bond (e.g. NH substituted with CH 2 ) or an ester bond (e.g., a depsipeptide, wherein one or more of the amide (—CONHR—) bonds are replaced by ester (COOR) bonds
- An “A19 insulin analog” is an insulin peptide that has a substitution of 4-amino phenylalanine or 4-methoxy phenylalanine for the native tyrosine residue at position 19 of the A chain of native insulin.
- an “IGF B161317 analog peptide” is a generic term that comprising an A chain and B chain heteroduplex, as well as single-chain insulin analogs thereof, wherein the A chain comprises the peptide sequence of SEQ ID NO: 19 and the B chain comprises the sequence of SEQ ID NO: 20 as well as analogs of those sequences wherein the analog of the A chain and/or B chain comprise 1-3 further amino acid substitutions, with the proviso that the B chain does not comprise the sequence of SEQ ID NO: 2 and comprises a tyrosine at position B16 and a leucine at position B17.
- IGF YL analog is a peptide comprising an IGF A chain of SEQ ID NO: 19 and an IGF B chain of SEQ ID NO: 36.
- single-chain insulin analog encompasses a group of structurally-related proteins wherein insulin or IGF A and B chains, or analogs or derivatives thereof, are covalently linked to one another to form a linear polypeptide chain.
- the single-chain insulin analog comprises the covalent linkage of the carboxy terminus of the B chain to the amino terminus of the A chain via a linking moiety.
- insulin A chain absent further descriptive language is intended to encompass the 21 amino acid sequence of SEQ ID NO: 1 as well as functional analogs and derivatives thereof, including the A chain of A19 insulin analogs and other analogs known to those skilled in the art, including modification of the sequence of SEQ ID NO: 1 by one or more amino acid insertions, deletions or substitutions at positions selected from A4, A5, A8, A9, A10, A12, A14, A15, A17, A18, A21.
- insulin B chain absent further descriptive language is intended to encompass the 30 amino acid sequence of SEQ ID NO: 2, as well as modified functional analogs of the native B chain, including modification of the amino acid at position B16 or B25 to a 4-amino phenylalanine or one or more amino acid insertions, deletions or substitutions at positions selected from B1, B2, B3, B4, B5, B9, B10, B13, B14, B17, B20, B21, B22, B23, B25, B26, B27, B28, B29 and B30 or deletions of any or all of positions B1-4 and B26-30.
- identity as used herein relates to the similarity between two or more sequences. Identity is measured by dividing the number of identical residues by the total number of residues and multiplying the product by 100 to achieve a percentage. Thus, two copies of exactly the same sequence have 100% identity, whereas two sequences that have amino acid deletions, additions, or substitutions relative to one another have a lower degree of identity.
- BLAST Basic Local Alignment Search Tool, Altschul et al. (1993) J. Mol. Biol. 215:403-410) are available for determining sequence identity.
- glucagon related peptide refers to those peptides which have biological activity (as agonists or antagonists) at any one or more of the glucagon, GLP-1, GLP-2, and GIP receptors and comprise an amino acid sequence that shares at least 40% sequence identity (e.g., 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%) with at least one of native glucagon, native oxyntomodulin, native exendin-4, native GLP-1, native GLP-2, or native GIP.
- any reference to an amino acid position in a glucagon related peptide e.g. for linkage of a prodrug moiety, a conjugate moiety, a hydrophilic polymer, acylation or alkylation refers to the position relative to the native glucagon amino acid sequence (SEQ ID NO: 701).
- C-terminal region of a glucagon related peptide is intended to encompass the native C-terminus of a glucagon peptide or any amino acid of a C-terminal extension of a glucagon analog that has been extended by the addition of one or more amino acids at the C-terminus, or the terminal amino acid of a glucagon analog that has been shortened by the deletion of one or more amino acids, respectively, relative to the native glucagon sequence.
- An insulin peptide conjugated at the C-terminal region of a glucagon related peptide is intended to include linkage to the side chain of an amino acid of the C-terminal region or linkage through the C-terminal carboxylic acid moiety.
- GLP-1 agonist refers to a compound that stimulates GLP-1 receptor activity, as measured by cAMP production using a validated in vitro model assay, such as that described in Example 13 of published International Application No. WO 2007/056362, published on May 18, 2007, the disclosure of which is hereby expressly incorporated by reference into the present application.
- glucagon refers to a peptide consisting of the sequence of SEQ ID NO: 701
- native GIP refers to a peptide consisting of the sequence of SEQ ID NO: 707
- native GLP-1 is a generic term that designates GLP-1(7-36) amide (consisting of the sequence of SEQ ID NO: 703), GLP-1(7-37) acid (consisting of the sequence of SEQ ID NO: 704) or a mixture of those two compounds.
- GIP GLP-1(7-37) acid
- glucagon peptide is a generic term that designates the natural glucagon peptide of SEQ ID NO: 701 as well as modified derivatives having one or more amino acid modifications relative to the native glucagon sequence, optionally including but not limited to substitutions at amino acid positions 1, 2, 5, 7, 8, 10, 12, 13, 14, 16, 17, 18, 24, 28 and 29.
- all references to a particular amino acid position by number refer to the amino acid at that position in native glucagon (SEQ ID NO: 701) or the corresponding amino acid position in any analogs thereof.
- a reference to “position 28” would mean the corresponding position 27 for a glucagon analog in which the first amino acid of SEQ ID NO: 701 has been deleted.
- a reference to “position 28” would mean the corresponding position 29 for a glucagon analog in which one amino acid has been added before the N-terminus of SEQ ID NO: 701.
- GLP-1 peptide is a generic term that designates native GLP-1 as well as modified derivatives having one or more amino acid modifications relative to the native GLP-1 sequence.
- derivative is intended to encompass chemical modification to a compound (e.g., an amino acid), including chemical modification in vitro, e.g. by introducing a group in a side chain in one or more positions of a polypeptide, e.g. a nitro group in a tyrosine residue, or iodine in a tyrosine residue, or by conversion of a free carboxylic group to an ester group or to an amide group, or by converting an amino group to an amide by acylation, or by acylating a hydroxy group rendering an ester, or by alkylation of a primary amine rendering a secondary amine or linkage of a hydrophilic moiety to an amino acid side chain.
- Other derivatives are obtained by oxidation or reduction of the side-chains of the amino acid residues in the polypeptide.
- IGF A chain absent further descriptive language is intended to encompass the 21 amino acid sequence of native IGF 1 or IGF 2 (SEQ ID NOs: 5 and 7 respectively), as well as functional analogs thereof known to those skilled in the art, including modification of the sequence of SEQ ID NO: 5 and 7 by one or more amino acid substitutions at positions selected from A5, A8, A9, A10, A12, A14, A15, A17, A18, A21.
- IGF YL B chain is intended to encompass an amino acid sequence comprising SEQ ID NO: 20, as well as analogs of the IGF YL B chain and derivatives thereof, including modification of the amino acid at position B16 or B25 to a 4-amino phenylalanine or one or more amino acid substitutions at positions selected from B1, B2, B3, B4, B5, B9, B10, B13, B14, B17, B20, B21, B22, B23, B26, B27, B28, B29 and B30 or deletions of any or all of positions B1-4 and B26-30.
- the term “selectivity” of a molecule for a first receptor relative to a second receptor refers to the following ratio: EC 50 of the molecule at the second receptor divided by the EC 50 of the molecule at the first receptor. For example, a molecule that has an EC 50 of 1 nM at a first receptor and an EC 50 of 100 nM at a second receptor has 100-fold selectivity for the first receptor relative to the second receptor.
- an amino acid “modification” refers to a substitution of an amino acid, or the derivation of an amino acid by the addition and/or removal of chemical groups to/from the amino acid, and includes substitution with any of the 20 amino acids commonly found in human proteins, as well as atypical or non-naturally occurring amino acids.
- Commercial sources of atypical amino acids include Sigma-Aldrich (Milwaukee, Wis.), ChemPep Inc. (Miami, Fla.), and Genzyme Pharmaceuticals (Cambridge, Mass.).
- Atypical amino acids may be purchased from commercial suppliers, synthesized de novo, or chemically modified or derivatized from naturally occurring amino acids.
- substitution refers to the replacement of one amino acid residue by a different amino acid residue.
- polyethylene glycol chain refers to mixtures of condensation polymers of ethylene oxide and water, in a branched or straight chain, represented by the general formula H(OCH 2 CH 2 ) n OH, wherein n is at least 2.
- Polyethylene glycol chain” or “PEG chain” is used in combination with a numeric suffix to indicate the approximate average molecular weight thereof. For example, PEG-5,000 refers to polyethylene glycol chain having a total molecular weight average of about 5,000 Daltons.
- pegylated refers to a compound that has been modified from its native state by linking a polyethylene glycol chain to the compound.
- a “pegylated polypeptide” is a polypeptide that has a PEG chain covalently bound to the polypeptide.
- linker is a bond, molecule or group of molecules that binds two separate entities to one another. Linkers may provide for optimal spacing of the two entities or may further supply a labile linkage that allows the two entities to be separated from each other. Labile linkages include photocleavable groups, acid-labile moieties, base-labile moieties and enzyme-cleavable groups.
- a “dimer” is a complex comprising two subunits covalently bound to one another via a linker.
- dimer when used absent any qualifying language, encompasses both homodimers and heterodimers.
- a homodimer comprises two identical subunits, whereas a heterodimer comprises two subunits that differ, although the two subunits are substantially similar to one another.
- C 1 -C n alkyl wherein n can be from 1 through 6, as used herein, represents a branched or linear alkyl group having from one to the specified number of carbon atoms.
- Typical C 1 -C 6 alkyl groups include, but are not limited to, methyl, ethyl, n-propyl, iso-propyl, butyl, iso-Butyl, sec-butyl, tert-butyl, pentyl, hexyl and the like.
- C 2 -C n alkenyl wherein n can be from 2 through 6, as used herein, represents an olefinically unsaturated branched or linear group having from 2 to the specified number of carbon atoms and at least one double bond.
- groups include, but are not limited to, 1-propenyl, 2-propenyl (—CH 2 —CH ⁇ CH 2 ), 1,3-butadienyl, (—CH ⁇ CHCH ⁇ CH 2 ), 1-butenyl (—CH ⁇ CHCH 2 CH 3 ), hexenyl, pentenyl, and the like.
- C 2 -C n alkynyl wherein n can be from 2 to 6, refers to an unsaturated branched or linear group having from 2 to n carbon atoms and at least one triple bond. Examples of such groups include, but are not limited to, 1-propynyl, 2-propynyl, 1-butynyl, 2-butynyl, 1-pentynyl, and the like.
- aryl refers to a mono- or bicyclic carbocyclic ring system having one or two aromatic rings including, but not limited to, phenyl, naphthyl, tetrahydronaphthyl, indanyl, indenyl, and the like.
- the size of the aryl ring and the presence of substituents or linking groups are indicated by designating the number of carbons present.
- (C 1 -C 3 alkyl)(C 6 -C 10 aryl) refers to a 5 to 10 membered aryl that is attached to a parent moiety via a one to three membered alkyl chain.
- heteroaryl refers to a mono- or bi-cyclic ring system containing one or two aromatic rings and containing at least one nitrogen, oxygen, or sulfur atom in an aromatic ring.
- the size of the heteroaryl ring and the presence of substituents or linking groups are indicated by designating the number of carbons present.
- (C 1 -C n alkyl)(C 5 -C 6 heteroaryl) refers to a 5 or 6 membered heteroaryl that is attached to a parent moiety via a one to “n” membered alkyl chain.
- halo refers to one or more members of the group consisting of fluorine, chlorine, bromine, and iodine.
- patient without further designation is intended to encompass any warm blooded vertebrate domesticated animal (including for example, but not limited to livestock, horses, cats, dogs and other pets) and humans.
- isolated means having been removed from its natural environment.
- the analog is made through recombinant methods and the analog is isolated from the host cell.
- purified relates to the isolation of a molecule or compound in a form that is substantially free of contaminants normally associated with the molecule or compound in a native or natural environment and means having been increased in purity as a result of being separated from other components of the original composition.
- purified polypeptide is used herein to describe a polypeptide which has been separated from other compounds including, but not limited to nucleic acid molecules, lipids and carbohydrates.
- a “peptidomimetic” refers to a chemical compound having a structure that is different from the general structure of an existing peptide, but that functions in a manner similar to the existing peptide, e.g., by mimicking the biological activity of that peptide.
- Peptidomimetics typically comprise naturally-occurring amino acids and/or unnatural amino acids, but can also comprise modifications to the peptide backbone.
- a peptidomimetic may include a sequence of naturally-occurring amino acids with the insertion or substitution of a non-peptide moiety, e.g. a retroinverso fragment, or incorporation of non-peptide bonds such as an azapeptide bond (CO substituted by NH) or pseudo-peptide bond (e.g.
- the peptidomimetic may be devoid of any naturally-occurring amino acids.
- charged amino acid or “charged residue” refers to an amino acid that comprises a side chain that is negatively charged (i.e., de-protonated) or positively charged (i.e., protonated) in aqueous solution at physiological pH.
- negatively charged amino acids include aspartic acid, glutamic acid, cysteic acid, homocysteic acid, and homoglutamic acid
- positively charged amino acids include arginine, lysine and histidine.
- Charged amino acids include the charged amino acids among the 20 amino acids commonly found in human proteins, as well as atypical or non-naturally occurring amino acids.
- acidic amino acid refers to an amino acid that comprises a second acidic moiety (other than the alpha carboxylic acid of the amino acid), including for example, a side chain carboxylic acid or sulfonic acid group.
- patient without further designation is intended to encompass any warm blooded vertebrate domesticated animal (including for example, but not limited to livestock, horses, cats, dogs and other pets), mammals, and humans.
- Insulin analogs will be abbreviated as follows:
- the insulin A and B chains will be designated by a capital A for the A chain and a capital B for the B chain wherein a superscript 0 (e.g., A 0 or B 0 ) will designate the base sequence is an insulin sequence (A chain: SEQ ID NO: 1, B chain SEQ ID NO: 2) and a superscript 1 (e.g., A 1 or B 1 ) will designate the base sequence is an IGF-1 sequence (A chain: SEQ ID NO: 5, B chain SEQ ID NO: 6).
- a superscript 0 e.g., A 0 or B 0
- a superscript 1 e.g., A 1 or B 1
- Modifications that deviate from the native insulin and IGF sequence are indicated in parenthesis following the designation of the A or B chain (e.g., [B 1 (H5,H10,Y16,L17): A 1 (H8,N18,N21)]) with the single letter amino acid abbreviation indicating the substitution and the number indicating the position of the substitution in the respective A or B chain, using native insulin numbering.
- a colon between the A and B chain indicates a two chain insulin whereas a dash will indicate a covalent bond and thus a single chain analog.
- a linking moiety will be included between the A and B chains and the designation C 1 refers to the native IGF 1 C peptide, SEQ ID NO: 17.
- the designation “position C8” in reference to the linking moiety designates an amino acid located at the position corresponding to the eighth amino acid of SEQ ID NO: 17.
- conjugates of an insulin peptide and a glucagon related peptide comprises a covalent linkage of the insulin peptide and the glucagon related peptide either directly or through a linker.
- the glucagon related peptide is covalently linked to the amino or carboxy terminus of the insulin A chain or B chain.
- the C-terminal region of one or two glucagon related peptides are covalently linked to the insulin peptide through a position independently selected from the side chain of an amino acid at a position selected from the group consisting of A9, A14 and A15 of the A chain, positions B1, B2, B10, B22, B28 or B29 of the B chain, at the N-terminal alpha amine of the A or B chain, the carboxy terminus of the B chain or at the side chain of an amino acid at any position of a linking moiety that links the A chain and B chain in a single chain insulin analog, including for example at position C8.
- the N-terminus or C-terminus of an insulin peptide is covalently linked to the side chain of an amino acid of the glucagon related peptide at a position selected from 10, 20, 24, 28 and 29.
- one or two glucagon related peptides are covalently linked to the insulin peptide through a position independently selected from the N-terminal alpha amine of the B chain, the carboxy terminus of the B chain or at any position of the linking moiety that links the A chain and B chain of a single chain insulin analog, including for example at position C8.
- the carboxy terminal region of the glucagon related peptide is covalently linked to the N-terminal alpha amine of the B chain of a single chain insulin peptide analog.
- the carboxy terminus of the glucagon related peptide is covalently linked to the N-terminal alpha amine of the B chain of a two chain or single chain insulin peptide analog.
- the insulin peptide is a two chain insulin, wherein the A chain and B chain are linked to one another via interchain disulfide bonds.
- the conjugate comprises a two chain insulin peptide wherein the carboxy terminal region of the glucagon related peptide is covalently linked to the amino terminus of the A chain of the insulin peptide.
- the conjugate comprises a two chain insulin peptide wherein the carboxy terminus of the A chain or the B chain of the insulin peptide is covalently linked to the amino terminus of the glucagon related peptide.
- the conjugate comprises a two chain insulin peptide wherein the carboxy terminus of the glucagon related peptide is covalently linked to the amino terminus of the B chain of the insulin peptide. In one embodiment the conjugate comprises a two chain insulin peptide wherein the carboxy terminus of the B chain of the insulin peptide is covalently linked to the amino terminus of the glucagon related peptide.
- the conjugate comprises a two chain insulin analog and a first and second glucagon related peptide wherein each glucagon related peptide is independently covalently linked to the insulin peptide at a position selected from the group consisting of the amino terminus of the B chain, the carboxy terminus of the A chain, and the carboxy terminus of the B chain.
- the conjugate comprises a two chain insulin peptide wherein the carboxy terminal region of a first glucagon related peptide is covalently linked to the amino terminus of the B chain of the insulin peptide and the carboxy terminus of the B chain of the insulin peptide is covalently linked to the amino terminus of a second glucagon related peptide.
- first and second glucagon related peptides are different and have activity at two different receptors selected from the group consisting of the glucagon, GLP-1 and GIP receptors.
- first glucagon related peptide has activity at the glucagon receptor and the second glucagon related peptide has activity at the GLP-1 receptor.
- first and/or second glucagon related peptide is a coagonist having activity at two receptors selected from the group consisting of the glucagon, GLP-1 and GIP receptors.
- the conjugate represents a fusion protein wherein the carboxy terminal region of the glucagon related peptide is linked to the amino terminus of the insulin peptide B chain either directly or through a peptide linker.
- the conjugate comprises a single chain insulin analog wherein the carboxy terminal region of the glucagon related peptide is covalently linked to the amino terminus of the single chain insulin analog.
- the conjugate comprises a single chain insulin analog wherein the carboxy terminus of the single chain insulin peptide is covalently linked to the amino terminus of the glucagon related peptide.
- the insulin peptide of the presently disclosed conjugate is native insulin, comprising the A chain of SEQ ID NO: 1 and the B chain of SEQ ID NO: 2, or an analog of native insulin, including for example a single-chain insulin analog comprising SEQ ID NOS: 1 and 2.
- the insulin peptide is an IGF B16B17 analog peptide.
- analogs of insulin encompass polypeptides comprising an A chain and a B chain wherein the insulin analogs differ from native insulin by one or more amino acid substitutions at positions selected from A5, A8, A9, A10, A12, A14, A15, A17, A18, A21, B1, B2, B3, B4, B5, B9, B10, B13, B14, B17, B20, B21, B22, B23, B26, B27, B28, B29 and B30 or deletions of any or all of positions B1-4 and B26-30.
- the glucagon related peptide component of the conjugate is a peptide selected from the group consisting of native glucagon (SEQ ID NO: 701), native GLP-1 (SEQ ID NO: 703) and native GIP (SEQ ID NO: 707).
- the glucagon related peptide is a glucagon peptide or GLP-1 peptide.
- the glucagon related peptide of the conjugate of the present disclosures is an analog of native human glucagon (SEQ ID NO: 701) comprising an amino acid sequence based on the amino acid sequence of SEQ ID NO: 701 but differing from SEQ ID NO: 701 inasmuch as the amino acid sequence of the glucagon analog comprises one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, and in some instances, 16 or more (e.g., 17, 18, 19, 20, 21, 22, 23, 24, 25, etc.), specified or optional amino acid modifications.
- SEQ ID NO: 701 native human glucagon
- the amino acid sequence of the glucagon analog comprises one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, and in some instances, 16 or more (e.g., 17, 18, 19, 20, 21, 22, 23, 24, 25, etc.), specified or optional amino acid modifications.
- the peptide of the present disclosures comprises a total of 1, up to 2, up to 3, up to 4, up to 5, up to 6, up to 7, up to 8, up to 9, or up to 10 additional amino acid modifications (e.g., in addition to the specified amino acid modifications), relative to the native human glucagon sequence (SEQ ID NO: 701).
- an analog of glucagon comprises (a) an amino acid comprising an imidazole side chain at position 1, (b) an DPP-IV protective amino acid at position 2, (c) an acylated amino acid or alkylated amino acid at any of positions 9, 10, 12, 16, 20, or 37-43, (d) an alpha helix stabilizing amino acid at one or more of positions 16, 17, 18, 19, 20, and 21, and (e) up to ten additional amino acid modifications relative to SEQ ID NO: 701.
- the present disclosure provides an analog of glucagon comprising (a)-(d) with up to 10 additional amino acid modifications in addition to the amino acid modifications specified in (a)-(d).
- the modifications are any of those described herein, e.g., acylation, alkylation, pegylation, truncation at C-terminus, substitution of the amino acid at one or more of positions 1, 2, 3, 7, 10, 12, 15, 16, 17, 18, 19, 20, 21, 23, 24, 27, 28, and 29.
- the insulin peptide component of the conjugates of the present disclosure may comprise the native B and A chain sequences of human insulin (SEQ ID NOs: 1 and 2, respectively) or any of the known analogs or derivatives thereof that exhibit insulin agonist activity when linked to one another in a heteroduplex.
- Such analogs include, for example, proteins having an A-chain and a B-chain that differ from the A-chain and B-chain of human insulin by having one or more amino acid deletions, one or more amino acid substitutions, and/or one or more amino acid insertions that do not destroy the insulin activity of the insulin analog.
- amino acid residue at position B28 is substituted with Asp, Lys, Leu, Val, or Ala, and the amino acyl residue at position B29 is Lys or Pro;
- an insulin analog comprising an Asp substituted at position B28 or a Lys substituted at position 28 and a proline substituted at position B29. Additional insulin analogs are disclosed in Chance, et al., U.S. Pat. No. 5,514,646; Chance, et al., U.S. patent application Ser. No. 08/255,297; Brems, et al., Protein Engineering, 5:527-533 (1992); Brange, et al., EPO Publication No. 214,826 (published Mar. 18, 1987); and Brange, et al., Current Opinion in Structural Biology, 1:934-940 (1991). The disclosures of which are expressly incorporated herein by reference.
- Insulin analogs may also have replacements of the amidated amino acids with acidic forms.
- Asn may be replaced with Asp or Glu.
- Gln may be replaced with Asp or Glu.
- Asn(A18), Asn(A21), or Asp(B3), or any combination of those residues may be replaced by Asp or Glu.
- Gln(A15) or Gln(B4), or both, may be replaced by either Asp or Glu.
- single chain insulin agonists comprising a B chain and an A chain of human insulin, or analogs or derivative thereof, wherein the carboxy terminus of the B chain is linked to the amino terminus of the A chain via a linking moiety.
- the A chain is an amino acid sequence selected from the group consisting of GIVEQCCTSICSLYQLENYCN (SEQ ID NO: 1), GIVDECCFRSCDLRRLEMYCA (SEQ ID NO: 5) or GIVEECCFRSCDLALLETYCA (SEQ ID NO: 7) and the B chain comprises the sequence FVNQHLCGSHLVEALYLVCGERGFFYTPKT (SEQ ID NO: 2), GPETLCGAELVDALYLVCGDRGFYFNKPT (SEQ ID NO: 6) or AYRPSETLCGGELVDTLYLVCGDRGFYFSRPA (SEQ ID NO: 8), or a carboxy shortened sequence thereof having one to five amino acids corresponding to B26, B27, B28, B29 and
- amino acid substitutions are conservative amino acid substitutions. Suitable amino acid substitutions at these positions that do not adversely impact insulin's desired activities are known to those skilled in the art, as demonstrated, for example, in Mayer, et al., Insulin Structure and Function, Biopolymers. 2007; 88(5):687-713, the disclosure of which is incorporated herein by reference.
- Additional amino acid sequences can be added to the amino terminus of the B chain or to the carboxy terminus of the A chain of the single chain insulin agonists of the present invention.
- a series of negatively charged amino acids can be added to the amino terminus of the B chain, including for example a peptide of 1 to 12, 1 to 10, 1 to 8 or 1 to 6 amino acids in length and comprising one or more negatively charged amino acids including for example glutamic acid and aspartic acid.
- the B chain amino terminal extension comprises 1 to 6 charged amino acids.
- the B chain amino terminal extension comprises the sequence GX 61 X 62 X 63 X 64 X 65 K (SEQ ID NO: 26) or X 61 X 62 X 63 X 64 X 65 RK (SEQ ID NO: 27), wherein X 61 , X 62 , X 63 X 64 and X 65 are independently glutamic acid or aspartic acid.
- the B chain comprises the sequence GEEEEEKGPEHLCGAHLVDALYLVCGDX 42 GFY (SEQ ID NO: 28), wherein X 42 is selected from the group consisting of alanine lysine, ornithine and arginine.
- the glucagon related peptide-insulin conjugates disclosed herein comprise a C-terminal amide or ester in place of a C-terminal carboxylate on the A chain.
- High potency glucagon related peptide-insulin conjugates can also be prepared based on using a modified IGF I and IGF II sequence described in published International application no. WO 2010/080607, the disclosure of which is expressly incorporated herein by reference, as the insulin peptide component. More particularly, analogs of IGF I and IGF II that comprise a substitution of a tyrosine leucine dipeptide for the native IGF amino acids at positions corresponding to B16 and B17 of native insulin have a tenfold increase in potency at the insulin receptor.
- the insulin peptide for use in the present disclosure comprises a B chain sequence of R 22 -X 25 LCGX 29 X 30 LVX 33 X 34 LYLVCGX 41 X 42 GFX 45 (SEQ ID NO: 20) and an A chain sequence of GIVX 4 X 5 CCX 8 X 9 X 10 CX 12 LX 14 X 15 LX 17 X 18 X 19 CX 21 -R 13 (SEQ ID NO: 29) wherein
- X 4 is glutamic acid or aspartic acid
- X 5 is glutamine or glutamic acid
- X 8 is histidine, threonine or phenylalanine
- X 9 is serine, arginine, lysine, ornithine or alanine
- X 10 is isoleucine or serine
- X 12 is serine or aspartic acid
- X 14 is tyrosine, arginine, lysine, ornithine or alanine;
- X 15 is glutamine, glutamic acid, arginine, alanine, lysine, ornithine or leucine;
- X 17 is glutamine, glutamic acid, arginine, aspartic acid or lysine, ornithine
- X 18 is methionine, asparagine, glutamine, aspartic acid, glutamic acid or threonine;
- X 19 is tyrosine, 4-methoxy-phenylalanine or 4-amino phenylalanine;
- X 21 is selected from the group consisting of alanine, glycine, serine, valine, threonine, isoleucine, leucine, glutamine, glutamic acid, asparagine, aspartic acid, histidine, tryptophan, tyrosine, and methionine;
- X 25 is histidine or threonine
- X 29 is selected from the group consisting of alanine, glycine and serine;
- X 30 is selected from the group consisting of histidine, aspartic acid, glutamic acid, homocysteic acid and cysteic acid;
- X 33 is selected from the group consisting of aspartic acid, glutamine and glutamic acid;
- X 34 is selected from the group consisting of alanine and threonine
- X 41 is selected from the group consisting of glutamic acid, aspartic acid or asparagine;
- X 42 is selected from the group consisting of alanine, lysine, ornithine and arginine;
- X 45 is tyrosine, histidine, asparagine or phenylalanine
- R 22 is selected from the group consisting of AYRPSE (SEQ ID NO: 14), FVNQ (SEQ ID NO: 12), PGPE (SEQ ID NO: 11), a tripeptide glycine-proline-glutamic acid, a tripeptide valine-asparagine-glutamine, a dipeptide proline-glutamic acid, a dipeptide asparagine-glutamine, glutamine, glutamic acid and a bond; and R 13 is COOH or CONH 2 .
- the A chain and the B chain are linked to one another by interchain disulfide bonds, including those that form between the A and B chains of native insulin.
- the A and B chains are linked together as a linear single chain-insulin peptide.
- the conjugates comprise an insulin peptide wherein the A chain comprises a sequence of GIVEQCCX 1 SICSLYQLENX 2 CX 3 (SEQ ID NO: 30) and said B chain sequence comprises a sequence of X 4 LCGX 5 X 6 LVEALYLVCGERGFF (SEQ ID NO: 31), wherein
- X 1 is selected from the group consisting of threonine and histidine;
- X 2 is tyrosine, 4-methoxy-phenylalanine or 4-amino phenylalanine;
- X 3 is selected from the group consisting of asparagine and glycine
- X 4 is selected from the group consisting of histidine and threonine
- X 5 is selected from the group consisting of alanine, glycine and serine;
- X 6 is selected from the group consisting of histidine, aspartic acid, glutamic acid, homocysteic acid and cysteic acid.
- an insulin analog wherein the A chain of the insulin peptide comprises the sequence GIVEQCCX 8 X 9 ICSLYQLENYCX 21 -R 13 (SEQ ID NO: 73) or GIVEQCCX 8 SICSLYQLX 17 NX 19 CX 21 (SEQ ID NO: 32) and the B chain comprising the sequence R 22 -X 25 LCGX 29 X 30 LVX 33 X 34 LYLVCGX 41 X 42 GFX 45 YT-Z 1 -B 1 (SEQ ID NO: 142), wherein
- X 8 is selected from the group consisting of threonine and histidine;
- X 9 is valine or tyrosine
- X 17 is glutamine or glutamic acid
- X 19 is tyrosine, 4-methoxy phenylalanine or 4-amino-phenylalanine;
- X 21 is asparagine or glycine
- X 25 is histidine or threonine
- X 29 is selected from the group consisting of alanine, glycine and serine;
- X 30 is selected from the group consisting of histidine, aspartic acid, glutamic acid, homocysteic acid and cysteic acid;
- X 33 is selected from the group consisting of aspartic acid and glutamic acid;
- X 34 is selected from the group consisting of alanine and threonine
- X 41 is selected from the group consisting of glutamic acid, aspartic acid or asparagine;
- X 42 is selected from the group consisting of alanine, ornithine, lysine and arginine;
- X 45 is tyrosine or phenylalanine
- R 22 is selected from the group consisting of FVNQ (SEQ ID NO: 12), a tripeptide valine-asparagine-glutamine, a dipeptide asparagine-glutamine, glutamine and an N-terminal amine
- Z 1 is a dipeptide selected from the group consisting of aspartate-lysine, lysine-proline, and proline-lysine;
- B 1 is selected from the group consisting of threonine, alanine or a threonine-arginine-arginine tripeptide.
- an insulin analog wherein the A chain of the insulin peptide comprises the sequence GIVEQCCX 8 SICSLYQLX 17 NX 19 CX 21 (SEQ ID NO: 32) and the B chain comprising the sequence
- X 8 is selected from the group consisting of threonine and histidine;
- X 17 is glutamic acid or glutamine
- X 19 is tyrosine, 4-methoxy-phenylalanine or 4-amino phenylalanine;
- X 21 is asparagine or glycine
- X 25 is selected from the group consisting of histidine and threonine
- X 29 is selected from the group consisting of alanine, glycine and serine;
- X 30 is selected from the group consisting of histidine, aspartic acid, glutamic acid, homocysteic acid and cysteic acid.
- the B chain comprises the sequence X 22 VNQX 25 LCGX 29 X 30 LVEALYLVCGERGFFYT-Z 1 -B 1 (SEQ ID NO: 34)
- X 22 is selected from the group consisting of phenylalanine and desamino-phenylalanine;
- X 25 is selected from the group consisting of histidine and threonine
- X 29 is selected from the group consisting of alanine, glycine and serine;
- X 30 is selected from the group consisting of histidine, aspartic acid, glutamic acid, homocysteic acid and cysteic acid;
- Z 1 is a dipeptide selected from the group consisting of aspartate-lysine, lysine-proline, and proline-lysine;
- B 1 is selected from the group consisting of threonine, alanine or a threonine-arginine-arginine tripeptide.
- the A chain comprises the sequence GIVEQCCX 8 SICSLYQLX 17 NX 19 CX 23 (SEQ ID NO: 32) or GIVDECCX 8 X 9 SCDLX 14 X 15 LX 17 X 18 X 19 CX 21 -R 13 (SEQ ID NO: 35), and the B chain comprises the sequence X 25 LCGX 29 X 30 LVX 33 X 34 LYLVCGDX 42 GFX 45 (SEQ ID NO: 36)
- X 8 is histidine or phenylalanine
- X 9 and X 14 are independently selected from arginine, lysine, ornithine or alanine;
- X 15 is arginine, lysine, ornithine or leucine
- X 17 is glutamic acid or glutamine
- X 18 is methionine, asparagine or threonine
- X 19 is tyrosine, 4-methoxy-phenylalanine or 4-amino phenylalanine;
- X 21 is alanine, glycine or asparagine
- X 23 is asparagine or glycine
- X 25 is selected from the group consisting of histidine and threonine
- X 29 is selected from the group consisting of alanine, glycine and serine;
- X 30 is selected from the group consisting of histidine, aspartic acid, glutamic acid, homocysteic acid and cysteic acid;
- X 33 is selected from the group consisting of aspartic acid and glutamic acid;
- X 34 is selected from the group consisting of alanine and threonine
- X 42 is selected from the group consisting of alanine, lysine, ornithine and arginine;
- X 45 is tyrosine
- R 13 is COOH or CONH 2 .
- the A chain comprises the sequence GIVDECCX 8 X 9 SCDLX 14 X 15 LX 17 X 18 X 19 CX 21 -R 13 (SEQ ID NO: 35), and the B chain comprises the sequence X 25 LCGX 29 X 30 LVX 33 X 34 LYLVCGDX 42 GFX 45 (SEQ ID NO: 36)
- X 8 is histidine
- X 9 and X 14 are independently selected from arginine, lysine, ornithine or alanine;
- X 15 is arginine, lysine, ornithine or leucine
- X 17 is glutamic acid, aspartic acid, asparagine, lysine, ornithine or glutamine;
- X 18 is methionine, asparagine or threonine
- X 19 is tyrosine, 4-methoxy-phenylalanine or 4-amino phenylalanine;
- X 21 is alanine, glycine or asparagine
- X 23 is asparagine or glycine
- X 25 is selected from the group consisting of histidine and threonine
- X 29 is selected from the group consisting of alanine, glycine and serine;
- X 30 is selected from the group consisting of histidine, aspartic acid, glutamic acid, homocysteic acid and cysteic acid;
- X 33 is selected from the group consisting of aspartic acid and glutamic acid;
- X 34 is selected from the group consisting of alanine and threonine
- X 42 is selected from the group consisting of alanine, lysine, ornithine and arginine;
- X 45 is tyrosine or phenylalanine
- R 13 is COOH or CONH 2 .
- the A chain comprises the sequence GIVDECCHX 9 SCDLX 14 X 15 LX 17 MX 19 CX 21 -R 13 (SEQ ID NO: 37), and the B chain comprises the sequence X 25 LCGAX 30 LVDALYLVCGDX 42 GFX 45 (SEQ ID NO: 38)
- X 9 , X 14 and X 15 are independently ornithine, lysine or arginine;
- X 17 is glutamic acid or glutamine
- X 19 is tyrosine, 4-methoxy-phenylalanine or 4-amino phenylalanine;
- X 21 is alanine, glycine or asparagine
- X 25 is selected from the group consisting of histidine and threonine
- X 30 is selected from the group consisting of histidine, aspartic acid and glutamic acid;
- X 42 is selected from the group consisting of alanine, lysine, ornithine and arginine;
- X 45 is tyrosine or phenylalanine
- R 13 is COOH or CONH 2 .
- the B chain is selected from the group consisting of HLCGAELVDALYLVCGDX 42 GFY (SEQ ID NO: 39), GPEHLCGAELVDALYLVCGDX 42 GFY (SEQ ID NO: 40), GPEHLCGAELVDALYLVCGDX 42 GFYFNPKT (SEQ ID NO: 41) and GPEHLCGAELVDALYLVCGDX 42 GFYFNKPT (SEQ ID NO: 42), wherein X 42 is selected from the group consisting of ornithine, lysine and arginine.
- the A chain comprises the sequence GIVDECCHX 9 SCDLX 14 X 15 LQMYCN-R 13 (SEQ ID NO: 43), wherein X 9 , X 14 and X 15 are independently ornithine, lysine or arginine.
- the A chain comprises the sequence GIVDECCX 8 RSCDLYQLENX 19 CN-R 13 (SEQ ID NO: 44) and the B chain comprises the sequence R 22 -X 25 LCGSHLVDALYLVCGDX 42 GFX 45 (SEQ ID NO: 45)
- X 8 is threonine, histidine or phenylalanine
- X 19 is tyrosine, 4-methoxy-phenylalanine or 4-amino phenylalanine;
- X 25 is histidine or threonine
- X 42 is alanine, ornithine or arginine
- X 45 is tyrosine histidine, asparagine or phenylalanine
- R 22 is selected from the group consisting of AYRPSE (SEQ ID NO: 14), FVNQ (SEQ ID NO: 12), PGPE (SEQ ID NO: 11), a tripeptide glycine-proline-glutamic acid, a tripeptide valine-asparagine-glutamine, a dipeptide proline-glutamic acid, a dipeptide asparagine-glutamine, glutamine, glutamic acid and a bond; and R 13 is COOH or CONH 2 . and
- R 13 is COOH or CONH 2 .
- the A chain comprises the sequence GIVEQCCHSICSLYQLENX 19 CX 21 -R 13 (SEQ ID NO: 46) or GIVDECCHRSCDLRRLEMX 19 CX 21 -R 13 (SEQ ID NO: 47); and the B chain comprises the sequence FVNQHLCGSHLVEALYLVCGERGFFYTPKT (SEQ ID NO: 2), or GPETLCGAELVDALYLVCGDRGFYFNPKT (SEQ ID NO: 48)
- X 19 is tyrosine, 4-methoxy phenylalanine or 4-amino-phenylalanine;
- X 21 is alanine, glycine or asparagine
- X 26 and X 27 are each alanine
- X 42 is arginine.
- linking moieties can be used to link human insulin A and B chains, or analogs or derivatives thereof, wherein the carboxy terminus of the B25 amino acid of the B chain is directly linked to a first end of a linking moiety, wherein the second end of the linking moiety is directly linked to the amino terminus of the A1 amino acid of the A chain via the intervening linking moiety.
- the insulin peptide is a single chain insulin agonist that comprises the general structure B-LM-A wherein B represents an insulin B chain, A represents an insulin A chain, and LM represents a linking moiety linking the carboxy terminus of the B chain to the amino terminus of the A chain.
- Suitable linking moieties for joining the B chain to the A chain are disclosed herein under the header Linking Moieties for Single Chain-Insulin Analogs and the respective subheaders “Peptide linkers” and “Non-Peptide Linkers”.
- the linking moiety comprises a linking peptide, and more particularly, in one embodiment the peptide represents an analog of the IGF-1 C peptide.
- Additional exemplary peptide linkers include but are not limited to the sequence X 51 X 52 GSSSX 57 X 58 (SEQ ID NO: 49) or X 51 X 52 GSSSX 57 X 58 APQT (SEQ ID NO: 50) wherein X 51 is selected from the group consisting of glycine, alanine, valine, leucine, isoleucine and proline, X 52 is alanine, valine, leucine, isoleucine or proline and X 57 or X 58 are independently arginine, lysine, cysteine, homocysteine, acetyl-phenylalanine or ornithine, optionally with a hydrophilic moiety linked to the side chain of the amino acid at position 7 or 8 of the linking moiety (i.e., at the X 57 or X 58 position).
- the linking moiety is a non-peptide linker comprising a relatively short bifunctional non-peptide polymer linker that approximates the length of an 8-16 amino acid sequence.
- the non-peptide linker has the structure:
- m is an integer ranging from 10 to 14 and the linking moiety is linked directly to the B25 amino acid of the B chain.
- the non-peptide linking moiety is a polyethylene glycol linker of approximately 4 to 20, 8 to 18, 8 to 16, 8 to 14, 8 to 12, 10 to 14, 10 to 12 or 11 to 13 monomers.
- a glucagon related peptide-insulin conjugate comprising an insulin peptide having the structure: IB-LM-IA, wherein IB comprises the sequence R 22 -X 25 LCGX 29 X 30 LVX 33 X 34 LYLVCGX 41 X 42 GFX 45 (SEQ ID NO: 20), LM is a linking moiety as disclosed herein that covalently links IB to IA, and IA comprises the sequence GIVX 4 X 5 CCX 8 X 9 X 10 CX 12 LX 14 X 15 LX 17 X 18 X 19 CX 21 -R 13 (SEQ ID NO: 29),
- X 4 is glutamic acid or aspartic acid
- X 5 is glutamine or glutamic acid
- X 8 is histidine or phenylalanine
- X 9 and X 14 are independently selected from arginine, lysine, ornithine or alanine;
- X 10 is isoleucine or serine
- X 12 is serine or aspartic acid
- X 14 is tyrosine, arginine, lysine, ornithine or alanine;
- X 15 is arginine, lysine, ornithine or leucine
- X 17 is glutamic acid or glutamine
- X 18 is methionine, asparagine or threonine
- X 19 is tyrosine, 4-methoxy-phenylalanine or 4-amino phenylalanine;
- X 21 is alanine, glycine or asparagine
- X 25 is selected from the group consisting of histidine and threonine
- X 29 is selected from the group consisting of alanine, glycine and serine;
- X 30 is selected from the group consisting of histidine, aspartic acid, glutamic acid, homocysteic acid and cysteic acid;
- X 33 is selected from the group consisting of aspartic acid and glutamic acid;
- X 34 is selected from the group consisting of alanine and threonine
- X 41 is selected from the group consisting of glutamic acid, aspartic acid or asparagine;
- X 42 is selected from the group consisting of alanine, lysine, ornithine and arginine;
- R 22 is selected from the group consisting of AYRPSE (SEQ ID NO: 14), FVNQ (SEQ ID NO: 12), PGPE (SEQ ID NO: 11), a tripeptide glycine-proline-glutamic acid, a tripeptide valine-asparagine-glutamine, a dipeptide proline-glutamic acid, a dipeptide asparagine-glutamine, glutamine, glutamic acid and an N-terminal amine; and
- R 13 is COOH or CONH 2 , further wherein the amino acid at the designation X 45 is directly bound to the linking moiety, LM (i.e., the designation IB-LM-IA as used herein is intended to represent that the B chain carboxyl terminus and the amino terminus of the A chain are directly linked to the linking moiety LM without any further intervening amino acids).
- LM i.e., the designation IB-LM-IA as used herein is intended to represent that the B chain carboxyl terminus and the amino terminus of the A chain are directly linked to the linking moiety LM without any further intervening amino acids.
- the linking moiety comprises an amino acid sequence of no more than 17 amino acids in length.
- the linking moiety comprises the sequence X 51 X 52 GSSSX 57 X 58 (SEQ ID NO: 49) or X 51 X 52 GSSSX 57 X 58 APQT (SEQ ID NO: 50) wherein X 51 is selected from the group consisting of glycine, alanine, valine, leucine, isoleucine and proline, X 52 is alanine, valine, leucine, isoleucine or proline and X 57 or X 58 are independently arginine, lysine, cysteine, homocysteine, acetyl-phenylalanine or ornithine, optionally with a hydrophilic moiety linked to the side chain of the amino acid at position 7 or 8 of the linking moiety (i.e., at the X 57 or X 58 position). Amino acid positions of
- the linking moiety comprises a 29 contiguous amino acid sequence, directly linked to the carboxy terminal amino acid of the B chain, wherein said 29 contiguous amino acid sequence has greater than 70%, 80%, 90% sequence identity to SSSSX 50 APPPSLPSPSRLPGPSDTPILPQX 51 (SEQ ID NO: 68), wherein X 50 and X 51 are independently selected from arginine and lysine.
- the linking peptide comprises a total of 29 to 158 or 29 to 58 amino acids and comprises the sequence of SEQ ID NO: 68.
- the linking moiety comprises a 29 contiguous amino acid sequence, directly linked to the carboxy terminal amino acid of the B chain, wherein said 29 contiguous amino acid sequence has greater than 90% sequence identity to SSSSX 50 APPPSLPSPSRLPGPSDTPILPQX 51 (SEQ ID NO: 68), wherein X 50 and X 51 are independently selected from arginine and lysine.
- the linking moiety comprises the sequence SSSSRAPPPSLPSPSRLPGPSDTPILPQK (SEQ ID NO: 51) or SSSSKAPPPSLPSPSRLPGPSDTPILPQR (SEQ ID NO: 52) optionally with one or two amino acid substitutions.
- a single chain insulin agonist polypeptide comprising a B chain and A chain of human insulin, or analogs or derivative thereof, wherein the last five carboxy amino acids of the native B chain are deleted (i.e., B26-B30), and amino acid B25 is linked to amino acid A1 of the A chain via an intervening linking moiety.
- the linking moiety comprises the structure:
- m is an integer ranging from 10 to 14 and the linking moiety is linked directly to the B25 amino acid of the B chain.
- a glucagon related peptide-insulin conjugate comprising an insulin peptide having the general formula IB-LM-IA wherein IB comprises the sequence GPEHLCGAX 30 LVDALYLVCGDX 42 GFYFNX 48 X 49 (SEQ ID NO: 40); LM comprises the sequence SSSSRAPPPSLPSPSRLPGPSDTPILPQK (SEQ ID NO: 51), SSSSKAPPPSLPSPSRLPGPSDTPILPQR (SEQ ID NO: 52), GYGSSSRR (SEQ ID NO: 18) or GAGSSSRR (SEQ ID NO: 22); and
- IA comprises the sequence GIVDECCX 8 X 9 SCDLX 14 X 15 LX 17 X 18 X 19 CX 21 -R 13 (SEQ ID NO: 35) wherein
- X 8 is histidine or phenylalanine
- X 9 is arginine, ornithine or alanine
- X 14 and X 15 are both arginine
- X 17 is glutamic acid
- X 19 is tyrosine, 4-methoxy-phenylalanine or 4-amino phenylalanine;
- X 21 is alanine or asparagine
- X 25 is histidine or threonine
- X 30 is selected from the group consisting of histidine, aspartic acid, glutamic acid, homocysteic acid and cysteic acid;
- X 42 is selected from the group consisting of alanine, ornithine and arginine;
- R 13 is COOH
- the linking moiety is a peptide or peptidomimetic of 6-18, 8-18, 8-17, 8-12, 8-10, 13-17 or 13-15 amino acids (or amino acid analogs or derivatives thereof).
- the linking moiety is a peptide or peptidomimetic of 6-18, 8-18, 8-17, 8-12, 8-10, 13-17 or 13-15 amino acids wherein the peptide linking moiety comprises two or more adjacent basic amino acid residues.
- the linking moiety is an 8 to 17 non-native amino acid sequence comprising the sequence X 51 X 52 X 53 X 54 X 55 X 56 X 57 X 58 (SEQ ID NO: 9), wherein X 51 , X 52 , X 53 , X 54 , X 55 and X 56 are independently any amino acid or amino acid analog or derivative thereof, and X 57 and X 58 are basic amino acids.
- the linking moiety is a non-native polypeptide of 8 to 17 amino acids in length and comprising the sequence X 51 X 52 X 53 X 54 X 55 X 56 RR (SEQ ID NO: 10), wherein X 52 is a non-aromatic amino acid, including for example alanine.
- the linking moiety is 8 to 17 amino acids in length and comprises the sequence X 51 X 52 GSSSRR (SEQ ID NO: 53) wherein X 51 is selected from the group consisting of glycine, alanine, valine, leucine, isoleucine, proline and methionine, and X 52 is a non-aromatic amino acid, including for example alanine.
- the linking moiety is 8 to 17 amino acids in length and comprises a sequence that differs from X 51 X 52 GSSSRR (SEQ ID NO: 53) by a single amino acid substitution wherein the amino acid substitution is an amino acid that is pegylated at its side chain, further wherein X 51 is selected from the group consisting of glycine, alanine, valine, leucine, isoleucine, proline and methionine, and X 52 is a non-aromatic amino acid, including for example alanine.
- the linking moiety is a derivative of the IGF 1 C chain sequence (GYGSSSRRAPQT; SEQ ID NO: 17).
- the derivative is a peptide that differs from SEQ ID NO: 17 by a single amino acid substitution of a lysine, cysteine ornithine, homocysteine, or acetyl-phenylalanine residue, and in a further embodiment the lysine, cysteine ornithine, homocysteine, or acetyl-phenylalanine amino acid is pegylated.
- the linking moiety is a peptide that differs from SEQ ID NO: 17 by a single lysine substitution.
- the substitution is made at position 8 of SEQ ID NO: 17.
- Applicants have discovered that use of the IGF 1 C chain sequence and analogs thereof as a linking moiety will generate a single chain insulin polypeptide that has near wild type insulin activity.
- use of a IGF 1 C chain sequence analog as the linking moiety wherein position 2 of the IGF 1 C chain sequence is modified, or the carboxy terminal four amino acids are deleted from the IGF 1 C chain sequence, produces a single chain insulin polypeptide that is selective for insulin (i.e., has a higher binding and/or activity at the insulin receptor compared to the IGF-1 receptor).
- the single chain insulin polypeptide has 5 ⁇ , 10 ⁇ , 20 ⁇ , 30 ⁇ , 40 ⁇ , or 50 ⁇ higher affinity or activity at the insulin receptor relative to the IGF-1 receptor.
- the linking moiety is a derivative of the IGF 1 C chain sequence (GYGSSSRRAPQT; SEQ ID NO: 17) and comprises a non-native sequence that differs from GYGSSSRR (SEQ ID NO: 18) or GAGSSSRRAPQT (SEQ ID NO: 23) by 1 to 3 amino acid substitutions, or 1 to 2 amino acid substitutions.
- at least one of the amino acid substitutions is a lysine or cysteine substitution, and in one embodiment the amino acid substitutions are conservative amino acid substitutions.
- the linking moiety is a peptide (or peptidomimetic) of 8 to 17 amino acids comprising a non-native amino acid sequence that differs from GYGSSSRR (SEQ ID NO: 18) or GAGSSSRRAPQT (SEQ ID NO: 23) by 1 amino acid substitution, including for example substitution with a lysine or cysteine.
- the linking moiety comprises the sequence GYGSSSRR (SEQ ID NO: 18) or GAGSSSRRAPQT (SEQ ID NO: 23).
- the linking moiety comprises the sequence GAGSSSRX 58 APQT (SEQ ID NO: 54), GYGSSSX 57 X 58 APQT (SEQ ID NO: 69), or an amino acid that differs from SEQ ID NO: 54 by a single amino acid substitution, wherein X 57 is arginine and X 58 is arginine, ornithine or lysine, and in a further embodiment a polyethylene glycol chain is linked to the side chain of the amino acid at position 8 of said linking moiety.
- the linking moiety comprises the sequence GX 52 GSSSRX 58 APQT (SEQ ID NO: 55), wherein X 52 is any non-aromatic amino acid, including for example, alanine, valine, leucine, isoleucine or proline, and X 58 represents an amino acid that has a polyethylene chain covalently linked to its side chain. In one embodiment X 58 is a pegylated lysine.
- the linking moiety is an 8 to 17 amino acid sequence comprising the sequence GX 52 GSSSRR (SEQ ID NO: 56), wherein X 52 is any amino acid, a peptidomimetic of SEQ ID NO: 31, or an analog thereof that differs from SEQ ID NO: 31 by a single amino acid substitution at any of positions 1, 3, 4, 5, 6, 7 or 8 of SEQ ID NO: 31, with the proviso that when the linking peptide is longer than 8 amino acids X 52 is other than tyrosine.
- the linking moiety comprises an 8-17 amino acid sequence selected from the group consisting of GYGSSSRR (SEQ ID NO: 18), GAGSSSRR (SEQ ID NO: 22), GAGSSSRRA (SEQ ID NO: 57), GAGSSSRRAP (SEQ ID NO: 58), GAGSSSRRAPQ (SEQ ID NO: 59), GAGSSSRRAPQT (SEQ ID NO: 23), PYGSSSRR (SEQ ID NO: 61), PAGSSSRR (SEQ ID NO: 62), PAGSSSRRA (SEQ ID NO: 63), PAGSSSRRAP (SEQ ID NO: 64), PAGSSSRRAPQ (SEQ ID NO: 65), PAGSSSRRAPQT (SEQ ID NO: 66).
- the linking moiety comprises an amino acid sequence that differs from GYGSSSRR (SEQ ID NO: 18), GAGSSSRR (SEQ ID NO: 22), GAGSSSRRA (SEQ ID NO: 57), GAGSSSRRAP (SEQ ID NO: 58), GAGSSSRRAPQ (SEQ ID NO: 59), GAGSSSRRAPQT (SEQ ID NO: 23), PYGSSSRR (SEQ ID NO: 61), PAGSSSRR (SEQ ID NO: 62), PAGSSSRRA (SEQ ID NO: 63), PAGSSSRRAP (SEQ ID NO: 64), PAGSSSRRAPQ (SEQ ID NO: 65), PAGSSSRRAPQT (SEQ ID NO: 66) by a single pegylated amino acid including for example a pegylated lysine or pegylated cysteine amino acid substitution.
- the pegylated amino acid is at position 8 of the linking moiety.
- CTP SSSSKAPPPSLPSPSRLPGPSDTPILPQR; SEQ ID NO: 52
- SEQ ID NO: 52 a peptide sequence named C-terminal peptide
- the CTP peptide can be used to connect the B and A chains of insulin to form a single chain insulin analog while still maintaining high in vitro potency in a manner that the native proinsulin C-peptide can not.
- a glucagon related peptide-insulin conjugate comprising an insulin peptide having the carboxy terminus of the B chain linked to the amino terminus of the A chain via a CTP peptide.
- an insulin analog is provided as a two-chain construct with the CTP covalently linked to the C-terminus of the B-chain and/or the amino terminus of the B chain. In vitro and in vivo characterization reveals the CTP modified insulin analogs to have high potency in the absence of glycosylation, thus providing a mechanism to extend insulin action that is based on glycosylation, a natural approach to longer duration proteins.
- the linking moiety comprises a peptide having a length of at least 18 amino acids that shares a similar amino acid content.
- the linking moiety comprises an analog of (SEQ ID NO: 68), wherein said analog differs from (SEQ ID NO: 68) by 1, 2, 3, 4, 5 or 6 amino acid substitutions.
- the linking peptide comprises a CTP peptide wherein amino acid substitutions are made at one or more positions selected from positions 1, 2, 3, 4, 10, 13, 15, and 21 of (SEQ ID NO: 68).
- the linking moiety comprises a 29 contiguous amino acid sequence, directly linked to the carboxy terminal amino acid of the B chain, wherein said 29 contiguous amino acid sequence has greater than 60, 80 or 90% sequence identity to SSSSX 50 APPPSLPSPSRLPGPSDTPILPQX 51 (SEQ ID NO: 68), with the proviso that the sequence does not comprise a 15 amino acid sequence identical to a 15 amino acid sequence contained within SEQ ID NO 53.
- the linking moiety comprises a 29 contiguous amino acid sequence, directly linked to the carboxy terminal amino acid of the B chain, wherein at least 58% of the amino acids comprising the 29 contiguous amino acid sequence are selected from the group consisting of serine and proline.
- the linking moiety comprises a 29 contiguous amino acid sequence, directly linked to the carboxy terminal amino acid of the B chain, wherein said 29 contiguous amino acid sequence has greater than 70%, 80%, 90% sequence identity to SSSSX 50 APPPSLPSPSRLPGPSDTPILPQX 51 (SEQ ID NO: 68), wherein X 50 and X 51 are independently selected from arginine and lysine, with the proviso that the sequence does not comprise a 15 amino acid sequence identical to a 15 amino acid sequence contained within SEQ ID NO 53.
- the linking moiety comprises a 29 contiguous amino acid sequence, directly linked to the carboxy terminal amino acid of the B chain, wherein said 29 contiguous amino acid sequence is an analog of (SEQ ID NO: 52), wherein said analog differs from (SEQ ID NO: 52) only by 1, 2, 3, 4, 5 or 6 amino acid modification, and in a further embodiment the amino acid modifications are conservative amino acid substitutions.
- the linking moiety comprises a 29 contiguous amino acid sequence, directly linked to the carboxy terminal amino acid of the B chain, wherein said 29 contiguous amino acid sequence is an analog of (SEQ ID NO: 52), wherein said analog differs from (SEQ ID NO: 52) only by 1, 2 or 3 amino acid substitutions.
- an insulin analog comprising a CTP peptide having the sequence (SSSSX 50 APPPSLPSPSRLPGPSDTPILPQX 51 ) n (SEQ ID NO: 68), wherein n is an integer selected from the group consisting of 1, 2, 3 and 4 and X 50 and X 51 are independently selected from arginine and lysine.
- the CTP peptide comprises the sequence SSSSX 50 APPPSLPSPSRLPGPSDTPILPQX 51 (SEQ ID NO: 68), wherein X 50 and X 51 are independently selected from arginine and lysine.
- the CTP peptide comprises a sequence selected from the group consisting of SSSSRAPPPSLPSPSRLPGPSDTPILPQK (SEQ ID NO: 51), SSSSKAPPPSLPSPSRLPGPSDTPILPQR (SEQ ID NO: 52) or SSSSRAPPPSLPSPSRLPGPSDTPILPQ (SEQ ID NO: 67), and in a further embodiment the CTP peptide comprises the sequence SSSSRAPPPSLPSPSRLPGPSDTPILPQK (SEQ ID NO: 53).
- insulin analogs comprising glycosylation sites may undergo further processing, known as post-translational modification, wherein sugar (glycosyl) residues may be added enzymatically in a process known as glycosylation.
- the resulting proteins bearing covalently linked oligosaccharide side chains are known as glycosylated proteins or glycoproteins. Accordingly, a protein that bears a glycosylation site is not necessarily glycosylated.
- insulin agonists analogs are provided that have been modified to comprise a peptide sequence that is prone to hyperglycosylation when expressed in a eukaryotic expression system.
- Non-native and native glycosylation sequences are known to those skilled in the art and include N-linked glycosylation sites, and O-linked glycosylation sites.
- N-linked glycosylation sites are peptide sequences that serve as recognition sites for enzymatic attachment of a carbohydrate moiety to the side chain of an asparagine residue.
- the tripeptide O-linked glycosylation sequences include asparagine-X-serine and asparagine-X-threonine, where X is any amino acid except proline. Thus, the presence of either of these tripeptide sequences in a polypeptide creates a potential glycosylation site.
- O-linked glycosylation are peptide sequences that serve as recognition sites for enzymatic attachment of a carbohydrate moiety to the side chain of a hydroxyamino acid, most commonly serine or threonine, although 5-hydroxyproline or 5-hydroxylysine may also be used.
- the O-linked glycosylation sugar is N-aceylgalactosamine, galactose, or xylose.
- a number of O-linked glycosylation sites are known in the art and have been reported in the literature. See, e.g., Ten Hagen et al. (11029) J. Biol. Chem. 274(39):27867-74; Hanisch et al. (2001) Glycobiology 11:731-740; and Ten Hagen et al. (2003) Glycobiology 13:1R-16R.
- a method of producing a hyperglycosylated insulin analog comprises providing a eukaryotic host cell that comprises a gene encoding an insulin analog that has been modified to include a non-native glycosylation site (e.g., a CTP peptide sequence) and culturing the cell under conditions that allow expression of the insulin analog gene.
- the host cell expresses human glycosylation enzymes such that glycosylated proteins (glycoproteins) produced in the host cell exhibit protein glycosylation identical to that of human cells (see US Patent Application Publication Nos. 2004/0018590 and 2002/0137134, the disclosures of which are incorporated herein by reference).
- the eukaryotic host cell is selected from yeast (e.g., Pichia pastoris ) or mammalian (CHO or HEK293) cells.
- an insulin analog wherein a glycosylation site has been introduced into the insulin peptide.
- an insulin analog either a two chain or single chain analog, is provided wherein a peptide comprising a glycosylation site has been linked to the carboxy terminus of the insulin B chain.
- a single chain insulin analog is provided comprising a linking moiety that covalently joins the carboxy terminus of an insulin B chain to the amino terminus of an insulin A chain, wherein the linking moiety comprises an amino acid sequence of greater than 18 residues and comprises one or more glycosylation sites.
- an insulin analog is provided comprising two peptide sequences that each contain at least one glycosylation site (either the same or different).
- a first peptide sequence containing a glycosylation site is linked to the N terminus of the B chain and the second peptide sequence containing a glycosylation site is linked to the C-terminus of the A or B chain.
- the insulin analog is a single chain analog wherein the linking moiety joining the B and A chains comprises the second peptide sequence.
- a glycosylation site is introduced by the addition of amino acid sequences to the base insulin analog. More particularly, applicants have discovered that peptide sequence named C-terminal peptide (CTP: SSSSKAPPPSLPSPSRLPGPSDTPILPQR; SEQ ID NO: 52), which is prone to O-linked hyperglycosylation when the protein is expressed in a eukaryotic cellular expression system can be covalently linked to an insulin analog without undermining the inherent in vitro activity of the insulin analog.
- CTP SSSSKAPPPSLPSPSRLPGPSDTPILPQR
- an insulin analog comprising A chain and a B chain and a CTP peptide, wherein the CTP peptide is a peptide having at least 60, 70, 80, 85, 90, or 95% sequence identity with (SEQ ID NO: 52).
- the CTP peptide is a peptide comprising a 18 to 29 amino acid sequence that shares at least 80, 82, 84, 86, 88, 90, 92, 94, 96 or 98% sequence identity with a 18 to 29 amino acid region of (SEQ ID NO: 52).
- the CTP peptide comprises an analog of (SEQ ID NO: 52), wherein said analog differs from (SEQ ID NO: 52) by 1, 1 to 2, 3 to 4, 4 to 6 or up to 8 amino acid substitutions.
- the amino acid substitution are at one or more positions selected from 1-4, 7-15, 18, 20, 21, 24 and 27 of (SEQ ID NO: 52).
- the amino acid substitution are at one or more positions selected from 1, 2, 3, 4, 10, 13, 15, and 21 of (SEQ ID NO: 52).
- the amino acid substitution are at one or more positions selected from 7, 8, 9, 12, 14, 18, 20, 24 and 27 of (SEQ ID NO: 52).
- the CTP peptide comprises a 29 amino acids sequence that differs from SEQ ID NO: 68 by 1 to 2 amino acid substitutions.
- the CTP peptide comprises a fragment of SEQ ID NO: 52 wherein the fragment represents a 18 to 28 contiguous amino acid sequence identical to an amino acid sequence contained within SEQ ID NO: 52.
- the CTP peptide consists of SEQ ID NO: 68, SEQ ID NO: 52 or SEQ ID NO: 51.
- the CTP peptide comprises a peptide of the sequence SSSSX 50 APPPSLPSPSRLPGPSDTPILPQX 51 (SEQ ID NO: 68), wherein X 50 and X 51 are independently arginine or lysine, or a peptide that differs from SSSSX 50 APPPSLPSPSRLPGPSDTPILPQX 51 (SEQ ID NO: 68) by one or two amino acid modifications.
- the CTP peptide is a 29 amino acid sequence comprising a sequence selected from the group consisting of SSSSRAPPPSLPSPSRLPGPSDTPILPQK (SEQ ID NO: 51), SSSSKAPPPSLPSPSRLPGPSDTPILPQR (SEQ ID NO: 52) and SSSSRAPPPSLPSPSRLPGPSDTPILPQ (SEQ ID NO: 67).
- the CTP peptide comprises the sequence (SSSSX 50 APPPSLPSPSRLPGPSDTPILPQX 51 ) n (SEQ ID NO: 68), wherein n is an integer selected from the group consisting of 1, 2, 3 and 4, and in a further embodiment n is 1 or 2.
- a first CTP peptide is linked to the N-terminus of the B chain and a second CTP peptide is linked to the carboxy terminus of the B chain, wherein the first and second CTP peptides comprise sequences independently selected from the group consisting of SEQ ID NO: 51, SEQ ID NO: 52, SEQ ID NO: 68 and SEQ ID NO: 67.
- the linking moiety is a relatively short bifunctional non-peptide polymer linker that approximates the length of an 8-16 amino acid sequence.
- the non-peptide linking moiety is a polyethylene glycol linker of approximately 4 to 20, 8 to 18, 8 to 16, 8 to 14, 10 to 14, 10 to 12 or 11 to 13 monomers.
- a single chain insulin agonist is provided wherein the last five carboxy amino acids of the native B chain are deleted, and amino acid B25 is directly linked to the linking moiety by a covalent bond. The second end of the linking moiety is covalently bound to amino acid A1 of the A chain thus linking the B and A chain via the linking moiety.
- the linking moiety is a linear polyethylene glycol linking moiety comprising at least 10 but no more than 16 monomer units and in another embodiment the polyethylene glycol linking moiety comprises at least 12 but no more than 16 monomer units, and in a further embodiment the polyethylene glycol linking moiety comprises at least 10 but no more than 14 monomer units.
- m is an integer ranging from 6 to 18, 8 to 16, 10 to 14 or 11 to 13. In one embodiment m is an integer selected from 10, 11, 12, 13 or 14. In one embodiment m is 12.
- a single chain insulin agonist wherein the last five carboxy amino acids of the native B chain are deleted, and amino acid B25 is linked to amino acid A1 of the A chain via a linking moiety comprising polyethylene glycol of at least 8 but no more than 16 monomer units and an amino acid sequence of one to four amino acids.
- the linking moiety comprises a 1-4 amino acid sequence and a linear polyethylene glycol of at least 8 but less than 14 monomer units in length covalently bound to said 1-4 amino acid sequence, with the proviso that the amino acid sequence is not YTPK (SEQ ID NO: 70) or FNKP (SEQ ID NO: 71).
- a single chain insulin agonist wherein the last five carboxy amino acids of the native B chain are deleted, and amino acid B25 is linked to amino acid A1 of the A chain via a linking moiety comprising a polyethylene glycol of at least 8 but less than 14 monomer units in length and a 2-5 amino acid sequence.
- the 2-5 amino acid sequence can be located between the B chain and the polyethylene glycol chain or between the A chain and the polyethylene glycol chain. However, when the 2-5 amino acid sequence is located between the B chain and the polyethylene glycol chain, the amino acid sequence is not YTPKT (SEQ ID NO: 16) or FNKPT (SEQ ID NO: 76).
- linking moiety comprises the general structure: W 1 -Z 1 -Y 1
- W 1 and Y 1 are independently a bond, X 46 , X 46 X 47 , X 46 X 47 X 48 , X 46 X 47 X 48 X 49 (SEQ ID NO: 24) or X 46 X 47 X 48 X 49 X 50 (SEQ ID NO: 13), with the proviso that W 1 is not YTPK (SEQ ID NO: 70) or FNKP (SEQ ID NO: 71) and Z 1 represents a polyethylene glycol of the general structure
- m is an integer ranging from 6-14, and each of X 46 , X 47 , X 48 , X 49 and X 50 are independently any amino acid. In one embodiment X 46 , X 47 , X 48 , X 49 and X 50 are independently any non-native amino acid relative to positions B26-B30 of insulin or IGF-1.
- X 46 , X 47 , X 48 , X 49 and X 50 are independently selected from the group consisting of glycine, alanine, valine, leucine, isoleucine, serine, threonine and proline, and in a further embodiment X 46 , X 47 , X 48 , X 49 and X 50 are independently selected from the group consisting of glycine, alanine, valine, leucine and isoleucine.
- W 1 is a bond and Y 1 is X 46 , X 46 X 47 or X 46 X 47 X 48 (SEQ ID NO: 15) wherein X 46 , X 47 and X 48 are each alanine and Z is a polyethylene glycol of 4-14 monomer units.
- Y 1 is a bond and W 1 is X 46 , X 46 X 47 or X 46 X 47 X 48 (SEQ ID NO: 15) wherein X 46 , X 47 and X 48 are each alanine and Z is a polyethylene glycol of 4-14 monomer units.
- a single chain insulin analog comprising an A chain and a C-terminally truncated B chain, having amino acids B26-B30 (relative to the native insulin sequence) removed, wherein said A chain and B chain are human insulin sequences, or analogs or derivatives thereof, further wherein the carboxy terminus of the B25 amino acid of the B chain is directly linked to a first end of a linking moiety and a second end of the linking moiety is directly linked to the amino terminus of the A1 amino acid of the A chain.
- the truncated B chain comprises the sequence of SEQ ID NO: 20 wherein the B25 amino acid is directly linked to the N terminus of the linking peptide.
- linking moiety comprises either
- the insulin peptides disclosed herein are further modified to comprise a hydrophilic moiety covalently linked to the side chain of an amino acid at a position selected from the group consisting of A9, A14 and A15 of the A chain or at the N-terminal alpha amine of the B chain (e.g.
- this hydrophilic moiety is covalently linked to a Lys, Cys, Orn, homocysteine, or acetyl-phenylalanine residue at any of these positions.
- the hydrophilic moiety is covalently linked to the side chain of an amino acid of the linking moiety.
- hydrophilic moieties include polyethylene glycol (PEG), for example, of a molecular weight of about 1,000 Daltons to about 40,000 Daltons, or about 20,000 Daltons to about 40,000 Daltons.
- Additional suitable hydrophilic moieties include, polypropylene glycol, polyoxyethylated polyols (e.g., POG), polyoxyethylated sorbitol, polyoxyethylated glucose, polyoxyethylated glycerol (POG), polyoxyalkylenes, polyethylene glycol propionaldehyde, copolymers of ethylene glycol/propylene glycol, monomethoxy-polyethylene glycol, mono-(C1-C10) alkoxy- or aryloxy-polyethylene glycol, carboxymethylcellulose, polyacetals, polyvinyl alcohol (PVA), polyvinyl pyrrolidone, poly-1,3-dioxolane, poly-1,3,6-trioxane, ethylene/male
- the hydrophilic moiety e.g., polyethylene glycol chain in accordance with some embodiments has a molecular weight selected from the range of about 500 to about 40,000 Daltons.
- the hydrophilic moiety, e.g. PEG has a molecular weight selected from the range of about 500 to about 5,000 Daltons, or about 1,000 to about 5,000 Daltons.
- the hydrophilic moiety, e.g., PEG has a molecular weight of about 10,000 to about 20,000 Daltons.
- the hydrophilic moiety, e.g., PEG has a molecular weight of about 20,000 to about 40,000 Daltons.
- PEG has a molecular weight of about 20,000 Daltons.
- an insulin peptide is provided wherein one or more amino acids of the analog are pegylated, and the combined molecular weight of the covalently linked PEG chains is about 20,000 Daltons.
- dextrans are used as the hydrophilic moiety.
- Dextrans are polysaccharide polymers of glucose subunits, predominantly linked by cd-6 linkages. Dextran is available in many molecular weight ranges, e.g., about 1 kD to about 100 kD, or from about 5, 10, 15 or 20 kD to about 20, 30, 40, 50, 60, 70, 80 or 90 kD.
- Linear or branched polymers are contemplated.
- Resulting preparations of conjugates may be essentially monodisperse or polydisperse, and may have about 0.5, 0.7, 1, 1.2, 1.5 or 2 polymer moieties per peptide.
- the hydrophilic moiety is a polyethylene glycol (PEG) chain, optionally linked to the side chain of an amino acid at a position selected from the group consisting of A9, A14 and A15 of the A chain, positions B1, B2, B10, B22, B28 or B29 of the B chain, at the N-terminal alpha amine of the B chain, or at any position of the linking moiety of a single chain insulin analog that links the A chain and B chain, including for example at position C8.
- the single chain insulin analog comprises a peptide linking moiety of 8 to 12 amino acids, wherein one of the amino acids of the linking moiety has a polyethylene chain covalently bound to its side chain.
- the single chain insulin analog comprises a peptide linking moiety of 8 to 12 amino acids, wherein an amino acid of the linking moiety is pegylated and one or more amino acid at a position selected from the group consisting of A9, A14 and A15 of the A chain, positions B1, B2, B10, B22, B28 or B29 of the B chain is also pegylated.
- the total molecular weight of the covalently linked PEG chain(s) is about 20,000 Daltons.
- a single chain insulin analog comprises a linking moiety of 8 to 12 amino acids, wherein one of the amino acids of the linking moiety has a 20,000 Dalton polyethylene chain covalently bound to its side chain.
- a insulin analog comprises a peptide linking moiety of 8 to 12 amino acids, wherein one of the amino acids of the linking moiety has a polyethylene chain covalently bound to its side chain and a second PEG chain is linked to the N-terminal alpha amine of the B chain (e.g. at position B1 for insulin based B chain or position B2 for IGF-1 based B chain) or at the side chain of an amino acid at position B1, B2 and B29 of the B chain.
- each PEG chain has a molecular weight of about 10,000 Daltons. In one embodiment when the PEG chain is linked to an 8 to 12 amino acid linking moiety, the PEG chain is linked at position C7 or C8 of the linking moiety and in one embodiment the PEG chain is linked at position C8 of the linking moiety. In one embodiment when two PEG chains are linked to the single chain insulin analog, with one PEG chain linked at position C8 and the second PEG is linked at A9, A14, A15, B1, B2, B10, B22, B28 or B29.
- Hydrophilic moieties such as polyethylene glycol can be attached to the glucagon related peptide-insulin conjugate under any suitable conditions used to react a protein with an activated polymer molecule. Any means known in the art can be used, including via acylation, reductive alkylation, Michael addition, thiol alkylation or other chemoselective conjugation/ligation methods through a reactive group on the PEG moiety (e.g., an aldehyde, amino, ester, thiol, ⁇ -haloacetyl, maleimido or hydrazino group) to a reactive group on the target compound (e.g., an aldehyde, amino, ester, thiol, ⁇ -haloacetyl, maleimido or hydrazino group).
- a reactive group on the PEG moiety e.g., an aldehyde, amino, ester, thiol, ⁇ -haloacetyl, maleimid
- Activating groups which can be used to link the water soluble polymer to one or more proteins include without limitation sulfone, maleimide, sulfhydryl, thiol, triflate, tresylate, azidirine, oxirane and 5-pyridyl. If attached to the peptide by reductive alkylation, the polymer selected should have a single reactive aldehyde so that the degree of polymerization is controlled. See, for example, Kinstler et al., Adv. Drug. Delivery Rev. 54: 477-485 (2002); Roberts et al., Adv. Drug Delivery Rev. 54: 459-476 (2002); and Zalipsky et al., Adv. Drug Delivery Rev. 16: 157-182 (1995).
- the insulin analog is modified to comprise an acyl group.
- the acyl group can be covalently linked directly to an amino acid of the glucagon related peptide-insulin conjugate, or indirectly to an amino acid of the glucagon related peptide-insulin conjugate via a spacer, wherein the spacer is positioned between the amino acid of the glucagon related peptide-insulin conjugate and the acyl group.
- the glucagon related peptide-insulin conjugate may be acylated at the same amino acid position where a hydrophilic moiety is linked, or at a different amino acid position.
- acylation may occur at any position including any of amino acid of the A or B chains as well as a position within the linking moiety, provided that the activity exhibited by the non-acylated glucagon related peptide-insulin conjugate is retained upon acylation.
- Nonlimiting examples include acylation at positions A14 and A15 of the A chain, positions position B1 for insulin based B chain or position B2 for IGF-1 based B chain or positions B10, B22, B28 or B29 of the B chain or at any position of the linking moiety.
- the insulin analog is modified to comprise an acyl group by direct acylation of an amine, hydroxyl, or thiol of a side chain of an amino acid of the glucagon related peptide-insulin conjugate.
- the insulin analog is directly acylated through the side chain amine, hydroxyl, or thiol of an amino acid.
- acylation is at position B28 or B29 (according to the amino acid numbering of the native insulin A and B chain sequences).
- an insulin analog can be provided that has been modified by one or more amino acid substitutions in the A or B chain sequence, including for example at positions A14, A15, B1, B2, B10, B22, B28 or B29 (according to the amino acid numbering of the native insulin A and B chain sequences) or at any position of the linking moiety with an amino acid comprising a side chain amine, hydroxyl, or thiol.
- the direct acylation of the insulin peptide occurs through the side chain amine, hydroxyl, or thiol of the amino acid at position B28 or B29 (according to the amino acid numbering of the native insulin A and B chain sequences).
- the acylated insulin analogs comprise a spacer between the peptide and the acyl group.
- the glucagon related peptide-insulin conjugate is covalently bound to the spacer, which is covalently bound to the acyl group.
- the insulin peptide is modified to comprise an acyl group by acylation of an amine, hydroxyl, or thiol of a spacer, which spacer is attached to a side chain of an amino acid at position B28 or B29 (according to the amino acid numbering of the A or B chain of native insulin), or at any position of the spacer moiety.
- the amino acid of the glucagon related peptide-insulin conjugate to which the spacer is attached can be any amino acid comprising a moiety which permits linkage to the spacer.
- an amino acid comprising a side chain —NH 2 , —OH, or —COOH e.g., Lys, Orn, Ser, Asp, or Glu is suitable.
- the spacer between the glucagon related peptide-insulin conjugate and the acyl group is an amino acid comprising a side chain amine, hydroxyl, or thiol (or a dipeptide or tripeptide comprising an amino acid comprising a side chain amine, hydroxyl, or thiol).
- the spacer comprises a hydrophilic bifunctional spacer.
- the spacer comprises an amino poly(alkyloxy)carboxylate.
- the spacer can comprise, for example, NH 2 (CH 2 CH 2 O) n (CH 2 ) m COOH, wherein m is any integer from 1 to 6 and n is any integer from 2 to 12, such as, e.g., 8-amino-3,6-dioxaoctanoic acid, which is commercially available from Peptides International, Inc. (Louisville, Ky.).
- the hydrophilic bifunctional spacer comprises two or more reactive groups, e.g., an amine, a hydroxyl, a thiol, and a carboxyl group or any combinations thereof.
- the hydrophilic bifunctional spacer comprises a hydroxyl group and a carboxylate.
- the hydrophilic bifunctional spacer comprises an amine group and a carboxylate.
- the hydrophilic bifunctional spacer comprises a thiol group and a carboxylate.
- the spacer between peptide the glucagon related peptide-insulin conjugate and the acyl group is a hydrophobic bifunctional spacer.
- Hydrophobic bifunctional spacers are known in the art. See, e.g., Bioconjugate Techniques, G. T. Hermanson (Academic Press, San Diego, Calif., 1996), which is incorporated by reference in its entirety.
- the bifunctional spacer can be a synthetic or naturally occurring amino acid comprising an amino acid backbone that is 3 to 10 atoms in length (e.g., 6-amino hexanoic acid, 5-aminovaleric acid, 7-aminoheptanoic acid, and 8-aminooctanoic acid).
- the spacer can be a dipeptide or tripeptide spacer having a peptide backbone that is 3 to 10 atoms (e.g., 6 to 10 atoms) in length.
- Each amino acid of the dipeptide or tripeptide spacer attached to the glucagon related peptide-insulin conjugate can be independently selected from the group consisting of: naturally-occurring and/or non-naturally occurring amino acids, including, for example, any of the D or L isomers of the naturally-occurring amino acids (Ala, Cys, Asp, Glu, Phe, Gly, His, Ile, Lys, Leu, Met, Asn, Pro, Arg, Ser, Thr, Val, Trp, Tyr), or any D or L isomers of the non-naturally occurring amino acids selected from the group consisting of: ⁇ -alanine ( ⁇ -Ala), N- ⁇ -methyl-alanine (Me-Ala), aminobutyric acid (Abu), ⁇ -aminobutyric acid ( ⁇ -Abu), aminohexanoic acid (c-Ahx), aminoisobutyric acid (Aib), aminomethylpyrrole carboxylic acid, aminopiperidinecarboxylic
- the dipeptide spacer is selected from the group consisting of: Ala-Ala, ⁇ -Ala- ⁇ -Ala, Leu-Leu, Pro-Pro, ⁇ -aminobutyric acid- ⁇ -aminobutyric acid, and ⁇ -Glu- ⁇ -Glu.
- the peptide the glucagon related peptide-insulin conjugate can be modified to comprise an acyl group by acylation of a long chain alkane of any size and can comprise any length of carbon chain.
- the long chain alkane can be linear or branched.
- the long chain alkane is a C 4 to C 30 alkane.
- the long chain alkane can be any of a C 4 alkane, C 6 alkane, C 8 alkane, C 10 alkane, C 12 alkane, C 14 alkane, C 16 alkane, C 18 alkane, C 20 alkane, C 22 alkane, C 24 alkane, C 26 alkane, C 28 alkane, or a C 30 alkane.
- the long chain alkane comprises a C 8 to C 20 alkane, e.g., a C 14 alkane, C 16 alkane, or a C 18 alkane.
- an amine, hydroxyl, or thiol group of the glucagon related peptide-insulin conjugate is acylated with a cholesterol acid.
- the peptide is linked to the cholesterol acid through an alkylated des-amino Cys spacer, i.e., an alkylated 3-mercaptopropionic acid spacer. Suitable methods of peptide acylation via amines, hydroxyls, and thiols are known in the art.
- the acyl group of the acylated peptide the glucagon related peptide-insulin conjugate can be of any size, e.g., any length carbon chain, and can be linear or branched.
- the acyl group is a C 4 to C 30 fatty acid.
- the acyl group can be any of a C 4 fatty acid, C 6 fatty acid, C 8 fatty acid, C 10 fatty acid, C 12 fatty acid, C 14 fatty acid, C 16 fatty acid, C 18 fatty acid, C 20 fatty acid, C 22 fatty acid, C 24 fatty acid, C 26 fatty acid, C 28 fatty acid, or a C 30 fatty acid.
- the acyl group is a C 8 to C 20 fatty acid, e.g., a C 14 fatty acid or a C 16 fatty acid.
- the acyl group is a bile acid.
- the bile acid can be any suitable bile acid, including, but not limited to, cholic acid, chenodeoxycholic acid, deoxycholic acid, lithocholic acid, taurocholic acid, glycocholic acid, and cholesterol acid.
- the glucagon related peptide-insulin conjugate is modified to comprise an alkyl group.
- the alkyl group can be covalently linked directly to an amino acid of the insulin analog, or indirectly to an amino acid of the glucagon related peptide-insulin conjugate via a spacer, wherein the spacer is positioned between the amino acid of the glucagon related peptide-insulin conjugate and the alkyl group.
- the alkyl group can be attached to the glucagon related peptide-insulin conjugate via an ether, thioether, or amino linkage.
- the glucagon related peptide-insulin conjugate may be alkylated at the same amino acid position where a hydrophilic moiety is linked, or at a different amino acid position. Alkylation can be carried out at any position within the glucagon related peptide-insulin conjugate, including for example in the C-terminal region of the B chain or at a position in the linking moiety, provided that insulin activity is retained.
- the glucagon related peptide-insulin conjugate is modified to comprise an alkyl group by direct alkylation of an amine, hydroxyl, or thiol of a side chain of an amino acid of the glucagon related peptide-insulin conjugate.
- the glucagon related peptide-insulin conjugate is directly alkylated through the side chain amine, hydroxyl, or thiol of an amino acid.
- the direct alkylation of the glucagon related peptide-insulin conjugate occurs through the side chain amine, hydroxyl, or thiol of the amino acid at position A14, A15, B1 (for insulin based B chains), B2 (for IGF-1 based B chains), B10, B22, B28 or B29 (according to the amino acid numbering of the A and B chain of native insulin).
- the glucagon related peptide-insulin conjugate comprises a spacer between the peptide and the alkyl group. In some embodiments, the glucagon related peptide-insulin conjugate is covalently bound to the spacer, which is covalently bound to the alkyl group.
- the glucagon related peptide-insulin conjugate is modified to comprise an alkyl group by alkylation of an amine, hydroxyl, or thiol of a spacer, wherein the spacer is attached to a side chain of an amino acid at position A14, A15, B1 (for insulin based B chains), B2 (for IGF-1 based B chains), B10, B22, B28 or B29 (according to the amino acid numbering of the A and B chains of native insulin).
- the amino acid of the glucagon related peptide-insulin conjugate to which the spacer is attached can be any amino acid (e.g., a singly ⁇ -substituted amino acid or an ⁇ , ⁇ -disubstituted amino acid) comprising a moiety which permits linkage to the spacer.
- An amino acid of the glucagon related peptide-insulin conjugate comprising a side chain —NH 2 , —OH, or —COOH e.g., Lys, Orn, Ser, Asp, or Glu
- the spacer between the peptide the glucagon related peptide-insulin conjugate and the alkyl group is an amino acid comprising a side chain amine, hydroxyl, or thiol or a dipeptide or tripeptide comprising an amino acid comprising a side chain amine, hydroxyl, or thiol.
- the spacer amino acid can be any amino acid.
- the spacer amino acid can be a hydrophobic amino acid, e.g., Gly, Ala, Val, Leu, Ile, Trp, Met, Phe, Tyr.
- the spacer amino acid can be an acidic residue, e.g., Asp and Glu.
- the spacer amino acid can be a hydrophobic amino acid, e.g., Gly, Ala, Val, Leu, Ile, Trp, Met, Phe, Tyr, 6-amino hexanoic acid, 5-aminovaleric acid, 7-aminoheptanoic acid, 8-aminooctanoic acid.
- the spacer amino acid can be an acidic residue, e.g., Asp and Glu, provided that the alkylation occurs on the alpha amine of the acidic residue.
- the spacer amino acid is an amino acid comprising a side chain amine, e.g., an amino acid of Formula I (e.g., Lys or Orn).
- an amino acid of Formula I e.g., Lys or Orn
- both the alpha amine and the side chain amine of the spacer amino acid to be alkylated, such that the peptide is dialkylated.
- Embodiments of the invention include such dialkylated molecules.
- the spacer comprises a hydrophilic bifunctional spacer.
- the spacer comprises an amino poly(alkyloxy)carboxylate.
- the spacer can comprise, for example, NH 2 (CH 2 CH 2 O) n (CH 2 ) m COOH, wherein m is any integer from 1 to 6 and n is any integer from 2 to 12, such as, e.g., 8-amino-3,6-dioxaoctanoic acid, which is commercially available from Peptides International, Inc. (Louisville, Ky.).
- the spacer between peptide the glucagon related peptide-insulin conjugate and the alkyl group is a hydrophilic bifunctional spacer.
- the hydrophilic bifunctional spacer comprises two or more reactive groups, e.g., an amine, a hydroxyl, a thiol, and a carboxyl group or any combinations thereof.
- the hydrophilic bifunctional spacer comprises a hydroxyl group and a carboxylate.
- the hydrophilic bifunctional spacer comprises an amine group and a carboxylate.
- the hydrophilic bifunctional spacer comprises a thiol group and a carboxylate.
- the spacer e.g., amino acid, dipeptide, tripeptide, hydrophilic bifunctional spacer, or hydrophobic bifunctional spacer
- the spacer is 3 to 10 atoms (e.g., 6 to 10 atoms, (e.g., 6, 7, 8, 9, or 10 atoms)) in length.
- the spacer is about 3 to 10 atoms (e.g., 6 to 10 atoms) in length and the alkyl is a C 12 to C 18 alkyl group, e.g., C 14 alkyl group, C 16 alkyl group, such that the total length of the spacer and alkyl group is 14 to 28 atoms, e.g., about 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, or 28 atoms. In some embodiments the length of the spacer and alkyl is 17 to 28 (e.g., 19 to 26, 19 to 21) atoms.
- the bifunctional spacer is a synthetic or non-naturally occurring amino acid comprising an amino acid backbone that is 3 to 10 atoms in length (e.g., 6-amino hexanoic acid, 5-aminovaleric acid, 7-aminoheptanoic acid, and 8-aminooctanoic acid).
- the spacer can be a dipeptide or tripeptide spacer having a peptide backbone that is 3 to 10 atoms (e.g., 6 to 10 atoms) in length.
- the dipeptide or tripeptide spacer attached to the glucagon related peptide-insulin conjugate can be composed of naturally-occurring and/or non-naturally occurring amino acids, including, for example, any of the amino acids taught herein.
- the spacer comprises an overall negative charge, e.g., comprises one or two negatively charged amino acids.
- the dipeptide spacer is selected from the group consisting of: Ala-Ala, ⁇ -Ala- ⁇ -Ala, Leu-Leu, Pro-Pro, ⁇ -aminobutyric acid- ⁇ -aminobutyric acid, and ⁇ -Glu- ⁇ -Glu.
- the dipeptide spacer is ⁇ -Glu- ⁇ -Glu.
- Suitable methods of peptide alkylation via amines, hydroxyls, and thiols are known in the art.
- a Williamson ether synthesis can be used to form an ether linkage between the insulin peptide and the alkyl group.
- a nucleophilic substitution reaction of the peptide with an alkyl halide can result in any of an ether, thioether, or amino linkage.
- the alkyl group of the alkylated peptide the glucagon related peptide-insulin conjugate can be of any size, e.g., any length carbon chain, and can be linear or branched. In some embodiments of the invention, the alkyl group is a C 4 to C 30 alkyl.
- the alkyl group can be any of a C 4 alkyl, C 6 alkyl, C 8 alkyl, C 10 alkyl, C 12 alkyl, C 14 alkyl, C 16 alkyl, C 18 alkyl, C 20 alkyl, C 22 alkyl, C 24 alkyl, C 26 alkyl, C 28 alkyl, or a C 30 alkyl.
- the alkyl group is a C 8 to C 20 alkyl, e.g., a C 14 alkyl or a C 16 alkyl.
- the alkyl group comprises a steroid moiety of a bile acid, e.g., cholic acid, chenodeoxycholic acid, deoxycholic acid, lithocholic acid, taurocholic acid, glycocholic acid, and cholesterol acid.
- a bile acid e.g., cholic acid, chenodeoxycholic acid, deoxycholic acid, lithocholic acid, taurocholic acid, glycocholic acid, and cholesterol acid.
- the long chain alkane When a long chain alkane is alkylated by the glucagon related peptide-insulin conjugate or the spacer, the long chain alkane may be of any size and can comprise any length of carbon chain.
- the long chain alkane can be linear or branched.
- the long chain alkane is a C 4 to C 30 alkane.
- the long chain alkane can be any of a C 4 alkane, C 6 alkane, C 8 alkane, C 10 alkane, C 12 alkane, C 14 alkane, C 16 alkane, C 18 alkane, C 20 alkane, C 22 alkane, C 24 alkane, C 26 alkane, C 28 alkane, or a C 30 alkane.
- the long chain alkane comprises a C 8 to C 20 alkane, e.g., a C 14 alkane, C 16 alkane, or a C 18 alkane.
- alkylation can occur between the insulin analog and a cholesterol moiety.
- the hydroxyl group of cholesterol can displace a leaving group on the long chain alkane to form a cholesterol-insulin peptide product.
- the insulin/incretin conjugates described herein can be modified into a depot form, such that the manner in which the conjugate of the present disclosure is released into the body to which it is administered is controlled with respect to time and location within the body (see, for example, U.S. Pat. No. 4,450,150).
- Depot forms of the conjugates of the present disclosures can be, for example, an implantable composition comprising the conjugate of the present disclosure and a porous or non-porous material, such as a polymer, wherein the conjugate of the present disclosures is encapsulated by or diffused throughout the material and/or degradation of the non-porous material.
- the depot is then implanted into the desired location within the body and the conjugate of the present disclosures are released from the implant at a predetermined rate.
- a large depot polymer can be linked to a self cleaving dipeptide element that is covalently bound to the conjugate as described herein.
- the depot polymer effectively sequesters the glucagon related peptide-insulin conjugate at its site of administration until it is subsequently cleaved from the single chain analog via a non-enzymatic reaction at a predetermined rate.
- Depot formulations of insulin analogs using a self cleaving dipeptide have been described in published international application no. WO 2010/080607, the disclosure of which is incorporated herein.
- a glucagon related peptide-insulin conjugate comprising a dipeptide prodrug element wherein the dipeptide prodrug element is linked to a large polymer such as PEG or dextran.
- a self cleaving dipeptide element comprising a large depot polymer (including for example, PEG) is linked to the side chain of an amino acid of the linking moiety, including for example, the amino acid at position C8 of the linking moiety.
- compositions can be prepared that comprise the single chain analogs and are formulated to have a desired in vivo release profile.
- the pharmaceutical composition is an immediate release, controlled release, sustained release, extended release, delayed release, or bi-phasic release formulation.
- Methods of formulating peptides or conjugates for controlled release are known in the art. See, for example, J Pharm 374: 46-52 (2009) and International Patent Application Publication Nos. WO 2008/130158, WO2004/033036; WO2000/032218; and WO 1999/040942.
- the instant compositions may further comprise, for example, micelles or liposomes, or some other encapsulated form, or may be administered in an extended release form to provide a prolonged storage and/or delivery effect.
- the disclosed pharmaceutical formulations may be administered according to any regime including, for example, daily (1 time per day, 2 times per day, 3 times per day, 4 times per day, 5 times per day, 6 times per day), every two days, every three days, every four days, every five days, every six days, weekly, bi-weekly, every three weeks, monthly, or bi-monthly.
- the depot polymer is selected from biocompatible polymers known to those skilled in the art.
- the depot polymers typically have a size selected from a range of about 20,000 to 120,000 Daltons. In one embodiment the depot polymer has a size selected from a range of about 40,000 to 100,000 or about 40,000 to 80,000 Daltons. In one embodiment the depot polymer has a size of about 40,000, 50,000, 60,000, 70,000 or 80,000 Daltons.
- Suitable depot polymers include but are not limited to dextrans, polylactides, polyglycolides, caprolactone-based polymers, poly(caprolactone), polyanhydrides, polyamines, polyesteramides, polyorthoesters, polydioxanones, polyacetals, polyketals, polycarbonates, polyphosphoesters, polyesters, polybutylene terephthalate, polyorthocarbonates, polyphosphazenes, succinates, poly(malic acid), poly(amino acids), polyvinylpyrrolidone, polyethylene glycol, polyhydroxycellulose, polysaccharides, chitin, chitosan, hyaluronic acid, and copolymers, terpolymers and mixtures thereof, and biodegradable polymers and their copolymers including caprolactone-based polymers, polycaprolactones and copolymers which include polybutylene terephthalate.
- the depot polymer is selected from the group consisting of polyethylene glycol, dextran, polylactic acid, polyglycolic acid and a copolymer of lactic acid and glycolic acid, and in one specific embodiment the depot polymer is polyethylene glycol. In one embodiment the depot polymer is polyethylene glycol and the combined molecular weight of depot polymer(s) linked to the dipeptide element is about 40,000 to 80,000 Daltons.
- a self cleaving dipeptide element comprising the structure U-J, wherein U is an amino acid or a hydroxyl acid and J is an N-alkylated amino acid.
- one or more dipeptide elements are linked to the glucagon related peptide-insulin conjugate through an amide bond formed through one or more amino groups selected from the N-terminal amino group of the B chain of the insulin component, the N-terminus of the glucagon related peptide component, or the side chain amino group of an amino acid present in the conjugate.
- one or more dipeptide elements are linked to the glucagon related peptide-insulin conjugate at an amino group selected from the N-terminal amino group of the conjugate, or the side chain amino group of an aromatic amine of a 4-amino-phenylalanine residue present at a position corresponding to position A19, B16 or B25 of native insulin, or a side chain of an amino acid of the linking moiety of a single chain insulin analog, or the N-terminus of the glucagon related peptide or insulin peptide components of the conjugate.
- R 1 , R 2 , R 4 and R 8 are independently selected from the group consisting of H, C 1 -C 18 alkyl, C 2 -C 18 alkenyl, (C 1 -C 18 alkyl)OH, (C 1 -C 18 alkyl)SH, (C 2 -C 3 alkyl)SCH 3 , (C 1 -C 4 alkyl)CONH 2 , (C 1 -C 4 alkyl)COOH, (C 1 -C 4 alkyl)NH 2 , (C 1 -C 4 alkyl)NHC(NH 2 + )NH 2 , (C 0 -C 4 alkyl)(C 3 -C 6 cycloalkyl), (C 0 -C 4 alkyl)(C 2 -C 5 heterocyclic), (C 0 -C 4 alkyl)(C 6 -C 10 aryl)R 7 , (C 1 -C 4 alkyl)(C 3 -C 9 heteroaryl), and C
- R 3 is selected from the group consisting of C 1 -C 18 alkyl, (C 1 -C 18 alkyl)OH, (C 1 -C 18 alkyl)NH 2 , (C 1 -C 18 alkyl)SH, (C 0 -C 4 alkyl)(C 3 -C 6 )cycloalkyl, (C 0 -C 4 alkyl)(C 2 -C 5 heterocyclic), (C 0 -C 4 alkyl)(C 6 -C 10 aryl)R 7 , and (C 1 -C 4 alkyl)(C 3 -C 9 heteroaryl) or R 4 and R 3 together with the atoms to which they are attached form a 4, 5 or 6 member heterocyclic ring;
- R 5 is NHR 6 or OH
- R 6 is H, C 1 -C 8 alkyl or R 6 and R 2 together with the atoms to which they are attached form a 4, 5 or 6 member heterocyclic ring;
- R 7 is selected from the group consisting of H and OH.
- the prodrug element is linked to the N-terminal amine of the glucagon related peptide-insulin conjugate and R 4 and R 3 together with the atoms to which they are attached form a 4, 5 or 6 member heterocyclic ring, then at least one of R 1 and R 2 are other than H.
- glucagon related peptide can be any of the class 1, class 2 or class 3 glucagon peptides described herein.
- the glucagon related peptide is a Class 1 glucagon related peptide, which is described herein and in International Patent Application No. PCT US2009/47437 (filed on Jun. 16, 2009) and International Patent Application Publication No. WO 2008/086086, published on Jul. 17, 2008, the contents of which are incorporated by reference in their entirety.
- Class 1 glucagon related peptides retain glucagon receptor activity relative to the native glucagon peptide (SEQ ID NO: 801).
- the glucagon related peptide can retain at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 75% activity, 80% activity, 85% activity, or 90% of the activity of native glucagon (calculated as the inverse ratio of EC50s for the glucagon related peptide vs. glucagon, e.g., as measured by cAMP production using the assay generally described in Example 7).
- the Class 1 glucagon related peptides have the same or greater activity (used synonymously with the term “potency” herein) than glucagon.
- the glucagon related peptides described herein exhibit no more than about 100%, 1000%, 10,000%, 100,000%, or 1,000,000% of the activity of native glucagon peptide.
- Native glucagon exhibits poor solubility in aqueous solution, particularly at physiological pH, with a tendency to aggregate and precipitate over time.
- Class 1 glucagon related peptides in some embodiments exhibit at least 2-fold, 5-fold, or even higher solubility compared to native glucagon at a pH between 6 and 8, or between 6 and 9, for example, at pH 7 after 24 hours at 25° C.
- a Class 1 glucagon related peptide has been modified relative to the wild type peptide of His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr (SEQ ID NO: 801) to improve the peptide's solubility in aqueous solutions, particularly at a pH ranging from about 5.5 to about 8.0, while retaining the native peptide's biological activity.
- the solubility of any of the Class 1 glucagon related peptides described herein can be further improved by attaching a hydrophilic moiety to the peptide.
- a hydrophilic moiety to the peptide.
- Introduction of such groups also increases duration of action, e.g. as measured by a prolonged half-life in circulation.
- Hydrophilic moieties are further described herein.
- solubility is improved by adding charge to the Class 1 glucagon related peptide by the substitution of native non-charged amino acids with charged amino acids selected from the group consisting of lysine, arginine, histidine, aspartic acid and glutamic acid, or by the addition of charged amino acids to the amino or carboxy terminus of the peptide.
- the Class 1 glucagon related peptide has improved solubility due to the fact that the peptide is modified by amino acid substitutions and/or additions that introduce a charged amino acid into the C-terminal portion of the peptide, and in some embodiments at a position C-terminal to position 27 of SEQ ID NO: 801.
- one, two or three charged amino acids may be introduced within the C-terminal portion, and in some embodiments C-terminal to position 27.
- the native amino acid(s) at positions 28 and/or 29 are substituted with a charged amino acid, and/or one to three charged amino acids are added to the C-terminus of the peptide, e.g. after position 27, 28 or 29.
- one, two, three or all of the charged amino acids are negatively charged.
- one, two, three or all of the charged amino acids are positively charged.
- the Class 1 glucagon related peptide may comprise any one or two of the following modifications: substitution of N28 with E; substitution of N28 with D; substitution of T29 with D; substitution of T29 with E; insertion of E after position 27, 28 or 29; insertion of D after position 27, 28 or 29.
- substitution of N28 with E substitution of N28 with D
- substitution of T29 with D substitution of T29 with E
- insertion of E after position 27, 28 or 29 substitution of D after position 27, 28 or 29.
- the Class 1 glucagon related peptide comprises an amino acid sequence of SEQ ID NO: 811, or an analog thereof that contains 1 to 3 further amino acid modifications (described herein in reference to glucagon agonists) relative to native glucagon, or a glucagon agonist analog thereof.
- SEQ ID NO: 811 represents a modified Class 1 glucagon related peptide, wherein the asparagine residue at position 28 of the native protein has been substituted with an aspartic acid.
- the Class 1 glucagon related peptide comprises an amino acid sequence of SEQ ID NO: 838, wherein the asparagine residue at position 28 of the native protein has been substituted with glutamic acid.
- Other exemplary embodiments include Class 1 glucagon related peptides of SEQ ID NOS: 824, 825, 826, 833, 835, 836 and 837.
- Class 1 glucagon related peptides may additionally exhibit improved stability and/or reduced degradation, for example, retaining at least 95% of the original peptide after 24 hours at 25° C.
- the Class 1 glucagon related peptides may include additional modifications that alter its pharmaceutical properties, e.g. increased potency, prolonged half-life in circulation, increased shelf-life, reduced precipitation or aggregation, and/or reduced degradation, e.g., reduced occurrence of cleavage or chemical modification after storage.
- any of the foregoing Class 1 glucagon related peptides can be further modified to improve stability by modifying the amino acid at position 15 of SEQ ID NO: 801 to reduce degradation of the peptide over time, especially in acidic or alkaline buffers.
- Asp at position 15 is substituted with a Glu, homo-Glu, cysteic acid, or homo-cysteic acid.
- any of the Class 1 glucagon related peptides described herein can be further modified to improve stability by modifying the amino acid at position 16 of SEQ ID NO: 801.
- Ser at position 16 is substituted with Thr or AIB, or any of the amino acids substitutions described herein with regard to Class 1 glucagon related peptides which enhance potency at the glucagon receptor.
- Such modifications reduce cleavage of the peptide bond between Asp15-Ser16.
- any of the Class 1 glucagon related peptides described herein can be further modified to reduce degradation at various amino acid positions by modifying any one, two, three, or all four of positions 20, 21, 24, or 27.
- Exemplary embodiments include substitution of Gln at position 20 with Ser, Thr, Ala or AIB, substitution of Asp at position 21 with Glu, substitution of Gln at position 24 with Ala or AIB, substitution of Met at position 27 with Leu or Nle.
- Removal or substitution of methionine reduces degradation due to oxidation of the methionine.
- Removal or substitution of Gln or Asn reduces degradation due to deamidation of Gln or Asn.
- Removal or substitution of Asp reduces degradation that occurs through dehydration of Asp to form a cyclic succinimide intermediate followed by isomerization to iso-aspartate.
- Class 1 glucagon related peptides are provided that have enhanced potency at the glucagon receptor, wherein the peptides comprise an amino acid modification at position 16 of native glucagon (SEQ ID NO: 801).
- enhanced potency can be provided by substituting the naturally occurring serine at position 16 with glutamic acid or with another negatively charged amino acid having a side chain with a length of 4 atoms, or alternatively with any one of glutamine, homoglutamic acid, or homocysteic acid, or a charged amino acid having a side chain containing at least one heteroatom, (e.g. N, O, S, P) and with a side chain length of about 4 (or 3-5) atoms.
- heteroatom e.g. N, O, S, P
- Substitution of serine at position 16 with glutamic acid enhances glucagon activity at least 2-fold, 4-fold, 5-fold and up to 10-fold greater at the glucagon receptor.
- the Class 1 glucagon related peptide retains selectivity for the glucagon receptor relative to the GLP-1 receptors, e.g., at least 5-fold, 10-fold, or 15-fold selectivity.
- the Class 1 glucagon related peptides disclosed herein are further modified at position 1 or 2 to reduce susceptibility to cleavage by dipeptidyl peptidase IV. More particularly, in some embodiments, position 1 and/or position 2 of the Class 1 glucagon related peptide is substituted with the DPP-IV resistant amino acid(s) described herein. In some embodiments, position 2 of the analog peptide is substituted with an amino isobutyric acid. In some embodiments, position 2 of the analog peptide is substituted with an amino acid selected from the group consisting of D-serine, D-alanine, glycine, N-methyl serine, and ⁇ -amino butyric acid.
- position 2 of the Class 1 glucagon related peptide is substituted with an amino acid selected from the group consisting of D-serine, glycine, and aminoisobutyric acid. In some embodiments, the amino acid at position 2 is not D-serine.
- Reduction in glucagon activity upon modification of the amino acids at position 1 and/or position 2 of the glucagon related peptide can be restored by stabilization of the alpha-helix structure in the C-terminal portion of the glucagon related peptide (around amino acids 12-29).
- the alpha helix structure can be stabilized by, e.g., formation of a covalent or non-covalent intramolecular bridge (e.g., a lactam bridge between side chains of amino acids at positions “i” and “i+4”, wherein i is an integer from 12 to 25), substitution and/or insertion of amino acids around positions 12-29 with an alpha helix-stabilizing amino acid (e.g., an ⁇ , ⁇ -disubstituted amino acid), as further described herein.
- a covalent or non-covalent intramolecular bridge e.g., a lactam bridge between side chains of amino acids at positions “i” and “i+4”, wherein i is an integer from 12 to 25
- substitution and/or insertion of amino acids around positions 12-29 with an alpha helix-stabilizing amino acid e.g., an ⁇ , ⁇ -disubstituted amino acid
- Glucagon receptor activity can be reduced by an amino acid modification at position 3 (according to the amino acid numbering of wild type glucagon), e.g. substitution of the naturally occurring glutamine at position 3, with an acidic, basic, or a hydrophobic amino acid.
- substitution at position 3 with glutamic acid, ornithine, or norleucine substantially reduces or destroys glucagon receptor activity.
- glucagon agonists can comprise the amino acid sequence of SEQ ID NO: 863, SEQ ID NO: 869, SEQ ID NO: 870, SEQ ID NO: 871, SEQ ID NO: 872, SEQ ID NO: 873 and SEQ ID NO: 874.
- Enhanced activity at the GLP-1 receptor is provided by replacing the carboxylic acid of the C-terminal amino acid with a charge-neutral group, such as an amide or ester. Conversely, retaining the native carboxylic acid at the C-terminus of the peptide maintains the relatively greater selectivity of the Class 1 glucagon related peptide for the glucagon receptor vs. the GLP-1 receptor (e.g., greater than about 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20-fold).
- Class 1 glucagon related peptide may further increase solubility and/or stability and/or glucagon activity.
- the Class 1 glucagon related peptide may alternatively comprise other modifications that do not substantially affect solubility or stability, and that do not substantially decrease glucagon activity.
- the Class 1 glucagon related peptide may comprise a total of up to 11, or up to 12, or up to 13, or up to 14 amino acid modifications relative to the native glucagon sequence. For example, conservative or non-conservative substitutions, additions or deletions may be carried out at any of positions 2, 5, 7, 10, 11, 12, 13, 14, 17, 18, 19, 20, 21, 24, 27, 28 or 29.
- Class 1 glucagon related peptide examples include but are not limited to:
- non-conservative substitutions conservative substitutions, additions or deletions while retaining at least partial glucagon agonist activity, for example, conservative substitutions at one or more of positions 2, 5, 7, 10, 11, 12, 13, 14, 16, 17, 18, 19, 20, 21, 24, 27, 28 or 29, substitution of Tyr at position 10 with Val or Phe, substitution of Lys at position 12 with Arg, substitution of one or more of these positions with Ala;
- modification of the aspartic acid at position 15 for example, by substitution with glutamic acid, homoglutamic acid, cysteic acid or homocysteic acid, which may reduce degradation; or modification of the serine at position 16, for example, by substitution of threonine, AIB, glutamic acid or with another negatively charged amino acid having a side chain with a length of 4 atoms, or alternatively with any one of glutamine, homoglutamic acid, or homocysteic acid, which likewise may reduce degradation due to cleavage of the Asp15-Ser16 bond;
- hydrophilic moiety such as the water soluble polymer polyethylene glycol, as described herein, e.g. at position 16, 17, 20, 21, 24, 29, 40 or at the C-terminal amino acid, which may increase solubility and/or half-life;
- acylating or alkylating the glucagon related peptide as described herein which may increase the activity at the glucagon receptor and/or the GLP-1 receptor, increase half-life in circulation and/or extending the duration of action and/or delaying the onset of action, optionally combined with addition of a hydrophilic moiety, additionally or alternatively, optionally combined with a modification which selectively reduces activity at the GLP-1 peptide, e.g., a modification of the Thr at position 7, such as a substitution of the Thr at position 7 with an amino acid lacking a hydroxyl group, e.g., Abu or Ile; deleting amino acids C-terminal to the amino acid at position 27 (e.g., deleting one or both of the amino acids at positions 28 and 29, yielding a peptide 27 or 28 amino acids in length);
- exemplary modifications of the Class 1 glucagon related peptide include at least one amino acid modification selected from Group A and one or more amino acid modifications selected from Group B and/or Group C, wherein Group A is:
- Thr at position 29 substitution of Thr at position 29 with a charged amino acid selected from the group consisting of Lys, Arg, His, Asp, Glu, cysteic acid, and homocysteic acid;
- Group B is:
- Group C is:
- DPP-IV dipeptidyl peptidase IV
- DPP-IV dipeptidyl peptidase IV
- Lys at position 12 is substituted with Arg.
- amino acids at positions 29 and/or 28, and optionally at position 27, are deleted.
- the glucagon related peptide comprises (a) an amino acid modification at position 1 and/or 2 that confers DPP-IV resistance, e.g., substitution with DMIA at position 1, or AIB at position 2, (b) an intramolecular bridge within positions 12-29, e.g.
- amino acid at position 29 in certain embodiments is Thr or Gly.
- the glucagon related peptide comprises (a) Asp28Glu29, or Glu28Glu29, or Glu29Glu30, or Glu28Glu30 or Asp28Glu30, and optionally (b) an amino acid modification at position 16 that substitutes Ser with, e.g. Thr or AIB, and optionally (c) an amino acid modification at position 27 that substitutes Met with, e.g., Nle, and optionally (d) amino acid modifications at positions 20, 21 and 24 that reduce degradation.
- the glucagon related peptide is T16, A20, E21, A24, Nle27, D28, E29.
- the Class 1 glucagon related peptide comprises the amino acid sequence:
- X1-X2-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Z (SEQ ID NO: 839) with 1 to 3 amino acid modifications thereto, wherein X1 and/or X2 is a non-native amino acid that reduces susceptibility of (or increases resistance of) the glucagon related peptide to cleavage by dipeptidyl peptidase IV (DPP-IV), wherein Z is selected from the group consisting of —COOH (the naturally occurring C-terminal carboxylate), -Asn-COOH, Asn-Thr-COOH, and Y—COOH, wherein Y is 1 to 2 amino acids, and wherein an intramolecular bridge, preferably a covalent bond, connects the side chains
- the intramolecular bridge is a lactam bridge.
- the amino acids at positions i and i+4 of SEQ ID NO: 839 are Lys and Glu, e.g., Glu16 and Lys20.
- X1 is selected from the group consisting of: D-His, N-methyl-His, alpha-methyl-His, imidazole acetic acid, des-amino-His, hydroxyl-His, acetyl-His, homo-His, and alpha, alpha-dimethyl imidiazole acetic acid (DMIA).
- X2 is selected from the group consisting of: D-Ser, D-Ala, Gly, N-methyl-Ser, Val, and alpha, amino isobutyric acid (AIB).
- the glucagon related peptide is covalently linked to a hydrophilic moiety at any of amino acid positions 16, 17, 20, 21, 24, 29, 40, within a C-terminal extension, or at the C-terminal amino acid.
- this hydrophilic moiety is covalently linked to a Lys, Cys, Orn, homocysteine, or acetyl-phenylalanine residue at any of these positions.
- Exemplary hydrophilic moieties include polyethylene glycol (PEG), for example, of a molecular weight of about 1,000 Daltons to about 40,000 Daltons, or about 20,000 Daltons to about 40,000 Daltons.
- the Class I glucagon related peptide comprises the amino acid sequence: X1-X2-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Z (SEQ ID NO: 839), wherein X1 and/or X2 is a non-native amino acid that reduces susceptibility of (or increases resistance of) the glucagon related peptide to cleavage by dipeptidyl peptidase IV (DPP-IV), wherein one, two, three, four or more of positions 16, 20, 21, and 24 of the glucagon related peptide is substituted with an ⁇ , ⁇ -disubstituted amino acid, and wherein Z is selected from the group consisting of —COOH (the naturally occurring C-terminal carboxy
- Exemplary further amino acid modifications to the foregoing Class 1 glucagon related peptides or analogs include substitution of Thr at position 7 with an amino acid lacking a hydroxyl group, e.g., aminobutyric acid (Abu), Ile, optionally, in combination with substitution or addition of an amino acid comprising a side chain covalently attached (optionally, through a spacer) to an acyl or alkyl group, which acyl or alkyl group is non-native to a naturally-occurring amino acid, substitution of Lys at position 12 with Arg; substitution of Asp at position 15 with Glu; substitution of Ser at position 16 with Thr or AIB; substitution of Gln at position 20 with Ser, Thr, Ala or AIB; substitution of Asp at position 21 with Glu; substitution of Gln at position 24 with Ser, Thr, Ala or AIB; substitution of Met at position 27 with Leu or Nle; substitution of Asn at position 28 with a charged amino acid; substitution of Asn at position 28 with
- the native glucagon peptide of SEQ ID NO: 801 is modified by the substitution of the native amino acid at position 28 and/or 29 with a negatively charged amino acid (e.g., aspartic acid or glutamic acid) and optionally the addition of a negatively charged amino acid (e.g., aspartic acid or glutamic acid) to the carboxy terminus of the peptide.
- a negatively charged amino acid e.g., aspartic acid or glutamic acid
- a negatively charged amino acid e.g., aspartic acid or glutamic acid
- the native glucagon peptide of SEQ ID NO: 801 is modified by the substitution of the native amino acid at position 29 with a positively charged amino acid (e.g., lysine, arginine or histidine) and optionally the addition of one or two positively charged amino acid (e.g., lysine, arginine or histidine) on the carboxy terminus of the peptide.
- a positively charged amino acid e.g., lysine, arginine or histidine
- one or two positively charged amino acid e.g., lysine, arginine or histidine
- a glucagon analog having improved solubility and stability comprising the amino acid sequence of SEQ ID NO: 834 with the proviso that at least one amino acids at position, 28, or 29 is substituted with an acidic amino acid and/or an additional acidic amino acid is added at the carboxy terminus of SEQ ID NO: 834.
- the acidic amino acids are independently selected from the group consisting of Asp, Glu, cysteic acid and homocysteic acid.
- a glucagon agonist having improved solubility and stability wherein the agonist comprises the amino acid sequence of SEQ ID NO: 833, wherein at least one of the amino acids at positions 27, 28 or 29 is substituted with a non-native amino acid residue (i.e. at least one amino acid present at position 27, 28 or 29 of the analog is an acid amino acid different from the amino acid present at the corresponding position in SEQ ID NO: 801).
- a glucagon agonist comprising the sequence of SEQ ID NO: 833 with the proviso that when the amino acid at position 28 is asparagine and the amino acid at position 29 is threonine, the peptide further comprises one to two amino acids, independently selected from the group consisting of Lys, Arg, His, Asp or Glu, added to the carboxy terminus of the glucagon related peptide.
- the methionine residue present at position 27 of the native peptide is changed to leucine or norleucine to prevent oxidative degradation of the peptide.
- a glucagon analog of SEQ ID NO: 833 wherein 1 to 6 amino acids, selected from positions 1, 2, 5, 7, 10, 11, 12, 13, 14, 16, 17, 18, 19, 20, 21 or 24 of the analog differ from the corresponding amino acid of SEQ ID NO: 801.
- a glucagon analog of SEQ ID NO: 833 is provided wherein 1 to 3 amino acids selected from positions 1, 2, 5, 7, 10, 11, 12, 13, 14, 16, 17, 18, 19, 20, 21 or 24 of the analog differ from the corresponding amino acid of SEQ ID NO: 801.
- a glucagon analog of SEQ ID NO: 807, SEQ ID NO: 808 or SEQ ID NO: 834 is provided wherein 1 to 2 amino acids selected from positions 1, 2, 5, 7, 10, 11, 12, 13, 14, 16, 17, 18, 19, 20, 21 or 24 of the analog differ from the corresponding amino acid of SEQ ID NO: 801, and in a further embodiment those one to two differing amino acids represent conservative amino acid substitutions relative to the amino acid present in the native sequence (SEQ ID NO: 801).
- a glucagon related peptide of SEQ ID NO: 811 or SEQ ID NO: 813 wherein the glucagon related peptide further comprises one, two or three amino acid substitutions at positions selected from positions 2, 5, 7, 10, 11, 12, 13, 14, 16, 17, 18, 19, 20, 21, 24, 27 or 29. In some embodiments the substitutions at positions 2, 5, 7, 10, 11, 12, 13, 14, 16, 17, 18, 19, 20, 27 or 29 are conservative amino acid substitutions.
- a glucagon agonist comprising an analog peptide of SEQ ID NO: 801 wherein the analog differs from SEQ ID NO: 801 by having an amino acid other than serine at position 2 and by having an acidic amino acid substituted for the native amino acid at position 28 or 29 or an acidic amino acid added to the carboxy terminus of the peptide of SEQ ID NO: 801.
- the acidic amino acid is aspartic acid or glutamic acid.
- a glucagon analog of SEQ ID NO: 809, SEQ ID NO: 812, SEQ ID NO: 813 or SEQ ID NO: 832 is provided wherein the analog differs from the parent molecule by a substitution at position 2. More particularly, position 2 of the analog peptide is substituted with an amino acid selected from the group consisting of D-serine, alanine, D-alanine, glycine, n-methyl serine and amino isobutyric acid.
- a glucagon agonist comprising an analog peptide of SEQ ID NO: 801 wherein the analog differs from SEQ ID NO: 801 by having an amino acid other than histidine at position 1 and by having an acidic amino acid substituted for the native amino acid at position 28 or 29 or an acidic amino acid added to the carboxy terminus of the peptide of SEQ ID NO: 801.
- the acidic amino acid is aspartic acid or glutamic acid.
- a glucagon analog of SEQ ID NO: 809, SEQ ID NO: 812, SEQ ID NO: 813 or SEQ ID NO: 832 is provided wherein the analog differs from the parent molecule by a substitution at position 1.
- position 1 of the analog peptide is substituted with an amino acid selected from the group consisting of DMIA, D-histidine, desaminohistidine, hydroxyl-histidine, acetyl-histidine and homo-histidine.
- the modified glucagon related peptide comprises a sequence selected from the group consisting of SEQ ID NO: 809, SEQ ID NO: 812, SEQ ID NO: 813 and SEQ ID NO: 832.
- a glucagon related peptide is provided comprising a sequence of SEQ ID NO: 809, SEQ ID NO: 812, SEQ ID NO: 813 or SEQ ID NO: 832 further comprising one to two amino acids, added to the C-terminus of SEQ ID NO: 809, SEQ ID NO: 812, SEQ ID NO: 813 or SEQ ID NO: 832, wherein the additional amino acids are independently selected from the group consisting of Lys, Arg, His, Asp Glu, cysteic acid or homocysteic acid.
- the additional amino acids added to the carboxy terminus are selected from the group consisting of Lys, Arg, His, Asp or Glu or in a further embodiment the additional amino acids are Asp or Glu
- the glucagon related peptide comprises the sequence of SEQ ID NO: 7 or a glucagon agonist analog thereof.
- the peptide comprising a sequence selected from the group consisting of SEQ ID NO: 808, SEQ ID NO: 810, SEQ ID NO: 811, SEQ ID NO: 812 and SEQ ID NO: 813.
- the peptide comprising a sequence selected from the group consisting of SEQ ID NO: 808, SEQ ID NO: 810 and SEQ ID NO: 811.
- the glucagon related peptide comprises the sequence of SEQ ID NO: 808, SEQ ID NO: 810 and SEQ ID NO: 811 further comprising an additional amino acid, selected from the group consisting of Asp and Glu, added to the C-terminus of the glucagon related peptide.
- the glucagon related peptide comprises the sequence of SEQ ID NO: 811 or SEQ ID NO: 813, and in a further embodiment the glucagon related peptide comprises the sequence of SEQ ID NO: 811.
- Xaa at position 15 is Asp, Glu, cysteic acid, homoglutamic acid or homocysteic acid
- the Xaa at position 28 is Asn or an acidic amino acid
- the Xaa at position 29 is Thr or an acidic amino acid
- R is an acidic amino acid, COOH or CONH 2 , with the proviso that an acidic acid residue is present at one of positions 28, 29 or 30.
- R is COOH, and in another embodiment R is CONH 2 .
- the present disclosure also encompasses glucagon fusion peptides wherein a second peptide has been fused to the C-terminus of the glucagon related peptide to enhance the stability and solubility of the glucagon related peptide.
- the fusion glucagon related peptide may comprise a glucagon agonist analog comprising a glucagon related peptide NH 2 -His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Xaa-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Xaa-Xaa-Xaa-R (SEQ ID NO: 834), wherein R is an acidic amino acid or a bond and an amino acid sequence of SEQ ID NO: 820 (GPSSGAPPPS), SEQ ID NO: 821 (KRNRNNIA) or SEQ ID NO: 822 (KRNR) linked to the carboxy terminal amino acid of the glucagon related peptide.
- a glucagon agonist analog comprising a glucagon related peptide NH 2 -His-S
- the glucagon related peptide is selected from the group consisting of SEQ ID NO: 833, SEQ ID NO: 807 or SEQ ID NO: 808 further comprising an amino acid sequence of SEQ ID NO: 820 (GPSSGAPPPS), SEQ ID NO: 821 (KRNRNNIA) or SEQ ID NO: 822 (KRNR) linked to the carboxy terminal amino acid of the glucagon related peptide.
- the glucagon fusion peptide comprises SEQ ID NO: 802, SEQ ID NO: 803, SEQ ID NO: 804, SEQ ID NO: 805 and SEQ ID NO: 806 or a glucagon agonist analog thereof, further comprising an amino acid sequence of SEQ ID NO: 820 (GPSSGAPPPS), SEQ ID NO: 821 (KRNRNNIA) or SEQ ID NO: 822 (KRNR) linked to amino acid 29 of the glucagon related peptide.
- the fusion peptide further comprises a PEG chain linked to an amino acid at position 16, 17, 21, 24, 29, within a C-terminal extension, or at the C-terminal amino acid, wherein the PEG chain is selected from the range of 500 to 40,000 Daltons.
- the amino acid sequence of SEQ ID NO: 820 (GPSSGAPPPS), SEQ ID NO: 821 (KRNRNNIA) or SEQ ID NO: 822 (KRNR) is bound to amino acid 29 of the glucagon related peptide through a peptide bond.
- the glucagon related peptide portion of the glucagon fusion peptide comprises a sequence selected from the group consisting of SEQ ID NO: 810, SEQ ID NO: 811 and SEQ ID NO: 813. In some embodiments the glucagon related peptide portion of the glucagon fusion peptide comprises the sequence of SEQ ID NO: 811 or SEQ ID NO: 813, wherein a PEG chain is linked at position 21, 24, 29, within a C-terminal extension or at the C-terminal amino acid, respectively.
- the glucagon related peptide sequence of the fusion peptide comprises the sequence of SEQ ID NO: 811, further comprising an amino acid sequence of SEQ ID NO: 820 (GPSSGAPPPS), SEQ ID NO: 821 (KRNRNNIA) or SEQ ID NO: 822 (KRNR) linked to amino acid 29 of the glucagon related peptide.
- the glucagon fusion peptide comprises a sequence selected from the group consisting of SEQ ID NO: 824, SEQ ID NO: 825 and SEQ ID NO: 826.
- the fusion peptides of the present invention will have a C-terminal amino acid with the standard carboxylic acid group.
- the fusion glucagon related peptide comprises a glucagon agonist analog selected from the group consisting of SEQ ID NO: 810, SEQ ID NO: 811 and SEQ ID NO: 813, further comprising an amino acid sequence of SEQ ID NO: 823 (GPSSGAPPPS-CONH 2 ) linked to amino acid 29 of the glucagon related peptide.
- the glucagon agonists of the present invention can be further modified to improve the peptide's solubility and stability in aqueous solutions while retaining the biological activity of the glucagon related peptide.
- introduction of hydrophilic groups at one or more positions selected from positions 16, 17, 20, 21, 24 and 29 of the peptide of SEQ ID NO: 811, or a glucagon agonist analog thereof, are anticipated to improve the solubility and stability of the pH stabilize glucagon analog.
- the glucagon related peptide of SEQ ID NO: 810, SEQ ID NO: 811, SEQ ID NO: 813, or SEQ ID NO: 832 is modified to comprise one or more hydrophilic groups covalently linked to the side chains of amino acids present at positions 21 and 24 of the glucagon related peptide.
- the glucagon related peptide of SEQ ID NO: 811 is modified to contain one or more amino acid substitution at positions 16, 17, 20, 21, 24 and/or 29, wherein the native amino acid is substituted with an amino acid having a side chain suitable for crosslinking with hydrophilic moieties, including for example, PEG.
- the native peptide can be substituted with a naturally occurring amino acid or a synthetic (non-naturally occurring) amino acid.
- Synthetic or non-naturally occurring amino acids refer to amino acids that do not naturally occur in vivo but which, nevertheless, can be incorporated into the peptide structures described herein.
- a glucagon agonist of SEQ ID NO: 810, SEQ ID NO: 811 or SEQ ID NO: 813 wherein the native glucagon peptide sequence has been modified to contain a naturally occurring or synthetic amino acid in at least one of positions 16, 17, 21, 24, 29, within a C-terminal extension or at the C-terminal amino acid of the native sequence, wherein the amino acid substitute further comprises a hydrophilic moiety.
- the substitution is at position 21 or 24, and in a further embodiment the hydrophilic moiety is a PEG chain.
- the glucagon related peptide of SEQ ID NO: 811 is substituted with at least one cysteine residue, wherein the side chain of the cysteine residue is further modified with a thiol reactive reagent, including for example, maleimido, vinyl sulfone, 2-pyridylthio, haloalkyl, and haloacyl.
- thiol reactive reagents may contain carboxy, keto, hydroxyl, and ether groups as well as other hydrophilic moieties such as polyethylene glycol units.
- the native glucagon peptide is substituted with lysine, and the side chain of the substituting lysine residue is further modified using amine reactive reagents such as active esters (succinimido, anhydride, etc) of carboxylic acids or aldehydes of hydrophilic moieties such as polyethylene glycol.
- amine reactive reagents such as active esters (succinimido, anhydride, etc) of carboxylic acids or aldehydes of hydrophilic moieties such as polyethylene glycol.
- the glucagon related peptide is selected from the group consisting of SEQ ID NO: 814, SEQ ID NO: 815, SEQ ID NO: 816, SEQ ID NO: 817, SEQ ID NO: 818 and SEQ ID NO: 819.
- the pegylated glucagon related peptide comprises two or more polyethylene glycol chains covalently bound to the glucagon related peptide wherein the total molecular weight of the glucagon chains is about 1,000 to about 5,000 Daltons.
- the pegylated glucagon agonist comprises a peptide of SEQ ID NO: 806, wherein a PEG chain is covalently linked to the amino acid residue at position 21 and at position 24, and wherein the combined molecular weight of the two PEG chains is about 1,000 to about 5,000 Daltons.
- the pegylated glucagon agonist comprises a peptide of SEQ ID NO: 806, wherein a PEG chain is covalently linked to the amino acid residue at position 21 and at position 24, and wherein the combined molecular weight of the two PEG chains is about 5,000 to about 20,000 Daltons.
- the polyethylene glycol chain may be in the form of a straight chain or it may be branched. In accordance with some embodiments the polyethylene glycol chain has an average molecular weight selected from the range of about 500 to about 40,000 Daltons. In some embodiments the polyethylene glycol chain has a molecular weight selected from the range of about 500 to about 5,000 Daltons. In another embodiment the polyethylene glycol chain has a molecular weight of about 20,000 to about 40,000 Daltons.
- any of the glucagon related peptides described above may be further modified to include a covalent or non-covalent intramolecular bridge or an alpha helix-stabilizing amino acid within the C-terminal portion of the glucagon related peptide (amino acid positions 12-29).
- the glucagon related peptide comprises any one or more of the modifications discussed above in addition to an amino acid substitution at positions 16, 20, 21, or 24 (or a combination thereof) with an ⁇ , ⁇ -disubstituted amino acid, e.g., AIB.
- the glucagon related peptide comprises any one or more modifications discussed above in addition to an intramolecular bridge, e.g., a lactam, between the side chains of the amino acids at positions 16 and 20 of the glucagon related peptide.
- an intramolecular bridge e.g., a lactam
- the glucagon related peptide comprises the amino acid sequence of SEQ ID NO: 877, wherein the Xaa at position 3 is an amino acid comprising a side chain of Structure I, II, or III:
- R 1 is C 0-3 alkyl or C 0-3 heteroalkyl
- R 2 is NHR 4 or C 1-3 alkyl
- R 3 is C 1-3 alkyl
- R 4 is H or C 1-3 alkyl
- X is NH, O, or S
- Y is NHR 4 , SR 3 , or OR 3 .
- X is NH or Y is NHR 4 .
- R 1 is C 0-2 alkyl or C 1 heteroalkyl.
- R 2 is NHR 4 or C 1 alkyl.
- R 4 is H or C 1 alkyl.
- an amino acid comprising a side chain of Structure I wherein, R 1 is CH—S, X is NH, and R 2 is CH 3 (acetamidomethyl-cysteine, C(Acm)); R 1 is CH 2 , X is NH, and R 2 is CH 3 (acetyldiaminobutanoic acid, Dab(Ac)); R 1 is C 0 alkyl, X is NH, R 2 is NHR 4 , and R 4 is H (carbamoyldiaminopropanoic acid, Dap(urea)); or R 1 is CH 2 —CH 2 , X is NH, and R 2 is CH 3 (acetylornithine, Orn(Ac)).
- an amino acid comprising a side chain of Structure II is provided, wherein R 1 is CH 2 , Y is NHR 4 , and R 4 is CH 3 (methylglutamine, Q(Me));
- an amino acid comprising a side chain of Structure III is provided wherein, R 1 is CH 2 and R 4 is H (methionine-sulfoxide, M(O));
- the amino acid at position 3 is substituted with Dab(Ac).
- glucagon agonists can comprise the amino acid sequence of SEQ ID NO: 863, SEQ ID NO: 869, SEQ ID NO: 871, SEQ ID NO: 872, SEQ ID NO: 873 and SEQ ID NO: 874.
- the glucagon related peptide is an analog of the glucagon related peptide of SEQ ID NO: 877.
- the analog comprises any of the amino acid modifications described herein, including, but not limited to: a substitution of Asn at position 28 with a charged amino acid; a substitution of Asn at position 28 with a charged amino acid selected from the group consisting of Lys, Arg, His, Asp, Glu, cysteic acid, and homocysteic acid; a substitution at position 28 with Asn, Asp, or Glu; a substitution at position 28 with Asp; a substitution at position 28 with Glu; a substitution of Thr at position 29 with a charged amino acid; a substitution of Thr at position 29 with a charged amino acid selected from the group consisting of Lys, Arg, His, Asp, Glu, cysteic acid, and homocysteic acid; a substitution at position 29 with Asp, Glu, or Lys; a substitution at position 29 with Glu;
- the analog of the glucagon related peptide of SEQ ID NO: 877 comprises an ⁇ , ⁇ -disubstituted amino acid, such as AIB, at one, two, three, or all of positions 16, 20, 21, and 24.
- the analog of the glucagon related peptide of SEQ ID NO: 877 comprises one or more of the following: substitution of His at position 1 with a non-native amino acid that reduces susceptibility of the glucagon related peptide to cleavage by dipeptidyl peptidase IV (DPP-IV), substitution of Ser at position 2 with a non-native amino acid that reduces susceptibility of the glucagon related peptide to cleavage by dipeptidyl peptidase IV (DPP-IV), substitution of Thr at position 7 with an amino acid lacking a hydroxyl group, e.g., Abu or Ile; substitution of Tyr at position 10 with Phe or Val; substitution of Lys at position 12 with Arg; substitution of Asp at position 15 with Glu, substitution of Ser at position 16 with Thr or AIB; substitution of Gln at position 20 with Ala or AIB; substitution of Asp at position 21 with Glu; substitution of Gln at position 24 with Ala or AI
- the glucagon related peptide comprises the amino acid sequence of any of SEQ ID NOs: 862-867 and 869-874.
- the analog of the glucagon related peptide comprising SEQ ID NO: 877 comprises a hydrophilic moiety, e.g., PEG, covalently linked to the amino acid at any of positions 16, 17, 20, 21, 24, and 29 or at the C-terminal amino acid.
- the analog of the glucagon related peptide comprising SEQ ID NO: 877 comprises an amino acid comprising a side chain covalently attached, optionally, through a spacer, to an acyl group or an alkyl group, which acyl group or alkyl group is non-native to a naturally-occurring amino acid.
- the acyl group in some embodiments is a C4 to C30 fatty acyl group.
- the alkyl group is a C4 to C30 alkyl.
- the acyl group or alkyl group is covalently attached to the side chain of the amino acid at position 10.
- the amino acid at position 7 is Ile or Abu.
- the glucagon agonist may be a peptide comprising the amino acid sequence of any of the SEQ ID NOs: 801-919, optionally with up to 1, 2, 3, 4, or 5 further modifications that retain glucagon agonist activity.
- the glucagon agonist comprises the amino acids of any of SEQ ID NOs: 859-919.
- the glucagon related peptide is a Class 2 glucagon related peptide, which is described herein and in International Patent Application No. PCT US2009/47447 (filed on Jun. 16, 2009),U.S. Provisional Application No. 61/090,448, and U.S. Application No. 61/151,349, the contents of which are incorporated by reference in their entirety.
- the biological sequences referenced in the following section (SEQ ID NOs: 1001-1262) relating to Class 2 glucagon related peptides correspond to SEQ ID NOs: 1-262 in International Patent Application No. PCT US2009/47447.
- Native glucagon does not activate the GIP receptor, and normally has about 1% of the activity of native-GLP-1 at the GLP-1 receptor. Modifications to the native glucagon sequence described herein produce Class 2 glucagon related peptides that can exhibit potent glucagon activity equivalent to or better than the activity of native glucagon (SEQ ID NO: 1001), potent GIP activity equivalent to or better than the activity of native GIP (SEQ ID NO: 1004), and/or potent GLP-1 activity equivalent to or better than the activity of native GLP-1.
- the Class 2 glucagon related peptide may be one of a glucagon/GIP co-agonist, glucagon/GIP/GLP-1 tri-agonist, GIP/GLP-1 co-agonist, or a GIP agonist glucagon related peptide, as further described herein.
- the Class 2 glucagon related peptides described herein exhibit an EC50 for GIP receptor activation activity of about 100 nM or less, or about 75, 50, 25, 10, 8, 6, 5, 4, 3, 2 or 1 nM or less. In some embodiments, the Class 2 glucagon related peptides exhibit an EC50 for glucagon receptor activation of about 100 nM or less, or about 75, 50, 25, 10, 8, 6, 5, 4, 3, 2 or 1 nM or less. In some embodiments, the Class 2 glucagon related peptides exhibit an EC50 for GLP-1 receptor activation of about 100 nM or less, or about 75, 50, 25, 10, 8, 6, 5, 4, 3, 2 or 1 nM or less.
- Receptor activation can be measured by in vitro assays measuring cAMP induction in HEK293 cells over-expressing the receptor, e.g. assaying HEK293 cells co-transfected with DNA encoding the receptor and a luciferase gene linked to cAMP responsive element as described in Example 7.
- Class 2 glucagon related peptides exhibit activity at both the glucagon receptor and the GIP receptor (“glucagon/GIP co-agonists”). These Class 2 glucagon related peptides have lost native glucagon's selectivity for glucagon receptor compared to GIP receptor.
- the EC50 of the Class 2 glucagon related peptide at the GIP receptor is less than about 50-fold, 40-fold, 30-fold or 20-fold different (higher or lower) from its EC50 at the glucagon receptor.
- the GIP potency of the Class 2 glucagon related peptide is less than about 500-, 450-, 400-, 350-, 300-, 250-, 200-, 150-, 100-, 75-, 50-, 25-, 20-, 15-, 10-, or 5-fold different (higher or lower) from its glucagon potency.
- the ratio of the EC50 of the Class 2 glucagon related peptide at the GIP receptor divided by the EC50 of the Class 2 glucagon related peptide at the glucagon receptor is less than about 100, 75, 60, 50, 40, 30, 20, 15, 10, or 5.
- GLP-1 activity have been significantly reduced or destroyed, e.g., by an amino acid modification at position 7, a deletion of the amino acid(s)C-terminal to the amino acid at position 27 or 28, yielding a 27- or 28-amino acid peptide, or a combination thereof.
- Class 2 glucagon related peptides exhibit activity at the glucagon, GIP and GLP-1 receptors (“glucagon/GIP/GLP-1 tri-agonists”). These Class 2 glucagon related peptides have lost native glucagon's selectivity for the glucagon receptor compared to both the GLP-1 and GIP receptors.
- the EC50 of the Class 2 glucagon related peptide at the GIP receptor is less than about 50-fold, 40-fold, 30-fold or 20-fold different (higher or lower) from its respective EC50s at the glucagon and GLP-1 receptors.
- the GIP potency of the Class 2 glucagon related peptide is less than about 500-, 450-, 400-, 350-, 300-, 250-, 200-, 150-, 100-, 75-, 50-, 25-, 20-, 15-, 10-, or 5-fold different (higher or lower) from its glucagon and GLP-1 potencies.
- the ratio of the EC50 of the tri-agonist at the GIP receptor divided by the EC50 of the tri-agonist at the GLP-1 receptor is less than about 100, 75, 60, 50, 40, 30, 20, 15, 10, or 5.
- Class 2 glucagon related peptides exhibit activity at the GLP-1 and GIP receptors, but in which the glucagon activity has been significantly reduced or destroyed (“GIP/GLP-1 co-agonists”), e.g., by an amino acid modification at position 3. For example, substitution at this position with an acidic, basic, or a hydrophobic amino acid (glutamic acid, ornithine, norleucine) reduces glucagon activity.
- the EC50 of the glucagon related peptide at the GIP receptor is less than about 50-fold, 40-fold, 30-fold or 20-fold different (higher or lower) from its EC50 at the GLP-1 receptor.
- the GIP potency of the Class 2 glucagon related peptide is less than about 25-, 20-, 15-, 10-, or 5-fold different (higher or lower) from its GLP-1 potency. In some embodiments these Class 2 glucagon related peptides have about 10% or less of the activity of native glucagon at the glucagon receptor, e.g. about 1-10%, or about 0.1-10%, or greater than about 0.1% but less than about 10%.
- the ratio of the EC50 of the Class 2 glucagon related peptide at the GIP receptor divided by the EC50 of the Class 2 glucagon related peptide at the GLP-1 receptor is less than about 100, 75, 60, 50, 40, 30, 20, 15, 10, or 5, and no less than 1. In some embodiments, the ratio of the GIP potency of the Class 2 glucagon related peptide compared to the GLP-1 potency of the Class 2 glucagon related peptide is less than about 100, 75, 60, 50, 40, 30, 20, 15, 10, or 5, and no less than 1.
- Class 2 glucagon related peptides exhibit activity at the GIP receptor, in which the glucagon and GLP-1 activity have been significantly reduced or destroyed (“GIP agonist glucagon peptides”), e.g., by amino acid modifications at positions 3 with Glu and 7 with Ile.
- GIP agonist glucagon peptides e.g., by amino acid modifications at positions 3 with Glu and 7 with Ile.
- these Class 2 glucagon related peptides have about 10% or less of the activity of native glucagon at the glucagon receptor, e.g. about 1-10%, or about 0.1-10%, or greater than about 0.1%, 0.5%, or 1% but less than about 1%, 5%, or 10%.
- these Class 2 glucagon related peptides also have about 10% or less of the activity of native GLP-1 at the GLP-1 receptor, e.g. about 1-10%, or about 0.1-10%, or greater than about 0.1%, 0.5%, or 1% but less than about 1%, 5%, or 10%.
- Enhanced activity at the GIP receptor is provided by an amino acid modification at position 1.
- His at position 1 is substituted with a large, aromatic amino acid, optionally Tyr, Phe, Trp, amino-Phe, nitro-Phe, chloro-Phe, sulfo-Phe, 4-pyridyl-Ala, methyl-Tyr, or 3-amino Tyr.
- the combination of Tyr at position 1 with stabilization of the alpha helix within the region corresponding to amino acids 12-29 provided a Class 2 glucagon related peptide that activates the GIP receptor as well as the GLP-1 receptor and the glucagon receptor.
- the alpha helix structure can be stabilized by, e.g., formation of a covalent or non-covalent intramolecular bridge, or substitution and/or insertion of amino acids around positions 12-29 with an alpha helix-stabilizing amino acid (e.g., an ⁇ , ⁇ -disubstituted amino acid).
- an alpha helix-stabilizing amino acid e.g., an ⁇ , ⁇ -disubstituted amino acid
- Enhanced activity at the GIP receptor is also provided by amino acid modifications at positions 27 and/or 28, and optionally at position 29.
- the Met at position 27 is substituted with a large aliphatic amino acid, optionally Leu
- the Asn at position 28 is substituted with a small aliphatic amino acid, optionally Ala
- the Thr at position 29 is substituted with a small aliphatic amino acid, optionally Gly.
- Substitution with LAG at positions 27-29 provides increased GIP activity relative to the native MNT sequence at those positions.
- Enhanced activity at the GIP receptor is also provided by an amino acid modification at position 12.
- position 12 is substituted with a large, aliphatic, nonpolar amino acid, optionally Ile.
- Enhanced activity at the GIP receptor is also provided by an amino acid modification at positions 17 and/or 18.
- position 17 is substituted with a polar residue, optionally Gln
- position 18 is substituted with a small aliphatic amino acid, optionally Ala.
- a substitution with QA at positions 17 and 18 provides increased GIP activity relative to the native RR sequence at those positions.
- an intramolecular bridge can be formed by a covalent bond between the side chains of two amino acids at positions i and i+4 or between positions j and j+3, or between positions k and k+7.
- the bridge is between positions 12 and 16, 16 and 20, 20 and 24, 24 and 28, or 17 and 20.
- non-covalent interactions such as salt bridges can be formed between positively and negatively charged amino acids at these positions.
- enhanced glucagon potency is provided by an amino acid modification at position 16 of native glucagon (SEQ ID NO: 1001).
- such enhanced potency can be provided by substituting the naturally occurring serine at position 16 with glutamic acid or with another negatively charged amino acid having a side chain with a length of 4 atoms, or alternatively with any one of glutamine, homoglutamic acid, or homocysteic acid, or a charged amino acid having a side chain containing at least one heteroatom, (e.g. N, O, S, P) and with a side chain length of about 4 (or 3-5) atoms.
- the glucagon related peptide retains its original selectivity for the glucagon receptor relative to the GLP-1 receptors.
- Glucagon receptor activity can be reduced by an amino acid modification at position 3, e.g. substitution of the naturally occurring glutamine at position 3, with an acidic, basic, or a hydrophobic amino acid.
- substitution at position 3 with glutamic acid, ornithine, or norleucine substantially reduces or destroys glucagon receptor activity.
- glucagon agonists can comprise the amino acid sequence of any of SEQ ID NOs: 1243-1248, 1250, 1251, and 1253-1256.
- an intramolecular bridge can be formed by a covalent bond between the side chains of two amino acids at positions i and i+4 or between positions j and j+3, or between positions k and k+7.
- non-covalent interactions such as salt bridges can be formed between positively and negatively charged amino acids at these positions.
- one or more ⁇ , ⁇ -disubstituted amino acids are inserted or substituted into this C-terminal portion (amino acids 12-29) at positions that retain the desired activity.
- amino acids 12-29 amino acids 12-29
- one, two, three or all of positions 16, 20, 21 or 24 are substituted with an ⁇ , ⁇ -disubstituted amino acid, e.g., AIB.
- Enhanced activity at the GLP-1 receptor is provided by replacing the carboxylic acid of the C-terminal amino acid with a charge-neutral group, such as an amide or ester.
- Enhanced activity at the GLP-1 receptor is also provided by stabilizing the alpha-helix structure in the C-terminal portion of glucagon (around amino acids 12-29), e.g., through formation of an intramolecular bridge between the side chains of two amino acids, or substitution and/or insertion of amino acids around positions 12-29 with an alpha helix-stabilizing amino acid (e.g., an ⁇ , ⁇ -disubstituted amino acid), as further described herein.
- an alpha helix-stabilizing amino acid e.g., an ⁇ , ⁇ -disubstituted amino acid
- the side chains of the amino acid pairs 12 and 16, 13 and 17, 16 and 20, 17 and 21, 20 and 24 or 24 and 28 are linked to one another and thus stabilize the glucagon alpha helix.
- the bridge or linker is about 8 (or about 7-9) atoms in length, particularly when the bridge is between positions i and i+4. In some embodiments, the bridge or linker is about 6 (or about 5-7) atoms in length, particularly when the bridge is between positions j and j+3.
- intramolecular bridges are formed by (a) substituting the naturally occurring serine at position 16 with glutamic acid or with another negatively charged amino acid having a side chain with a length of 4 atoms, or alternatively with any one of glutamine, homoglutamic acid, or homocysteic acid, or a charged amino acid having a side chain containing at least one heteroatom, (e.g.
- the side chains of such amino acids at positions 16 and 20 can form a salt bridge or can be covalently linked.
- the two amino acids are bound to one another to form a lactam ring.
- stabilization of the alpha helix structure in the C-terminal portion of the glucagon related peptide is achieved through the formation of an intramolecular bridge other than a lactam bridge.
- suitable covalent bonding methods include any one or more of olefin metathesis, lanthionine-based cyclization, disulfide bridge or modified sulfur-containing bridge formation, the use of a, w-diaminoalkane tethers, the formation of metal-atom bridges, and other means of peptide cyclization are used to stabilize the alpha helix.
- one or more ⁇ , ⁇ -disubstituted amino acids are inserted or substituted into this C-terminal portion (amino acids 12-29) at positions that retain the desired activity.
- amino acids 12-29 amino acids 12-29
- one, two, three or all of positions 16, 20, 21 or 24 are substituted with an ⁇ , ⁇ -disubstituted amino acid, e.g., AIB.
- Increased activity at the GLP-1 receptor is provided by an amino acid modification at position 20 as described herein.
- Increased activity at the GLP-1 receptor is also provided by adding GPSSGAPPPS (SEQ ID NO: 1095) or XGPSSGAPPPS (SEQ ID NO: 1096) to the C-terminus.
- GLP-1 activity in such analogs can be further increased by modifying the amino acid at position 18, 28 or 29, or at position 18 and 29, as described herein.
- a further modest increase in GLP-1 potency is provided by modifying the amino acid at position 10 to be a large, aromatic amino acid residue, optionally Trp.
- Potency at the GLP-1 receptor can be further enhanced by an alanine substitution for the native arginine at position 18.
- Reduced activity at the GLP-1 receptor is provided, e.g., by an amino acid modification at position 7 as described herein.
- any of the modifications described above in reference to a Class 2 glucagon related peptide which increase GLP-1 receptor activity can be applied individually or in combination. Combinations of the modifications that increase GLP-1 receptor activity generally provide higher GLP-1 activity than any of such modifications taken alone.
- the invention provides glucagon related peptides that comprise modifications at position 16, at position 20, and at the C-terminal carboxylic acid group, optionally with a covalent bond between the amino acids at positions 16 and 20; glucagon related peptides that comprise modifications at position 16 and at the C-terminal carboxylic acid group; glucagon related peptides that comprise modifications at positions 16 and 20, optionally with a covalent bond between the amino acids at positions 16 and 20; and glucagon related peptides that comprise modifications at position 20 and at the C-terminal carboxylic acid group.
- Modifications at position 1 and/or 2 can increase the peptide's resistance to dipeptidyl peptidase IV (DPP IV) cleavage.
- DPP IV dipeptidyl peptidase IV
- position 1 and/or position 2 may be substituted with a DPP-IV resistant amino acid as described herein.
- the amino acid at position 2 is substituted with N-methyl alanine.
- modifications at position 2 may reduce glucagon activity, sometimes significantly; surprisingly, this reduction in glucagon activity can be restored by stabilizing the alpha-helix structure in the C-terminal portion of glucagon (around amino acids 12-29), e.g., through formation of a covalent bond between the side chains of two amino acids, as described herein.
- the covalent bond is between amino acids at positions “i” and “i+4”, or positions “j” and “j+3”, e.g., between positions 12 and 16, 16 and 20, 20 and 24, 24 and 28, or 17 and 20.
- this covalent bond is a lactam bridge between a glutamic acid at position 16 and a lysine at position 20. In some embodiments, this covalent bond is an intramolecular bridge other than a lactam bridge, as described herein.
- any of the Class 2 glucagon related peptides can be further modified to improve stability by modifying the amino acid at position 15 and/or 16 of SEQ ID NO: 1001 to reduce degradation of the peptide over time, especially in acidic or alkaline buffers. Such modifications reduce cleavage of the Asp15-Ser16 peptide bond.
- the amino acid modification at position 15 is a deletion or substitution of Asp with glutamic acid, homoglutamic acid, cysteic acid or homocysteic acid.
- the amino acid modification at position 16 is a deletion or substitution of Ser with Thr or AIB.
- Ser at position 16 is substituted with glutamic acid or with another negatively charged amino acid having a side chain with a length of 4 atoms, or alternatively with any one of glutamine, homoglutamic acid, or homocysteic acid.
- the methionine residue present at position 27 of the native peptide is modified, e.g. by deletion or substitution. Such modifications may prevent oxidative degradation of the peptide.
- the Met at position 27 is substituted with leucine, isoleucine or norleucine. In some specific embodiments, Met at position 27 is substituted with leucine or norleucine.
- the Gln at position 20 and/or 24 is modified, e.g. by deletion or substitution. Such modifications can reduce degradation that occurs through deamidation of Gln.
- the Gln at position 20 and/or 24 is substituted with Ser, Thr, Ala or AIB.
- the Gln at position 20 and/or 24 is substituted with Lys, Arg, Orn, or Citrulline.
- the Asp at position 21 is modified, e.g. by deletion or substitution. Such modifications can reduce degradation that occurs through dehydration of Asp to form a cyclic succinimide intermediate followed by isomerization to iso-aspartate.
- position 21 is substituted with Glu, homoglutamic acid or homocysteic acid. In some specific embodiments, position 21 is substituted with Glu.
- Stabilization of the alpha-helix structure in the C-terminal portion of the Class 2 glucagon related peptide provides enhanced GLP-1 and/or GIP activity and restores glucagon activity which has been reduced by amino acid modifications at positions 1 and/or 2.
- the alpha helix structure can be stabilized by, e.g., formation of a covalent or non-covalent intramolecular bridge, or substitution and/or insertion of amino acids around positions 12-29 with an alpha helix-stabilizing amino acid (e.g., an ⁇ , ⁇ -disubstituted amino acid).
- Stabilization of the alpha-helix structure of a GIP agonist may be accomplished as described herein.
- the analog of glucagon (SEQ ID NO: 1001) having GIP agonist activity comprises SEQ ID NO: 1001 with (a) an amino acid modification at position 1 that confers GIP agonist activity, (b) a modification which stabilizes the alpha helix structure of the C-terminal portion (amino acids 12-29) of the analog, and (c) optionally, 1 to 10 (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10) further amino acid modifications.
- the analog exhibits at least about 1% activity of native GIP at the GIP receptor or any other activity level at the GIP receptor described herein.
- the modification which stabilizes the alpha helix structure is one which provides or introduces an intramolecular bridge, including, for example, a covalent intramolecular bridge, such as any of those described herein.
- the covalent intramolecular bridge in some embodiments is a lactam bridge.
- the lactam bridge of the analog of these embodiments can be a lactam bridge as described herein.
- the lactam bridge may be one which is between the side chains of amino acids at positions i and i+4 or between the side chains of amino acids at positions j and j+3, wherein i is 12, 13, 16, 17, 20 or 24, and wherein j is 17.
- the lactam bridge can be between the amino acids at positions 16 and 20, wherein one of the amino acids at positions 16 and 20 is substituted with Glu and the other of the amino acids at positions 16 and 20 is substituted with Lys.
- the modification which stabilizes the alpha helix structure is the introduction of one, two, three, or four ⁇ , ⁇ -disubstituted amino acids at position(s) 16, 20, 21, and 24 of the analog.
- the ⁇ , ⁇ -disubstituted amino acid is AIB.
- the ⁇ , ⁇ -disubstituted amino acid (e.g., AIB) is at position 20 and the amino acid at position 16 is substituted with a positive-charged amino acid, such as, for example, an amino acid of Formula IV, which is described herein.
- the amino acid of Formula IV may be homoLys, Lys, Orn, or 2,4-diaminobutyric acid (Dab).
- the amino acid modification at position 1 is a substitution of His with an amino acid lacking an imidazole side chain, e.g. a large, aromatic amino acid (e.g., Tyr).
- the analog of glucagon comprises amino acid modifications at one, two or all of positions 27, 28 and 29.
- the Met at position 27 can be substituted with a large aliphatic amino acid, optionally Leu
- the Asn at position 28 can be substituted with a small aliphatic amino acid, optionally Ala
- the Thr at position 29 can be substituted with a small aliphatic amino acid, optionally Gly, or a combination of two or three of the foregoing.
- the analog of glucagon comprises Leu at position 27, Ala at position 28, and Gly or Thr at position 29.
- the analog of glucagon comprises an extension of 1 to 21 amino acids C-terminal to the amino acid at position 29.
- the extension can comprise the amino acid sequence of SEQ ID NO: 1095 or 1096, for instance.
- the analog of glucagon can comprise an extension of which 1-6 amino acids of the extension are positive-charged amino acids.
- the positive-charged amino acids may be amino acids of Formula IV, including, but not limited to Lys, homoLys, Orn, and Dab.
- the analog of glucagon in some embodiments is acylated or alkylated as described herein.
- the acyl or alkyl group may be attached to the analog of glucagon, with or without a spacer, at position 10 or 40 of the analog, as further described herein.
- the analog may additionally or alternatively be modified to comprise a hydrophilic moiety as further described herein.
- the analog comprises any one or a combination of the following modifications:
- the analog of glucagon (SEQ ID NO: 1001) having GIP agonist activity comprises the following modifications:
- the lactam bridge of the analog of these embodiments can be a lactam bridge as described herein.
- the lactam bridge can be between the amino acids at positions 16 and 20, wherein one of the amino acids at positions 16 and 20 is substituted with Glu and the other of the amino acids at positions 16 and 20 is substituted with Lys.
- the analog can comprise, for example, the amino acid sequence of any of SEQ ID NOs: 1005-1094.
- the analog of glucagon (SEQ ID NO: 1001) having GIP agonist activity comprises the following modifications:
- the ⁇ , ⁇ -disubstituted amino acid of the analog of these embodiments can be any ⁇ , ⁇ -disubstituted amino acid, including, but not limited to, amino iso-butyric acid (AIB), an amino acid disubstituted with the same or a different group selected from methyl, ethyl, propyl, and n-butyl, or with a cyclooctane or cycloheptane (e.g., 1-aminocyclooctane-1-carboxylic acid).
- AIB amino iso-butyric acid
- an amino acid disubstituted with the same or a different group selected from methyl, ethyl, propyl, and n-butyl or with a cyclooctane or cycloheptane (e.g., 1-aminocyclooctane-1-carboxylic acid).
- the amino acid at position 20 is substituted with an ⁇ , ⁇ -disubstituted amino acid, e.g., AIB.
- the analog can comprise, for example, the amino acid sequence of any of SEQ ID NOs: 1099-1141, 1144-1164, 1166-1169, and 1173-1178.
- the analog of glucagon (SEQ ID NO: 1001) having GIP agonist activity comprises the following modifications:
- the amino acid of Formula IV of the analog of these embodiments may be any amino acid, such as, for example, the amino acid of Formula IV, wherein n is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, or 16. In certain embodiments, n is 2, 3, 4, or 5, in which case, the amino acid is Dab, Orn, Lys, or homoLys respectively.
- the alpha, alpha-disubstituted amino acid of the analog of these embodiments may be any alpha, alpha-disubstituted amino acid, including, but not limited to, amino iso-butyric acid (AIB), an amino acid disubstituted with the same or a different group selected from methyl, ethyl, propyl, and n-butyl, or with a cyclooctane or cycloheptane (e.g., 1-aminocyclooctane-1-carboxylic acid).
- the alpha, alpha-disubstituted amino acid is AIB.
- the analog can comprise, for example, the amino acid sequence of any of SEQ ID NOs: 1099-1165.
- the analog of glucagon (SEQ ID NO: 1001) having GIP agonist activity comprises:
- the acylated or alkylated amino acid is an amino acid of Formula I, II, or III.
- the amino acid of Formula I is Dab, Orn, Lys, or homoLys.
- the extension of about 1 to about 21 amino acids comprises the amino acid sequence of GPSSGAPPPS (SEQ ID NO: 1095) or XGPSSGAPPPS (SEQ ID NO: 1096), wherein X is any amino acid, or GPSSGAPPPK (SEQ ID NO: 1170) or XGPSSGAPPPK (SEQ ID NO: 1171) or XGPSSGAPPPSK (SEQ ID NO: 1172), wherein X is Gly or a small, aliphatic or non-polar or slightly polar amino acid.
- the about 1 to about 21 amino acids may comprise sequences containing one or more conservative substitutions relative to SEQ ID NO: 1095, 1096, 1170, 1171 or 1172.
- the acylated or alkylated amino acid is located at position 37, 38, 39, 40, 41, 42, or 43 of the C-terminally-extended analog. In certain embodiments, the acylated or alkylated amino acid is located at position 40 of the C-terminally extended analog.
- the analog having GIP agonist activity further comprises amino acid modifications at one, two or all of positions 27, 28 and 29, e.g., amino acid modifications at position 27 and/or 28.
- the amino acid modification at position 1 that confers GIP agonist activity can be a substitution of His with an amino acid lacking an imidazole side chain.
- the amino acid modification at position 1 can, for example, be a substitution of His with a large, aromatic amino acid.
- the large, aromatic amino acid is any of those described herein, including, for example, Tyr.
- amino acid modifications at one, two, or all of positions 27, 28, and 29 can be any of the modifications at these positions described herein.
- the Met at position 27 can be substituted with a large aliphatic amino acid, optionally Leu
- the Asn at position 28 can be substituted with a small aliphatic amino acid, optionally Ala
- the Thr at position 29 can be substituted with a small aliphatic amino acid, optionally Gly.
- the analog can comprise such amino acid modifications at position 27 and/or 28.
- the analog of the above exemplary embodiments can further comprise 1-9 or 1-6 further, additional amino acid modifications, e.g. 1, 2, 3, 4, 5, 6, 7, 8 or 9 further amino acid modifications, such as, for example, any of the modifications described herein which increase or decrease the activity at any of the GIP, GLP-1, and glucagon receptors, improve solubility, improve duration of action or half-life in circulation, delay the onset of action, or increase stability.
- additional amino acid modifications e.g. 1, 2, 3, 4, 5, 6, 7, 8 or 9 further amino acid modifications, such as, for example, any of the modifications described herein which increase or decrease the activity at any of the GIP, GLP-1, and glucagon receptors, improve solubility, improve duration of action or half-life in circulation, delay the onset of action, or increase stability.
- the analog can further comprise, for example, an amino acid modification at position 12, optionally, a substitution with Ile, and/or amino acid modifications at positions 17 and 18, optionally substitution with Q at position 17 and A at position 18, and/or an addition of GPSSGAPPPS (SEQ ID NO: 1095) or XGPSSGAPPPS (SEQ ID NO: 1096), or sequences containing one or more conservative substitutions relative to SEQ ID NO: 1095 or 1096, to the C-terminus.
- the analog can comprise one or more of the following modifications:
- the analog can be covalently linked to a hydrophilic moiety.
- the analog is covalently linked to the hydrophilic moiety at any of amino acid positions 16, 17, 20, 21, 24, 29, 40, or the C-terminus.
- the analog comprises a C-terminal extension (e.g., an amino acid sequence of SEQ ID NO: 1095) and an addition of an amino acid comprising the hydrophilic moiety, such that the hydrophilic moiety is covalently linked to the analog at position 40.
- the analog of glucagon having GIP agonist activity comprises the amino acid sequence according to any one of SEQ ID NOs: 1227, 1228, 1229 or 1230 that further comprises the following modifications:
- the analog of the above exemplary embodiments can further comprise 1-6 further amino acid modifications, such as, for example, any of the modifications described herein which increase or decrease the activity at any of the GIP, GLP-1, and glucagon receptors, improve solubility, improve duration of action or half-life in circulation, delay the onset of action, or increase stability.
- glucagon analogs described in the above exemplary embodiment comprise further amino acid modifications at one, two or all of positions 27, 28 and 29. Modifications at these positions can be any of the modifications described herein relative to these positions.
- position 27 can be substituted with a large aliphatic amino acid (e.g., Leu, Ile or norleucine) or Met
- position 28 can be substituted with another small aliphatic amino acid (e.g., Gly or Ala) or Asn
- position 29 can be substituted with another small aliphatic amino acid (e.g., Ala or Gly) or Thr.
- the analog can comprise such amino acid modifications at position 27 and/or 28.
- the analog can further comprise one or more of the following additional modifications:
- the analog in some embodiments comprise a combination of the modifications (i) through (xii).
- the analog can comprise an amino acid modification at position 3 (e.g., an amino acid substitution of Gln with Glu), wherein the analog has less than 1% of the activity of glucagon at the glucagon receptor.
- the analog can comprise an amino acid modification at position 7 (e.g., an amino acid substitution of Thr with an amino acid lacking a hydroxyl group, e.g., Abu or Ile), wherein the analog has less than about 10% of the activity of GLP-1 at the GLP-1 receptor.
- the analog may be attached to the acyl or alkyl group via a spacer, as described herein.
- the spacer may be 3 to 10 atoms in length and may be, for instance, an amino acid (e.g., 6-amino hexanoic acid, any amino acid described herein), a dipeptide (e.g., Ala-Ala, ⁇ Ala- ⁇ Ala, Leu-Leu, Pro-Pro, ⁇ Glu- ⁇ Glu), a tripeptide, or a hydrophilic or hydrophobic bifunctional spacer.
- the total length of the spacer and the acyl or alkyl group is about 14 to about 28 atoms.
- the amino acid spacer is not ⁇ -Glu.
- the dipeptide spacer is not ⁇ -Glu- ⁇ -Glu.
- an analog of the invention comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1099-1141, 1144-1164, 1166, 1192-1207, 1209-1221 and 1223 or selected from the group consisting of SEQ ID NOs: 1167-1169, 1173-1178 and 1225.
- the analog of glucagon having GIP agonist activity comprises an acyl or alkyl group (e.g., an acyl or alkyl group which is non-native to a naturally occurring amino acid), wherein the acyl or alkyl group is attached to a spacer, wherein (i) the spacer is attached to the side chain of the amino acid at position 10 of the analog; or (ii) the analog comprises an extension of 1 to 21 amino acids C-terminal to the amino acid at position 29 and the spacer is attached to the side chain of an amino acid corresponding to one of positions 37-43 relative to SEQ ID NO: 1001, wherein the EC50 of the analog for GIP receptor activation is about 10 nM or less.
- an acyl or alkyl group e.g., an acyl or alkyl group which is non-native to a naturally occurring amino acid
- the analog comprises an extension of 1 to 21 amino acids C-terminal to the amino acid at position 29 and the spacer is attached to the side chain of an
- the analog may comprise an amino acid sequence of SEQ ID NO: 1001 with (i) an amino acid modification at position 1 that confers GIP agonist activity, (ii) amino acid modifications at one, two, or all of positions 27, 28, and 29, (iii) at least one of:
- n is 1 to 7, wherein each of R1 and R2 is independently selected from the group consisting of H, C 1 -C 18 alkyl, (C 1 -C 18 alkyl)OH, (C 1 -C 18 alkyl)NH 2 , (C 1 -C 18 alkyl)SH, (C 0 -C 4 alkyl)(C 3 -C 6 )cycloalkyl, (C 0 -C 4 alkyl)(C 2 -C 5 heterocyclic), (C 0 -C 4 alkyl)(C 6 -C 10 aryl)R 7 , and (C 1 -C 4 alkyl)(C 3 -C 9 heteroaryl), wherein R 7 is H or OH, and the side chain of the amino acid of Formula IV comprises a free amino group; and (ii) an amino acid substitution of the Gln at position 20 with an alpha, alpha-disubstituted amino acid, and (iv) up to 6 further amino acid modifications.
- the alpha, alpha-disubstituted amino acid of the analog of these embodiments may be any alpha, alpha-disubstituted amino acid, including, but not limited to, amino iso-butyric acid (AIB), an amino acid disubstituted with the same or a different group selected from methyl, ethyl, propyl, and n-butyl, or with a cyclooctane or cycloheptane (e.g., 1-aminocyclooctane-1-carboxylic acid).
- AIB amino iso-butyric acid
- an amino acid disubstituted with the same or a different group selected from methyl, ethyl, propyl, and n-butyl or with a cyclooctane or cycloheptane (e.g., 1-aminocyclooctane-1-carboxylic acid).
- the amino acid of Formula IV of the analog of these embodiments may be any amino acid, such as, for example, the amino acid of Formula IV, wherein n is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, or 16. In certain embodiments, n is 2, 3, 4, or 5, in which case, the amino acid is Dab, Orn, Lys, or homoLys respectively.
- the amino acid modification at position 1 that confers GIP agonist activity can be a substitution of His with an amino acid lacking an imidazole side chain.
- amino acid modifications at one, two, or all of positions 27, 28, and 29 can be any of the modifications at these positions described herein.
- the Met at position 27 can be substituted with a large aliphatic amino acid, optionally Leu
- the Asn at position 28 can be substituted with a small aliphatic amino acid, optionally Ala
- the Thr at position 29 can be substituted with a small aliphatic amino acid, optionally Gly.
- the analog can comprise such amino acid modifications at position 27 and/or 28.
- the analog can further comprise, for example, an amino acid modification at position 12, optionally, a substitution with Ile, and/or amino acid modifications at positions 17 and 18, optionally substitution with Q at position 17 and A at position 18, and/or an addition of GPSSGAPPPS (SEQ ID NO: 1095) or XGPSSGAPPPS (SEQ ID NO: 1096), or sequences containing one or more conservative substitutions relative to SEQ ID NO: 1095 or 1096, to the C-terminus.
- the analog can comprise one or more of the following modifications:
- the analog can be covalently linked to a hydrophilic moiety.
- the analog is covalently linked to the hydrophilic moiety at any of amino acid positions 16, 17, 20, 21, 24, 29, 40, or the C-terminus.
- the analog comprises a C-terminal extension (e.g., an amino acid sequence of SEQ ID NO: 1095) and an addition of an amino acid comprising the hydrophilic moiety, such that the hydrophilic moiety is covalently linked to the analog at position 40.
- the hydrophilic moiety is covalently linked to a Lys, Cys, Orn, homocysteine, or acetyl-phenylalanine of the analog.
- the Lys, Cys, Orn, homocysteine, or acetyl-phenylalanine may be an amino acid that is native to the glucagon sequence (SEQ ID NO: 1001) or it may be an amino acid which is replacing a native amino acid of SEQ ID NO: 1001.
- the linkage to the hydrophilic moiety can comprise the structure
- the hydrophilic moiety may be any of those described herein. See, e.g., the teachings under the section “Linkage of hydrophilic moieties.”
- the hydrophilic moiety is a polyethylene glycol (PEG).
- PEG polyethylene glycol
- the PEG in certain embodiments has a molecular weight of about 1,000 Daltons to about 40,000 Daltons, e.g., about 20,000 Daltons to about 40,000 Daltons.
- the spacer can be any spacer as described herein.
- the spacer may be 3 to 10 atoms in length and may be, for instance, an amino acid (e.g., 6-amino hexanoic acid, any amino acid described herein), a dipeptide (e.g., Ala-Ala, ⁇ Ala- ⁇ Ala, Leu-Leu, Pro-Pro, ⁇ Glu- ⁇ Glu), a tripeptide, or a hydrophilic or hydrophobic bifunctional spacer.
- the total length of the spacer and the acyl or alkyl group is about 14 to about 28 atoms.
- the amino acid spacer is not ⁇ -Glu.
- the dipeptide spacer is not ⁇ -Glu- ⁇ -Glu.
- the acyl or alkyl group is any acyl or alkyl group as described herein, such as an acyl or alkyl group which is non-native to a naturally occurring amino acid.
- the acyl or alkyl group in some embodiments is a C4 to C30 fatty acyl group, such as, for example, a C10 fatty acyl or alkyl group, a C12 fatty acyl or alkyl group, a C14 fatty acyl or alkyl group, a C16 fatty acyl or alkyl group, a C18 fatty acyl or alkyl group, a C20 acyl or alkyl group, or a C22 acyl or alkyl group, or a C4 to C30 alkyl group.
- the acyl group is a C12 to C18 fatty acyl group (e.g., a C14 or C16 fatty acyl group).
- the extension of about 1 to about 21 amino acids C-terminal to the amino acid at position 29 of the analog comprises the amino acid sequence of GPSSGAPPPS (SEQ ID NO: 1095) or XGPSSGAPPPS (SEQ ID NO: 1096), wherein X is any amino acid, or GPSSGAPPPK (SEQ ID NO: 1170) or XGPSSGAPPPK (SEQ ID NO: 1171) or XGPSSGAPPPSK (SEQ ID NO: 1172), wherein Xis Gly or a small, aliphatic or non-polar or slightly polar amino acid.
- the about 1 to about 21 amino acids may comprise sequences containing one or more conservative substitutions relative to SEQ ID NO: 1095, 1096, 1170, 1171 or 1172.
- the acylated or alkylated amino acid is located at position 37, 38, 39, 40, 41, 42, or 43 of the C-terminally-extended analog.
- the acylated or alkylated amino acid is located at position 40 of the C-terminally extended analog.
- the acyl or alkyl group is covalently linked to an amino acid which is native to SEQ ID NO: 1001, 1227, 1228, 1229 or 1230 or it may be linked to a substituted amino acid.
- the acyl or alkyl group is covalently linked to an amino acid which is native to SEQ ID NO: 1095, 1096, 1171 or 1172
- the GIP agonist may be a peptide comprising the amino acid sequence of any of the amino acid sequences, e.g., SEQ ID NOs: 1005-1094, optionally with up to 1, 2, 3, 4, or 5 further modifications that retain GIP agonist activity.
- the GIP agonist comprises the amino acids of any of SEQ ID NOs: 1099-1262.
- the glucagon related peptide is a Class 3 glucagon related peptide, which is described herein and in International Patent Application No. PCT/US2009/47438 (filed on Jun. 16, 2009), International Patent Application Publication No. WO 2008/101017, published on Aug. 21, 2008, and U.S. Provisional Application No. 61/090,412 and U.S. Application No. 61/177,476, the contents of which are incorporated by reference in their entirety.
- the Class 3 glucagon related peptide can be a peptide that exhibits increased activity at the glucagon receptor, and in further embodiments exhibits enhanced biophysical stability and/or aqueous solubility.
- the Class 3 glucagon related peptide has lost native glucagon's selectivity for the glucagon receptor verses the GLP-1 receptor, and thus represents co-agonists of those two receptors. Selected amino acid modifications within the Class 3 glucagon related peptide can control the relative activity of the peptide at the GLP-1 receptor verses the glucagon receptor.
- the Class 3 glucagon related peptide can be a glucagon/GLP-1 co-agonist that has higher activity at the glucagon receptor versus the GLP-1 receptor, a glucagon/GLP-1 co-agonist that has approximately equivalent activity at both receptors, or a glucagon/GLP-1 co-agonist that has higher activity at the GLP-1 receptor versus the glucagon receptor.
- the latter category of co-agonist can be engineered to exhibit little or no activity at the glucagon receptor, and yet retain ability to activate the GLP-1 receptor with the same or better potency than native GLP-1. Any of these co-agonists may also include modifications that confer enhanced biophysical stability and/or aqueous solubility.
- Modifications of the Class 3 glucagon related peptide can be made to produce a glucagon related peptide having anywhere from at least about 1% (including at least about 1.5%, 2%, 5%, 7%, 10%, 20%, 30%, 40%, 50%, 60%, 75%, 100%, 125%, 150%, 175%) to about 200% or higher activity at the GLP-1 receptor relative to native GLP-1 and anywhere from at least about 1% (including about 1.5%, 2%, 5%, 7%, 10%, 20%, 30%, 40%, 50%, 60%, 75%, 100%, 125%, 150%, 175%, 200%, 250%, 300%, 350%, 400%, 450%) to about 500% or higher activity at the glucagon receptor relative to native glucagon.
- amino acid sequence of native glucagon is SEQ ID NO: 701
- amino acid sequence of GLP-1(7-36)amide is SEQ ID NO: 703
- amino acid sequence of GLP-1(7-37)acid is SEQ ID NO: 704.
- the Class 3 glucagon related peptide can be a glucagon related peptide with increased or decreased activity at the glucagon receptor, or GLP-1 receptor, or both.
- the Class 3 glucagon related peptide can be a glucagon related peptide with altered selectivity for the glucagon receptor versus the GLP-1 receptor.
- high potency Class 3 glucagon related peptides are provided that also exhibit improved solubility and/or stability.
- the Class 3 glucagon related peptide is a glucagon agonist that has been modified relative to the wild type peptide of His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr (SEQ ID NO: 701) to enhance the peptide's potency at the glucagon receptor.
- the normally occurring serine at position 16 of native glucagon can be substituted with select acidic amino acids to enhance the potency of glucagon, in terms of its ability to stimulate cAMP synthesis in a validated in vitro model assay (see Example 7). More particularly, this substitution enhances the potency of the analog at least 2-fold, 4-fold, 5-fold, and up to 10-fold greater at the glucagon receptor. This substitution also enhances the analog's activity at the GLP-1 receptor at least 5-fold, 10-fold, or 15-fold relative to native glucagon, but selectivity is maintained for the glucagon receptor over the GLP-1 receptor.
- such enhanced potency can be provided by substituting the naturally occurring serine at position 16 with glutamic acid or with another negatively charged amino acid having a side chain with a length of 4 atoms, or alternatively with any one of glutamine, homoglutamic acid, or homocysteic acid, or a charged amino acid having a side chain containing at least one heteroatom, (e.g. N, O, S, P) and with a side chain length of about 4 (or 3-5) atoms.
- heteroatom e.g. N, O, S, P
- the serine residue at position 16 of native glucagon is substituted with an amino acid selected from the group consisting of glutamic acid, glutamine, homoglutamic acid, homocysteic acid, threonine, or glycine.
- the serine residue at position 16 of native glucagon is substituted with an amino acid selected from the group consisting of glutamic acid, glutamine, homoglutamic acid and homocysteic acid, and in some embodiments the serine residue is substituted with glutamic acid.
- the enhanced potency Class 3 glucagon related peptide comprises a peptide of SEQ ID NO: 90, SEQ ID NO: 91, SEQ ID NO: 92, SEQ ID NO: 93, SEQ ID NO: 94, SEQ ID NO: 95 or a glucagon agonist analog of SEQ ID NO: 93.
- a Class 3 glucagon related peptide having enhanced potency at the glucagon receptor relative to wild type glucagon wherein the peptide comprises the sequence of SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97 or SEQ ID NO: 98, wherein the glucagon related peptide retains its selectivity for the glucagon receptor relative to the GLP-1 receptors.
- the Class 3 glucagon related peptide having enhanced specificity for the glucagon receptor comprises the peptide of SEQ ID NO: 96, SEQ ID NO: 97, SEQ ID NO: 98 or a glucagon agonist analog thereof, wherein the carboxy terminal amino acid retains its native carboxylic acid group.
- a Class 3 glucagon related peptide comprises the sequence of NH2-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Glu-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-COOH (SEQ ID NO: 98), wherein the peptide exhibits approximately fivefold enhanced potency at the glucagon receptor, relative to native glucagon as measured by the in vitro cAMP assay of Example 7.
- Glucagon receptor activity can be reduced, maintained, or enhanced by an amino acid modification at position 3, e.g. substitution of the naturally occurring glutamine at position 3.
- substitution of the amino acid at position 3 with an acidic, basic, or hydrophobic amino acid has been shown to substantially reduce or destroy glucagon receptor activity.
- the analogs that are substituted with, for example, glutamic acid, ornithine, or norleucine have about 10% or less of the activity of native glucagon at the glucagon receptor, e.g.
- exemplary analogs described herein have about 0.5%, about 1% or about 7% of the activity of native glucagon, while exhibiting at least 20% of the activity of GLP-1 at the GLP-1 receptor.
- any of the Class 3 glucagon related peptides including glucagon analogs, glucagon agonist analogs, glucagon co-agonists, and glucagon/GLP-1 co-agonist molecules, described herein may be modified to contain a modification at position 3, e.g., Gln substituted with Glu, to produce a peptide with high selectivity, e.g., tenfold selectivity, for the GLP-1 receptor as compared to the selectivity for the glucagon receptor.
- a modification at position 3 e.g., Gln substituted with Glu
- the naturally occurring glutamine at position 3 of any of the Class 3 glucagon related peptides can be substituted with a glutamine analog without a substantial loss of activity at the glucagon receptor, and in some cases, with an enhancement of glucagon receptor activity, as described herein.
- the amino acid at position 3 is substituted with Dab(Ac).
- glucagon agonists can comprise the amino acid sequence of SEQ ID NO: 595, SEQ ID NO: 601 SEQ ID NO: 603, SEQ ID NO: 604, SEQ ID NO: 605, and SEQ ID NO: 606.
- modifications at position 2 may reduce glucagon activity.
- This reduction in glucagon activity can be restored by stabilizing the alpha-helix in the C-terminal portion of glucagon, e.g. through means described herein, for example, through a covalent bond between the side chains of the amino acids at positions “i” and “i+4”, e.g., 12 and 16, 16 and 20, or 20 and 24.
- this covalent bond is a lactam bridge between a glutamic acid at position 16 and a lysine at position 20.
- this covalent bond is an intramolecular bridge other than a lactam bridge.
- suitable covalent bonding methods include any one or more of olefin metathesis, lanthionine-based cyclization, disulfide bridge or modified sulfur-containing bridge formation, the use of a, w-diaminoalkane tethers, the formation of metal-atom bridges, and other means of peptide cyclization.
- Enhanced activity at the GLP-1 receptor is provided by replacing the carboxylic acid of the C-terminal amino acid with a charge-neutral group, such as an amide or ester.
- these Class 3 glucagon related peptides comprise a sequence of SEQ ID NO: 108, wherein the carboxy terminal amino acid has an amide group in place of the carboxylic acid group found on the native amino acid.
- These Class 3 glucagon related peptides have strong activity at both the glucagon and GLP-1 receptors and thus act as co-agonists at both receptors.
- the Class 3 glucagon related peptide is a glucagon and GLP-1 receptor co-agonist, wherein the peptide comprises the sequence of SEQ ID NO: 108, wherein the amino acid at position 28 is Asn or Lys and the amino acid at position 29 is Thr-amide.
- Increased activity at the GLP-1 receptor is provided by modifications that stabilize the alpha helix in the C-terminal portion of glucagon (e.g. around residues 12-29).
- modifications permit formation of an intramolecular bridge between the side chains of two amino acids that are separated by three intervening amino acids (i.e., an amino acid at position “i” and an amino acid at position “i+4”, wherein i is any integer between 12 and 25), by two intervening amino acids, i.e., an amino acid at position “j” and an amino acid at position “j+3,” wherein j is any integer between 12 and 27, or by six intervening amino acids, i.e., an amino acid at position “k” and an amino acid at position “k+7,” wherein k is any integer between 12 and 22.
- the bridge or linker is about 8 (or about 7-9) atoms in length and forms between side chains of amino acids at positions 12 and 16, or at positions 16 and 20, or at positions 20 and 24, or at positions 24 and 28.
- the two amino acid side chains can be linked to one another through non-covalent bonds, e.g., hydrogen-bonding, ionic interactions, such as the formation of salt bridges, or by covalent bonds.
- the Class 3 glucagon related peptide exhibits glucagon/GLP-1 receptor co-agonist activity and comprises an amino acid sequence selected from the group consisting of SEQ ID NO: 99, 101, 102 and 103.
- the side chains are covalently bound to one another, and in some embodiments the two amino acids are bound to one another to form a lactam ring.
- the Class 3 glucagon related peptide comprises a glucagon related peptide analog of SEQ ID NO: 108, wherein the peptide comprises an intramolecular lactam bridge formed between amino acid positions 12 and 16 or between amino acid positions 16 and 20.
- the Class 3 glucagon related peptide comprises the sequence of SEQ ID NO: 108, wherein an intramolecular lactam bridge is formed between amino acid positions 12 and 16, between amino acid positions 16 and 20, or between amino acid positions 20 and 24 and the amino acid at position 29 is glycine, wherein the sequence of SEQ ID NO: 29 is linked to the C-terminal amino acid of SEQ ID NO: 108.
- the amino acid at position 28 is aspartic acid.
- stabilization of the alpha helix structure in the C-terminal portion of the Class 3 glucagon related peptide is achieved through the formation of an intramolecular bridge other than a lactam bridge.
- suitable covalent bonding methods include any one or more of olefin metathesis, lanthionine-based cyclization, disulfide bridge or modified sulfur-containing bridge formation, the use of a, w-diaminoalkane tethers, the formation of metal-atom bridges, and other means of peptide cyclization are used to stabilize the alpha helix.
- enhanced activity at the GLP-1 receptor may be achieved by stabilizing the alpha-helix structure in the C-terminal portion of the glucagon related peptide (around amino acids 12-29) through purposeful introduction of one or more ⁇ , ⁇ -disubstituted amino acids at positions that retain the desired activity.
- Such peptides may be considered herein as a peptide lacking an intramolecular bridge.
- stabilization of the alpha-helix is accomplished in this manner without introduction of an intramolecular bridge such as a salt bridge or covalent bond.
- one, two, three, four or more of positions 16, 17, 18, 19, 20, 21, 24 or 29 of a glucagon related peptide is substituted with an ⁇ , ⁇ -disubstituted amino acid.
- substitution of position 16 of the Class 3 glucagon related peptide with amino iso-butyric acid (AIB) enhances GLP-1 activity, in the absence of a salt bridge or lactam.
- one, two, three or more of positions 16, 20, 21 or 24 are substituted with AIB.
- Enhanced activity at the GLP-1 receptor may be achieved by an amino acid modification at position 20.
- the glutamine at position 20 is replaced with another hydrophilic amino acid having a side chain that is either charged or has an ability to hydrogen-bond, and is at least about 5 (or about 4-6) atoms in length, for example, lysine, citrulline, arginine, or ornithine.
- GLP-1 activity at the GLP-1 receptor is demonstrated in Class 3 glucagon related peptides comprising the C-terminal extension of SEQ ID NO: 78.
- GLP-1 activity in such Class 3 glucagon related peptides comprising SEQ ID NO: 78 can be further increased by modifying the amino acid at position 18, 28 or 29, or at position 18 and 29, as described herein.
- a further modest increase in GLP-1 potency may be achieved by modifying the amino acid at position 10 to be Trp.
- the Class 3 glucagon related peptides can comprise modifications at position 16, at position 20, and at the C-terminal carboxylic acid group, optionally with a covalent bond between the amino acids at positions 16 and 20; can comprise modifications at position 16 and at the C-terminal carboxylic acid group; can comprise modifications at positions 16 and 20, optionally with a covalent bond between the amino acids at positions 16 and 20; or can comprise modifications at position 20 and at the C-terminal carboxylic acid group; optionally with the proviso that the amino acid at position 12 is not Arg; or optionally with the proviso that the amino acid at position 9 is not Glu.
- the Class 3 glucagon related peptides can be further modified to improve the peptide's solubility and stability in aqueous solutions at physiological pH, while retaining the high biological activity relative to native glucagon.
- Hydrophilic moieties as discussed herein can be attached to the Class 3 glucagon related peptide as further discussed herein.
- introduction of hydrophilic groups at positions 17, 21, and 24 of the Class 3 glucagon related peptide comprising SEQ ID NO: 97 or SEQ ID NO: 98 are anticipated to improve the solubility and stability of the high potency glucagon analog in solutions having a physiological pH. Introduction of such groups also increases duration of action, e.g. as measured by a prolonged half-life in circulation.
- the Class 3 glucagon related peptide comprises a sequence selected from the group consisting of SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106 and SEQ ID NO: 107, wherein the side chain of an amino acid residue at one of position 16, 17, 21 or 24 of said Class 3 glucagon related peptide further comprises a polyethylene glycol chain, having a molecular weight selected from the range of about 500 to about 40,000 Daltons. In some embodiments, the polyethylene glycol chain has a molecular weight selected from the range of about 500 to about 5,000 Daltons.
- the polyethylene glycol chain has a molecular weight of about 10,000 to about 20,000 Daltons. In yet other exemplary embodiments the polyethylene glycol chain has a molecular weight of about 20,000 to about 40,000 Daltons.
- the hydrophilic group comprises a polyethylene (PEG) chain. More particularly, in some embodiments, the Class 3 glucagon related peptide comprises the sequence of SEQ ID NO: 94 or SEQ ID NO: 95 wherein a PEG chain is covalently linked to the side chains of amino acids present at positions 21 and 24 of the Class 3 glucagon related peptide and the carboxy terminal amino acid of the Class 3 glucagon related peptide has the carboxylic acid group. In accordance with some embodiments, the polyethylene glycol chain has an average molecular weight selected from the range of about 500 to about 10,000 Daltons.
- the pegylated Class 3 glucagon related peptide comprises two or more polyethylene glycol chains covalently bound to the Class 3 glucagon related peptide wherein the total molecular weight of the glucagon chains is about 1,000 to about 5,000 Daltons.
- the pegylated glucagon agonist comprises a peptide consisting of SEQ ID NO: 93 or a glucagon agonist analog of SEQ ID NO: 93, wherein a PEG chain is covalently linked to the amino acid residue at position 21 and at position 24, and wherein the combined molecular weight of the two PEG chains is about 1,000 to about 5,000 Daltons.
- the solubility of the Class 3 glucagon related peptide comprising SEQ ID NO: 20 can be further improved, for example, by introducing one, two, three or more charged amino acid(s) to the C-terminal portion of glucagon related peptide of SEQ ID NO: 108, preferably at a position C-terminal to position 27.
- a charged amino acid can be introduced by substituting a native amino acid with a charged amino acid, e.g. at positions 28 or 29, or alternatively by adding a charged amino acid, e.g. after position 27, 28 or 29.
- one, two, three or all of the charged amino acids are negatively charged. Additional modifications, e.g.
- an analog of the Class 3 glucagon related peptide of SEQ ID NO: 108 is provided wherein the analog differs from SEQ ID NO: 108 by 1 to 2 amino acid substitutions at positions 17-26, and, in some embodiments, the analog differs from the peptide of SEQ ID NO: 108 by an amino acid substitution at position 20.
- the glucagon related peptide is modified to comprise an acyl or alkyl group, e.g., a C4 to C30 acyl or alkyl group.
- the invention provides a Class 3 glucagon related peptide modified to comprise an acyl group or alkyl group covalently linked to the amino acid at position 10 of the glucagon related peptide.
- the glucagon related peptide may further comprise a spacer between the amino acid at position 10 of the Class 3 glucagon related peptide and the acyl group or alkyl group.
- Any of the foregoing Class 3 glucagon related peptides may comprise two acyl groups or two alkyl groups, or a combination thereof.
- the acylated Class 3 glucagon related peptide comprises the amino acid sequence of any of SEQ ID NOs: 534-544 and 546-549.
- the Class 3 glucagon related peptides described herein are further modified by truncation or deletion of one or two amino acids of the C-terminus of the glucagon peptide (i.e., position 29 and/or 28) without affecting activity and/or potency at the glucagon and GLP-1 receptors.
- the Class 3 glucagon related peptide can comprise amino acids 1-27 or 1-28 of the native glucagon peptide (SEQ ID NO: 1), optionally with one or more modifications described herein.
- the truncated Class 3 glucagon related peptide comprises SEQ ID NO: 550 or SEQ ID NO: 551.
- the truncated glucagon agonist peptide comprises SEQ ID NO: 552 or SEQ ID NO: 553.
- the Class 3 glucagon related peptides disclosed herein are modified by the addition of a second peptide to the carboxy terminus of the glucagon related peptide, for example, SEQ ID NO: 78, SEQ ID NO: 117 or SEQ ID NO: 118.
- a Class 3 glucagon related peptide having a sequence selected from the group consisting of SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, and SEQ ID NO: 69 is covalently bound through a peptide bond to a second peptide, wherein the second peptide comprises a sequence selected from the group consisting of SEQ ID NO: 78, SEQ ID NO: 117 and SEQ ID NO: 118.
- Class 3 glucagon related peptides which comprise the C-terminal extension
- the threonine at position 29 of the native glucagon related peptide is replaced with a glycine.
- a Class 3 glucagon related peptide having a glycine substitution for threonine at position 29 and comprising the carboxy terminal extension of SEQ ID NO: 78 is four times as potent at the GLP-1 receptor as native glucagon modified to comprise the carboxy terminal extension of SEQ ID NO: 78. Potency at the GLP-1 receptor can be further enhanced by an alanine substitution for the native arginine at position 18.
- Class 3 glucagon related peptide can have a carboxy terminal extension of SEQ ID NO: 117 (KRNRNNIA) or SEQ ID NO: 118.
- Class 3 glucagon related peptide comprising SEQ ID NO: 81 or SEQ ID NO: 108, further comprises the amino acid sequence of SEQ ID NO: 117 (KRNRNNIA) or SEQ ID NO: 118 linked to amino acid 29 of the glucagon related peptide.
- the Class 3 glucagon related peptide comprises a sequence selected from the group consisting of SEQ ID NO: 98, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102 and SEQ ID NO: 103, further comprising the amino acid sequence of SEQ ID NO: 117 (KRNRNNIA) or SEQ ID NO: 118 linked to amino acid 29 of the glucagon related peptide.
- the glucagon related peptide comprises a sequence selected from the group consisting of SEQ ID NO: 98, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112, SEQ ID NO: 72 and SEQ ID NO: 120 further comprising the amino acid sequence of SEQ ID NO: 78 (GPSSGAPPPS) or SEQ ID NO: 79 linked to amino acid 29 of the Class 3 glucagon related peptide.
- the Class 3 glucagon related peptide comprises the sequence of SEQ ID NO: 121.
- (A) Improving solubility for example, by introducing one, two, three or more charged amino acid(s) to the C-terminal portion of native glucagon, preferably at a position C-terminal to position 27.
- a charged amino acid can be introduced by substituting a native amino acid with a charged amino acid, e.g. at positions 28 or 29, or alternatively by adding a charged amino acid, e.g. after position 27, 28 or 29.
- one, two, three or all of the charged amino acids are negatively charged.
- one, two, three or all of the charged amino acids are positively charged.
- Such modifications increase solubility, e.g. provide at least 2-fold, 5-fold, 10-fold, 15-fold, 25-fold, 30-fold or greater solubility relative to native glucagon at a given pH between about 5.5 and 8, e.g., pH 7, when measured after 24 hours at 25° C.
- (C) Increasing stability by modification of the aspartic acid at position 15, for example, by deletion or substitution with glutamic acid, homoglutamic acid, cysteic acid or homocysteic acid. Such modifications can reduce degradation or cleavage at a pH within the range of 5.5 to 8, especially in acidic or alkaline buffers, for example, retaining at least 75%, 80%, 90%, 95%, 96%, 97%, 98% or 99% of the original peptide after 24 hours at 25° C.
- (D) Increasing stability by modification of the methionine at position 27, for example, by substitution with leucine or norleucine. Such modifications can reduce oxidative degradation. Stability can also be increased by modification of the Gln at position 20 or 24, e.g. by substitution with Ser, Thr, Ala or AIB. Such modifications can reduce degradation that occurs through deamidation of Gln. Stability can be increased by modification of Asp at position 21, e.g. by substitution with Glu. Such modifications can reduce degradation that occurs through dehydration of Asp to form a cyclic succinimide intermediate followed by isomerization to iso-aspartate.
- DPP IV dipeptidyl peptidase IV
- substitution of His at position 1 with a large, aromatic amino acid e.g., Tyr, Phe, Trp or amino-Phe
- Ser at position 2 with Ala substitution of Tyr at position 10 with Val or Phe
- substitution of Lys at position 12 with Arg substitution of Asp at position 15 with Glu
- substitution of Ser at position 16 with Thr or AIB substitution of His at position 1 with a large, aromatic amino acid (e.g., Tyr, Phe, Trp or amino-Phe); Ser at position 2 with Ala; substitution of Tyr at position 10 with Val or Phe; substitution of Lys at position 12 with Arg; substitution of Asp at position 15 with Glu; substitution of Ser at position 16 with Thr or AIB.
- a large, aromatic amino acid e.g., Tyr, Phe, Trp or amino-Phe
- Ser at position 2 with Ala substitution of Tyr at position 10 with Val or Phe
- substitution of Lys at position 12 with Arg substitution of Lys at position 12 with Arg
- Class 3 glucagon related peptides with GLP-1 activity that contain a non-conservative substitution of His at position 1 with a large, aromatic amino acid (e.g., Tyr) can retain GLP-1 activity provided that the alpha-helix is stabilized via an intramolecular bridge, e.g., such as any of those described herein.
- a large, aromatic amino acid e.g., Tyr
- the Class 3 glucagon related peptide can be linked, optionally via covalent bonding and optionally via a linker, to a conjugate moiety.
- the Class 3 glucagon related peptide also can be part of a fusion peptide or protein wherein a second peptide or polypeptide has been fused to a terminus, e.g., the carboxy terminus of the Class 3 glucagon related peptide.
- the fusion Class 3 glucagon related peptide may comprise a glucagon agonist of SEQ ID NO: 72, SEQ ID NO: 97 or SEQ ID NO: 98 further comprising an amino acid sequence of SEQ ID NO: 78 (GPSSGAPPPS), SEQ ID NO: 117 (KRNRNNIA) or SEQ ID NO: 118 (KRNR) linked to amino acid 29 of the glucagon related peptide.
- the amino acid sequence of SEQ ID NO: 78 (GPSSGAPPPS), SEQ ID NO: 117 (KRNRNNIA) or SEQ ID NO: 118 (KRNR) is bound to amino acid 29 of the Class 3 glucagon related peptide through a peptide bond.
- glucagon related peptide fusion peptides comprising the C-terminal extension peptide of Exendin-4 (e.g., SEQ ID NO: 78 or SEQ ID NO: 79)
- substitution of the native threonine residue at position 29 with glycine dramatically increases GLP-1 receptor activity.
- This amino acid substitution can be used in conjunction with other modifications disclosed herein with regard to Class 3 glucagon related peptides to enhance the affinity of the glucagon analogs for the GLP-1 receptor.
- the T29G substitution can be combined with the S16E and N20K amino acid substitutions, optionally with a lactam bridge between amino acids 16 and 20, and optionally with addition of a PEG chain as described herein.
- a Class 3 glucagon related peptide comprises the sequence of SEQ ID NO: 121.
- the Class 3 glucagon related peptide portion of the glucagon fusion peptide is selected from the group consisting of SEQ ID NO: 72, SEQ ID NO: 90, SEQ ID NO: 91, SEQ ID NO: 92, and SEQ ID NO: 93 wherein a PEG chain, when present at positions 17, 21, 24, or the C-terminal amino acid, or at both 21 and 24, is selected from the range of 500 to 40,000 Daltons.
- the Class 3 glucagon related peptide segment is selected from the group consisting of SEQ ID NO: 95, SEQ ID NO: 96, and SEQ ID NO: 122, wherein the PEG chain is selected from the range of 500 to 5,000.
- the Class 3 glucagon related peptide is a fusion peptide comprising the sequence of SEQ ID NO: 72 and SEQ ID NO: 80 wherein the peptide of SEQ ID NO: 80 is linked to the carboxy terminus of SEQ ID NO: 72.
- an additional chemical modification of the Class 3 glucagon related peptide of SEQ ID NO: 98 bestows increased GLP-1 receptor potency to a point where the relative activity at the glucagon and GLP-1 receptors is virtually equivalent.
- a Class 3 glucagon related peptide comprises a terminal amino acid comprising an amide group in place of the carboxylic acid group that is present on the native amino acid.
- the relative activity of the Class 3 glucagon related peptide at the respective glucagon and GLP-1 receptors can be adjusted by further modifications to the Class 3 glucagon related peptide to produce analogs demonstrating about 40% to about 500% or more of the activity of native glucagon at the glucagon receptor and about 20% to about 200% or more of the activity of native GLP-1 at the GLP-1 receptor, e.g. 50-fold, 100-fold or more increase relative to the normal activity of glucagon at the GLP-1 receptor.
- a glucagon analog comprising the sequence of SEQ ID NO: 72, wherein said analog differs from SEQ ID NO: 72 by 1 to 3 amino acids, selected from positions 1, 2, 3, 5, 7, 10, 11, 13, 14, 17, 18, 19, 21, 24, 27, 28, and 29, wherein said glucagon related peptide exhibits at least 20% of the activity of native GLP-1 at the GLP-1 receptor.
- glucagon/GLP-1 receptor co-agonist comprising the sequence:
- Xaa at position 15 is selected from the group of amino acids consisting of Asp, Glu, cysteic acid, homoglutamic acid and homocysteic acid
- Xaa at position 16 is selected from the group of amino acids consisting of Ser, Glu, Gln, homoglutamic acid and homocysteic acid
- the Xaa at position 20 is Gln or Lys
- the Xaa at position 24 is Gln or Glu
- the Xaa at position 28 is Asn, Lys or an acidic amino acid
- the Xaa at position 29 is
- the glucagon/GLP-1 receptor co-agonist comprises the sequence of SEQ ID NO: 81 wherein the amino acid at position 28 is aspartic acid and the amino acid at position 29 is glutamic acid.
- the amino acid at position 28 is the native asparagine
- the amino acid at position 29 is glycine
- the amino acid sequence of SEQ ID NO: 79 or SEQ ID NO: 80 is covalently linked to the carboxy terminus of SEQ ID NO: 81.
- a co-agonist comprising the sequence of SEQ ID NO: 81 wherein an additional acidic amino acid added to the carboxy terminus of the peptide.
- the carboxy terminal amino acid of the glucagon analog has an amide in place of the carboxylic acid group of the natural amino acid.
- the glucagon analog comprises a sequence selected from the group consisting of SEQ ID NO: 85, SEQ ID NO: 86, SEQ ID NO: 87, and SEQ ID NO: 88.
- a glucagon related peptide analog of SEQ ID NO: 81 is provided, wherein said analog differs from SEQ ID NO: 81 by 1 to 3 amino acids, selected from positions 1, 2, 3, 5, 7, 10, 11, 13, 14, 17, 18, 19, 21 and 27, with the proviso that when the amino acid at position 16 is serine, either position 20 is lysine, or a lactam bridge is formed between the amino acid at position 24 and either the amino acid at position 20 or position 28.
- the analog differs from SEQ ID NO: 81 by 1 to 3 amino acids selected from positions 1, 2, 3, 21 and 27.
- the glucagon peptide analog of SEQ ID NO: 81 differs from that sequence by 1 to 2 amino acids, or in some embodiments by a single amino acid, selected form positions 1, 2, 3, 5, 7, 10, 11, 13, 14, 17, 18, 19, 21 and 27, with the proviso that when the amino acid at position 16 is serine, either position 20 is lysine, or a lactam bridge is formed between the amino acid at position 24 and either the amino acid at position 20 or position 28.
- a relatively selective GLP-1 receptor agonist comprising the sequence NH2-His-Ser-Xaa-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Xaa-Xaa-Arg-Arg-Ala-Xaa-Asp-Phe-Val-Xaa-Trp-Leu-Met-Xaa-Xaa-R (SEQ ID NO: 83) wherein the Xaa at position 3 is selected from the group of amino acids consisting of Glu, Orn or Nle, the Xaa at position 15 is selected from the group of amino acids consisting of Asp, Glu, cysteic acid, homoglutamic acid and homocysteic acid, Xaa at position 16 is selected from the group of amino acids consisting of Ser, Glu, Gln, homoglutamic acid and homocysteic acid, the Xaa at position 20 is Gln or
- the glucagon related peptide comprises the sequence of SEQ ID NO: 81 further comprising an additional acidic amino acid added to the carboxy terminus of the peptide.
- the carboxy terminal amino acid of the glucagon analog has an amide in place of the carboxylic acid group of the natural amino acid.
- glucagon/GLP-1 receptor co-agonist comprising a modified glucagon related peptide selected from the group consisting of:
- Xaa at position 15 is selected from the group of amino acids consisting of Asp, Glu, cysteic acid, homoglutamic acid and homocysteic acid
- Xaa at position 16 is selected from the group of amino acids consisting of Ser, Glu, Gln, homoglutamic acid and homocysteic acid
- the Xaa at position 20 is Gln or Lys
- the Xaa at position 24 is Gln or Glu
- the Xaa at position 28 is Asn, Asp or Lys
- R is COOH or CONH2
- R is CONH2
- the Xaa at position 15 is Asp
- the Xaa at position 16 is selected from the group of amino acids consisting of Glu, Gln, homoglutamic acid and homocysteic acid
- the Xaas at positions 20 and 24 are each Gln
- the Xaa at position 28 is Asn or Asp
- the Xaa at position 29 is Thr.
- the Xaas at positions 15 and 16 are each Glu
- the Xaas at positions 20 and 24 are each Gln
- the Xaa at position 28 is Asn or Asp
- the Xaa at position 29 is Thr
- R is CONH2.
- glucagon peptide can be modified while retaining at least some of the activity of the parent peptide. Accordingly, applicants anticipate that one or more of the amino acids located at positions at positions 2, 5, 7, 10, 11, 12, 13, 14, 17, 18, 19, 20, 21, 24, 27, 28 or 29 of the peptide of SEQ ID NO: 99 can be substituted with an amino acid different from that present in the native glucagon peptide, and still retain activity at the glucagon receptor.
- the methionine residue present at position 27 of the native peptide is changed to leucine or norleucine to prevent oxidative degradation of the peptide.
- amino acid at position 20 is substituted with Lys, Arg, Orn or Citrulline and/or position 21 is substituted with Glu, homoglutamic acid or homocysteic acid.
- a glucagon analog of SEQ ID NO: 108 wherein 1 to 6 amino acids, selected from positions 1, 2, 5, 7, 10, 11, 13, 14, 17, 18, 19, 21, 27, 28 or 29 of the analog differ from the corresponding amino acid of SEQ ID NO: 701, with the proviso that when the amino acid at position 16 is serine, position 20 is Lys, or alternatively when position 16 is serine the position 24 is Glu and either position 20 or position 28 is Lys.
- a glucagon analog of SEQ ID NO: 108 is provided wherein 1 to 3 amino acids selected from positions 1, 2, 5, 7, 10, 11, 13, 14, 17, 18, 19, 20, 21, 27, 28 or 29 of the analog differ from the corresponding amino acid of SEQ ID NO: 701.
- a glucagon analog of SEQ ID NO: 96, SEQ ID NO: 97 or SEQ ID NO: 99 is provided wherein 1 to 2 amino acids selected from positions 1, 2, 5, 7, 10, 11, 13, 14, 17, 18, 19, 20 or 21 of the analog differ from the corresponding amino acid of SEQ ID NO: 701, and in a further embodiment the one to two differing amino acids represent conservative amino acid substitutions relative to the amino acid present in the native glucagon sequence (SEQ ID NO: 701).
- a glucagon peptide of SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102 or SEQ ID NO: 103 wherein the glucagon peptide further comprises one, two or three amino acid substitutions at positions selected from positions 2, 5, 7, 10, 11, 13, 14, 17, 18, 19, 20, 21, 27 or 29. In some embodiments the substitutions at positions 2, 5, 7, 10, 11, 13, 14, 16, 17, 18, 19, 20, 21, 27 or 29 are conservative amino acid substitutions.
- a glucagon/GLP-1 receptor co-agonist comprising a variant of the sequence of SEQ ID NO 81, wherein 1 to 10 amino acids selected from positions 16, 17, 18, 20, 21, 23, 24, 27, 28 and 29, respectively, of the variant differ from the corresponding amino acid of SEQ ID NO: 701.
- a variant of the sequence of SEQ ID NO 81 is provided wherein the variant differs from SEQ ID NO: 81 by one or more amino acid substitutions selected from the group consisting of Gln17, Ala18, Glu21, Ile23, Ala24, Val27 and Gly29.
- a glucagon/GLP-1 receptor co-agonist comprising variants of the sequence of SEQ ID NO 81, wherein 1 to 2 amino acids selected from positions 17-26 of the variant differ from the corresponding amino acid of SEQ ID NO: 701.
- a variant of the sequence of SEQ ID NO 81 is provided wherein the variant differs from SEQ ID NO: 81 by an amino acid substitution selected from the group consisting of Gln17, Ala18, Glu21, Ile23 and Ala24.
- a variant of the sequence of SEQ ID NO 81 wherein the variant differs from SEQ ID NO: 81 by an amino acid substitution at position 18 wherein the substituted amino acid is selected from the group consisting of Ala, Ser, Thr, and Gly.
- a variant of the sequence of SEQ ID NO 81 is provided wherein the variant differs from SEQ ID NO: 81 by an amino acid substitution of Ala at position 18. Such variations are encompassed by SEQ ID NO: 72.
- a glucagon/GLP-1 receptor co-agonist comprising variants of the sequence of SEQ ID NO 81, wherein 1 to 2 amino acids selected from positions 17-22 of the variant differ from the corresponding amino acid of SEQ ID NO: 701, and in a further embodiment a variant of SEQ ID NO 81 is provided wherein the variant differs from SEQ ID NO: 81 by for 2 amino acid substitutions at positions 20 and 21.
- glucagon/GLP-1 receptor co-agonist comprising the sequence:
- R is CONH 2 .
- a glucagon/GLP-1 receptor co-agonist comprising a variant of SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 114, SEQ ID NO: 115 or SEQ ID NO: 116, wherein the variant differs from said sequence by an amino acid substitution at position 20.
- the amino acid substitution is selected form the group consisting of Lys, Arg, Orn or citrulline for position 20.
- a glucagon agonist comprising an analog peptide of SEQ ID NO: 82 wherein the analog differs from SEQ ID NO: 82 by having an amino acid other than serine at position 2.
- the serine residue is substituted with aminoisobutyric acid, D-alanine, and in some embodiments the serine residue is substituted with aminoisobutyric acid.
- Such modifications suppresses cleavage by dipeptidyl peptidase IV while retaining the inherent potency of the parent compound (e.g. at least 75, 80, 85, 90, 95% or more of the potency of the parent compound).
- the solubility of the analog is increased, for example, by introducing one, two, three or more charged amino acid(s) to the C-terminal portion of native glucagon, preferably at a position C-terminal to position 27.
- one, two, three or all of the charged amino acids are negatively charged.
- the analog further comprises an acidic amino acid substituted for the native amino acid at position 28 or 29 or an acidic amino acid added to the carboxy terminus of the peptide of SEQ ID NO: 82.
- the glucagon analogs disclosed herein are further modified at position 1 or 2 to reduce susceptibility to cleavage by dipeptidyl peptidase IV.
- a glucagon analog of SEQ ID NO: 97, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102 or SEQ ID NO: 103 is provided wherein the analog differs from the parent molecule by a substitution at position 2 and exhibits reduced susceptibility (i.e., resistance) to cleavage by dipeptidyl peptidase IV.
- position 2 of the analog peptide is substituted with an amino acid selected from the group consisting of D-serine, D-alanine, valine, amino n-butyric acid, glycine, N-methyl serine and aminoisobutyric acid.
- position 2 of the analog peptide is substituted with an amino acid selected from the group consisting of D-serine, D-alanine, glycine, N-methyl serine and aminoisobutyric acid.
- position 2 of the analog peptide is substituted with an amino acid selected from the group consisting of D-serine, glycine, N-methyl serine and aminoisobutyric acid.
- the amino acid at position 2 is not D-serine.
- the glucagon related peptide comprises the sequence of SEQ ID NO: 127 or SEQ ID NO: 128.
- a glucagon analog of SEQ ID NO: 97, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102 or SEQ ID NO: 103 is provided wherein the analog differs from the parent molecule by a substitution at position 1 and exhibits reduced susceptibility (i.e., resistance) to cleavage by dipeptidyl peptidase IV.
- position 1 of the analog peptide is substituted with an amino acid selected from the group consisting of D-histidine, alpha, alpha-dimethyl imidiazole acetic acid (DMIA), N-methyl histidine, alpha-methyl histidine, imidazole acetic acid, desaminohistidine, hydroxyl-histidine, acetyl-histidine and homo-histidine.
- a glucagon agonist is provided comprising an analog peptide of SEQ ID NO: 82 wherein the analog differs from SEQ ID NO: 82 by having an amino acid other than histidine at position 1.
- the solubility of the analog is increased, for example, by introducing one, two, three or more charged amino acid(s) to the C-terminal portion of native glucagon, preferably at a position C-terminal to position 27.
- one, two, three or all of the charged amino acids are negatively charged.
- the analog further comprises an acidic amino acid substituted for the native amino acid at position 28 or 29 or an acidic amino acid added to the carboxy terminus of the peptide of SEQ ID NO: 82.
- the acidic amino acid is aspartic acid or glutamic acid.
- the glucagon/GLP-1 receptor co-agonist comprises a sequence of SEQ ID NO: 108 further comprising an additional carboxy terminal extension of one amino acid or a peptide selected from the group consisting of SEQ ID NO: 78, SEQ ID NO: 117 and SEQ ID NO: 118.
- the amino acid is typically selected from one of the 20 common amino acids, and in some embodiments the additional carboxy terminus amino acid has an amide group in place of the carboxylic acid of the native amino acid.
- the additional amino acid is selected from the group consisting of glutamic acid, aspartic acid and glycine.
- a glucagon/GLP-1 receptor co-agonist wherein the peptide comprises at least one lactam ring formed between the side chain of a glutamic acid residue and a lysine residue, wherein the glutamic acid residue and a lysine residue are separated by three amino acids.
- the carboxy terminal amino acid of the lactam bearing glucagon peptide has an amide group in place of the carboxylic acid of the native amino acid.
- a glucagon and GLP-1 co-agonist comprising a modified glucagon peptide selected from the group consisting of:
- R is selected from the group consisting of COOH, CONH 2 , glutamic acid, aspartic acid, glycine, SEQ ID NO: 78, SEQ ID NO: 117 and SEQ ID NO: 118, and a lactam bridge is formed between Lys at position 12 and Glu at position 16 for SEQ ID NO: 109, between Glu at position 16 and Lys at position 20 for SEQ ID NO: 110, between Lys at position 20 and Glu at position 24 for SEQ ID NO: 111, between Glu at position 24 and Lys at position 28 for SEQ ID NO: 112, between Lys at position 12 and Glu at position 16 and between Lys at position 20 and Glu at position 24 for SEQ ID NO: 104, between Lys at position 12 and Glu at position 16 and between Glu at position 24 and Lys at position 28 for SEQ ID NO: 105 and between Glu at position 16 and
- R is selected from the group consisting of COOH, CONH 2 , glutamic acid, aspartic acid, glycine, the amino acid at position 28 is Asn, and the amino acid at position 29 is threonine.
- R is CONH 2 , the amino acid at position 28 is Asn and the amino acid at position 29 is threonine.
- R is selected from the group consisting of SEQ ID NO: 78, SEQ ID NO: 79 and SEQ ID NO: 80 and the amino acid at position 29 is glycine.
- the glucagon/GLP-1 receptor co-agonist is selected from the group consisting of SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105 and SEQ ID NO: 106, wherein the peptide further comprises an additional carboxy terminal extension of one amino acid or a peptide selected from the group consisting of SEQ ID NO: 78, SEQ ID NO: 117 and SEQ ID NO: 118.
- the terminal extension comprises the sequence of SEQ ID NO: 78, SEQ ID NO: 79 or SEQ ID NO: 80 and the glucagon related peptide comprises the sequence of SEQ ID NO: 72.
- the glucagon/GLP-1 receptor co-agonist comprises the sequence of SEQ ID NO: 81 wherein the amino acid at position 16 is glutamic acid, the amino acid at position 20 is lysine, the amino acid at position 28 is asparagine and the amino acid sequence of SEQ ID No: 78 or SEQ ID NO: 79 is linked to the carboxy terminus of SEQ ID NO: 81.
- the amino acid is typically selected from one of the 20 common amino acids, and in some embodiments the amino acid has an amide group in place of the carboxylic acid of the native amino acid. In some embodiments the additional amino acid is selected from the group consisting of glutamic acid and aspartic acid and glycine.
- the glucagon agonist analog further comprises a carboxy terminal extension, the carboxy terminal amino acid of the extension, in some embodiments, ends in an amide group or an ester group rather than a carboxylic acid.
- the glucagon/GLP-1 receptor co-agonist comprises the sequence: NH 2 -His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Glu-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Xaa-CONH 2 (SEQ ID NO: 107), wherein the Xaa at position 30 represents any amino acid.
- Xaa is selected from one of the 20 common amino acids, and in some embodiments the amino acid is glutamic acid, aspartic acid or glycine.
- the solubility of this peptide can be further improved by covalently linking a PEG chain to the side chain of amino acid at position 17, 21, 24 or 30 of SEQ ID NO: 107.
- the peptide comprises an additional carboxy terminal extension of a peptide selected from the group consisting of SEQ ID NO: 78, SEQ ID NO: 117 and SEQ ID NO: 118.
- the glucagon/GLP-1 receptor co-agonist comprises the sequence of SEQ ID NO: 129, SEQ ID NO: 130 and SEQ ID NO: 131.
- Additional site specific modifications internal to the glucagon sequence of SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 107 and SEQ ID NO: 121 can be made to yield a set of glucagon agonists that possess variable degrees of GLP-1 agonism. Accordingly, peptides that possess virtually identical in vitro potency at each receptor have been prepared and characterized. Similarly, peptides with tenfold selectively enhanced potency at each of the two receptors have been identified and characterized.
- substitution of the serine residue at position 16 with glutamic acid enhances the potency of native glucagon at both the Glucagon and GLP-1 receptors, but maintains approximately a tenfold selectivity for the glucagon receptor.
- substitution of the native glutamine at position 3 with glutamic acid SEQ ID NO: 128, generates a glucagon analog that exhibits approximately a tenfold selectivity for the GLP-1 receptor.
- the solubility of the glucagon/GLP-1 co-agonist peptides can be further enhanced in aqueous solutions at physiological pH, while retaining the high biological activity relative to native glucagon by the introduction of hydrophilic groups at positions 16, 17, 21, and 24 of the peptide, or by the addition of a single modified amino acid (i.e., an amino acid modified to comprise a hydrophilic group) at the carboxy terminus of the glucagon/GLP-1 co-agonist peptide.
- the hydrophilic group comprises a polyethylene (PEG) chain.
- the glucagon peptide comprises the sequence of SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105 or SEQ ID NO: 106 wherein a PEG chain is covalently linked to the side chain of an amino acids at position 16, 17, 21, 24, 29 or the C-terminal amino acid of the glucagon peptide, with the proviso that when the peptide comprises SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100 or SEQ ID NO: 101 the polyethylene glycol chain is covalently bound to an amino acid residue at position 17, 21 or 24, when the peptide comprises SEQ ID NO: 102 or SEQ ID NO: 103 the polyethylene glycol chain is covalently bound to an amino acid residue at position 16, 17 or 21, and when the peptide comprises SEQ ID NO: 104, SEQ ID NO:
- the glucagon peptide comprises the sequence of SEQ ID NO: 99, SEQ ID NO: 100 or SEQ ID NO: 101, wherein a PEG chain is covalently linked to the side chain of an amino acids at position 17, 21, 24, or the C-terminal amino acid of the glucagon peptide, and the carboxy terminal amino acid of the peptide has an amide group in place of the carboxylic acid group of the native amino acid.
- the glucagon/GLP-1 receptor co-agonist peptide comprises a sequence selected from the group consisting of SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106 and SEQ ID NO: 107, wherein a PEG chain is covalently linked to the side chain of an amino acid at position 17, 21 or 24 of SEQ ID NO: 100, SEQ ID NO: 101 and SEQ ID NO: 107, or at position 16, 17 or 21 of SEQ ID NO: 102 and SEQ ID NO: 103 or at position 17 or 21 of SEQ ID NO: 104, SEQ ID NO: 105 and SEQ ID NO: 106 of the glucagon peptide.
- the glucagon/GLP-1 receptor co-agonist peptide comprises the sequence of SEQ ID NO: 99 or SEQ ID NO: 107, wherein a PEG chain is covalently linked to the side chain of an amino acids at position 17, 21 or 24 or the C-terminal amino acid of the glucagon peptide.
- a glucagon peptide selected from the group consisting of SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, and SEQ ID NO: 107 is further modified to comprise a PEG chain covalently linked to the side chain of an amino acid at position 17 or 21 of the glucagon peptide.
- the pegylated glucagon/GLP-1 receptor co-agonist further comprises the sequence of SEQ ID NO: 78, SEQ ID NO: 117 or SEQ ID NO: 79.
- the glucagon related peptide comprises the sequence of SEQ ID NO: 72 or SEQ ID NO: 120, further comprising a C-terminal extension of SEQ ID NO: 78, SEQ ID NO: 79 or SEQ ID NO: 80 linked to the C-terminal amino acid of SEQ ID NO: 72 or SEQ ID NO: 120, and optionally further comprising a PEG chain covalently linked to the side chain of an amino acids at position 17, 18, 21, 24 or 29 or the C-terminal amino acid of the peptide.
- the glucagon related peptide comprises the sequence of SEQ ID NO: 72 or SEQ ID NO: 120, wherein a PEG chain is covalently linked to the side chain of an amino acids at position 21 or 24 of the glucagon related peptide and the peptide further comprises a C-terminal extension of SEQ ID NO: 78, or SEQ ID NO: 79.
- the glucagon related peptide comprises the sequence of SEQ ID NO: 72, or SEQ ID NO: 81 or SEQ ID NO: 82, wherein an additional amino acid is added to the carboxy terminus of SEQ ID NO: 81 or SEQ ID NO: 82, and a PEG chain is covalently linked to the side chain of the added amino acid.
- the pegylated glucagon analog further comprises a C-terminal extension of SEQ ID NO: 78 or SEQ ID NO: 79 linked to the C-terminal amino acid of SEQ ID NO: 81 or SEQ ID NO: 82.
- the glucagon related peptide comprises the sequence of SEQ ID NO: 107, wherein a PEG chain is covalently linked to the side chain of the amino acid at position 30 of the glucagon related peptide and the peptide further comprises a C-terminal extension of SEQ ID NO: 78 or SEQ ID NO: 79 linked to the C-terminal amino acid of SEQ ID NO: 107.
- the polyethylene glycol chain may be in the form of a straight chain or it may be branched. In accordance with some embodiments the polyethylene glycol chain has an average molecular weight selected from the range of about 500 to about 10,000 Daltons. In some embodiments the polyethylene glycol chain has an average molecular weight selected from the range of about 1,000 to about 5,000 Daltons. In an alternative embodiment the polyethylene glycol chain has an average molecular weight selected from the range of about 10,000 to about 20,000 Daltons. In accordance with some embodiments the pegylated glucagon related peptide comprises two or more polyethylene glycol chains covalently bound to the glucagon related peptide wherein the total molecular weight of the glucagon chains is about 1,000 to about 5,000 Daltons.
- the pegylated glucagon agonist comprises a peptide consisting of SEQ ID NO: 93 or a glucagon agonist analog of SEQ ID NO: 93, wherein a PEG chain is covalently linked to the amino acid residue at position 21 and at position 24, and wherein the combined molecular weight of the two PEG chains is about 1,000 to about 5,000 Daltons.
- the glucagon peptide comprises the amino acid sequence of SEQ ID NO: 701 with up to ten amino acid modifications and comprises an amino acid at position 10 which is acylated or alkylated.
- the amino acid at position 10 is acylated or alkylated with a C4 to C30 fatty acid.
- the amino acid at position 10 comprises an acyl group or an alkyl group which is non-native to a naturally-occurring amino acid.
- the glucagon peptide comprising an amino acid at position 10 which is acylated or alkylated comprises a stabilized alpha helix.
- the glucagon peptide comprises an acyl or alkyl group as described herein and an intramolecular bridge, e.g., a covalent intramolecular bridge (e.g., a lactam bridge) between the side chains of an amino acid at position i and an amino acid at position i+4, wherein i is 12, 16, 20, or 24.
- an intramolecular bridge e.g., a covalent intramolecular bridge (e.g., a lactam bridge) between the side chains of an amino acid at position i and an amino acid at position i+4, wherein i is 12, 16, 20, or 24.
- the glucagon peptide comprises an acyl or alkyl group as described herein and one, two, three or more of positions 16, 20, 21 and/or 24 of the glucagon peptide are substituted with an ⁇ , ⁇ -disubstituted amino acid, e.g., AIB.
- the non-native glucagon peptide comprises Glu at position 16 and Lys at position 20, wherein optionally a lactam bridge links the Glu and the Lys, and, optionally, the glucagon peptide further comprises one or more modifications selected from the group consisting of: Gln at position 17, Ala at position 18, Glu at position 21, Ile at position 23, and Ala at position 24.
- the glucagon related peptide comprises an amino acid at position 10 which is acylated or alkylated
- the glucagon related peptide can further comprise a C-terminal amide in lieu of the C-terminal alpha carboxylate.
- the glucagon related peptide comprising an acyl or alkyl group as described herein further comprises an amino acid substitution at position 1, at position 2, or at positions 1 and 2, wherein the amino acid substitution(s) achieve DPP-IV protease resistance.
- the glucagon related peptide is one which comprises SEQ ID NOs: 72 with an amino acid at position 10 acylated or alkylated as described herein.
- the acyl or alkyl group of these embodiments may be any acyl or alkyl group described herein.
- the acyl group may be a C4 to C30 (e.g., C8 to C24) fatty acyl group and the alkyl group may be a C4 to C30 (e.g., C8 to C24) alkyl group.
- the amino acid to which the acyl or alkyl group is attached may be any of the amino acids described herein, e.g., an amino acid of any of Formula I (e.g., Lys), Formula II, and Formula III.
- the acyl group or alkyl group is directly attached to the amino acid at position 10.
- the acyl or alkyl group is attached to the amino acid at position 10 via a spacer, such as, for example, a spacer which is 3 to 10 atoms in length, e.g., an amino acid or dipeptide. Suitable spacers for purposes of attaching an acyl or alkyl group are described herein.
- the glucagon analogs comprise at least one amino acid modification and up to 15 amino acid modifications (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 amino acid modifications), or up to 10 amino acid modifications.
- the analogs comprising at least one amino acid modification and up to 10 amino acid modifications represent conservative amino acid modifications. Conservative amino acid modifications are described herein.
- the glucagon analog comprises the amino acid sequence of SEQ ID NO: 701 with one or more of: Gln at position 17, Ala at position 18, Glu at position 21, Ile at position 23, and Ala or Cys at position 24, or conservative amino acid substitutions thereof.
- the analog comprises a C-terminal amide in place of the C-terminal alpha carboxylate.
- the analog comprises an amino acid substitution at position 1, position 2, or positions 1 and 2, which substitution(s) achieve DPP-IV protease resistance. Suitable amino acid substitutions are described herein. For example, DMIA at position 1 and/or d-Ser or AIB at position 2.
- the amino acid at position 2 is not D-serine.
- the analog may comprise one or a combination of: (a) Ser at position 2 substituted with Ala; (b) Gln at position 3 substituted with Glu or a glutamine analog; (c) Thr at position 7 substituted with a Ile; (d) Tyr at position 10 substituted with Trp or an amino acid comprising an acyl or alkyl group which is non-native to a naturally-occurring amino acid; (e) Lys at position 12 substituted with Ile; (f) Asp at position 15 substituted with Glu; (g) Ser at position 16 substituted with Glu; (h) Gln at position 20 substituted with Ser, Thr, Ala, AIB; (i) Gln at position 24 substituted with Ser, Thr, Ala, AIB; (j) Met at position 27 substituted with Leu or Nle; (k) Asn at position 29 substituted with a charged amino acid, optionally, Asp or Glu; and (1) Thr at position 29 substituted with Gly or a charged
- the analog comprises an extension of 1-21 amino acids (e.g., 5-19, 7-15, 9-12 amino acids).
- the extension of the analog may comprise any amino acid sequence, provided that the extension is 1 to 21 amino acids. In some aspects, the extension is 7 to 15 amino acids and in other aspects, the extension is 9 to 12 amino acids.
- the extension comprises (i) the amino acid sequence of SEQ ID NO: 78 or 674, (ii) an amino acid sequence which has high sequence identity (e.g., at least 80%, 85%, 90%, 95%, 98%, 99%) with the amino acid sequence of SEQ ID NO: 78 or 674, or (iii) the amino acid sequence of (i) or (ii) with one or more conservative amino acid modifications.
- At least one of the amino acids of the extension is acylated or alkylated.
- the amino acid comprising the acyl or alkyl group may be located at any position of extension of the analog.
- the acylated or alkylated amino acid of the extension is located at one of positions 37, 38, 39, 40, 41, or 42 (according to the numbering of SEQ ID NO: 701) of the analog.
- the acylated or alkylated amino acid is located at position 40 of the analog.
- the acyl or alkyl group is an acyl or alkyl group which is non-native to a naturally-occurring amino acid.
- the acyl or alkyl group may be a C4 to C30 (e.g., C12 to C18) fatty acyl group or C4 to C30 (e.g., C12 to C18) alkyl.
- the acyl or alkyl group may be any of those discussed herein.
- the acyl or alkyl group is attached directly to the amino acid, e.g., via the side chain of the amino acid.
- the acyl or alkyl group is attached to the amino acid via a spacer (e.g., an amino acid, a dipeptide, a tripeptide, a hydrophilic bifunctional spacer, a hydrophobic bifunctional spacer).
- the spacer is 3 to 10 atoms in length.
- the amino acid spacer is not ⁇ -Glu.
- the dipeptide spacer is not ⁇ -Glu- ⁇ -Glu.
- the amino acid to which the acyl or alkyl group is attached may be any of those described herein, including, for example, an amino acid of Formula I, II, or III.
- the amino acid which is acylated or alkylated may be a Lys, for example.
- Suitable amino acids comprising an acyl or alkyl group, as well as suitable acyl groups and alkyl groups, are described herein. See, for example, the teachings under the sections entitled Acylation and Alkylation.
- 1-6 amino acids (e.g., 1-2, 1-3, 1-4, 1-5 amino acids) of the extension are positive-charged amino acids, e.g., amino acids of Formula IV, such as, for example, Lys.
- positive-charged amino acid refers to any amino acid, naturally-occurring or non-naturally occurring, comprising a positive charge on an atom of its side chain at a physiological pH.
- the positive-charged amino acids are located at any of positions 37, 38, 39, 40, 41, 42, and 43.
- a positive-charged amino acid is located at position 40.
- the extension is acylated or alkylated as described herein and comprises 1-6 positive charged amino acids as described herein.
- the analogs which exhibit agonist activity at the GIP receptor comprises (i) SEQ ID NO: 701 with at least one amino acid modification, (ii) an extension of 1 to 21 amino acids (e.g., 5 to 18, 7 to 15, 9 to 12 amino acids)C-terminal to the amino acid at position 29 of the analog, and (iii) an amino acid comprising an acyl or alkyl group which is non-native to a naturally-occurring amino acid which is located outside of the C-terminal extension (e.g., at any of positions 1-29).
- the analog comprises an acylated or alkylated amino acid at position 10.
- the acyl or alkyl group is a C4 to C30 fatty acyl or C4 to C30 alkyl group.
- the acyl or alkyl group is attached via a spacer, e.g., an amino acid, dipeptide, tripeptide, hydrophilic bifunctional spacer, hydrophobic bifunctional spacer).
- the analog comprises an amino acid modification which stabilizes the alpha helix, such as a salt bridge between a Glu at position 16 and a Lys at position 20, or an alpha, alpha-disubstituted amino acid at any one, two, three, or more of positions 16, 20, 21, and 24.
- the analog additionally comprises amino acid modifications which confer DPP-IV protease resistance, e.g., DMIA at position 1, AIB at position 2.
- Analogs comprising further amino acid modifications are contemplated herein.
- the Class 3 glucagon related peptide comprises the structures of any of SEQ ID NOs: 657-669.
- the Class 3 glucagon related peptide comprises the amino acid sequence of native glucagon (SEQ ID NO: 701) comprising the following modifications: AIB at position 2, Glu at position 3, Lys at position 10, Glu at position 16, Gln at position 17, Ala at position 18, Lys at position 20, Glu at position 21, Ile at position 23, Ala at position 24; wherein Lys at position 10 is acylated with a C14 or C16 fatty acid, and wherein the C-terminal carboxylate is replaced with an amide.
- this Class 3 glucagon related peptide is attached via its N-terminal amino acid to the dipeptide D-Lys-Sarcosine.
- the Class 3 glucagon related peptide comprises, consists essentially of, or consists of an amino acid sequence of any of SEQ ID NOs: 514, 517-534, or 554, optionally with up to 1, 2, 3, 4, or 5 further modifications that retain GLP-1 agonist and/or glucagon agonist activity.
- the Class 3 glucagon related peptide comprises the amino acids of any of SEQ ID NOs: 562-684, and 1701-1776.
- the Class 3 glucagon related peptide comprises the amino acid sequences of any of SEQ ID NOs: 1801-1908.
- the disclosed glucagon related peptide-insulin peptide conjugates are believed to be suitable for any use that has previously been described for insulin peptides. Accordingly, the glucagon related peptide-insulin conjugates described herein can be used to treat hyperglycemia, or treat other metabolic diseases that result from high blood glucose levels. Accordingly, the present invention encompasses pharmaceutical compositions comprising a glucagon related peptide-insulin conjugate as disclosed herein and a pharmaceutically acceptable carrier for use in treating a patient suffering from high blood glucose levels.
- the patient to be treated using a glucagon related peptide-insulin conjugate disclosed herein is a domesticated animal, and in another embodiment the patient to be treated is a human.
- One method of treating hyperglycemia in accordance with the present disclosure comprises the steps of administering the presently disclosed glucagon related peptide-insulin conjugate to a patient using any standard route of administration, including parenterally, such as intravenously, intraperitoneally, subcutaneously or intramuscularly, intrathecally, transdermally, rectally, orally, nasally or by inhalation.
- parenterally such as intravenously, intraperitoneally, subcutaneously or intramuscularly, intrathecally, transdermally, rectally, orally, nasally or by inhalation.
- the composition is administered subcutaneously or intramuscularly.
- the composition is administered parenterally and the glucagon related peptide-insulin conjugate is prepackaged in a syringe.
- the glucagon related peptide-insulin conjugate disclosed herein may be administered alone or in combination with other anti-diabetic agents.
- Anti-diabetic agents known in the art or under investigation include native insulin, native glucagon and functional analogs thereof, sulfonylureas, such as tolbutamide (Orinase), acetohexamide (Dymelor), tolazamide (Tolinase), chlorpropamide (Diabinese), glipizide (Glucotrol), glyburide (Diabeta, Micronase, Glynase), glimepiride (Amaryl), or gliclazide (Diamicron); meglitinides, such as repaglinide (Prandin) or nateglinide (Starlix); biguanides such as metformin (Glucophage) or phenformin; thiazolidinediones such as rosiglitazone (Avandia), pio
- compositions comprising the glucagon related peptide-insulin conjugates disclosed herein can be formulated and administered to patients using standard pharmaceutically acceptable carriers and routes of administration known to those skilled in the art. Accordingly, the present disclosure also encompasses pharmaceutical compositions comprising one or more of the glucagon related peptide-insulin conjugates disclosed herein or a pharmaceutically acceptable salt thereof, in combination with a pharmaceutically acceptable carrier.
- the pharmaceutical composition comprises a 1 mg/ml concentration of the glucagon related peptide-insulin conjugate at a pH of about 4.0 to about 7.0 in a phosphate buffer system.
- the pharmaceutical compositions may comprise the glucagon related peptide-insulin conjugate as the sole pharmaceutically active component, or the glucagon related peptide-insulin conjugate peptide can be combined with one or more additional active agents.
- glucagon related peptide-insulin conjugate peptides include all pharmaceutically acceptable salts thereof.
- the kit is provided with a device for administering the glucagon related peptide-insulin conjugate to a patient.
- the kit may further include a variety of containers, e.g., vials, tubes, bottles, and the like.
- the kits will also include instructions for use.
- the device of the kit is an aerosol dispensing device, wherein the composition is prepackaged within the aerosol device.
- the kit comprises a syringe and a needle, and in one embodiment the glucagon related peptide-insulin conjugate composition is prepackaged within the syringe.
- the compounds of this invention may be prepared by standard synthetic methods, recombinant DNA techniques, or any other methods of preparing peptides and fusion proteins. Although certain non-natural amino acids cannot be expressed by standard recombinant DNA techniques, techniques for their preparation are known in the art. Compounds of this invention that encompass non-peptide portions may be synthesized by standard organic chemistry reactions, in addition to standard peptide chemistry reactions when applicable.
- an insulin agonist/incretin conjugate comprising a glucagon related peptide and an insulin peptide is provided, wherein the glucagon related peptide is linked either directly or through a linker to the insulin peptide.
- the conjugate of embodiment 1 has the C-terminal region of the glucagon related peptides covalently linked to the insulin peptide through a position independently selected from the side chain of an amino acid at a position selected from the group consisting of A9, A14 and A15 of the A chain, positions B1, B2, B10, B22, B28 or B29 of the B chain, the N-terminal alpha amine of the B chain, the carboxy terminus of the B chain and at the side chain of an amino acid at any position of a linking moiety that links the A chain and B chain of a single chain insulin analog.
- embodiment 1 or 2 has the carboxy terminus of the glucagon related peptide covalently linked to the amino terminus of the B chain of the insulin peptide.
- the conjugate of any one of embodiments 1-3 comprises the insulin peptide as a single chain insulin analog.
- the conjugate of any of embodiments 1-4 comprises a single chain insulin analog wherein a glucagon related peptide is linked to the amino acid side chain of an amino acid of the linking moiety that links the A chain and B chain of the single chain insulin analog.
- the conjugate of any of embodiments 1-4 comprises a two chain insulin analog and said conjugate comprises a first and second glucagon related peptide wherein each glucagon related peptide is independently covalently linked to the insulin peptide at a position selected from the group consisting of the amino terminus of the B chain, the carboxy terminus of the A chain, and the carboxy terminus of the B chain.
- glucagon related peptide has glucagon agonist activity
- amino acid sequence of SEQ ID NO: 701 modified to comprise at least one amino acid modification selected from the group consisting of:
- Group A is an amino acid modification selected from the group consisting of substitution of Ser at position 16 with Thr or AIB;
- Group B is an amino acid modification selected from the group consisting of:
- DPP-IV dipeptidyl peptidase IV
- DPP-IV dipeptidyl peptidase IV
- glucagon related peptide has glucagon agonist activity
- EC50 of the analog for GIP receptor activation is about 10 nM or less
- an amino acid that differs from SEQ ID NO: 701 by no more than ten amino acid modifications comprising one or more amino acid substitutions with AIB at positions 16, 20, 21, and/or 24, and an amino acid modification at position 1 and/or 2 that provides reduced susceptibility to cleavage by dipeptidyl peptidase IV, wherein said glucagon related peptide exhibits at least 20% of the activity of native GLP-1 at the GLP-1 receptor;
- the conjugate of any one of embodiment 1-7 is provided wherein said insulin peptide comprises an A chain and a B chain wherein said A chain comprises a sequence GIVX 4 X 5 CCX 8 X 9 X 10 CX 12 LX 14 X 15 LX 17 X 18 YCX 21 -R 13 (SEQ ID NO: 19), and said B chain comprises a sequence R 22 -X 25 LCGX 29 X 30 LVX 33 X 34 LYLVCGX 41 X 42 GFX 45 (SEQ ID NO: 20), wherein
- X 4 is glutamic acid or aspartic acid
- X 5 is glutamine or glutamic acid
- X 8 is histidine, threonine or phenylalanine
- X 9 is serine, arginine, lysine, ornithine or alanine
- X 10 is isoleucine or serine
- X 12 is serine or aspartic acid
- X 14 is tyrosine, arginine, lysine, ornithine or alanine;
- X 15 is glutamine, glutamic acid, arginine, alanine, lysine, ornithine or leucine;
- X 17 is glutamic acid, aspartic acid, asparagine, lysine, ornithine or glutamine;
- X 18 is methionine, asparagine, glutamine, aspartic acid, glutamic acid or threonine;
- X 21 is selected from the group consisting of alanine, glycine, serine, valine, threonine, isoleucine, leucine, glutamine, glutamic acid, asparagine, aspartic acid, histidine, tryptophan, tyrosine, and methionine;
- X 25 is histidine or threonine
- X 29 is selected from the group consisting of alanine, glycine and serine;
- X 30 is selected from the group consisting of histidine, aspartic acid, glutamic acid, homocysteic acid and cysteic acid;
- X 33 is selected from the group consisting of aspartic acid and glutamic acid;
- X 34 is selected from the group consisting of alanine and threonine
- X 41 is selected from the group consisting of glutamic acid, aspartic acid or asparagine;
- X 42 is selected from the group consisting of alanine, ornithine, lysine and arginine;
- X 45 is tyrosine or phenylalanine
- R 22 is selected from the group consisting of AYRPSE (SEQ ID NO: 14), FVNQ (SEQ ID NO: 12), PGPE (SEQ ID NO: 11), a tripeptide glycine-proline-glutamic acid, a tripeptide valine-asparagine-glutamine, a dipeptide proline-glutamic acid, a dipeptide asparagine-glutamine, glutamine, glutamic acid and an N-terminal amine; and
- R 13 is COOH or CONH 2 .
- the conjugate of any one of embodiments 1-7 is provided wherein said A chain comprises the sequence GIVEQCCX 8 X 9 ICSLYQLENYCX 21 -R 13 (SEQ ID NO: 73) said B chain comprises the sequence R 22 -X 25 LCGX 29 X 30 LVX 33 X 34 LYLVCGX 41 X 42 GFX 45 (SEQ ID NO: 20)
- X 8 is histidine or threonine
- X 9 is serine, lysine, or alanine
- X 21 is alanine, glycine or asparagine
- X 25 is histidine or threonine
- X 29 is selected from the group consisting of alanine, glycine and serine;
- X 30 is selected from the group consisting of histidine, aspartic acid, glutamic acid, homocysteic acid and cysteic acid;
- X 33 is selected from the group consisting of aspartic acid and glutamic acid;
- X 34 is selected from the group consisting of alanine and threonine
- X 41 is selected from the group consisting of glutamic acid, aspartic acid or asparagine;
- X 42 is selected from the group consisting of alanine, ornithine, lysine and arginine;
- X 45 is tyrosine or phenylalanine
- R 22 is selected from the group consisting of FVNQ (SEQ ID NO: 12), a tripeptide valine-asparagine-glutamine, a dipeptide asparagine-glutamine, glutamine and an N-terminal amine; and
- R 13 is COOH or CONH 2 .
- the conjugate of any one of embodiments 1-7 is provided wherein said A chain comprises a sequence GIVDECCX 8 X 9 SCDLRRLEMX 19 CX 21 -R 13 (SEQ ID NO: 74) and said B chain comprises a sequence R 22 -X 25 LCGAX 30 LVDALYLVCGDX 42 GFY (SEQ ID NO: 75), wherein
- X 8 is phenylalanine or histidine
- X 9 is arginine, ornithine or alanine
- X 19 is tyrosine, 4-methoxy-phenylalanine or 4-amino-phenylalanine;
- X 21 is alanine or asparagine
- X 25 is histidine or threonine
- X 30 is selected from the group consisting of histidine, aspartic acid, glutamic acid, homocysteic acid and cysteic acid;
- X 42 is selected from the group consisting of alanine ornithine and arginine; and R 13 is COOH or CONH 2 ;
- R 22 is selected from the group consisting of AYRPSE (SEQ ID NO: 14), FVNQ (SEQ ID NO: 12), PGPE (SEQ ID NO: 11), a tripeptide glycine-proline-glutamic acid, a tripeptide valine-asparagine-glutamine, a dipeptide proline-glutamic acid, a dipeptide asparagine-glutamine, glutamine, glutamic acid and an N-terminal amine; and
- R 13 is COOH or CONH 2 .
- the conjugate of any one of embodiments 1-7 is provided wherein said B chain comprises a sequence R 22 -X 25 LCGX 29 X 30 LVX 33 X 34 LYLVCGX 41 X 42 GFX 45 YT-Z 1 -B 1 (SEQ ID NO: 142), wherein
- Z 1 is a dipeptide selected from the group consisting of aspartate-lysine, lysine-proline, and proline-lysine;
- B 1 is selected from the group consisting of threonine, alanine or a threonine-arginine-arginine tripeptide.
- the conjugate of any one of embodiments 1-7 is provided wherein said A chain comprises a sequence GIVEQCCTSICSLYQLENYCN-R 13 (SEQ ID NO: 1) and said B chain comprises a sequence FVNQHLCGSHLVEALYLVCGERGFFYTPKT (SEQ ID NO: 2).
- the conjugate of any one of embodiments 1-12 is provided wherein the insulin peptide is a single chain insulin and the peptide linker joining the B and A chains is selected from the group consisting of SSSSKAPPPSLPSPSRLPGPSDTPILPQR (SEQ ID NO: 52), SSSSRAPPPSLPSPSRLPGPSDTPILPQK (SEQ ID NO: 51), GAGSSSX 57 X 58 (SEQ ID NO: 76), GYGSSSX 57 X 58 (SEQ ID NO: 21) and GYGSSSX 57 X 58 APQT; (SEQ ID NO: 77), wherein
- X 57 and X 58 are independently arginine, lysine or ornithine.
- the conjugate of any one of embodiments 1-13 is provided wherein the peptide linker is selected from the group consisting of GYGSSSRR (SEQ ID NO: 18) and GAGSSSRR (SEQ ID NO: 22).
- the conjugate of any one of embodiments 1-14 is provided wherein the glucagon related peptide comprises the sequence of SEQ ID NO: 72 or an analog of SEQ ID NO: 72, wherein said analog differs from SEQ ID NO: 72 by 1 to 3 amino acid modifications, selected from positions 1, 2, 3, 5, 7, 10, 11, 13, 14, 17, 18, 19, 21, 24, 27, 28, and 29, wherein the glucagon related peptide comprises an intramolecular bridge between the side chains of the amino acids at positions 12 and 16, 16 and 20, 20 and 24, or 24 and 28 or a pharmaceutically acceptable salt thereof.
- the conjugate of any one of embodiments 1-15 is provided wherein the glucagon related peptide comprises a salt bridge or a lactam bridge between amino acids at positions 16 and 20.
- the conjugate of any one of embodiments 1-16 is provided further comprising a peptide selected from the group consisting of SEQ ID NOs: 78, 79, and 80 linked to the carboxy terminus of said glucagon related peptide.
- the conjugate of any one of embodiments 1-17 is provided wherein the amino acid at position 3 of the glucagon related peptide is glutamic acid.
- the conjugate of any one of embodiments 1-18 is provided wherein the amino acid at position 28 of the glucagon related peptide is Asp, Asn, or Lys, and the amino acid at position 29 of the glucagon related peptide is Gly or Thr.
- the conjugate of any one of embodiments 1-19 is provided wherein the amino acid at position 16 of the glucagon related peptide is glutamic acid, the amino acid at position 20 of the glucagon related peptide is lysine, and the C-terminal carboxylic acid group of the glucagon related peptide is replaced with an amide, optionally with a lactam bridge between the glutamic acid at position 16 and the lysine at position 20 of the glucagon related peptide.
- the conjugate of any one of embodiments 1-20 is provided wherein the amino acid at position 1 or 2 of the glucagon related peptide is modified to exhibit reduced susceptibility to cleavage by dipeptidyl peptidase IV (DPP-IV).
- the conjugate of any one of embodiments 1-21 is provided wherein the glucagon related peptide comprises an amino acid sequence selected from the group consisting of:
- glucagon related peptide comprises an analog of glucagon (SEQ ID NO: 701) having GIP agonist activity, said analog comprising one or more of the following modifications:
- the conjugate of any one of embodiments 1-14 is provided wherein the glucagon related peptide comprises the following modifications: (a) the amino acid at position 1 is a large, aromatic amino acid, optionally, Tyr, and (b) wherein (i) the Met at position 27 is substituted with a large, aliphatic amino acid, optionally Leu, (ii) the Asn at position 28 is substituted with a small aliphatic amino acid, optionally Ala, or (iii) the Thr at position 29 is substituted with a small aliphatic amino acid, optionally Gly, or wherein the analog comprises a combination of (i), (ii), and (iii).
- the conjugate of any one of embodiments 23 or 24 wherein the glucagon related peptide further comprises the amino acid sequence of GPSSGAPPPS (SEQ ID NO: 95) or XGPSSGAPPPS (SEQ ID NO: 96) linked to said peptide at a position located C-terminal to the amino acid at position 29.
- the conjugate of any one of embodiments 1-14 and 23-25 is provided, wherein the glucagon related peptide further comprises one or more of the following modifications:
- the conjugate of any one of embodiments 1-14 and 23-25 is provided wherein the glucagon related peptide comprises an amino acid sequence according to any one of SEQ ID NOS: 227, 228, 229 or 230 further comprising a terminal extension of an amino acid sequence of GPSSGAPPPS (SEQ ID NO: 820) or XGPSSGAPPPS (SEQ ID NO: 1096), wherein X is any amino acid, C-terminal to the amino acid at position 29.
- the conjugate of any one of embodiments 1-14 or 23 is provided wherein the glucagon related peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 920-964, 146-164, 166, 192-207, 209-221 and 223.
- the conjugate of any one of embodiments 1-14 is provided wherein the glucagon related peptide comprises the sequence of SEQ ID NO: 701 or the a modified SEQ ID NO: 701 comprising one, two, three or more charged amino acid(s) at a position C-terminal to the amino acid at position 27 of the glucagon related peptide and up to 7 additional amino acid modifications of relative to SEQ ID NO: 701.
- the conjugate of any one of embodiments 1-14 or 29 is provided wherein one, two, three or more charged amino acid(s) at a position C-terminal to the amino acid at position 27 are provided wherein the charged amino acids are Glu or Asp.
- the conjugate of any one of embodiments 1-30 is provided wherein the glucagon related peptide comprises the sequence of HAEGTFTSDVSSYLEEQAAREFIAWLVRGRG (SEQ ID NO: 700), HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG (SEQ ID NO: 703), HAEGTFTSDVSSYLEGQAAKEFICWLVKGR (SEQ ID NO: 717) HSQGTFTSDYSKYLDSRRAQDFVQWLMNT (SEQID NO: 701) or HSQGTFTSDYSKYLDERRAQDFVQWLMNT (SEQ ID NO: 699).
- the glucagon related peptide comprises the sequence of HAEGTFTSDVSSYLEEQAAREFIAWLVRGRG (SEQ ID NO: 700), HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG (SEQ ID NO: 703), HAEGTFTSDVSSYLEGQAAKEFICWLVKGR (SEQ ID NO: 717)
- the conjugate of any one of embodiments 1-31 is provided wherein the insulin peptide is a single chain insulin analog comprising the sequence GPEX 25 LCGAX 30 LVDALYLVCGDX 42 GFYFNX 48 X 49 GAGSSSRRGIVDECCX 8 RSCDLR RLENYCN-R 13 (SEQ ID NO: 144), FVNQHLCGSHLVEALYLVCGERGFFYTPKTGAGSSSRRGIVEQCCTSICSLYQLENY CN-R 13 (SEQ ID NO: 143) or GPEHLCGAHLVDALYLVCGDRGFYFNDRGAGSSSRRGIVDECCHRSCDLRRLENYC N (SEQ ID NO: 145) wherein
- X 8 is phenylalanine or histidine
- X 25 is histidine or threonine
- X 30 is histidine, aspartic acid, glutamic acid, homocysteic acid or cysteic acid;
- X 42 is alanine ornithine or arginine
- X 48 is lysine or aspartic acid
- X 49 is proline, ornithine or arginine
- R 13 is COOH or CONH 2 .
- U is an amino acid or a hydroxy acid
- J is an N-alkylated amino acid linked to said conjugate through an amide bond between a carboxyl moiety of J and an amine of the conjugate, wherein U, J, or the amino acid of the conjugate to which U-J is linked is a non-coded amino acid, further wherein the chemical cleavage half-life (t 1/2 ) of U-J from the conjugate is at least about 1 hour to about 1 week in PBS under physiological conditions.
- the conjugate of any one of embodiments 33 wherein the conjugate further comprises a hydrophilic moiety covalently linked to structure U-J or alternatively a hydrophilic moiety is covalently linked to the side chain of an amino acid of said conjugate, including a hydrophilic moiety covalently linked at one or more positions corresponding to A14, A15, B0, B1, B10, B22, B28, B29 or positions 16, 17, 20, 21, 24, or 29 of native glucagon (SEQ ID NO: 701), or at the C-terminal region of the glucagon related peptide.
- the hydrophilic moiety is a polyethylene glycol.
- the conjugate of any one of embodiments 1-32 is provided, wherein the conjugate is further modified to comprise an acyl group or alkyl group covalently linked to an amino acid side chain.
- said acyl group or alkyl group is covalently linked to a position of the glucagon related peptide that corresponds to position 10 of native glucagon (SEQ ID NO: 701), or at one or more positions selected from A14, A15, B0, B1, B10, B22, B28, B29 of the insulin peptide, or at the side chain of an amino acid of the structure U-J.
- a pharmaceutical composition comprising a conjugate of any one of the preceding embodiments, or pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable carrier is also provided in accordance with the present disclosure.
- Insulin A & B chains were synthesized on 4-methylbenzhydryl amine (MBHA) resin or 4-Hydroxymethyl-phenylacetamidomethyl (PAM) resin using Boc chemistry.
- the peptides were cleaved from the resin using HF/p-cresol 95:5 for 1 hour at 0° C. Following HF removal and ether precipitation, peptides were dissolved into 50% aqueous acetic acid and lyophilized. Alternatively, peptides were synthesized using Fmoc chemistry.
- the peptides were cleaved from the resin using Trifluoroacetic acid (TFA)/Triisopropylsilane (TIS)/H 2 O (95:2.5:2.5), for 2 hour at room temperature.
- TSA Trifluoroacetic acid
- TIS Triisopropylsilane
- H 2 O 95:2.5:2.5
- the peptide was precipitated through the addition of an excessive amount of diethyl ether and the pellet solubilized in aqueous acidic buffer.
- the quality of peptides were monitored by RP-HPLC and confirmed by Mass Spectrometry (ESI or MALDI).
- Insulin A chains were synthesized with a single free cysteine at amino acid 7 and all other cysteines protected as acetamidomethyl A-(SH) 7 (Acm) 6,11,20 .
- Insulin B chains were synthesized with a single free cysteine at position 7 and the other cysteine protected as acetamidomethyl B-(SH) 7 (Acm) 19 .
- the crude peptides were purified by conventional RP-HPLC.
- the synthesized A and B chains were linked to one another through their native disulfide bond linkage in accordance with the general procedure outlined in FIG. 1 .
- the respective B chain was activated to the Cys 7 -Npys analog through dissolution in DMF or DMSO and reacted with 2,2′-Dithiobis(5-nitropyridine) (Npys) at a 1:1 molar ratio, at room temperature.
- the activation was monitored by RP-HPLC and the product was confirmed by ESI-MS.
- the first B7-A7 disulfide bond was formed by dissolution of the respective A-(SH) 7 (Acm) 6,11,20 and B-(Npys) 7 (Acm) 19 at 1:1 molar ratio to a total peptide concentration of 10 mg/ml.
- the chain combination reaction was complete the mixture was diluted to a concentration of 50% aqueous acetic acid.
- the last two disulfide bonds were formed simultaneously through the addition of iodine.
- a 40 fold molar excess of iodine was added to the solution and the mixture was stirred at room temperature for an additional hour.
- the reaction was terminated by the addition of an aqueous ascorbic acid solution.
- the mixture was purified by RP-HPLC and the final compound was confirmed by MALDI-MS. As shown in FIG. 2 and the data in Table 1, the synthetic insulin prepared in accordance with this procedure compares well with purified insulin for insulin receptor binding.
- Insulin peptides comprising a modified amino acid can also be synthesized in vivo using a system that allows for incorporation of non-coded amino acids into proteins, including for example, the system taught in U.S. Pat. Nos. 7,045,337 and 7,083,970.
- Insulin or an insulin analog
- mPEG20k-Aldyhyde or an insulin analog
- NaBH 3 CN in a molar ratio of 1:2:30, were dissolved in acetic acid buffer at a pH of 4.1-4.4.
- the reaction solution was composed of 0.1 N NaCl, 0.2 N acetic acid and 0.1 N Na 2 CO 3 .
- the insulin peptide concentration was approximately 0.5 mg/ml.
- the reaction occurs over six hours at room temperature. The degree of reaction was monitored by RP-HPLC and the yield of the reaction was approximately 50%.
- the reaction mixture was diluted 2-5 fold with 0.1% TFA and applied to a preparative RP-HPLC column.
- HPLC condition C4 column; flow rate 10 ml/min; A buffer 10% ACN and 0.1% TFA in water; B buffer 0.1% TFA in ACN; A linear gradient B % from 0-40% (0-80 min); PEG-insulin or analogues was eluted at approximately 35% buffer B.
- the desired compounds were verified by MALDI-TOF, following chemical modification through sulftolysis or trypsin degradation.
- Insulin or an insulin analog
- mPEG20k-NHS were dissolved in 0.1 N Bicine buffer (pH 8.0) at a molar ratio of 1:1.
- the insulin peptide concentration was approximately 0.5 mg/ml.
- Reaction progress was monitored by HPLC. The yield of the reaction is approximately 90% after 2 hours at room temperature.
- reaction mixture was diluted 2-5 fold and loaded to RP-HPLC.
- HPLC condition C4 column; flow rate 10 ml/min; A buffer 10% ACN and 0.1% TFA in water; B buffer 0.1% TFA in ACN; A linear gradient B % from 0-40% (0-80 min); PEG-insulin or analogues was collected at approximately 35% B.
- the desired compounds were verified by MALDI-TOF, following chemical modification through sulftolysis or trypsin degradation.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Endocrinology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Zoology (AREA)
- Biophysics (AREA)
- Toxicology (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Diabetes (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Chemical & Material Sciences (AREA)
- Obesity (AREA)
- Emergency Medicine (AREA)
- Hematology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Immunology (AREA)
- Epidemiology (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US14/774,357 US20160024169A1 (en) | 2013-03-14 | 2014-03-05 | Insulin-incretin conjugates |
Applications Claiming Priority (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201361783491P | 2013-03-14 | 2013-03-14 | |
| PCT/US2014/020801 WO2014158900A1 (en) | 2013-03-14 | 2014-03-05 | Insulin-incretin conjugates |
| US14/774,357 US20160024169A1 (en) | 2013-03-14 | 2014-03-05 | Insulin-incretin conjugates |
Related Parent Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2014/020801 A-371-Of-International WO2014158900A1 (en) | 2013-03-14 | 2014-03-05 | Insulin-incretin conjugates |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/846,485 Continuation US10696726B2 (en) | 2013-03-14 | 2017-12-19 | Insulin-incretin conjugates |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| US20160024169A1 true US20160024169A1 (en) | 2016-01-28 |
Family
ID=51625081
Family Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US14/774,357 Abandoned US20160024169A1 (en) | 2013-03-14 | 2014-03-05 | Insulin-incretin conjugates |
| US15/846,485 Expired - Fee Related US10696726B2 (en) | 2013-03-14 | 2017-12-19 | Insulin-incretin conjugates |
Family Applications After (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/846,485 Expired - Fee Related US10696726B2 (en) | 2013-03-14 | 2017-12-19 | Insulin-incretin conjugates |
Country Status (10)
| Country | Link |
|---|---|
| US (2) | US20160024169A1 (enExample) |
| EP (1) | EP2970511B1 (enExample) |
| JP (1) | JP6538645B2 (enExample) |
| KR (1) | KR20150131213A (enExample) |
| CN (1) | CN105324397B (enExample) |
| AU (1) | AU2014241743B2 (enExample) |
| BR (1) | BR112015023071A2 (enExample) |
| CA (1) | CA2904332A1 (enExample) |
| RU (1) | RU2678134C2 (enExample) |
| WO (1) | WO2014158900A1 (enExample) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2017160669A1 (en) * | 2016-03-18 | 2017-09-21 | Merck Sharp & Dohme Corp. | Insulin-incretin conjugates |
| US11753455B2 (en) * | 2018-06-21 | 2023-09-12 | Novo Nordisk A/S | Compounds for treatment of obesity |
Families Citing this family (29)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| UA116217C2 (uk) | 2012-10-09 | 2018-02-26 | Санофі | Пептидна сполука як подвійний агоніст рецепторів glp1-1 та глюкагону |
| SG10201705097PA (en) | 2012-12-21 | 2017-07-28 | Sanofi Sa | Functionalized exendin-4 derivatives |
| WO2014158900A1 (en) | 2013-03-14 | 2014-10-02 | Indiana University Research And Technology Corporation | Insulin-incretin conjugates |
| WO2015086729A1 (en) | 2013-12-13 | 2015-06-18 | Sanofi | Dual glp-1/gip receptor agonists |
| TW201609795A (zh) | 2013-12-13 | 2016-03-16 | 賽諾菲公司 | 作為雙重glp-1/gip受體促效劑的艾塞那肽-4(exendin-4)胜肽類似物 |
| EP3080149A1 (en) | 2013-12-13 | 2016-10-19 | Sanofi | Dual glp-1/glucagon receptor agonists |
| WO2015086730A1 (en) | 2013-12-13 | 2015-06-18 | Sanofi | Non-acylated exendin-4 peptide analogues |
| TW201625670A (zh) | 2014-04-07 | 2016-07-16 | 賽諾菲公司 | 衍生自exendin-4之雙重glp-1/升糖素受體促效劑 |
| TW201625669A (zh) | 2014-04-07 | 2016-07-16 | 賽諾菲公司 | 衍生自艾塞那肽-4(Exendin-4)之肽類雙重GLP-1/升糖素受體促效劑 |
| TW201625668A (zh) | 2014-04-07 | 2016-07-16 | 賽諾菲公司 | 作為胜肽性雙重glp-1/昇糖素受體激動劑之艾塞那肽-4衍生物 |
| US9932381B2 (en) | 2014-06-18 | 2018-04-03 | Sanofi | Exendin-4 derivatives as selective glucagon receptor agonists |
| ES2822994T3 (es) * | 2014-09-24 | 2021-05-05 | Univ Indiana Res & Tech Corp | Conjugados de incretina-insulina |
| AR105319A1 (es) | 2015-06-05 | 2017-09-27 | Sanofi Sa | Profármacos que comprenden un conjugado agonista dual de glp-1 / glucagón conector ácido hialurónico |
| AR105284A1 (es) | 2015-07-10 | 2017-09-20 | Sanofi Sa | Derivados de exendina-4 como agonistas peptídicos duales específicos de los receptores de glp-1 / glucagón |
| CA2996455A1 (en) | 2015-08-25 | 2017-03-02 | Novo Nordisk A/S | Novel insulin derivatives and the medical uses hereof |
| WO2017074798A2 (en) * | 2015-10-27 | 2017-05-04 | Merck Sharp & Dohme Corp. | Long-acting co-agonists of the glucagon and glp-1 receptors |
| EP3448417B1 (en) * | 2016-04-26 | 2025-11-12 | Merck Sharp & Dohme LLC | Insulin dimer-incretin conjugates |
| RU2769476C2 (ru) | 2016-07-22 | 2022-04-01 | Университи Оф Юта Ресёч Фаудэтион | Аналоги инсулина |
| JP7133229B2 (ja) * | 2017-02-03 | 2022-09-08 | ヴァンダービルト ユニバーシティー | 糖尿病を治療するためのシステム、組成物および方法 |
| US11590237B2 (en) | 2017-05-18 | 2023-02-28 | Merck Sharp & Dohme Llc | Pharmaceutical formulation comprising incretin-insulin conjugates |
| MX2020001058A (es) | 2017-07-28 | 2020-08-06 | Univ Princeton | Marcadores de fusión para expresión de proteínas recombinantes. |
| PE20211264A1 (es) | 2017-08-17 | 2021-07-15 | Novo Nordisk As | Analogos de insulina acilados novedosos y usos de estos |
| TWI707865B (zh) | 2018-05-04 | 2020-10-21 | 丹麥商諾佛 儂迪克股份有限公司 | Gip衍生物及其用途 |
| SG11202106168VA (en) * | 2018-12-11 | 2021-07-29 | Sanofi Sa | Insulin analogs having reduced insulin receptor binding affinity |
| US12435116B2 (en) | 2019-10-16 | 2025-10-07 | Clarence Hurt | Compounds, compositions, methods, and uses for treating insulin resistance, type 2 diabetes and metabolic syndrome |
| FI4073097T3 (fi) | 2019-12-11 | 2024-08-13 | Novo Nordisk As | Uusia insuliinianalogeja ja niiden käyttötapoja |
| US20230272030A1 (en) * | 2020-07-24 | 2023-08-31 | Jiangsu Gensciences Inc. | Insulin-fc fusion protein and application thereof |
| WO2022094146A1 (en) | 2020-10-28 | 2022-05-05 | The Trustees Of Princeton University | Methods of converting precursor proteins to mature proteins using kex2 proteases |
| EP4291305A4 (en) * | 2021-02-09 | 2025-07-30 | Univ Indiana Trustees | CONFORMATIONALLY CONSTRAINED GLUCAGON ANALOGUES AND THEIR USE IN GLUCAGON SINGLE-CHAIN INSULIN FUSION PROTEINS |
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20140120120A1 (en) * | 2011-06-02 | 2014-05-01 | Hanmi Science Co., Ltd | Composition for treating diabetes comprising long-acting insulin conjugate and long-acting insulinotropic peptide conjugate |
| US9573987B2 (en) * | 2011-12-20 | 2017-02-21 | Indiana University Research And Technology Corporation | CTP-based insulin analogs for treatment of diabetes |
Family Cites Families (130)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3740385A (en) | 1970-05-07 | 1973-06-19 | M Ondetti | N-terminal derivatives of secretin |
| US4450150A (en) | 1973-05-17 | 1984-05-22 | Arthur D. Little, Inc. | Biodegradable, implantable drug delivery depots, and method for preparing and using the same |
| US4275152A (en) | 1977-02-03 | 1981-06-23 | Eastman Kodak Company | Hydrolysis of protein-bound cholesterol esters |
| DK119785D0 (da) | 1985-03-15 | 1985-03-15 | Nordisk Gentofte | Insulinpraeparat |
| PH25772A (en) | 1985-08-30 | 1991-10-18 | Novo Industri As | Insulin analogues, process for their preparation |
| PT83613B (en) | 1985-10-28 | 1988-11-21 | Lilly Co Eli | Process for the selective chemical removal of a protein amino-terminal residue |
| US4741897A (en) | 1986-07-08 | 1988-05-03 | Baxter Travenol | Thyroxine analogs and reagents for thyroid hormone assays |
| US4876242A (en) | 1987-09-21 | 1989-10-24 | Merck & Co., Inc. | Human insulin-like growth factor analoges with reduced binding to serum carrier proteins and their production in yeast |
| GB8728561D0 (en) | 1987-12-07 | 1988-01-13 | Glaxo Group Ltd | Chemical compounds |
| US5514646A (en) | 1989-02-09 | 1996-05-07 | Chance; Ronald E. | Insulin analogs modified at position 29 of the B chain |
| ES2075196T3 (es) | 1989-02-17 | 1995-10-01 | Chiron Mimotopes Pty Ltd | Metodo para el uso y la sintesis de peptidos. |
| US6225449B1 (en) | 1991-10-04 | 2001-05-01 | Washington University | Hormone analogs with multiple CTP extensions |
| AU631868B2 (en) | 1989-04-20 | 1992-12-10 | Mount Sinai School Of Medicine Of The City University Of New York, The | Hepatospecific insulin analogues |
| US5545618A (en) | 1990-01-24 | 1996-08-13 | Buckley; Douglas I. | GLP-1 analogs useful for diabetes treatment |
| US5510459A (en) | 1991-01-17 | 1996-04-23 | Zymogenetics, Inc. | Glucagon antagonists |
| US5268453A (en) | 1991-08-08 | 1993-12-07 | Scios Inc. | Tissue-selective insulin analogs |
| AU6550294A (en) | 1993-03-09 | 1994-09-26 | Abbott Laboratories | Genetically engineered enzymes and their conjugates for diagnostic assays |
| US5359030A (en) | 1993-05-10 | 1994-10-25 | Protein Delivery, Inc. | Conjugation-stabilized polypeptide compositions, therapeutic delivery and diagnostic formulations comprising same, and method of making and using the same |
| US5480867A (en) | 1993-12-29 | 1996-01-02 | The Rockefeller University | Glucagon analogs with serine replacements |
| US5512549A (en) | 1994-10-18 | 1996-04-30 | Eli Lilly And Company | Glucagon-like insulinotropic peptide analogs, compositions, and methods of use |
| US5869602A (en) | 1995-03-17 | 1999-02-09 | Novo Nordisk A/S | Peptide derivatives |
| US6476290B1 (en) | 1995-04-19 | 2002-11-05 | Dalhousie University | Transgenic tilapia comprising a humanized insulin gene |
| IL118127A0 (en) | 1995-05-05 | 1996-09-12 | Lilly Co Eli | Single chain insulin with high bioactivity |
| US6180767B1 (en) | 1996-01-11 | 2001-01-30 | Thomas Jefferson University | Peptide nucleic acid conjugates |
| NZ334595A (en) | 1996-09-09 | 2000-08-25 | Zealand Pharmaceuticals As | Peptide prodrugs containing an alpha-hydroxyacid linker that have increased stability against enzymatic cleavage |
| UA65549C2 (uk) | 1996-11-05 | 2004-04-15 | Елі Ліллі Енд Компані | Спосіб регулювання ожиріння шляхом периферійного введення аналогів та похідних glp-1 (варіанти) та фармацевтична композиція |
| CA2320193A1 (en) | 1998-02-10 | 1999-08-19 | Welfide Corporation | Controlled release preparation |
| NZ506447A (en) | 1998-02-23 | 2002-11-26 | Neurocrine Biosciences Inc | Peptide analogues of insulin with alanine substitutions and pharmaceutical use |
| JP4394279B2 (ja) | 1998-03-09 | 2010-01-06 | ジーランド ファーマ アクティーゼルスカブ | 酵素加水分解に対する傾向が減少した薬理学的に活性なペプチド複合体 |
| DE19828113A1 (de) | 1998-06-24 | 2000-01-05 | Probiodrug Ges Fuer Arzneim | Prodrugs von Inhibitoren der Dipeptidyl Peptidase IV |
| US20030236190A1 (en) | 1998-09-02 | 2003-12-25 | Renuka Pillutla | Isulin and IGF-1 receptor agonists and antagonists |
| US6875741B2 (en) | 1998-09-02 | 2005-04-05 | Renuka Pillutla | Insulin and IGF-1 receptor agonists and antagonists |
| GB2344287A (en) | 1998-12-03 | 2000-06-07 | Ferring Bv | Controlled release pharmaceutical formulation |
| DE19908041A1 (de) | 1999-02-24 | 2000-08-31 | Hoecker Hartwig | Kovalent verbrückte Insulindimere |
| US6921748B1 (en) | 1999-03-29 | 2005-07-26 | Uutech Limited | Analogs of gastric inhibitory polypeptide and their use for treatment of diabetes |
| EP1180121B9 (en) | 1999-05-17 | 2004-09-08 | Conjuchem, Inc. | Long lasting insulinotropic peptides |
| US6746853B1 (en) | 1999-05-19 | 2004-06-08 | Xencor, Inc. | Proteins with insulin-like activity useful in the treatment of diabetes |
| AUPQ661800A0 (en) | 2000-03-31 | 2000-05-04 | Metabolic Pharmaceuticals Limited | Insulin-potentiating compounds |
| US6677136B2 (en) | 2000-05-03 | 2004-01-13 | Amgen Inc. | Glucagon antagonists |
| AU2001269833A1 (en) | 2000-06-14 | 2001-12-24 | Cytovax Biotechnologies, Inc. | Use of coiled-coil structural scaffold to generate structure-specific peptides |
| AU2001276842B2 (en) | 2000-06-28 | 2007-04-26 | Glycofi, Inc. | Methods for producing modified glycoproteins |
| US7449308B2 (en) | 2000-06-28 | 2008-11-11 | Glycofi, Inc. | Combinatorial DNA library for producing modified N-glycans in lower eukaryotes |
| CN1454214A (zh) | 2000-08-02 | 2003-11-05 | 赛莱技术公司 | 具有增高功效的修饰生物肽 |
| AU2001284697A1 (en) | 2000-08-04 | 2002-02-18 | Dmi Biosciences, Inc. | Method of synthesizing diketopiperazines |
| WO2002026265A2 (en) | 2000-09-29 | 2002-04-04 | Schering Corporation | Pegylated interleukin-10 |
| EP1193272B1 (en) | 2000-10-02 | 2004-06-30 | Yonsei University | Single-chain insulin analogs |
| KR100449454B1 (ko) | 2000-10-02 | 2004-09-21 | 이현철 | 단일사슬 인슐린 유도체의 유전자를 포함하는 당뇨병치료용 벡터 |
| KR101229995B1 (ko) | 2000-12-11 | 2013-02-06 | 씨제이 주식회사 | 생체내 에리스로포이에틴 활성이 증진된 융합단백질 |
| EP1243276A1 (en) | 2001-03-23 | 2002-09-25 | Franciscus Marinus Hendrikus De Groot | Elongated and multiple spacers containing activatible prodrugs |
| DK2322631T3 (en) | 2001-04-19 | 2015-01-12 | Scripps Research Inst | Methods and compositions for the production of orthogonal tRNA-aminoacyl-tRNA syntetasepar |
| US20040002468A1 (en) | 2001-08-08 | 2004-01-01 | Genzyme Corporation | Methods of treating diabetes and other blood sugar disorders |
| WO2003020201A2 (en) | 2001-08-28 | 2003-03-13 | Eli Lilly And Company | Pre-mixes of glp-1 and basal insulin |
| GB0121709D0 (en) | 2001-09-07 | 2001-10-31 | Imp College Innovations Ltd | Food inhibition agent |
| US7041646B2 (en) | 2001-10-05 | 2006-05-09 | Bayer Pharmaceuticals Corporation | Methods of treating type 2 diabetes with peptides acting as both GLP-1 receptor agonists and glucagon receptor antagonists |
| AR036711A1 (es) | 2001-10-05 | 2004-09-29 | Bayer Corp | Peptidos que actuan como agonistas del receptor del glp-1 y como antagonistas del receptor del glucagon y sus metodos de uso farmacologico |
| HUP0700151A2 (en) | 2001-10-18 | 2007-05-29 | Bristol Myers Squibb Co | Human glucagon-like-peptide-1 mimics and their use in the treatment of diabetes and related conditions |
| BR0215029A (pt) | 2001-12-20 | 2005-12-20 | Lilly Co Eli | Molécula de insulina, uso da mesma, composição, uso desta, microcristal, processo para prepará-lo, uso deste, e, métodos para preparar uma molécula de insulina, para tratar hiperglicemia, e para tratar diabetes mellitus |
| JP2005518408A (ja) | 2001-12-29 | 2005-06-23 | ノボ ノルディスク アクティーゼルスカブ | 異常脂肪血症を治療するための、glp−1化合物と他の薬物との組み合わせ使用 |
| EP1575490A4 (en) | 2002-06-04 | 2007-08-08 | Lilly Co Eli | MODIFIED ANALOGUES OF GLUCAGON-LIKE PEPTIDE-1 (GLP-1) |
| FR2842209B1 (fr) | 2002-07-09 | 2007-11-23 | Nouvelle protease aspartique dite saspase et son utilisation dans le domaine cosmetique et therapeutique | |
| WO2004033036A2 (en) | 2002-10-04 | 2004-04-22 | Microchips, Inc. | Medical device for controlled drug delivery and cardiac monitoring and/or stimulation |
| US7192922B2 (en) | 2002-11-19 | 2007-03-20 | Allegheny-Singer Research Institute | Method of treating left ventricular dysfunction |
| WO2004067548A2 (en) | 2003-01-31 | 2004-08-12 | Theratechnologies Inc. | Chemically modified metabolites of regulatory peptides and methods of producing and using same |
| WO2004078777A2 (en) | 2003-03-04 | 2004-09-16 | Biorexis Pharmaceutical Corporation | Dipeptidyl-peptidase protected proteins |
| EA009366B1 (ru) | 2003-03-19 | 2007-12-28 | Эли Лилли Энд Компани | Связанные с полиэтиленгликолем соединения гпп-1 |
| CA2843439A1 (en) | 2003-04-08 | 2004-10-21 | Yeda Research And Development Co. Ltd | Reversible pegylated drugs |
| EA008831B1 (ru) | 2003-06-12 | 2007-08-31 | Эли Лилли Энд Компани | Слитые белки аналогов glp-1 |
| US20050124550A1 (en) | 2003-06-18 | 2005-06-09 | Peri Krishna G. | Compounds that modulate the glucagon response and uses thereof |
| CA2539253A1 (en) | 2003-09-19 | 2005-03-31 | Novo Nordisk A/S | Albumin-binding derivatives of therapeutic peptides |
| US20050187147A1 (en) | 2003-09-22 | 2005-08-25 | Newman Michael J. | Compositions and methods for increasing drug efficiency |
| US7364875B2 (en) | 2003-10-30 | 2008-04-29 | Cresent Innovations, Inc. | Method for producing medical and commercial grade poly-gamma-glutamic acid of high molecular weight |
| PL1680443T3 (pl) | 2003-11-05 | 2014-02-28 | Dana Farber Cancer Inst Inc | Stabilizowane alfa-helikalne peptydy i ich zastosowanie |
| JP5697831B2 (ja) * | 2003-12-03 | 2015-04-08 | ノヴォ ノルディスク アー/エス | 単鎖インシュリン |
| AU2004298424A1 (en) | 2003-12-18 | 2005-06-30 | Novo Nordisk A/S | Novel GLP-1 compounds |
| US20060286129A1 (en) | 2003-12-19 | 2006-12-21 | Emisphere Technologies, Inc. | Oral GLP-1 formulations |
| US20080318837A1 (en) | 2003-12-26 | 2008-12-25 | Nastech Pharmaceutical Company Inc. | Pharmaceutical Formation For Increased Epithelial Permeability of Glucose-Regulating Peptide |
| BRPI0507594A (pt) | 2004-02-11 | 2007-07-03 | Amylin Pharmaceuticals Inc | polipetìdeos hìbridos com propriedades selecionáveis |
| US7442682B2 (en) | 2004-10-19 | 2008-10-28 | Nitto Denko Corporation | Transepithelial delivery of peptides with incretin hormone activities |
| JP2008517917A (ja) | 2004-10-21 | 2008-05-29 | アイジーエフ オンコロジー エルエルシー | 癌を治療するための毒素および放射性核種結合igf−1受容体リガンド |
| JP5185624B2 (ja) * | 2004-12-02 | 2013-04-17 | ドマンティス リミテッド | 血清アルブミンおよびglp−1またはpyyを標的とする二重特異性抗体 |
| US8263545B2 (en) | 2005-02-11 | 2012-09-11 | Amylin Pharmaceuticals, Inc. | GIP analog and hybrid polypeptides with selectable properties |
| EP1853627A2 (en) | 2005-02-11 | 2007-11-14 | Amylin Pharmaceuticals, Inc. | Gip analog and hybrid polypeptides with selectable properties |
| WO2006097521A1 (en) | 2005-03-18 | 2006-09-21 | Novo Nordisk A/S | Pegylated single-chain insulin |
| EP1863537A2 (en) | 2005-03-18 | 2007-12-12 | Novo Nordisk A/S | Dimeric peptide agonists of the glp-1 receptor |
| US7521211B2 (en) | 2005-04-05 | 2009-04-21 | Regeneron Pharmaceuticals, Inc | IGF-1 and IGF-2 chimeric polypeptides and therapeutic uses thereof |
| US20090209453A1 (en) | 2005-04-13 | 2009-08-20 | University Of Medicine And Dentistry Of New Jersey | Glycoprotein Hormone Analogs |
| US8338368B2 (en) | 2005-11-07 | 2012-12-25 | Indiana University Research And Technology Corporation | Glucagon analogs exhibiting physiological solubility and stability |
| US8304386B2 (en) | 2006-02-03 | 2012-11-06 | Prolor Biotech, Inc. | Long-acting growth hormone and methods of producing same |
| US20090069216A1 (en) | 2006-02-21 | 2009-03-12 | Novo Nordisk A/S | Single-Chain Insulin Analogues and Pharmaceutical Formulations Thereof |
| ES2397659T3 (es) | 2006-03-15 | 2013-03-08 | Novo Nordisk A/S | Mezclas de amilina e insulina |
| CN101432025B (zh) | 2006-03-21 | 2012-04-04 | 安米林药品公司 | 肽-肽酶抑制剂结合物及其使用方法 |
| EP2054437A2 (en) | 2006-08-07 | 2009-05-06 | Teva Biopharmaceuticals USA, Inc. | Albumin-insulin fusion proteins |
| WO2008021560A2 (en) | 2006-08-17 | 2008-02-21 | Amylin Pharmaceuticals, Inc. | Dpp-iv resistant gip hybrid polypeptides with selectable properties |
| CL2007002502A1 (es) | 2006-08-31 | 2008-05-30 | Hoffmann La Roche | Variantes del factor de crecimiento similar a insulina-1 humano (igf-1) pegilados en lisina; metodo de produccion; proteina de fusion que la comprende; y su uso para tratar la enfermedad de alzheimer. |
| DK2615108T3 (en) | 2006-09-08 | 2017-01-30 | Ambrx Inc | Modified human plasma polypeptide or fc scaffolds and their applications |
| WO2008086086A2 (en) | 2007-01-05 | 2008-07-17 | Indiana University Research And Technology Corporation | Glucagon analogs exhibiting enhanced solubility in physiological ph buffers |
| US20090098130A1 (en) | 2007-01-05 | 2009-04-16 | Bradshaw Curt W | Glucagon-like protein-1 receptor (glp-1r) agonist compounds |
| JP6017754B2 (ja) | 2007-02-15 | 2016-11-02 | インディアナ ユニバーシティー リサーチ アンド テクノロジー コーポレーションIndiana University Research And Technology Corporation | グルカゴン/glp−1受容体コアゴニスト |
| KR20080092839A (ko) | 2007-04-12 | 2008-10-16 | 칫소가부시키가이샤 | 잉크젯용 잉크 |
| BRPI0810140A2 (pt) | 2007-04-19 | 2014-10-29 | Dong A Pharm Co Ltd | Composição de microempresa biodegradável adequada para a liberação controlada de um peptídeo de controle de glicose e formulação da mesma |
| US7829664B2 (en) | 2007-06-01 | 2010-11-09 | Boehringer Ingelheim International Gmbh | Modified nucleotide sequence encoding glucagon-like peptide-1 (GLP-1), nucleic acid construct comprising same for production of glucagon-like peptide-1 (GLP-1), human cells comprising said construct and insulin-producing constructs, and methods of use thereof |
| DK2158214T3 (da) | 2007-06-15 | 2011-12-05 | Zealand Pharma As | Glukagonanaloger |
| EP2036923A1 (en) | 2007-09-11 | 2009-03-18 | Novo Nordisk A/S | Improved derivates of amylin |
| EP2036539A1 (en) | 2007-09-11 | 2009-03-18 | Novo Nordisk A/S | Stable formulations of amylin and its analogues |
| CA2702289A1 (en) | 2007-10-30 | 2009-05-07 | Indiana University Research And Technology Corporation | Compounds exhibiting glucagon antagonist and glp-1 agonist activity |
| US8946148B2 (en) | 2007-11-20 | 2015-02-03 | Ambrx, Inc. | Modified insulin polypeptides and their uses |
| EP2249853A4 (en) * | 2008-01-30 | 2012-12-26 | Univ Indiana Res & Tech Corp | ESTER BASED PEPTIDE PRODRUGS |
| CN101980725B (zh) | 2008-02-01 | 2013-06-12 | 阿森迪斯药物股份有限公司 | 包含可自裂解的连接体的前药 |
| DE112009001414T5 (de) | 2008-06-05 | 2011-04-21 | Toshiba Kikai K.K. | Bearbeitungssystem, Steuerungseinrichtung, Steuerungsverfahren und Programm |
| BRPI0915282A2 (pt) | 2008-06-17 | 2017-02-07 | Univ Indiana Res & Tech Corp | agonistas mistos baseados no gip para o tratamento de distúrbios metabólicos e obesidade |
| AU2009260302B2 (en) | 2008-06-17 | 2014-10-23 | Indiana University Research And Technology Corporation | Glucagon/GLP-1 receptor co-agonists |
| JP5753779B2 (ja) | 2008-06-17 | 2015-07-22 | インディアナ ユニバーシティー リサーチ アンド テクノロジー コーポレーションIndiana University Research And Technology Corporation | 生理学的pHの緩衝液中で向上した溶解性及び安定性を示すグルカゴン類縁体 |
| EP2356139A4 (en) | 2008-07-23 | 2013-01-09 | Harvard College | LIGURE COMBINED POLYPEPTIDES |
| KR20110114568A (ko) | 2008-12-19 | 2011-10-19 | 인디애나 유니버시티 리서치 앤드 테크놀로지 코퍼레이션 | 디펩티드 링크된 약효 물질 |
| EP2376099A4 (en) | 2008-12-19 | 2012-04-25 | Univ Indiana Res & Tech Corp | INSULIN AGAIN YL-BASED GROWTH FACTORS WITH HIGH ACTIVITY AT THE INSULIN RECEPTOR |
| WO2010080606A1 (en) | 2008-12-19 | 2010-07-15 | Indiana University Research And Technology Corporation | Insulin analogs |
| AU2009327418A1 (en) | 2008-12-19 | 2010-06-24 | Indiana University Research And Technology Corporation | Amide based glucagon superfamily peptide prodrugs |
| CN102245624B (zh) * | 2008-12-19 | 2016-08-10 | 印第安纳大学研究及科技有限公司 | 基于酰胺的胰岛素前药 |
| EP2408470A4 (en) * | 2009-03-20 | 2012-08-29 | Smartcells Inc | SOLUBLE NONDEPOT INSULIN CONJUGATE AND ITS USE |
| AU2010277559B2 (en) * | 2009-07-31 | 2016-08-11 | Sanofi-Aventis Deutschland Gmbh | Prodrugs comprising an insulin linker conjugate |
| RU2012136450A (ru) | 2010-01-27 | 2014-03-10 | Индиана Юниверсити Рисерч Энд Текнолоджи Корпорейшн | Конъюгаты антагонист глюкагона - агонист gip и композиции для лечения метаболических расстройств и ожирения |
| WO2011159895A2 (en) | 2010-06-16 | 2011-12-22 | Indiana University Research And Technology Corporation | Single chain insulin agonists exhibiting high activity at the insulin receptor |
| WO2011159882A2 (en) | 2010-06-16 | 2011-12-22 | Indiana University Research And Technology Corporation | Novel stabilized insulin agonists |
| US8946147B2 (en) | 2010-06-24 | 2015-02-03 | Indiana University Research And Technology Corporation | Amide-based insulin prodrugs |
| EP2588126A4 (en) | 2010-06-24 | 2015-07-08 | Univ Indiana Res & Tech Corp | AMID-BASED GLUCAGON SUPERFAMILY PEPTIDE PRODRUGS |
| WO2011163460A1 (en) | 2010-06-24 | 2011-12-29 | Indiana University Research And Technology Corporation | Yl-based insulin-like growth factors exhibiting high activity at the insulin receptor |
| WO2011163473A1 (en) | 2010-06-25 | 2011-12-29 | Indiana University Research And Technology Corporation | Glucagon analogs exhibiting enhanced solubility and stability in physiological ph buffers |
| MA34913B1 (fr) * | 2011-01-20 | 2014-02-01 | Zealand Pharma As | Combinaison d'analogues du glucagon acylé à des analogues d'insuline |
| WO2012167744A1 (en) * | 2011-06-10 | 2012-12-13 | Beijing Hanmi Pharmaceutical Co., Ltd. | Glucose dependent insulinotropic polypeptide analogs, pharmaceutical compositions and use thereof |
| WO2014158900A1 (en) | 2013-03-14 | 2014-10-02 | Indiana University Research And Technology Corporation | Insulin-incretin conjugates |
-
2014
- 2014-03-05 WO PCT/US2014/020801 patent/WO2014158900A1/en not_active Ceased
- 2014-03-05 US US14/774,357 patent/US20160024169A1/en not_active Abandoned
- 2014-03-05 BR BR112015023071A patent/BR112015023071A2/pt not_active IP Right Cessation
- 2014-03-05 EP EP14773636.7A patent/EP2970511B1/en not_active Not-in-force
- 2014-03-05 CA CA2904332A patent/CA2904332A1/en not_active Abandoned
- 2014-03-05 CN CN201480027381.0A patent/CN105324397B/zh not_active Expired - Fee Related
- 2014-03-05 JP JP2016500671A patent/JP6538645B2/ja not_active Expired - Fee Related
- 2014-03-05 RU RU2015143472A patent/RU2678134C2/ru not_active IP Right Cessation
- 2014-03-05 KR KR1020157028780A patent/KR20150131213A/ko not_active Abandoned
- 2014-03-05 AU AU2014241743A patent/AU2014241743B2/en not_active Ceased
-
2017
- 2017-12-19 US US15/846,485 patent/US10696726B2/en not_active Expired - Fee Related
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20140120120A1 (en) * | 2011-06-02 | 2014-05-01 | Hanmi Science Co., Ltd | Composition for treating diabetes comprising long-acting insulin conjugate and long-acting insulinotropic peptide conjugate |
| US9573987B2 (en) * | 2011-12-20 | 2017-02-21 | Indiana University Research And Technology Corporation | CTP-based insulin analogs for treatment of diabetes |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2017160669A1 (en) * | 2016-03-18 | 2017-09-21 | Merck Sharp & Dohme Corp. | Insulin-incretin conjugates |
| US11753455B2 (en) * | 2018-06-21 | 2023-09-12 | Novo Nordisk A/S | Compounds for treatment of obesity |
Also Published As
| Publication number | Publication date |
|---|---|
| EP2970511B1 (en) | 2020-09-30 |
| KR20150131213A (ko) | 2015-11-24 |
| CN105324397A (zh) | 2016-02-10 |
| US10696726B2 (en) | 2020-06-30 |
| EP2970511A4 (en) | 2016-03-23 |
| JP2016512255A (ja) | 2016-04-25 |
| WO2014158900A1 (en) | 2014-10-02 |
| AU2014241743A1 (en) | 2015-09-17 |
| JP6538645B2 (ja) | 2019-07-03 |
| BR112015023071A2 (pt) | 2017-07-18 |
| RU2678134C2 (ru) | 2019-01-23 |
| RU2015143472A (ru) | 2017-04-28 |
| CA2904332A1 (en) | 2014-10-02 |
| AU2014241743B2 (en) | 2018-07-05 |
| CN105324397B (zh) | 2020-01-14 |
| US20180194827A1 (en) | 2018-07-12 |
| EP2970511A1 (en) | 2016-01-20 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US10696726B2 (en) | Insulin-incretin conjugates | |
| US10232020B2 (en) | Incretin-insulin conjugates | |
| US10233225B2 (en) | Single chain insulin agonists exhibiting high activity at the insulin receptor | |
| US9573987B2 (en) | CTP-based insulin analogs for treatment of diabetes | |
| US9593156B2 (en) | Insulin analog dimers | |
| US20110245164A1 (en) | Yl-based insulin-like growth factors exhibiting high activity at the insulin receptor | |
| US10683334B2 (en) | Aqueously soluble and chemically stable glucagon peptides |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AS | Assignment |
Owner name: INDIANA UNIVERSITY RESEARCH & TECHNOLOGY CORPORATI Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:DIMARCHI, RICHARD D.;HAN, JIE;LI, PENGYUN;AND OTHERS;SIGNING DATES FROM 20140403 TO 20140520;REEL/FRAME:033758/0978 |
|
| STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |