HUE030701T2

HUE030701T2 - Tweak-kötõ antitestek

Info

Publication number: HUE030701T2
Application number: HUE11191771A
Authority: HU
Inventors: Linda C Burkly; Stark Ellen A Garber; Alexey Lugovskoy
Original assignee: Biogen Ma Inc
Priority date: 2005-05-27
Filing date: 2006-05-25
Publication date: 2017-05-29
Also published as: EP1888113A4; CA2609600A1; PL2460831T3; KR101679468B1; JP2008542278A; HK1116423A1; PL1888113T3; GEP20115324B; RS20070462A; CN101247830A; ES2605945T3; US20080241163A1; EP1888113A2; MEP35408A; EP1888113B1; ZA200710765B; NO20076607L; CN101247830B; DK1888113T3; JP2014221837A

Description

• WINKLES JEFFREY A ET AL: "Role of TWEAK and Fn14 in tumor biology", FRONTIERS IN BIOSCIENCE, FRONTIERS IN BIOSCIENCE, ALBERTSON, NY, US, vol. 12,1 January 2007 (2007-01-01), pages 2761-2771, XP002510082, ISSN: 1093-9946 • CAMPBELL S ET AL: "THE ROLE OF TWEAK/FN14 IN THE PATHOGENESIS OF INFLAMMATION AND SYSTEMIC AUTOIMMUNITY", FRONTIERS IN BIOSCIENCE, FRONTIERS IN BIOSCIENCE, ALBERTSON, NY, US, vol. 9, no. SUPPL. S, 1 September 2004 (2004-09-01), pages 2273-2284, XP009074253, ISSN: 1093-9946 • ALMAGRO JUAN C ET AL: "Humanization of antibodies", FRONTIERS IN BIOSCIENCE, FRONTIERS IN BIOSCIENCE, ALBERTSON, NY, US, vol. 13,1 January 2008 (2008-01-01), pages 1619-1633, XP009126790, ISSN: 1093-9946

Remarks:

Thefile contains technical information submitted after the application was filed and not included in this specification

Description

BACKGROUND

[0001] The tumor-necrosis factor (TNF)-related cytokines are a superfamily of proteins that have an array of functions, including ones implicated in immune regulation and apoptosis regulation. TWEAK (TNF-like weak inducer of apoptosis) is one member of this superfamily. Jakubowski, A. et al., Journal of Cell Science (2002) 115(2):267-274 discloses antagonist monoclonal antibodies directed at human and mouse TWEAK.

SUMMARY

[0002] Anti-TWEAK antibodies can be used to treat a variety of conditions and disorders, e.g., an inflammatory disorder, a neuronal disorder or other disorder described herein. When used to treat a human subject, the antibody is preferably a human, humanized or otherwise effectively human antibody.

[0003] Based on the disclosure that is contained herein, the present invention provides an isolated protein that comprises a heavy chain variable domain sequence and a light chain variable domain sequence that can form an antigen binding site that binds to human TNF-like weak inducer of apoptosis (TWEAK), wherein the heavy chain variable domain sequence of the protein comprises framework regions that are at least 95% identical to the framework regions of the amino acid sequence set forth in SEQ ID NO: 59; and wherein the light chain variable domain sequence of the protein comprises framework regions that are at least 95% identical to the framework regions of the amino acid sequence set forth in SEQ ID NO: 61 or 63, and wherein the protein comprises the following complementarity determining regions (CDRs): CDRFI1 consisting of the amino acid sequence: GFTFSRYAMS (SEQ ID NO: 1); CDRFI2 consisting of the amino acid sequence: EISSGGSYPYYPDTVTG (SEQ ID NO: 2); CDRH3 consisting of the amino acid sequence: VLYYDYDGDRIEVMDY (SEQ ID NO: 3); CDRL1 consisting of the amino acid sequence: RSSQSLVSSKGNTYLFI (SEQ ID NO: 8); CDRL2 consisting of the amino acid sequence: KVSNRFS (SEQ ID NO: 9); and CDRL3 consisting of the amino acid sequence: SQSTHFPRT (SEQ ID NO: 10).

[0004] In a further aspect, the present invention provides an isolated protein comprising a heavy chain variable domain sequence and a light chain variable domain sequence that can form an antigen binding site that binds to human TWEAK, wherein the heavy chain variable domain sequence comprises the following CDRs: CDRH1 consisting of the amino acid sequence: GFTFSRYAMS (SEQ ID NO: 1); CDRH2 consisting of the amino acid sequence: EISSGGSYPYYPDTVTG (SEQ ID NO: 2); and CDRH3 consisting of the amino acid sequence: VLYYDYDGDRIEVMDY (SEQ ID NO: 3); and wherein the light chain variable domain sequence comprises the following CDRs: CDRL1 consisting of the amino acid sequence: RSSQSLVSSKGNTYLH (SEQ ID NO: 8); CDRL2 consisting of the amino acid sequence: KVSNRFS (SEQ ID NO: 9); and CDRL3 consisting of the amino acid sequence: SQSTHFPRT (SEQ ID NO: 10), for use in treating a disorder selected from the group consisting of progressive muscular atrophy, cachexia, and idiopathic pulmonary fibrosis.

[0005] The present invention and embodiments thereof are set out in the appended claims.

[0006] The protein is also referred to herein as "anti-TWEAK antibody." [0007] In one embodiment, the antibody is an antigen-binding fragment of a full length antibody, e.g., a Fab, F(ab’)2, Fv or a single chain Fv fragment. Typically, the antibody is a full length antibody. The antibody can be a monoclonal antibody or a mono-specific antibody. For example, the antibody is in a composition that includes less than 20 other species of anti-TWEAK antibodies, e.g., in a composition that does not include another species of anti-TWEAK antibody.

[0008] The antibody can be effectively human. An "effectively human" antibody is an antibody that includes a sufficient number of human amino acid positions such that the antibody does not elicit an immunogenic response in a normal human. Preferably, the protein does not evoke a neutralizing antibody response, e.g., the human anti-murine antibody (HAMA) response. HAMA can be problematic in a number of circumstances, e.g., if the antibodies are desired to be administered repeatedly, e.g., in treatment of a chronic or recurrent disease condition. A HAMA response can make repeated antibody administration potentially ineffective because of an increased antibody clearance from the serum (see, e.g., Saleh et al., Cancer Immunol. Immunother., 32:180-190(1990)) and also because of potential allergic reactions (see, e.g., LoBuglio et al. (1986) Hybridoma, 5:5117-5123).

[0009] For example, the antibody can be a human, humanized, CDR-grafted, chimeric, mutated, affinity matured, deimmunized, synthetic or otherwise in vitro-generated antibody, and combinations thereof. In one embodiment, the anti-TWEAK antibody is a humanized antibody.

[0010] The heavy and light chains of the anti-TWEAK antibody can be substantially full-length. The protein can include at least one, and preferably two, complete heavy chains, and at least one, and preferably two, complete light chains) or can include an antigen-binding fragment (e.g., a Fab, F(ab’)2, Fv or a single chain Fvfragment). In yet other embodiments, the antibody has a heavy chain constant region chosen from, e.g., lgG1, lgG2, lgG3, lgG4, IgM, lgA1, lgA2, IgD, and IgE; particularly, chosen from, e.g., lgG1, lgG2, lgG3, and lgG4, more particularly, lgG1 (e.g., human lgG1). Typically, the heavy chain constant region is human or a modified form of a human constant region. In another embodiment, the antibody has a light chain constant region chosen from, e.g., kappa or lambda, particularly, kappa (e.g., human kappa).

[0011] The protein can include one of the following sequences: DIVMTQTPLSLPVTPGEPASISCRSSQSLVSSKGNTYLHWYLQKPGQSP QLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCSQSTH FPRT (SEQ ID NO:17) DIVMTQTPLSLPVTPGEPÄSISCRSSQSLVSSKGNTYLHWYLQKPGQSP QLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCSQSTH FPRT (SEQ ID NO:18) DWMTQSPLSLPVTLGQPASISCRSSQSLVSSKGNTYLHWFQQRPGQSP RRLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCSQSTH FPRT (SEQ ID NO:19) DWMTQSPLSLPVTLGQPASISCRSSQSLVSSKGNTYLHWFQQRPGQSP RRLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCSQSTH FPRT (SEQ ID NO :20) DIVMTQTPLSLSVTPGQPASISCRSSQSLVSSKGNTYLHWYLQKPGQSP QLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCSQSTH FPRT (SEQ ID NO :21) DIVMTQTPLSLSVTPGQPASISCRSSQSLVSSKGNTYLHWYLQKPGQPP QLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCSQSTH FPRT (SEQ ID NO:22) DIVMTQSPLSLPVTPGEPASISCRSSQSLVSSKGNTYLHWYLQKPGQSP QLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCSQSTH FPRT (SEQ ID NO:23) DIVMTQSPLSLPVTPGEPASISCRSSQSLVSSKGNTYLHWYLQKPGQSP QLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCSQSTH FPRT (SEQ ID NO :24) DIVMTQTPLSSPVTLGQPASISCRSSQSLVSSKGNTYLHWLQQRPGQPP RLLIYKVSNRFSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCSQSTH FPRT (SEQ ID NO:25) DIQMTQSPSSLSASVGDRVTITCRSSQSLVSSKGNTYLHWYQQKPGKAP KLLIYKVSNRFSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCSQSTH FPRT (SEQ ID NO:26) or a sequence that has fewer than eight, seven, six, five, four, three, or two alterations (e.g., substitutions, insertions or deletions, e.g., conservative substitutions or a substitution for an amino acid residue at a corresponding position in P2D10, huP2D10-L1, or huP2D10-L2). Exemplary substitutions are at one of the following Kabat positions: 2, 4, 6, 35, 36, 38, 44, 47, 49, 62, 64-69, 85, 87, 98, 99, 101, and 102. The substitutions can, for example, substitute one or more amino acids from P2D10 into corresponding positions in a framework region, e.g., a human framework region, e.g., in FR2 (e.g., at position 46 to Phe according to consecutive numbering) and in FR3 (e.g., at position 87 to Phe).

[0012] The protein can include one of the following sequences in the heavy chain variable domain:

QVQLVQSGAEVKKPGASVKVSCKASGFTFSRYAMSWVRQAPGQGLEWMG

EIS SGGSYPYYPDTVTGRVTMTRDTSISTAYMELSRLRSDDTAVYYCAR VLYYDYDGDRIE (SEQ ID NO :27)

Qvqlvqsgaevkkpgasvkvsckasgftfsryamswvrqapgqrlewmg EISSGGSYPYYPDTVTGRVTITRDTSASTAYMELSSLRSEDTAVYYCAR VLYYDYDGDRIE (SEQ ID NO:28) QVQLVQSGAEVKKPGASVKVSCKASGFTFSRYAMSWVRQATGQGLEWMG EISSGGSYPYYPDTVTGRVTMTRNTSISTAYMELSSLRSEDTAVYYCAR VLYYDYDGDRIE (SEQ ID NO :29) QVQLVQSGAEVKKPGASVKVSCKASGFTFSRYAMSWVRQAPGQGLEWMG EISSGGSYPYYPDTVTGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCAR VLYYDYDGDRIE (SEQ ID NO:30) QVQLVQSGAEVKKPGASVKVSCKVSGFTFSRYAMSWVRQAPGKGLEWMG EISSGGSYPYYPDTVTGRVTMTEDTSTDTAYMELSSLRSEDTAVYYCAT VLYYDYDGDRIE (SEQ ID NO:31) QMQLVQSGAEVKKTGSSVKVSCKASGFTFSRYAMSWVRQAPGQALEWMG EISSGGSYPYYPDTVTGRVTITRDRSMSTAYMELSSLRSEDTAMYYCAR VLYYDYDGDRIE (SEQ ID NO :32) QVQLVQSGAEVKKPGASVKVSCKASGFTFSRYAMSWVRQAPGQGLEWMG EIS SGGS YP YYPDTVTGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCAR VLYYDYDGDRIE (SEQ ID NO:33) QMQLVQSGPEVKKPGTSVKVSCKASGFTFSRYAMSWVRQARGQRLEWIG EISSGGSYPYYPDTVTGRVTITRDMSTSTAYMELSSLRSEDTAVYYCAA VLYYDYDGDRIE (SEQ ID NO :34) EVQLVESGGGLVQPGGSLRLSCAASGFTFSRYAMSWVRQAPGKGLEWVA EISSGGSYPYYPDTVTGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR VLYYDYDGDRIE (SEQ ID NO :35) EVQLVESGGGLVQPGRSLRLSCAASGFTFSRYAMSWVRQAPGKGLEWVS EISSGGSYPYYPDTVTGRFTISRDNAKNSLYLQMNSLRAEDTALYYCAK DVLYYDYDGDRIE (SEQ ID NO:36) QVQLVESGGGLVKPGGSLRLSCÄASGFTFSRYAMSWIRQAPGKGLEWVS EISSGGSYPYYPDTVTGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR VLYYDYDGDRIE (SEQ ID NO:37) EVQLVESGGGLVKPGGSLRLSCAASGFTFSRYAMSWVRQAPGKGLEWVG EISSGGSYPYYPDTVTGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCTT VLYYDYDGDRIE (SEQ ID NO:38) EVQLVESGGGWRPGGSLRLSCAASGFTFSRYAMSWVRQAPGKGLEWVS EISSGGSYPYYPDTVTGRFTISRDNAKNSLYLQMNSLRAEDTALYHCAR VLYYDYDGDRIE (SEQ ID NO:39) EVQLVESGGGLVKPGGSLRLSCAASGFTFSRYAMSWVRQAPGKGLEWVS EISSGGSYPYYPDTVTGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR VLYYDYDGDRIE (SEQ ID NO:40) EVQLLESGGGLVQPGGSLRLSCAASGFTFSRYAMSWVRQAPGKGLEWVS EISSGGSYPYYPDTVTGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK VLYYDYDGDRIE (SEQ ID NO :41) QVQLVESGGGWQPGRSLRLSCAASGFTFSRYAMSWVRQAPGKGLEWVA EISSGGSYPYYPDTVTGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK VLYYDYDGDRIE (SEQ ID NO:42) QVQLVESGGGWQPGRSLRLSCÄASGFTFSRYAMSWVRQAPGKGLEWVA EISSGGSYPYYPDTVTGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR VLYYDYDGDRIE (SEQ ID NO :43) QVQLVESGGGWQPGRSLRLSCAASGFTFSRYAMSWVRQAPGKGLEWVA EISSGGSYPYYPDTVTGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK VLYYDYDGDRIE (SEQ ID NO :44) QVQLVESGGGWQPGRSLRLSCAASGFTFSRYAMSWVRQAPGKGLEWVA EISSGGSYPYYPDTVTGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR VLYYDYDGDRIE (SEQ ID NO:45) EVQLVESGGWVQPGGSLRLSCAASGFTFSRYAMSWVRQAPGKGLEWVS EISSGGSYPYYPDTVTGRFTISRDNSKNSLYLQMNSLRTEDTALYYCAK DVLYYDYDGDRIE (SEQ ID NO:46) EVQLVESGGGLVQPGGSLRLSCAASGFTFSRYAMSWVRQAPGKGLEWVS EISSGGSYPYYPDTVTGRFTISRDNAKNSLYLQMNSLRDEDTAVYYCAR VLYYDYDGDRIE (SEQ ID NO:47) EVQLVESGGGLVQPGRSLRLSCTASGFTFSRYAMSWFRQAPGKGLEWVG EISSGGSYPYYPDTVTGRFTISRDGSKSIAYLQMNSLKTEDTAVYYCTR VLYYDYDGDRIE (SEQ ID NO :48) EVQLVESGGGLVQPGGSLRLSCAASGFTFSRYAMSWVRQAPGKGLEYVS EISSGGSYPYYPDTVTGRFTISRDNSKNTLYLQMGSLRAEDMAVYYCAR VLYYDYDGDRIE (SEQ ID NO :49) or a sequence that has fewer than eight, seven, six, five, four, three, or two alterations (e.g., substitutions, insertions or deletions, e.g., conservative substitutions or a substitution for an amino acid residue at a corresponding position in P2D10). Exemplary substitutions are at one of the following Kabat positions: 2, 4, 6, 25, 36, 37, 39, 47, 48, 93, 94, 103, 104,106, and 107. The substitutions can, for example, substitute one or more amino acids from P2D10 into corresponding positions in a framework region, e.g., a human framework region.

[0013] In one embodiment, the heavy chain framework (e.g., FR1, FR2, FR3, individually, or a sequence encompassing FR1, FR2, and FR3, but excluding CDRs) includes an amino acid sequence, which is at least 80%, 85%, 90%, 95%, 97%, 98%, 99% or more identical to the heavy chain framework of one of the following germline V segment sequences: DP-25, DP-1, DP-12, DP-9, DP-7, DP-31, DP-32, DP-33, DP-58, DP-54, other VH I subgroup germline sequence, other VH III subgroup germline sequence, or another V gene which is compatible with the canonical structure class 1-3 (see, e.g., Chothia et al. (1992) J. Mol. Biol. 227:799-817; Tomlinson étal. (1992) J. Mol. Biol. 227:776-798). Other frameworks compatible with the canonical structure class 1-3 include frameworks with the one or more of the following residues according to Kabat numbering: Ala, Gly, Thr, or Val at position 26; Gly at position 26; Tyr, Phe, or Gly at position 27; Phe, Val, lie, or Leu at position 29; Met, lie, Leu, Val, Thr, Trp, or lie at position 34; Arg, Thr, Ala, Lys at position 94; Gly, Ser, Asn, or Asp at position 54; and Arg at position 71.

[0014] In one embodiment, the light chain framework (e.g., FR1, FR2, FR3, individually, or a sequence encompassing FR1, FR2, and FR3, but excluding CDRs) includes an amino acid sequence, which is at least 80%, 85%, 90%, 95%, 97%, 98%, 99% or more identical to the light chain framework of a Vk II subgroup germline sequence or one of the following germline V segment sequences: A17, A1, A18, A2, A19/A3, A23, a Vk I subgroup germline sequence (e.g., a DPK9 sequence), or another V gene which is compatible with the canonical structure class 4-1 (see, e.g., Tomlinson et al. (1995) EMBO J. 14:4628). Other frameworks compatible with the canonical structure class 4-1 include frameworks with the one or more of the following residues according to Kabat numbering: Val or Leu or lie at position 2; Ser or Pro at position 25; lie or Leu at position 27b; Gly at position 29; Phe or Leu at position 33; and Phe at position 71. Further, according to the Kabat numbering, position 48 can be lie or Val.

[0015] In another embodiment, the light chain framework (e.g., FR1, FR2, FR3, individually, or a sequence encompassing FR1, FR2, and FR3, but excluding CDRs) includes an amino acid sequence, which is at least 80%, 85%, 90%, 95%, 97%, 98%, 99% or more identical to the light chain framework of a Vk I subgroup germline sequence, e.g., a DPK9 sequence.

[0016] In one embodiment, the light or the heavy chain variable framework (e.g., the region encompassing at least FR1, FR2, FR3, and optionally FR4) can be chosen from: (a) a light or heavy chain variable framework including at least 80%, 90%, 95%, or preferably 100% of the amino acid residues from a human light or heavy chain variable framework, e.g., a light or heavy chain variable framework residue from a human mature antibody, a human germline sequence, a human consensus sequence, or a human antibody described herein; (b) a light or heavy chain variable framework including from 20% to 80%, 40% to 60%, 60% to 90%, or 70% to 95% of the amino acid residues from a human light or heavy chain variable framework, e.g., a light or heavy chain variable framework residue from a human mature antibody, a human germline sequence, a human consensus sequence; (c) a non-human framework (e.g., a rodent framework); or(d) a non-human framework that has been modified, e.g., to remove antigenic or cytotoxic determinants, e.g., deimmunized, or partially humanized. In one embodiment, the heavy chain variable domain sequence includes human residues or human consensus sequence residues at one or more of the following positions (preferably at least five, ten, twelve, or all): (in the FR of the variable domain of the light chain) 4L, 35L, 36L, 38L, 43L, 44L, 58L, 46L, 62L, 63L, 64L, 65L, 66L, 67L, 68L, 69L, 70L, 71L, 73L, 85L, 87L, 98L, and/or (in the FR of the variable domain of the heavy chain) 2H, 4H, 24H, 36H, 37H, 39H, 43H, 45H, 49H, 58H, 60H, 67H, 68H, 69H, 70H, 73H, 74H, 75H, 78H, 91 H, 92H, 93H, and/or 103H (according to the Kabat numbering).

[0017] In one embodiment, one or both of the variable domains include amino acid positions in the framework region that are variously derived from both a murine antibody (e.g., P2D10) and a humanized antibody (e.g., 56-84m and K107) or germline sequence. For example, the variable domain will include a number of positions at which the amino acid is identical to both the murine antibody and the human antibody (or germline sequence) because the two are identical at that position. Of the remaining framework positions where the murine and human differ, at least 50, 60, 70, 80, or 90% of the positions of the variable domain are preferably identical to the human antibody (or germline sequence) rather than the murine. None, or at least one, two, three, or four of such remaining framework positions may be identical to the murine antibody rather than to the human antibody. For example, in HC FR1, one or two such positions can be murine; in HC FR2, one or two such positions can be murine; in FR3, one, two, three, or four such positions can be murine; in LC FR1, one, two, three, or four such positions can be murine; in LC FR2, one or two such positions can be murine; in LC FR3, one or two such positions can be murine.

[0018] The anti-TWEAK antibody can be derivatized or linked to another functional molecule, e.g., another peptide, protein, or compound. For example, the antibody can be functionally linked (e.g., by chemical coupling, genetic fusion, non-covalent association or otherwise) to one or more other molecular entities, such as another antibody (e.g., a bispecific or a multi-specific antibody), toxins, radioisotopes, polymers, cytotoxic or cytostatic agents, among others.

[0019] In another aspect, the disclosure provides compositions, e.g., pharmaceutical compositions, that include a pharmaceutically acceptable carrier and the anti-Tweak antibody described herein.

[0020] The anti-TWEAK antibody (e.g., a pharmaceutical composition thereof) is administered to a subject who needs an anti-TWEAK antibody therapy or whose condition would be ameliorated by the antibody. For example, the anti-TWEAK antibody can be administered to a subject who has or is at risk for an inflammatory disorder, immune disorder, autoimmune disorder, neuronal disorder, a neoplastic disorder, or other disorder described herein. In one embodiment, an anti-TWEAK antibody described herein is for use in the treatment of an inflammatory disorder, immune disorder, autoimmune disorder, neuronal disorder, a neoplastic disorder, or other disorder described herein.

[0021] In another instance, the disclosure features a method of treating a TWEAK-associated disorder, in a subject. The method includes: administering to the subject an anti-TWEAK antibody, in an amount sufficient to treat (e.g., improve or prevent) the TWEAK-associated disorder. The anti-TWEAK antibody can be administered to the subject, alone or in combination with other therapeutic modalities as described herein. In one instance, the subject is a mammal, e.g., a human, e.g., a human having a TWEAK-associated disorder, e.g., a disorder disclosed herein. The antibody can be used to ameliorate one or more symptoms of such disorders. The term "treating" refers to administering a therapy in an amount, manner, and/or mode effective to improve or prevent a condition, symptom, or parameter associated with a disorder (e.g., a disorder described herein) or to prevent onset, progression, or exacerbation of the disorder, to either a statistically significant degree or to a degree detectable to one skilled in the art. Accordingly, treating can achieve therapeutic and/or prophylactic benefits. An effective amount, manner, or mode can vary depending on the subject and may be tailored to the subject. In one instance, an anti-TWEAK antibody described herein is used for the preparation of a medicament for the treatment of a TWEAK-associated disorder.

[0022] The disclosure features a method of modulating interaction between TWEAK and a TWEAK receptor protein. For exam pie, an anti-TWEAK antibody can be used to reduce or inhibit binding, between TWEAK and a TWEAK receptor, such as Fn14. The method comprises contacting TWEAK or a complex that contains TWEAK with the antibody. The method can be used on cells in vitro e.g., in culture, e.g. in vitro or ex vivo. For example, TWEAK receptor-expressing cells can be cultured in vitro in culture medium and the contacting step can be effected by adding an anti-TWEAK antibody to the culture medium. Alternatively, the method can be performed on cells present in a subject, e.g., as part of an in vivo (e.g., therapeutic or prophylactic) protocol. For example, the anti-TWEAK antibody can be delivered locally orsystemically. In one instance, an anti-TWEAK antibody described herein is used for the preparation of a medicament for modulating interaction between TWEAK and a TWEAK receptor protein.

[0023] The method can include contacting TWEAK with the TWEAK receptor complex, or subunit thereof, under conditions that allow an interaction between TWEAK and the TWEAK receptor complex, or subunit thereof, to occur to thereby form a TWEAK/TWEAK receptor mixture. Generally, the anti-TWEAK antibody is provided in an effective amount, e.g., so that contacting the TWEAK/TWEAK receptor mixture with the anti-TWEAK antibody modulates, e.g., interferes with (e.g., inhibits, blocks or otherwise reduces) the interaction between TWEAK and the receptor protein or at least one function of TWEAK, e.g., TWEAK mediated signaling.

[0024] The disclosure also features nucleic acids comprising nucleotide sequences, which encode heavy and light chain variable regions of the anti-TWEAK antibodies, e.g., as described herein. For example, the disclosure features a first and second nucleic acid encoding heavy and light chain variable regions, respectively, of P2D10. In another instance the disclosure features host cells and vectors containing the nucleic acids described herein.

[0025] The disclosure also features the epitope of TWEAK, e.g., human TWEAK, recognized by P2D10 and proteins able to interact with the epitope. For example, proteins and peptides that include the epitope can be used to generate or screen for other binding compounds that interact with the epitope, e.g., proteins such as antibodies or small molecules. For exam pie, a peptide that includes the epitope can be used as an immunogen or as a target for screening an expression library. It is also possible to evaluate compounds for their ability to interact with the peptide, or, by mapping or structure determination, to evaluate compounds for their ability to interact with the epitope, e.g., in the context of a mature TWEAK. An exemplary evaluation includes determining if the compound can interact with TWEAK in the presence of a competing P2D10 antibody.

[0026] Methods for delivering or targeting an agent, e.g., a therapeutic (including a genetic agent) ora cytotoxic agent, with an anti-TWEAK antibody (e.g., P2D10 or other antibody described herein) to a TWEAK-expressing cell or structure in vivo are also disclosed.

[0027] As used herein, the term "antibody" refers to a protein that includes at leastone immunoglobulin variable region, e.g., an amino acid sequence that provides an immunoglobulin variable domain or an immunoglobulin variable domain sequence. For example, an antibody can include a heavy (H) chain variable region (abbreviated herein as VH), and a light (L) chain variable region (abbreviated herein as VL). In another example, an antibody includes two heavy (H) chain variable regions and two light (L) chain variable regions. The term "antibody" encompasses antigen-binding fragments of antibodies (e.g., single chain antibodies, Fab fragments, F(ab’)2 fragments, Fd fragments, Fv fragments, and dAb fragments) as well as full length antibodies, e.g., full length, immunoglobulins of types IgA, IgG (e.g., lgG1, lgG2, lgG3, lgG4), IgE, IgD, IgM (as well as subtypes thereof). The term "full length antibody" refers to an antibody having at least 96% of the length of a natural antibody that is processed to remove any signal sequences. A full length antibody can include the complete length of the natural antibody, e.g., residues from the amino-terminal residue of a natural antibody (e.g., a lgG1, lgG2, lgG3, lgG4) to its carboxy-terminal residue.

[0028] An "immunoglobulin variable domain sequence" refers to an amino acid sequence which can form the structure of an immunoglobulin variable domain. For example, the sequence may include all or part of the amino acid sequence of a naturally-occurring variable domain. For example, the sequence may or may not include one, two or more N- or exterminai amino acids, or may include other alterations that are compatible with formation of the protein structure.

[0029] An "isolated composition" refers to a composition that is removed from at least 90% of at least one component of a natural sample from which the isolated composition can be obtained. Compositions produced artificially or naturally can be "compositions of at least" a certain degree of purity if the species or population of species of interest is at least 5, 10, 25, 50, 75, 80, 90, 95, 98, or 99% pure on a weight-weight basis.

[0030] An "epitope" refers to the site on a target compound that is bound by an antibody. In the case where the target compound is a protein, for example, an epitope may refer to the amino acids (particularly amino acid side chains) that are bound by the antibody. Overlapping epitopes include at least one common amino acid residue, e.g., at at least 2, 3, 4 or 5 common amino acid residues.

[0031] As used herein, the term "hybridizes under low stringency, medium stringency, high stringency, or very high stringency conditions" describes conditions for hybridization and washing. Guidance for performing hybridization reactions can be found in Current Protocols in Molecular Biology, John Wiley & Sons, N.Y. (1989), 6.3.1-6.3.6. Aqueous and nonaqueous methods are described in that reference and either can be used. Specific hybridization conditions referred to herein are as follows: 1) low stringency hybridization conditions in 6X sodium chloride/sodium citrate (SSC) at about 45°C, followed by two washes in 0.2X SSC, 0.1 % SDS at least at 50°C (the temperature of the washes can be increased to 55°C for low stringency conditions); 2) medium stringency hybridization conditions in 6X SSC at about 45°C, followed by one or more washes in 0.2X SSC, 0.1% SDS at 60°C; 3) high stringency hybridization conditions in 6X SSC at about 45°C, followed by one or more washes in 0.2X SSC, 0.1% SDS at 65°C; and preferably 4) very high stringency hybridization conditions are 0.5M sodium phosphate, 7% SDS at 65°C, followed by one or more washes at 0.2X SSC, 1% SDS at 65°C. High stringency conditions (3) are the preferred conditions and the ones that should be used unless otherwise specified.

[0032] A "TWEAK-associated disorder" is any disorder in which TWEAK contributes to etiology or a disorder whose condition, symptoms, or risk of onset is altered by provision of a TWEAK blocking agent.

[0033] Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although methods and materials similar or equivalent to those described herein can be used in the practice or testing described herein, suitable methods and materials are described below. In addition, embodiments of the invention described with respect to Chothia CDRs may also be implemented using Kabat CDRs.

[0034] In the case of conflict, the present specification, including definitions, controls. In addition, the materials, methods, and examples are illustrative only and not intended to be limiting.

DETAILED DESCRIPTION

[0035] P2D10 is an exemplary murine antibody that specifically binds to human TWEAK and inhibits TWEAK function. Variants of the P2D10 antibody are also disclosed, including exemplary humanized variants. These antibodies, other anti-TWEAK antibodies, and other TWEAK blocking agents can be used to treat or prevent TWEAK-mediated disorders, e.g., inflammatory disorders and other disorders disclosed herein.

Anti-TWEAK Antibodies [0036] This disclosure includes the sequences of specific examples of anti-TWEAK antibodies, such as P2D10, huP2D10-1, and huP2D10-2. Particular anti bodies, such as these, can be made, for example, by preparing and expressing synthetic genes that encode the recited amino acid sequences or by mutating human germline genes to provide a gene that encodes the recited amino acid sequences. Moreover, these antibodies and other anti-TWEAK antibodies can be produced, e.g., using one or more of the following methods.

[0037] Numerous methods are available for obtaining antibodies, particularly human antibodies. One exemplary method includes screening protein expression libraries, e.g., phage or ribosome display libraries. Phage display is described, for example, U.S. 5,223,409; Smith (1985) Science 228:1315-1317; WO 92/18619; WO 91/17271; WO 92/20791; WO 92/15679; WO 93/01288; WO 92/01047; WO 92/09690; and WO 90/02809. The display of Fab’s on phage is described, e.g., in U.S. Pat. Nos. 5,658,727; 5,667,988; and 5,885,793.

[0038] In addition to the use of display libraries, other methods can be used to obtain a TWEAK-binding antibody. For example, the TWEAK protein or a peptide thereof can be used as an antigen in a non-human animal, e.g., a rodent, e.g., a mouse, hamster, or rat.

[0039] The non-human animal includes at least a part of a human immunoglobulin gene. For example, it is possible to engineer mouse strains deficient in mouse antibody production with large fragments of the human Ig loci. Using the hybridoma technology, antigen-specific monoclonal antibodies derived from the genes with the desired specificity may be produced and selected. See, e.g., XENOMOUSE™, Green et al. (1994) Nature Genetics 7:13-21, U .S. 2003-0070185, WO 96/34096, and WO 96/33735.

[0040] In another instance, a monoclonal antibody is obtained from the non-human animal, and then modified, e.g., humanized ordeimmunized. Winter describes an exemplary CDR-grafting method that may be used to prepare humanized antibodies described herein (U.S. 5,225,539). All or some of the CDRs of a particular human antibody may be replaced with at least a portion of a non-human antibody. It may only be necessary to replace the CDRs required for binding or binding determinants of such CDRs to arrive at a useful humanized antibody that binds to TWEAK.

[0041] Humanized antibodies can be generated by replacing sequences of the Fv variable region that are not directly involved in antigen binding with equivalent sequences from human Fv variable regions. General methods for generating humanized antibodies are provided by Momison, S. L. (1985) Science 229:1202-1207, by Oietal. (1986) BioTechniques 4:214, and by US 5,585,089; US 5,693,761; US 5,693,762; US 5,859,205; and US 6,407,213. Those methods include isolating, manipulating, and expressing the nucleic acid sequences that encode all or part of immunoglobulin Fv variable regions from at least one of a heavy or light chain. Sources of such nucleic acid are well known to those skilled in the art and, for example, may be obtained from a hybridoma producing an antibody against a predetermined target, as described above, from germline immunoglobulin genes, or from synthetic constructs. The recombinant DNA encoding the humanized antibody can then be cloned into an appropriate expression vector.

[0042] Human germline sequences, for example, are disclosed in Tomlinson, I.A. etal. (1992) J. Mol. Biol. 227:776-798; Cook, G. P. et al. (1995) Immunol. Today 16:237-242; Chothia, D. et al. (1992) J. Mol. Bio. 227:799-817; and Tomlinson etal. (1995) EMBO J 14:4628-4638. The V BASE directory provides a comprehensive directory of human immunoglobulin variable region sequences (compiled by Tomlinson, I.A. et al. MRC Centre for Protein Engineering, Cambridge, UK). These sequences can be used as a source of human sequence, e.g., for framework regions and CDRs. Consensus human framework regions can also be used, e.g., as described in U.S. Pat. No. 6,300,064.

[0043] A non-human TWEAK-binding antibody may also be modified by specific deletion of human T cell epitopes or "deimmunization" by the methods disclosed in WO 98/52976 and WO 00/34317. Briefly, the heavy and light chain variable regions of an antibody can be analyzed for peptides that bind to MHC Class II; these peptides represent potential T-cell epitopes (as defined in WO 98/52976 and WO 00/34317). For detection of potential T-cell epitopes, a computer modeling approach termed "peptide threading" can be applied, and in addition a database of human MHC class II binding peptides can be searched for motifs present in the VHand VL sequences, as described in WO 98/52976 and WO 00/34317. These motifs bind to any of the 18 major MHC class II DR allotypes, and thus constitute potential T cell epitopes. Potential T-cell epitopes detected can be eliminated by substituting small numbers of amino acid residues in the variable regions, or preferably, by single amino acid substitutions. As far as possible, conservative substitutions are made. Often, but not exclusively, an amino acid common to a position in human germline antibody sequences may be used. After the deim-munizing changes are identified, nucleic acids encoding VH and VL can be constructed by mutagenesis or other synthetic methods (e.g., de novo synthesis, cassette replacement, and so forth). A mutagenized variable sequence can, optionally, be fused to a human constant region, e.g., human IgG 1 or kappa constant regions.

[0044] In some cases, a potential T cell epitope will include residues which are known or predicted to be important for antibody function. For example, potential T cell epitopes are usually biased towards the CDRs. In addition, potential T cell epitopes can occur in framework residues important for antibody structure and binding. Changes to eliminate these potential epitopes will in some cases require more scrutiny, e.g., by making and testing chains with and without the change. Where possible, potential T cell epitopes that overlap the CDRs can be eliminated by substitutions outside the CDRs. In some cases, an alteration within a CDR is the only option, and thus variants with and without this substitution can be tested. In other cases, the substitution required to remove a potential T cell epitope is at a residue position within the framework that might be critical for antibody binding. In these cases, variants with and without this substitution are tested. Thus, in some cases several variant deimmunized heavy and light chain variable regions are designed and various heavy/light chain combinations are tested to identify the optimal deimmunized antibody. The choice of the final deimmunized antibody can then be made by considering the binding affinity of the different variants in conjunction with the extent of deimmunization, particularly, the number of potential T cell epitopes remaining in the variable region. Deimmunization can be used to modify any antibody, e.g., an antibody that includes a non-human sequence, e.g., a synthetic antibody, a murine antibody other non-human monoclonal antibody, or an antibody isolated from a display library.

[0045] Other methods for humanizing antibodies can also be used. For example, other methods can account for the three dimensional structure of the antibody, framework positions that are in three dimensional proximity to binding determinants, and immunogenic peptide sequences. See, e.g., WO 90/07861; U.S. Pat. Nos. 5,693,762; 5,693,761; 5,585,089; 5,530,101 ; and 6,407,213; Tempest et al. (1991) Biotechnology 9:266-271. Still another method is termed "humaneering" and is described, for example, in U.S. 2005-008625.

[0046] The antibody can include a human Fc region, e.g., a wild-type Fc region or an Fc region that includes one or more alterations. In one embodiment, the constant region is altered, e.g., mutated, to modify the properties of the antibody (e.g., to increase or decrease one or more of: Fc receptor binding, antibody glycosylation, the number of cysteine residues, effector cell function, or complement function). For example, the human lgG1 constant region can be mutated at one or more residues, e.g., one or more of residues 234 and 237. Antibodies may have mutations in the CFI2 region of the heavy chain that reduce or alter efFectorfunction, e.g., Fc receptor binding and complement activation. For exam pie, antibodies may have mutations such as those described in U.S. Patent Nos. 5,624,821 and 5,648,260. Antibodies may also have mutations that stabilize the disulfide bond between the two heavy chains of an immunoglobulin, such as mutations in the hinge region of lgG4, as disclosed in the art (e.g., Angal et al. (1993) Mol. Immunol. 30:105-08). See also, e.g., U.S. 2005-0037000.

[0047] Affinity Maturation. In one instance, an anti-TWEAK antibody is modified, e.g., by mutagenesis, to provide a pool of modified antibodies. The modified antibodies are then evaluated to identify one or more antibodies which have altered functional properties (e.g., improved binding, improved stability, reduced antigenicity, or increased stability in vivo). In one implementation, display library technology is used to select or screen the pool of modified antibodies. Fligher affinity antibodies are then identified from the second library, e.g., by using higher stringency or more competitive binding and washing conditions. Other screening techniques can also be used.

[0048] In some implementations, the mutagenesis is targeted to regions known or likely to be at the binding interface. If, for example, the identified binding proteins are antibodies, then mutagenesis can be directed to the CDR regions of the heavy or light chains as described herein. Further, mutagenesis can be directed to framework regions near or adjacent to the CDRs, e.g., framework regions, particularly within 10, 5, or 3 amino acids of a CDR junction. In the case of antibodies, mutagenesis can also be limited to one or a few of the CDRs, e.g., to make step-wise improvements.

[0049] In one instance, mutagenesis is used to make an antibody more similar to one or more germline sequences. One exemplary germlining method can include: identifying one or more germline sequences that are similar (e.g., most similar in a particular database) to the sequence of the isolated antibody. Then mutations (at the amino acid level) can be made in the isolated antibody, either incrementally, in combination, or both. For example, a nucleic acid library that includes sequences encoding some or all possible germline mutations is made. The mutated antibodies are then evaluated, e.g., to identify an antibody that has one or more additional germline residues relative to the isolated antibody and that is still useful (e.g., has a functional activity). In one instance, as many germline residues are introduced into an isolated antibody as possible.

[0050] In one instance, mutagenesis is used to substitute or insert one or more germline residues into a CDR region. For exam pie, the germline CDR residue can beírom a germline sequence that is similar (e.g., most similar) to the variable region being modified. After mutagenesis, activity (e.g., binding or other functional activity) of the antibody can be evaluated to determine if the germline residue or residues are tolerated. Similar mutagenesis can be performed in the framework regions.

[0051] Selecting a germline sequence can be performed in different ways. For example, a germline sequence can be selected if it meets a predetermined criteria for selectivity or similarity, e.g., at least a certain percentage identity, e.g., at least 75, 80, 85, 90, 91,92, 93, 94, 95, 96, 97, 98, 99, or 99.5% identity, relative to the donor non-human antibody. The selection can be performed using at least 2, 3, 5, or 10 germline sequences. In the case of CDR1 and CDR2, identifying a similar germline sequence can include selecting one such sequence. In the case of CDR3, identifying a similar germline sequence can include selecting one such sequence, but may include using two germline sequences that separately contribute to the amino-terminal portion and the carboxy-terminal portion. In other implementations, more than one or two germline sequences are used, e.g., to form a consensus sequence.

[0052] In other embodiments, the antibody may be modified to have an altered glycosylation pattern (i.e., altered from the original or native glycosylation pattern). As used in this context, "altered" means having one or more carbohydrate moieties deleted, and/or having one or more glycosylation sites added to the original antibody. Addition of glycosylation sites to the presently disclosed antibodies may be accomplished by altering the amino acid sequence to contain glycosylation site consensus sequences; such techniques are well known in the art. Another means of increasing the number of carbohydrate moieties on the antibodies is by chemical or enzymatic coupling of glycosides to the amino acid residues of the antibody. These methods are described in, e.g., WO 87/05330, and Aplin and Wriston (1981) CRC Crit. Rev. Biochem. 22:259-306. Removal of any carbohydrate moieties presenton the antibodies may be accomplished chemically or enzymatically as described in the art (Hakimuddin et al. (1987) Arch. Biochem. Biophys. 259:52; Edge et al. (1981) Anal. Biochem. 118:131; and Thotakura et al. (1987) Meth. Enzymol. 138:350). See, e.g., U.S. Pat. No. 5,869,046 for a modification that increases in vivo half life by providing a salvage receptor binding epitope.

[0053] In one instance, an antibody has CDR sequences that differ only ^substantially from those of P2D10. Insubstantial differences include minor amino acid changes, such as substitutions of 1 or 2 out of any of typically 5-7 amino acids in the sequence of a CDR, e.g., a Chothia or Kabat CDR. Typically an amino acid is substituted by a related amino acid having similar charge, hydrophobic, or stereochemical characteristics. Such substitutions would be within the ordinary skills of an artisan. Unlike in CDRs, more substantial changes in structure framework regions (FRs) can be made without adversely affecting the binding properties of an antibody. Changes to FRs include, but are not limited to, humanizing a nonhuman-derived framework or engineering certain framework residues that are important for antigen contact or for stabilizing the binding site, e.g., changing the class or subclass of the constant region, changing specific amino acid residues which might alter an effector function such as Fc receptor binding (Lund et al. (1991) J. Immun. 147:2657-62; Morgan et al. (1995) Immunology 86:319-24), or changing the species from which the constant region is derived.

[0054] The anti-TWEAK antibodies can be in the form of full length antibodies, or in the form of fragments of antibodies, e.g., Fab, F(ab’)2, Fd, dAb, and scFvfragments. Additional forms include a protein that includes a single variable domain, e.g., a camel or camelized domain. See, e.g., U.S. 2005-0079574 and Davies et ai. (1996) Protein Eng. 9(6):531-7.

[0055] Antibody Production. Some antibodies, e.g., Fab’s, can be produced in bacterial cells, e.g., E. coli cells. Antibodies can also be produced in eukaryotic cells. In one embodiment, the antibodies (e.g., scFv’s) are expressed in a yeast cell such as Pichia (see, e.g., Powers et al. (2001) J Immunol Methods. 251:123-35), Hanseula, or Saccharomyces.

[0056] In one preferred embodiment, antibodies are produced in mammalian cells. Exemplary mammalian host cells for expressing an antibody include Chinese Hamster Ovary (CHO cells) (including dhfr CHO cells, described in Urlaub and Chasin (1980) Proc. Natl. Acad. Sei. USA 77:4216-4220, used with a DHFR selectable marker, e.g., as described in Kaufman and Sharp (1982) Mol. Biol. 159:601-621), lymphocytic cell lines, e.g., NS0 myeloma cells and SP2 cells, COS cells, and a cell from a transgenic animal, e.g., a transgenic mammal. For example, the cell is a mammary epithelial cell.

[0057] In addition to the nucleic acid sequence encoding the diversified immunoglobulin domain, the recombinant expression vectors may carry additional sequences, such as sequences that regulate replication of the vector in host cells (e.g., origins of replication) and selectable marker genes. The selectable marker gene facilitates selection of host cells into which the vector has been introduced (see e.g., U.S. Pat. Nos. 4,399,216,4,634,665 and 5,179,017). For example, typically the selectable marker gene confers resistance to drugs, such as G418, hygromycin, or methotrexate, on a host cell into which the vector has been introduced.

[0058] In an exemplary system for antibody expression, a recombinant expression vector encoding both the antibody heavy chain and the antibody light chain is introduced into dhfr CHO cells by calcium phosphate-mediated transfection. Within the recombinant expression vector, the antibody heavy and light chain genes are each operatively linked to enhancer/promoter regulatory elements (e.g., derived from SV40, CMV, adenovirus and the like, such as a CMV en-hancer/AdMLP promoter regulatory element or an SV40 enhancer/AdMLP promoter regulatory element) to drive high levels of transcription of the genes. The recombinant expression vector also carries a DHFR gene, which allows for selection of CHO cells that have been transfected with the vector using methotrexate selection/amplification. The selected transformant host cells are cultured to allow for expression of the antibody heavy and light chains and the antibody is recovered from the culture medium. Standard molecular biology techniques are used to prepare the recombinant expression vector, transfect the host cells, select for transformants, culture the host cells and recover the antibody from the culture medium. For example, some antibodies can be isolated by affinity chromatography with a Protein A or Protein G coupled matrix.

[0059] For antibodies that include an Fc domain, the antibody production system preferably synthesizes antibodies in which the Fc region is glycosylated. For example, the Fc domain of IgG molecules is glycosylated at asparagine 297 in the CH2 domain. This asparagine is the site for modification with biantennary-type oligosaccharides. It has been demonstrated that this glycosylation is required for effector functions mediated by Fey receptors and complement C1q (Burton and Woof (1992) Adv. Immunol. 51:1-84; Jefferis etal. (1998) Immunol. Rev. 163:59-76). In one embodiment, the Fc domain is produced in a mammalian expression system that appropriately glycosylates the residue corresponding to asparagine 297. The Fc domain or other region of the antibody can also include other eukaryotic post-translational modifications.

[0060] Antibodies can also be produced by a transgenic animal. For example, U.S. Pat. No. 5,849,992 describes a method of expressing an antibody in the mammary gland of a transgenic mammal. A transgene is constructed that includes a milk-specific promoter and nucleic acids encoding the antibody of interest and a signal sequence for secretion. The milk produced by females of such transgenic mammals includes, secreted-therein, the antibody of interest. The antibody can be purified from the milk, or for some applications, used directly.

Characterization [0061] The binding properties of an antibody may be measured by any standard method, e.g., one of the following methods: BIACORE™ analysis, Enzyme Linked Immunosorbent Assay (ELISA), Fluorescence Resonance Energy Transfer (FRET), x-ray crystallography, sequence analysis and scanning mutagenesis. The ability of a protein to inhibit one or more activities of TWEAK can be evaluated in vitro or in an animal model of a disorder, e.g., a disorder described herein. Preferably, the antibody has a statistically significant effect that indicates that the antibody inhibits one or more activities of TWEAK.

[0062] In one instance, an antibody is evaluated for inhibition of the ability of TWEAK to stimulate production of IL-8, MMP-1, PGE2, IL-6, IP-10 and RANTES in dermal fibroblasts. See Chicheportiche et al. (2002) Arthritis Res. 4(2): 126-133 for suitable assay conditions.

[0063] In another instance, an antibody is evaluated for its ability to inhibit TWEAK from stimulating the proliferation of an endothelial cell. See, e.g., U.S. 2003-0211993 which describes a proliferation assay (as well as other useful assays) as follows: HVEC are plated in 96-well microtiter plates at subconfluence (4000 cells per well) and cultured overnight in CS-C Medium without addition of supplier growth supplements. Media is replaced with complete Media, or with basal media. Cells are cultured in basal media with or without TWEAK (100 ng/ml), bFGF using a 1/500 to 1/1000 dilution of bFGF growth supplement (Clonetics) or 1 ng/ml (R&D Systems), VEGF (10 ng/ml) or combinations of these factors. Where indicated, 10 μg/ml of the antibody being tested or a control antibody is also added. Cells are incubated at 37°C with 5% C02 for three days and proliferation was measured by pulsing with 3H-Thymidineforthe last 10 hours of culture. Cell-bound radioactivity can be measured with a BETAPLATE™ (EG&G Wallac, Gaithersburg, Md.). A decrease in proliferation mediated by TWEAK or the combination of TWEAK and bFGF can indicate that the antibody is effective at blocking TWEAK activity.

[0064] Surface Plasmon Resonance (SPR).The binding interaction of a protein of interest and a target (e.g., TWEAK) can be analyzed using SPR. SPR or Biomolecular Interaction Analysis (BIA) detects biospecific interactions in real time, without labeling any of the interactants. Changes in the mass at the binding surface (indicative of a binding event) of the BIA chip result in alterations of the refractive index of light near the surface (the optical phenomenon of surface plasmon resonance (SPR)). The changes in the refractivity generate a detectable signal, which are measured as an indication of real-time reactions between biological molecules. Methods for using SPR are described, for example, in U.S. Pat. No. 5,641,640; Raether (1988) Surface Plasmons Springer Verlag; Sjolander and Urbaniczky (1991) Anal. Chem. 63:2338-2345; Szabo et al. (1995) Curr. Opin. Struct. Biol. 5:699-705 and on-line resources provide by BIAcore International AB (Uppsala, Sweden). Information from SPR can be used to provide an accurate and quantitative measure of the equilibrium dissociation constant (Kd), and kinetic parameters, including Kon and Koff, for the binding of a biomolecule to a target.

[0065] Epitopes can also be directly mapped by assessing the ability of different antibodies to compete with each other for binding to TWEAK (e.g., human TWEAK, particularly soluble human TWEAK) using BIAcore chromatographic techniques (Pharmacia BIAtechnology Handbook, "Epitope Mapping", Section 6.3.2, (May 1994); see also Johne et aL (1993) J. Immunol. Methods, 160:191-198). Additional general guidance for evaluating antibodies, e.g., in Western blots and immunoprécipitation assays, can be found in Antibodies: A Laboratory Manual, ed. by Harlow and Lane, Cold Spring Harbor press (1988)). TWEAK-Associated Disorders [0066] An anti-TWEAK antibody (such as an antibody described herein) can be used to treat a variety of disorders, such as a TWEAK-associated disorder. For example, the antibody can be used to treat inflammatory, immune, or autoimmune disorders in patients, as well as neoplastic disorders. Examples of inflammatory TWEAK-associated disorders include rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, inflammatory bowel disease (including ulcerative colitis and Crohn’s disease), psoriasis, or inflammatory myositis. Still other examples of inflammatory disorders that can be treated include Langerhans-cell histiocytosis, adult respiratory distress syndrome/bronchiolitis obliterans, Wegener’s granulomatosis, vasculitis, cachexia, stomatitis, idiopathic pulmonary fibrosis, dermatomyositis or polymyositis, non-infectious scleritis, chronic sarcoidosis with pulmonary involvement, myelodysplastic syndromes/refractory anemia with excess blasts, ulcerative colitis, moderate to severe chronic obstructive pulmonary disease, and giant cell arteritis.

[0067] A subject who is at risk for, diagnosed with, or who has one of these disorders can be administered an anti-TWEAK antibody in an amount and for a time to provide an overall therapeutic effect. The anti-TWEAK antibody can be administered alone or in combination with other agents.

Methods for administering a TWEAK blocking agent in combination with a TNF-a blocking agent have been described. In the case of a com bination therapy, the amounts and times of administration can be those that provide, e.g., a synergistic therapeutic effect. Further, the administration of the TWEAK blocking agent (with or without the second agent) can be used as a primary, e.g., first line treatment, or as a secondary treatment, e.g., for subjects who have an inadequate response to an previously administered therapy (i.e., a therapy other than one with a TWEAK blocking agent).

Rheumatoid Arthritis (RA) [0068] An anti-TWEAK antibody (such as an antibody described herein) can be used to treat rheumatoid arthritis and related disorders. Rheumatoid arthritis ("RA") is a chronic inflammatory disease that causes pain, swelling, stiffness, and loss of function, primarily in joints. RA frequently begins in the synovium, the membrane that surrounds a joint creating a protective sac. In many individuals suffering from RA, leukocytes infiltrate from the circulation into the synovium causing continuous abnormal inflammation (e.g., synovitis). Consequently, the synovium becomes inflamed, causing warmth, redness, swelling, and pain. The collagen in the cartilage is gradually destroyed, narrowing the joint space and eventually damaging bone. The inflammation causes erosive bone damage in the affected area. During this process, the cells of the synovium grow and divide abnormally, making the normally thin synovium thick and resulting in a joint that is swollen and puffy to the touch.

[0069] As RA progresses, abnormal synovial cells can invade and destroy the cartilage and bone within the joint. The surrounding muscles, ligaments, and tendons that support and stabilize the joint can become weak and unable to work normally. RA also may cause more generalized bone loss that may lead to osteoporosis, making bones fragile and more prone to fracture. All of these effects cause the pain, impairment and deformities associated with RA. Regions that can be effected include the wrists, knuckles, knees and the ball of the foot. Often, many joints may be involved, and even the spine can be affected. In about 25% of people with RA, inflammation of small blood vessels can cause rheumatoid nodules, or lumps, under the skin, that often form close to the joints. As the disease progresses, fluid may also accumulate, particularly in the ankles. Many patients with RA also develop anemia, or a decrease in the normal number of red blood cells.

[0070] RA encompasses a number of disease subtypes, such as Felty’s syndrome, seronegative RA, "classical" RA, progressive and/or relapsing RA, and RA with vasculitis. Some experts classify the disease into type 1 or type 2. Type 1, the less common form, lasts a few months at most and leaves no permanent disability. Type 2 is chronic and lasts for years, sometimes for life. RA can also manifest as subcutaneous rheumatoid nodules, visceral nodules, vasculitis causing leg ulcers or mononeuritis multiplex, pleural or pericardial effusions, lymphadenopathy, Felty’s syndrome, Sjogren’s syndrome, and episcleritis. These disease subtypes and also subjects showing one or more of the above symptoms can be treated using the antibodies described herein.

[0071] RA can be assessed by a variety of clinical measures. Some exemplary indicia include the total Sharp score (TSS), Sharp erosion score, and the HAQ disability index. The methods herein can be used to achieve an improvement for at least one of these indicia. The therapeutic properties of an anti-TWEAK antibody for treating RA can be evaluated in an animal model, e.g., using the mouse collagen-induced arthritis (rnCIA) model (see e.g., Stuartét al., J. Clin. Invest. 69:673-683 (1982).

Multiple Sclerosis [0072] An anti-TWEAK antibody (such as an antibody described herein) can be used to treat multiple sclerosis (MS) and related disorders. MS is a central nervous system disease that is characterized by inflammation and loss of myelin sheaths.

[0073] Patients having MS may be identified by criteria establishing a diagnosis of clinically definite MS as defined by the workshop on the diagnosis of MS (Poser et al., Ann. Neurol. (1983) 13:227). Briefly, an individual with clinically definite MS has had two attacks and clinical evidence of either two lesions or clinical evidence of one lesion and paraclinical evidence of another, separate lesion. Definite MS may also be diagnosed by evidence of two attacks and oligoclonal bands of IgG in cerebrospinal fluid or by combination of an attack, clinical evidence of two lesions and oligoclonal band of IgG in cerebrospinal fluid.

[0074] Effective treatment of multiple sclerosis may be examined in several different ways. The following parameters can be used to gauge effectiveness of treatment. Three main criteria are used: EDSS (extended disability status scale), appearance of exacerbations or MRI (magnetic resonance imaging). The EDSS is a means to grade clinical impairment due to MS (Kurtzke (1983) Neurology 33:1444). Eight functional systems are evaluated for the type and severity of neurologic impairment. Briefly, prior to treatment, patients are evaluated for impairment in the following systems: pyramidal, cerebella, brainstem, sensory, bowel and bladder, visual, cerebral, and other. Follow-ups are conducted at defined intervals. The scale ranges from 0 (normal) to 10 (death due to MS). A decrease of in EDSS indicates an effective treatment (Kurtzke (1994) Ann. Neurol. 36:573-79).

[0075] An exemplary animal model for multiple sclerosis is the experimental autoimmune encephalitis (EAE) mouse model, e.g., as described in Tuohy et al. (J. Immunol. (1988) 141: 1126-1130), Sobel et al. (J. Immunol. (1984) 132: 2393-2401), and Traugott (Cell Immunol. (1989) 119: 114-129). Mice can be administered an antibody described herein prior to EAE induction. The mice are evaluated for characteristic criteria to determine the efficacy of the antibody.

Stroke [0076] An anti-TWEAK antibody (such as an antibody described herein) can be used to treat a subject who has experienced a stroke, e.g., a thromboembolic or hemorrhagic stroke (e.g., within the last 48, 24, 12, 8, or 2 hours), or to prevent a stroke, e.g., in a subject at risk for stroke. Stroke is a general term for acute brain damage resulting from disease of blood vessels. Stroke can be classified into at least two main categories: hemorrhagic stroke (resulting from leakage of blood outside of the normal blood vessels) and ischemic stroke (cerebral ischemia due to lack of blood supply). Some events that can cause ischemic stroke include thrombosis, embolism, and systemic hypoperfusion (with resultant ischemia and hypoxia).

[0077] Stroke generally causes neuronal death and injury in the brain by oxygen deprivation and secondary events. The area of the brain that dies as a result of the lack of blood supply or other damage is called an infarct. In some cases, the treatments described herein can be used to reduce or minimize the size of an infarct, e.g., by reducing secondary events that cause neuronal death or injury.

[0078] Obstruction of a cerebral artery resulting from a thrombus which has built up on the wall of a brain artery is generally called cerebral thrombosis. In cerebral embolism, the occlusive material blocking the cerebral artery arises downstream in the circulation (e.g. an embolus is carried to the cerebral artery from the heart). Because it is difficult to discern whether a stroke is caused by thrombosis or embolism, the term thromboembolism is used to cover both these types of stroke. Systemic hypoperfusion may arise as a consequence of decreased blood levels, reduced hematocrit, low blood pressure or inability of the heart to pump blood adequately.

[0079] Further, an anti-TWEAK antibody can be administered as a prophylactic stroke therapy, or as a component thereof, e.g., to a subject who has experienced a transient ischemic attack (TIA) or is exhibiting symptoms of TIA.

Neuronal disorders [0080] An anti-TWEAK antibody (such as an antibody described herein) can be used to treat or prevent neuronal disorders such as mechanical neuronal traumas and neurodegenerative disorders. Examples of mechanical neuronal traumas include spinal cord injury (SCI) and traumatic brain injury (TBI). Examples of neurodegenerative disorders include amyotrophic lateral sclerosis (ALS), progressive bulbar palsy (PBP), primary lateral sclerosis (PLS), progressive muscular atrophy (PMA), Parkinson’s Disease, Huntington’s Disease (HD), aud Alzheimer’s Disease.

[0081] In one embodiment, the neuronal disorder is primarily characterized by destruction or death of nerve cells, e.g., of motor neurons (e.g., ALS), of striatal neurons of basal ganglia and/or cortical neurons (e.g., Huntington’s disease), of substantia nigra neurons (e.g., Parkinson’s disease).

Cancer [0082] TWEAK and its receptors may be involved in the development of at least some types of cancer, e.g., a pancreatic cancer. An anti-TWEAK antibody (such as an antibody described herein) can be used to treat or prevent cancers (e.g., adenocarcinomas) and other neoplastic disorders.

Pharmaceutical Compositions [0083] An anti-TWEAK antibody (such as an antibody described herein) can be formulated as a pharmaceutical composition for administration to a subject, e.g., to treat a disorder described herein. Typically, a pharmaceutical composition includes a pharmaceutically acceptable carrier. As used herein, "pharmaceutically acceptable carrier" includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible. The composition can include a pharmaceutically acceptable salt, e.g., an acid addition salt or a base addition salt (see e.g., Berge, S.M., et al. (1977) J. Pharm. Sei. 66:1-19).

[0084] Pharmaceutical formulation is a well-established art, and is further described, e.g., in Gennaro (ed.), Remington: The Science and Practice of Pharmacy, 20th ed., Lippincott, Williams & Wilkins (2000) (ISBN: 0683306472); Ansel et al., Pharmaceutical Dosage Forms and Drug Delivery Systems, 7th Ed., Lippincott Williams & Wilkins Publishers (1999) (ISBN: 0683305727); and Kibbe (ed.), Handbook of Pharmaceutical Excipients American Pharmaceutical Association, 3rd ed. (2000) (ISBN: 091733096X).

[0085] The pharmaceutical compositions may be in a variety of forms. These include, for example, liquid, semi-solid and solid dosage forms, such as liquid solutions (e.g., injectable and infusible solutions), dispersions or suspensions, tablets, pills, powders, liposomes and suppositories. The preferred form can depend on the intended mode of administration and therapeutic application. Typically compositions for the agents described herein are in the form of injectable or infusible solutions.

[0086] In one embodiment, the anti-TWEAK antibody is formulated with excipient materials, such as sodium chloride, sodium dibasic phosphate heptahydrate, sodium monobasic phosphate, and a stabilizer. It can be provided, for example, in a buffered solution at a suitable concentration and can be stored at 2-8°C.

[0087] Such compositions can be administered by a parenteral mode (e.g., intravenous, subcutaneous, intraperitoneal, or intramuscular injection). The phrases "parenteral administration" and "administered parenterally" as used herein mean modes of administration other than enteral and topical administration, usually by injection, and include, without limitation, intravenous, intramuscular, intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, epidural and intraster-nal injection and infusion.

[0088] The composition can be formulated as a solution, microemulsion, dispersion, liposome, or other ordered structure suitable for stable storage at high concentration. Sterile injectable solutions can be prepared by incorporating an agent described herein in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization. Generally, dispersions are prepared by incorporating an agent described herein into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above. In the case of sterile powders for the preparation of sterile injectable solutions, the preferred methods of preparation are vacuum drying and freeze drying that yield a powder of an agent described herein plus any additional desired ingredient from a previously sterile-filtered solution thereof. The proper fluidity of a solution can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants. Prolonged absorption of injectable compositions can be brought about by including in the composition an agent that delays absorption, for example, monostearate salts and gelatin.

[0089] In certain embodiments, the anti-TWEAK antibody may be prepared with a carrierthatwill protect the compound against rapid release, such as a controlled release formulation, including implants, and microencapsulated delivery systems. Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyg-lycolic acid, collagen, polyorthoesters, and polylactic acid. Many methods for the preparation of such formulations are patented or generally known. See, e.g., Sustained and Controlled Release Drug Delivery Systems, J.R. Robinson, ed., Marcel Dekker, Inc., New York (1978).

[0090] An anti-TWEAK antibody can be modified, e.g., with a moiety that improves its stabilization and/or retention in circulation, e.g., in blood, serum, or other tissues, e.g., by at least 1.5, 2, 5, 10, or 50 fold. The modified antibody can be evaluated to assess whether it can reach sites of inflammation, e.g., joints.

[0091] For example, the anti-TWEAK antibody can be associated with (e.g., conjugated to) a polymer, e.g., a substantially non-antigenic polymer, such as a polyalkylene oxide or a polyethylene oxide. Suitable polymers will vary substantially by weight. Polymers having molecular number average weights ranging from about 200 to about 35,000 Daltons (or about 1,000 to about 15,000, and 2,000 to about 12,500) can be used.

[0092] For example, the anti-TWEAK antibody can be conjugated to a water soluble polymer, e.g., a hydrophilic polyvinyl polymer, e.g., polyvinylalcohol or polyvinylpyrrolidone. Examples of such polymers include polyalkylene oxide homopolymers such as polyethylene glycol (PEG) or polypropylene glycols, polyoxyethylenated polyols, copolymers thereof and block copolymers thereof, provided that the water solubility of the block copolymers is maintained. Additional useful polymers include polyoxyalkylenes such as polyoxyethylene, polyoxypropylene, and block copolymers of polyoxyethylene and polyoxypropylene; polymethacrylates; carbomers; and branched or unbranched polysaccharides.

[0093] In some implementations, the anti-TWEAK antibody can also be coupled to or otherwise associated with a label or other agent, e.g., another therapeutic agent such as a cytotoxic or cytostatic agent, although, in many embodiments, this configuration is unnecessary. Examples of cytotoxicand chemotherapeutic agents include taxol, cytochalasin B, gramicidin D, vinblastine, doxorubicin, daunorubicin, a maytansinoid (e.g., maytansinol or the DM1 maytansinoid, a sulfhydryl-containing derivative of maytansine), mitoxantrone, mithramycin, actinomycin D, 1-dehydrotestosterone, glucocorticoids, procaine, taxane, tetracaine, lidocaine, propranolol, and puromycin and analogs or homologs thereof.

[0094] When the anti-TWEAK antibody is used in combination with a second agent (e.g., an anti-TNF-a antibody or other agent), the two agents can be formulated separately or together. The agents can be formulated or otherwise used in a synergistically effective amount. It is also possible to use one or both of the agents in amounts less than would be used for mono-therapy. For example, the respective pharmaceutical compositions can be mixed, e.g., just prior to administration, and administered together or can be administered separately, e.g., at the same or different times.

[0095] It is also possible to use other TWEAK blocking agents. The agent may be any type of compound (e.g., small organic or inorganic molecule, nucleic acid, protein, or peptide mimetic) that can be administered to a subject. In one embodiment, the blocking agent is a biologic, e.g., a protein having a molecular weight of between 5-300 kDa. For example, a TWEAK blocking agent may inhibit binding of TWEAK to a TWEAK receptor. Exemplary TWEAK blocking agents, other than antibodies that bind to TWEAK, include antibodies that bind to TWEAK-R and soluble forms of the TWEAK-R (e.g., Fn14) that compete with cell surface TWEAK-R for binding to TWEAK. Other therapeutic agents described herein can also be provided as a pharmaceutical composition, e.g., by standard methods or method described herein.

Administration [0096] The anti-TWEAK antibody can be administered to a subject, e.g., a human subject, by a variety of methods. For many applications, the route of administration is one of: intravenous injection or infusion (IV), subcutaneous injection (SC), intraperitoneally (IP), or intramuscular injection. It is also possible to use intra-articular delivery. Other modes of parenteral administration can also be used. Examples of such modes include: intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, transtracheal, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, and epidural and intrasternal injection. In some cases, administration may be directly to a site of inflammation, e.g., a joint or other inflamed site.

[0097] The route and/or mode of administration of the antibody can also be tailored for the individual case, e.g., by monitoring the subject, e.g., using tomographic imaging, neurological exam, and standard parameters associated with the particular disorder, e.g., criteria for assessing rheumatoid arthritis.

[0098] The antibody can be administered as a fixed dose, or in a mg/kg dose. The dose can also be chosen to reduce or avoid production of antibodies against the anti-TWEAK antibody. Dosage regimens are adjusted to provide the desired response, e.g., a therapeutic response or a combinatorial therapeutic effect Generally, doses of the anti-TWEAK antibody (and optionally a second agent) can be used in order to provide a subject with the agent in bioavailable quantities. For example, doses in the range of 0.1-100 mg/kg, 0.5-100 mg/kg, 1 mg/kg -100 mg/kg, 0.5-20 mg/kg, 0.1-10 mg/kg, or 1-10 mg/kg can be administered. Other doses can also be used.

[0099] Dosage unit form or "fixed dose" as used herein refers to physically discrete units suited as unitary dosages for the subjects to be treated; each unit contains a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier and optionally in association with the other agent Single or multiple dosages may be given. Alternatively, or in addition, the antibody may be administered via continuous infusion.

[0100] A anti-TWEAK antibody dose can be administered, e.g., at a periodic interval over a period of time (a course of treatment) sufficient to encompass at least 2 doses, 3 doses, 5 doses, 10 doses, or more, e.g., once or twice daily, or about one to four times per week, or preferably weekly, biweekly, monthly, e.g., for between about 1 to 12 weeks, preferably between 2 to 8 weeks, more preferably between about 3 to 7 weeks, and even more preferably for about 4, 5, or 6 weeks. Factors that may influence the dosage and timing required to effectively treat a subject, include, e.g., the severity of the disease or disorder, formulation, route of delivery, previous treatments, the general health and/or age of the subject, and other diseases present. Moreover, treatment of a subject with a therapeutically effective amount of a compound can include a single treatment or, preferably, can include a series of treatments. Animal models can also be used to determine a useful dose, e.g., an initial dose or a regimen.

[0101] If a subject is at risk for developing an inflammatory disorder or other disorder described herein, the antibody can be administered before the full onset of the disorder, e.g., as a preventative measure. The duration of such preventative treatment can be a single dosage of the antibody or the treatment may continue (e.g., multiple dosages). For example, a subject at risk for the disorder or who has a predisposition for the disorder may be treated with the antibody for days, weeks, months, or even years so as to prevent the disorder from occurring or fulminating.

[0102] A pharmaceutical composition may include a "therapeutically effective amount" of an agent described herein. Such effective amounts can be determined based on the effect of the administered agent, or the combinatorial effect of agents if more than one agent is used. A therapeutically effective amount of an agent may also vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the compound to elicit a desired response in the individual, e.g., amelioration of at least one disorder parameter or amelioration of at least one symptom of the disorder. A therapeutically effective amount is also one in which any toxic or detrimental effects of the composition are outweighed by the therapeutically beneficial effects.

Devices and Kits for Therapy [0103] Pharmaceutical compositions that include the anti-TWEAK antibody can be administered with a medical device. The device can designed with features such as portability, room temperature storage, and ease of use so that it can be used in emergency situations, e.g., by an untrained subject or by emergency personnel in the field, removed from medical facilities and other medical equipment. The device can include, e.g., one or more housings for storing pharmaceutical preparations that include anti-TWEAK antibody, and can be configured to deliver one or more unit doses of the antibody. The device can be further configured to administer a second agent, e.g., an anti-TNF-a antibody, either as a single pharmaceutical composition that also includes the anti-TWEAK antibody or as two separate pharmaceutical compositions.

[0104] For example, the pharmaceutical composition can be administered with a needleless hypodermic injection device, such as the devices disclosed in US 5,399,163; 5,383,851; 5,312,335; 5,064,413; 4,941,880; 4,790,824; or 4,596,556. Examples of well-known implants and modules include: US 4,487,603, which discloses an implantable microinfusion pump for dispensing medication at a controlled rate; US 4,486,194, which discloses a therapeutic device for administering medicants through the skin; US 4,447,233, which discloses a medication infusion pump for delivering medication at a precise infusion rate; US 4,447,224, which discloses a variable flow implantable infusion apparatus for continuous drug delivery; US 4,439,196, which discloses an osmotic drug delivery system having multi-chamber compartments; and US 4,475,196, which discloses an osmotic drug delivery system. Many other devices, implants, delivery systems, and modules are also known.

[0105] An anti-TWEAK antibody can be provided in a kit. In one instance, the kit includes (a) a container that contains a composition that includes the anti-TWEAK antibody, and optionally (b) informational material. The informational material can be descriptive, instructional, marketing or other material that relates to the methods described herein and/or the use of the agents for therapeutic benefit.

[0106] In an instance, the kit also includes a second agent for treating an inflammatory disorder, e.g., an anti- TNF-a antibody. For example, the kit includes a first container that contains a composition that includes the anti-TWEAK antibody, and a second container that includes the second agent.

[0107] The informational material of the kits is not limited in its form. In one instance, the informational material can include information about production of the compound, molecular weight of the compound, concentration, date of expiration, batch or production site information, and so forth. In one instance, the informational material relates to methods of administering the anti-TWEAK antibody, e.g., in a suitable dose, dosage form, or mode of administration (e.g., a dose, dosage form, or mode of administration described herein), to treat a subject who has had or who is at risk for an inflammatory disorder, or other disorder described herein. The information can be provided in a variety of formats, include printed text, computer readable material, video recording, or audio recording, or information that provides a link or address to substantive material, e.g., on the internet.

[0108] In addition to the antibody, the composition in the kit can include other ingredients, such as a solvent or buffer, a stabilizer, ora preservative. The antibody can be provided in any form, e.g., liquid, dried or lyophilized form, preferably substantially pure and/or sterile. When the agents are provided in a liquid solution, the liquid solution preferably is an aqueous solution. When the agents are provided as a dried form, reconstitution generally is by the addition of a suitable solvent. The solvent, e.g., sterile water or buffer, can optionally be provided in the kit.

[0109] The kit can include one or more containers for the composition or compositions containing the agents. In some instances, the kit contains separate containers, dividers or compartments for the composition and informational material. Forexample, the composition can be contained in a bottle, vial, or syringe, and the informational material can be contained in a plastic sleeve or packet In other instances, the separate elements of the kit are contained within a single, undivided container. For example, the composition is contained in a bottle, vial or syringe that has attached thereto the informational material in the form of a label. In some instances, the kit includes a plurality (e.g., a pack) of individual containers, each containing one or more unit dosage forms (e.g., a dosage form described herein) of the agents. The containers can include a combination unit dosage, e.g., a unit that includes both the anti-TWEAK antibody and the second agent, e.g., in a desired ratio. For example, the kit includes a plurality of syringes, ampules, foil packets, blister packs, or medical devices, e.g., each containing a single combination unit dose. The containers of the kits can be air tight, waterproof (e.g., impermeable to changes in moisture or evaporation), and/or light-tight [0110] The kit optionally includes a device suitable for administration of the composition, e.g., a syringe or other suitable delivery device. The device can be provided pre-loaded with one or both of the agents or can be empty, but suitable for loading.

Targetting TWEAK-expressing cells [0111] The anti-TWEAK antibodies described herein can be used to target a payload to a TWEAK-expressing cell or to a tissue or other structure associated with TWEAK. For example, the antibodies can be attached to a virus or virus like particle that can deliver an exogenous gene (e.g., forgene therapy) orto a liposome, e.g., a liposome that encapsulates a therapeutic agent or exogenous gene. An exemplary method for using an antibody to target a virus is described in Roux et al. (1989) Proc Natl Acad Sei USA (1989) 86:9079-9083. See also, e.g., Curr Gene Ther. (2005) 5:63-70 and Hum Gene Ther. (2004) 15:1034-1044.

[0112] The anti-TWEAK Abs of this invention may also be attached to liposomes containing a therapeutic agent such as a chemotherapeutic agents. Attachment of antibodies to liposomes may be accomplished by any known cross-linking agent such as heterobifunctional cross-linking agents that have been widely used to couple toxins or chemotherapeutic agents to antibodies for targeted delivery. For example, conjugation to liposomes can be accomplished using the carbohydrate-directed cross-linking reagent 4-(4-maleimidophenyl) butyric acid hydrazide (MPBH) (Duzgunes et al. (1992) J. Cell. Biochem. Abst. Suppl. 16E 77). Liposomes containing antibodies can also be prepared by well-known methods (See, e.g. DE 3,218,121; Epstein etal. (1985) Proc. Natl. Acad. Sei. USA, 82:3688-92 ; Hwang etal. (1980) Proc. Natl. Acad. Sei. USA, 77:4030-34; U.S. 4,485,045 and 4,544,545).

Diagnostic Uses [0113] Anti-TWEAK antibodies can be used in a diagnostic method for detecting the presence of a TWEAK, in vitro (e.g., a biological sample, such as tissue, biopsy) or in vivo (e.g., in vivo imaging in a subject). For example, human or effectively human anti-TWEAK antibodies can be administered to a subject to detect TWEAK within the subject. For example, the antibody can be labeled, e.g., with an MRI detectable label or a radiolabel. The subject can be evaluated using a means for detecting the detectable label. For example, the subject can be scanned to evaluate localization of the antibody within the subject. For example, the subject is imaged, e.g., by NMR or other tomographic means.

[0114] Examples of labels useful for diagnostic imaging include radiolabels such as 131l,1111n, 123l, 99mTc, 32pi 33pi 125l, 3H, 14C, and 188Rh, fluorescent labels such as fluorescein and rhodamine, nuclear magnetic resonance active labels, positron emitting isotopes detectable by a positron emission tomography ("PET") scanner, chemiluminescers such as luciferin, and enzymatic markers such as peroxidase or phosphatase. Short-range radiation emitters, such as isotopes detectable by short-range detector probes, can also be employed. The protein ligand can be labeled with such reagents using known techniques. For example, see Wensel and Meares (1983) Radioimmunoimaging and Radioimmunotherapy, Elsevier, New York for techniques relating to the radiolabeling of antibodies and Colcher et al. (1986) Meth. Enzymol. 121: 802-816.

[0115] The subject can be "imaged" in vivo using known techniques such as radionuclear scanning using e.g., a gamma camera or emission tomography. See e.g., A.R. Bradwell et al., "Developments in Antibody Imaging", Monoclonal Antibodies for Cancer Detection and Therapy, R.W. Baldwin etal., (eds.), pp 65-85 (Academic Press 1985). Alternatively, a positron emission transaxial tomography scanner, such as designated Pet VI located at Brookhaven National Laboratory, can be used where the radiolabel emits positrons (e.g., 11C, 18F, 150, and 13N).

[0116] MRI Contrast Agents. Magnetic Resonance Imaging (MRI) uses NMR to visualize internal features of living subject, and is useful for prognosis, diagnosis, treatment, and surgery. MRI can be used without radioactive tracer compounds for obvious benefit. Some MRI techniques are summarized in EPO 502 814 A. Generally, the differences related to relaxation time constants T1 and T2 of water protons in different environments is used to generate an image. However, these differences can be insufficient to provide sharp high resolution images.

[0117] The differences in these relaxation time constants can be enhanced by contrast agents. Examples of such contrast agents include a number of magnetic agents, paramagnetic agents (which primarily alter Tl) and ferromagnetic or superparamagnetic agents (which primarily alter T2 response). Chelates (e.g., EDTA, DTPA and NTA chelates) can be used to attach (and reduce toxicity) of some paramagnetic substances (e.g., Fe3+, Mn2+, Gd3+). Other agents can be in the form of particles, e.g., less than 10 μηι to about 10 nm in diameter). Particles can have ferromagnetic, antiferromagnetic or superparamagnetic properties. Particles can include, e.g., magnetite (Fe304), y-Fe203, ferrites, and other magnetic mineral compounds of transition elements. Magnetic particles may include one or more magnetic crystals with and without nonmagnetic material. The nonmagnetic material can include synthetic or natural polymers (such as sepharose, dextran, dextrin, starch and the like).

[0118] The anti-TWEAK antibodies can also be labeled with an indicating group containing the NMR-active 19F atom, ora plurality of such atoms inasmuch as (i) substantially all of naturally abundant fluorine atoms are the 19F isotope and, thus, substantially all fluorine-containing compounds are NMR-active; (ii) many chemically active polyfluorinated compounds such as trifluoracetic anhydride are commercially available at relatively low cost, and (iii) many fluorinated compounds have been found medically acceptable for use in humans such as the perfluorinated polyethers utilized to carry oxygen as hemoglobin replacements. After permitting such time for incubation, a whole body MRI is carried out using an apparatus such as one of those described by Pykett (1982) Scientific American, 246:78-88 to locate and image TWEAK distribution.

[0119] In another instance, the disclosure provides a method for detecting the presence of TWEAK in a sample in vitro (e.g., a biological sample, such as serum, plasma, tissue, biopsy). The subject method can be used to diagnose a disorder, e.g., an immune cell-associated disorder. The method includes: (i) contacting the sample or a control sample with the anti-TWEAK antibody; and (ii) evaluating the sample for the presence of TWEAK, e.g., by detecting formation of a complex between the anti-TWEAK antibody and TWEAK, or by detecting the presence of the antibody or TWEAK. For example, the antibody can be immobilized, e.g., on a support, and retention of the antigen on the support is detected, and/or vice versa. A control sample can be included. A statistically significant change in the formation of the complex in the sample relative to the control sample can be indicative of the presence of TWEAK in the sample. Generally, an anti-TWEAK antibody can be used in applications that include fluorescence polarization, microscopy, ELISA, centrifugation, chromatography, and cell sorting (e.g., fluorescence activated cell sorting).

Example 1 [0120] The sequence of the murine P2D10 heavy chain variable domain, with CDRs underlined, is:

1 EVQLVESGGG LVRPGGSLKL FCAASQFTFS RYAMSWVRQS PEKRLEWVAE 51 ISSGGSYPYY PDTVTGRFTI SRDNAKNTLY LEMSSLKSED TAMYYCARVL 101 YYPYDGDRIB VMDYWGQGTA VIVSS (SEQ ID NO :50) [0121] This is a murine subgroup 3D heavy chain variable domain.

[0122] The sequence of the murine P2D10 light chain variable domain, with CDRs underlined, is: 1 DWMTQSPLS LSVSLGDQAS ISCRSSQSLV SSKGNTYLHW YLQKPGQSPK 51 FLIYKVSNRF SGVPDRFSGS GSGTDFTLKI SRVAAEDLGV YFCSQSTHFP 101 RTFGGGTTLE IK (SEQ ID NO:51) [0123] This is a murine subgroup 2 kappa light chain.

[0124] The following human acceptor frameworks were chosen for huP2D10: Human 56-84m subgroup 3 heavy chain variable domain (NCBI database accession number Gl:33318898, Scamurra et al., direct submission). The sequence with CDRs underlined is as follows.: 1 EVQLVESGGG LVQPGGSLRL SGAASGFTFS SYWMSWVRQA PGKGLEWVAN 51 IKQDGSBKYY VDSVKGRFTI SRDNAKNSLY LQMNSLRAED TAVYYCARDP 101 MTTWKPSLA TNDYWGQGTL VTVSS (SEQ ID NO:52) [0125] The sequence of human K107 subgroup 2 light chain variable domain (NCBI database accession number Gl: 21669075, Akahori et al., direct submission), with CDRs underlined is:

1 DWMTQSPLS LPVTPGEPAS ISCRSSQSLL HSNGYNYLDW YLQKPGQSPQ 51 LLIYLGSNRA SGVPDRFSGS GSGTDFTLKI SRVEAEDVGV YYCMQALQTP 101 LTFGGGTKVE IK (SEQ ID NO:53) [0126] In the human acceptor sequences shown, the CDRs (which are underlined) are the same length and canonical classes as those in the muP2D10 variable domains.

[0127] Shown below is the alignment of the murine P2D10 (top) and human acceptor 56-84m (bottom) heavy chain variable domains (68.8% identical):

[0128] Shown below is the alignment of the murine P2D10 (top) and human acceptor K107 light (bottom) chain variable domains (75.9% identical):

[0129] There are two versions of huP2D10 light chain (L1 and L2). The antibody huP2D10-1 refers to an antibody that includes huP2D10 H1 and huP2D10 L1. The antibody huP2D10-2 refers to an antibody that includes huP2D10 H1 and huP2D10L2.

[0130] Shown below is the alignment of the 56-84m human acceptor (top) and the huP2D10 H1 heavy chain (bottom) variable domain:

[0131] CDRs are underlined. The huP2D10 heavy chain is a straight CDR graft (i.e., there are no back mutations in the framework).

[0132] Shown below is the alignment of the K107 human kappa acceptor (top) and the huP2D10 L1 light chain (bottom) variable domain:

[0133] CDRs are underlined. The huP2D10 L1 light chain has two back mutations that are indicated in lower case in the framework shown above: L46F in FR2 and Y87F in FR3.

[0134] Shown below is the alignment of the K107 human acceptor (top) and the huP2D10 L2 light chain (bottom) variable domain:

[0135] CDRs are underlined. The huP2D10 L2 light chain is a straight CDR graft (without back mutations in the framework).

[0136] This is an exemplary amino acid sequence of the mature huP2D10 H1 lgG1 heavy chain: 1 EVQLVESGGG LVQPGGSLRL SCAASGFTFS RYAMSWVRQA PGKGLEWVAE 51 ISSGGSYPYY PDTVTGRFTI SRDNAKNSLY LQMNSLRAED TÄVYYCARVL 101 YYDYDGDRIE VMDYWGQGTL VTVSSASTKG PSVFPLAPSS KSTSGGTAAL 151 GCLVKDYFPE PVTVSWNSGA LTSGVHTFPA VLQSSGLYSL SSWTVPSSS 201 LGTQTYICNV NHKPSNTKVD KKVEPKSCDK THTCPPCPAP ELLGGPSVFL 251 FPPKPKDTLM ISRTPEVTCV WDVSHEDPE VKFNWYVDGV EVHNAKTKPR 301 EEQYNSTYRV VSVLTVLHQD WLNGKEYKCK VSNKALPAPI EKTISKAKGQ 351 PREPQVYTLP PSRDELTKNQ VSLTCLVKGF YPSDIAVEWE SNGQPENNYK 401 TTPPVLDSDG SFFLYSKLTV DKSRWQQGNV FSCSVMHEAL HNHYTQKSLS 451 LSPG (SEQ ID NO:64) [0137] Kabat numbering for the VH segment of the heavy chain variable domain (SED ID NO:65) is shown below:

Rabat No. 1234567890 1234567890 1234567890 1234567890 1234567890

hP2D10 EVQLVESGGG LVQPGGSLRL SCAASGFTFS RYAMSWVRQA PGKGLEWVAE

Rabat No. 12a3456789 0123456789 0123456789 012abc3456 78901234

hP2D10 ISSGGSYPYY PDTVTGRFTI SRDNAKNSLY LQMNSLRAED TAVYYCAR

[0138] This is an exemplary amino acid sequence of the mature huP2D10 L1 light chain: 1 DWMTQSPLS LPVTPGEPAS ISCRSSQSLV SSKGNTYLHW YLQKPQQSPQ 51 FLIYKVSNRF SGVPDRFSGS GSGTDFTLKI SRVEAEDVGV YFCSQSTHFP 101 RTFGGGTKVE IKRTVAAPSV FIFPPSDEQL KSGTASWCL LNNFYPREAK 151 VQWKVDNALQ SGNSQESVTE QDSKDSTYSL SSTLTLSKAD YEKHKVYACE 201 VTHQGLSSPV TKSFNRGEC (SEQ ID NO:66) [0139] Kabat numbering for this VL segment is shown below (SEQ ID NO:67):

Kabat No. 1234567890 1234567890 1234567abc de89012345 6789012345

hP2D10 DWMTQSPLS LPVTPGEPAS ISCRSSQSLV SSKGNTYLHW YLQKPGQSPQ

Rabat No. 6789012345 6789012345 6789012345 6789012345 6789012345

hP2D10 FLIYKVSNRF SGVPDRFSGS GSGTDFTLKI SRVEAEDVGV YFCSQSTHFP

[0140] This is an exemplary amino acid sequence of the mature huP2D10 L2 light chain: 1 DWMTQSPLS LFVTPGBPAS ISCRSSQSLV SSKGNTYLHW YLQKPGQSPQ 51 LLIYKVSNRF SGVPDRFSGS GSGTDFTLKI SRVEAEDVGV YYCSQSTHFP 101 RTFGGGTKVE IKRTVAAPSV FIFPPSDEQL KSGTASWCL LNNFYPREAK 151 VQWKVDNALQ SGNSQESVTE QDSKDSTYSL SSTLTLSRAD YEKHKVYACE 201 VTHQGLSSPV TKSFNRGEC (SEQ ID NO:68) [0141] Kabat numbering for this VL segment is shown below (SEQ ID NO:69):

Rabat No. 1234567890 1234567890 1234567abc de89012345 6789012345

hP2D10 DWMTQSPLS LPVTPGEPAS ISCRSSQSLV SSKGNTYLHW YLQKPGQSPQ

Kabat No. 6789012345 6789012345 6789012345 6789012345 6789012345

hP2D10 LLIYKVSNRF SGVPDRFSGS GSGTDFTLKI SRVEAEDVGV YFCSQSTHFP

Example 2 [0142] The blocking monoclonal antibody to TWEAK, mP2D10, significantly reduced clinical severity in models of multiple sclerosis, stroke, and rheumatic arthritis. The pharmacokinetics (PK) of anti-TWEAK monoclonal antibody, mP2D10, following intravenous (IV) administration were modeled.

[0143] mP2D10 was administered to mice at 1, 10 or 100 mg/kg via IV injection. Serum concentrations of mP2D10 was determined using ELISA. The concentration-time PK profile was analyzed using a two-compartment model with first-order elimination or Michaelis-Menten elimination from the central compartment with a volume of VI. The rate constants between the two compartments were K12 (exiting compartment 1 to 2) and K21 (exiting compartment 2 to 1). For the first-order elimination model, the elimination rate constant was K10. For the Michaelis-Menten elimination model, the drug was cleared at the rate of Vm*C1/(Km+C1), in which, C1 was mP2D10 in the concentration in the central compartment, Vm and Km were constants. The data were fitted with ADAPT II software (D’Argenio, D.Z. and A. Schu-mitzky. ADAPT II User’s Guide: Pharmacokinetic / Pharmacodynamic Systems Analysis Software. Biomedical Simulations Resource, Los Angeles, 1997.) using the Maximum Likelihood estimation procedure.

[0144] For the two-compartment linear elimination model, V1 was 23.2 mL/kg, K10 was 0.0096 h-1, the K12 was 2.501 and K21 was 1.053. The area under curve (AIC) value was 298 and the Schwarz value was 304.2. For the two-com-partment non-linear elimination model, the V1 was 0.0235. The Vm was 9.22 mg/kg/hr, the Km was 484.2 μg/mL. The K12 was 2.348 h-1, and the K21 was 0.966 h-1. The AIC value was 269and the Schwarz value was 276. The PK of mP2D10 was better predicted by a non-linear model than a linear model.

[0145] The concentration-time profiles of mP2D10 were better predicted by a two-compartment model with Michaelis-Menten elimination than with first order elimination.

[0146] Those skilled in the art will recognize, orbe able to ascertain using no more than routine experimentation, many equivalents of the specific embodiments described herein.

SEQUENCE LISTING

[0147] <110> Biogen Idee MA Inc.

<120 TWEAK BINDING ANTIBODIES

<130 P31553EP-PCT <140 EP06760258.1 <141 > 2006-05-25 <150 US 60/685,149 <151 > 2005-05-27 <160> 69 <170> FastSEQ for Windows Version 4.0 <210> 1 <211> 10 <212> PRT <213> Mus musculus <400> 1

Gly Phe Thr Phe Ser Arg Tyr Ala Met Ser 15 10 <210> 2 <211 > 17 <212> PRT <213> Mus musculus <400> 2

Glu Ile Ser Ser Gly Gly Ser Tyr Pro Tyr Tyr Pro Asp Thr Val Thr 15 10 15

Gly <210> 3 <211 > 16 <212> PRT <213> Mus musculus <400> 3

Val Leu Tyr Tyr Asp Tyr Asp Gly Asp Arg Ile Glu Val Met Asp Tyr 15 10 15

<210> 4 <211 > 10 <212> PRT <213> Artificial Sequence <220> <223> Synthetically generated peptide <220> <221 > VARIANT <222> 2 <223> Xaa = Tyr or Phe <220> <221 > VARIANT <222> 3 <223> Xaa = Asn or Thr <220>

<221 > VARIANT <222>5 <223> Xaa = Ser, Thr, Asp or Asn <220 <221 > VARIANT <222> 6 <223> Xaa = Arg or Tyr <220 <221 > VARIANT <222> 9 <223> xaa = Met, lie or Leu <220 <221 > VARIANT <222> 10 <223> Xaa = His or Ser <400> 4

Gly Xaa Xaa Phe Xaa Xaa Tyr Ala Xaa Xaa 15 10

<210> 5 <211>8 <212> PRT <213> Artificial Sequence <220> <223> Synthetically generated peptide <220> <221 > VARIANT <222> 3 <223> Xaa = Pro or Val <220> <221 > VARIANT <222> 5 <223> Xaa = Thr or Ser <220> <221 > VARIANT <222> 7 <223> Xaa = Thr or Lys <400> 5

Tyr Tyr Xaa Asp Xaa Val Xaa Gly 1 5

<210> 6 <211>7 <212> PRT <213> Artificial Sequence <220 <223> Synthetically generated peptide <220 <221 > VARIANT <222> 1 <223> Xaa = Val or Leu <220 <221 > VARIANT <222>2 <223> Xaa = lie or Leu <220

<221 > VARIANT <222> 3, 4, 6 <223> Xaa = Tyr or Phe <400 6

Xaa Xaa Xaa Xaa Asp Xaa Asp 1 5

<210>7 <211>7 <212> PRT <213> Artificial Sequence <220> <223> Synthetically generated peptide <220> <221 > VARIANT <222> 1 <223> Xaa = Asp or G lu <220> <221 > VARIANT <222>2 <223> Xaa = Arg or Lys <220> <221 > VARIANT <222>3 <223> Xaa = Ile, Leu, Val or Met <220> <221 > VARIANT <222>4 <223> Xaa = Glu, Gin or Asp <220> <221 > VARIANT <222>5 <223> Val, Ala or Leu <220>

<221 > VARIANT <222>7 <223> Xaa = Asp or G lu <400 7

Xaa Xaa Xaa Xaa Xaa Met Xaa 1 5 <210>8 <211> 16 <212> PRT <213> Mus musculus <400> 8

Arg Ser Ser Gin Ser Leu Val Ser Ser Lys Gly Asn Thr Tyr Leu His 15 10 15 <210> 9 <211>7 <212> PRT <213> Mus musculus <400> 9

Lys Val Ser Asn Arg Phe Ser 1 5 <210> 10 <211>9 <212> PRT <213> Mus musculus <400> 10

Ser Gin Ser Thr His Phe Pro Arg Thr 1 5

<210> 11 <211 > 16 <212> PRT <213> Artificial Sequence <220> <223> Synthetically generated peptide <220> <221 > VARIANT <222> 1 <223> Xaa = Arg or Lys <220> <221 > VARIANT <222> 6 <223> Xaa = Leu or Ile <220 <221 > VARIANT <222> 7 <223> Xaa = Lys or Val <220 <221 > VARIANT <222> 10 <223> Xaa = Lys or Arg <220> <221 > VARIANT <222> 13 <223> Xaa = Thr or Asn <220> <221 > VARIANT <222> 16 <223> Xaa = Glu, His, Asp, Asn, Gin or Tyr <400> 11

Xaa Ser Ser Gin Ser Xaa Xaa Ser Ser Xaa Gly Asn Xaa Tyr Leu Xaa 15 10 15

<210> 12 <211> 16 <212> PRT <213> Artificial Sequence <220> <223> Synthetically generated peptide <220> <221 > VARIANT <222> 1 <223> Xaa = Arg or Lys <220> <221 > VARIANT <222> 6 <223> Xaa = Leu or Ile <220> <221 > VARIANT <222> 10 <223> Xaa = Lys or Arg <220> <221 > VARIANT <222> 13 <223> Xaa = Thr or Asn <400> 12

Xaa Ser Ser Gin Ser Xaa Val Ser Ser Xaa Gly Asn Xaa Tyr Leu His 15 10 15

<210 13 <211>7 <212> PRT <213> Artificial Sequence <220 <223> Synthetically generated peptide <220 <221 > VARIANT <222> 1 <223> Xaa = Lys or G lu <220 <221 > VARIANT <222> 2 <223> Xaa = Leu, Val or lie <220 <221 > VARIANT <222> 4 <223> Xaa = Asn, Tyr or Ser <220 <221 > VARIANT <222> 5 <223> Xaa = Arg or Trp <220 <221 > VARIANT <222> 6 <223> Xaa = Phe, Ala or Asp <400 13

Xaa Xaa Ser Xaa Xaa Xaa Ser 1 5

<210> 14 <211>7 <212> PRT <213> Artificial Sequence <220> <223> Synthetically generated peptide <220> <221 > VARIANT <222> 2 <223> Xaa = Leu, Val or lie <220>

<221 > VARIANT <222>4 <223> Xaa = Asn, Tyr or Ser <220 <221 > VARIANT <222> 6 <223> Xaa = Phe, Ala or Asp <400 14

Lys Xaa Ser Xaa Arg Xaa Ser 1 5

<210> 15 <211>7 <212> PRT <213> Artificial Sequence <220> <223> Synthetically generated peptide <220> <221 > VARIANT <222> 1 <223> Xaa = Ser or Met <220> <221 > VARIANT <222> 3 <223> Xaa = Gly, Ser or Ala <220> <221 > VARIANT <222> 4 <223> Xaa = Ser or Thr <220> <221 > VARIANT <222> 5 <223> Xaa = His, Glu or Gin <220> <221 > VARIANT <222> 6 <223> Xaa = Phe, Trp or Leu <400> 15

Xaa Gin Xaa Xaa Xaa Xaa Pro 1 5

<210> 16 <211>7 <212> PRT <213> Artificial Sequence <220> <223> Synthetically generated peptide <220> <221 > VARIANT <222>3 <223> Xaa = Gly, Ser or Ala <220> <221 > VARIANT <222> 4 <223> Xaa = Ser, Ile or Thr <220> <221 > VARIANT <222> 5 <223> Xaa = His, Glu or Gin <400> 16

Ser Gin Xaa Xaa Xaa Phe Pro 1 5

<210> 17 <211> 102 <212> PRT <213> Artificial Sequence <220> <223> Synthetically generated peptide <400> 17

Asp Ile Val Met Thr Gin Thr Pro Leu Ser Leu Pro Val Thr Pro Gly 15 10 15

Glu Pro Ala Ser Ile Ser Cys Arg Ser Ser Gin ser Leu Val ser ser 20 25 30

Lys Gly Asn Thr Tyr Leu His Trp Tyr Leu Gin Lys Pro Gly Gin ser 35 40 45

Pro Gin Leu Leu Ile Tyr Lys Val Ser Asn Arg Phe Ser Gly Val Pro 50 55 60

Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile 65 70 75 80

Ser Arg Val Glu Ala Glu Asp Val Gly Val Tyr Tyr Cys Ser Gin Ser 85 90 95

Thr His Phe Pro Arg Thr 100

<210> 18 <211> 102 <212> PRT <213> Artificial Sequence <220> <223> Synthetically generated peptide <400> 18

Asp Ile Val Met Thr Gin Thr Pro Leu Ser Leu Pro Val Thr Pro Gly 15 10 15

Glu Pro Ala Ser Ile Ser Cys Arg Ser Ser Gin Ser Leu Val Ser Ser 20 25 30

Lys Gly Asn Thr Tyr Leu His Trp Tyr Leu Gin Lys Pro Gly Gin Ser 35 40 45

Pro Gin Leu Leu Ile Tyr Lys Val Ser Asn Arg Phe Ser Gly Val Pro 50 55 60

Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile 65 70 75 80

Ser Arg Val Glu Ala Glu Asp Val Gly Val Tyr Tyr Cys Ser Gin Ser 85 90 95

Thr His Phe Pro Arg Thr 100

<210> 19 <211> 102 <212> PRT <213> Artificial Sequence <220> <223> Synthetically generated peptide <400> 19

Asp Val Val Met Thr Gin Ser Pro Leu Ser Leu Pro Val Thr Leu Gly 15 10 15

Gin Pro Ala Ser Ile Ser cys Arg Ser Ser Gin ser Leu Val ser ser 20 25 30

Lys Gly Asn Thr Tyr Leu His Trp Phe Gin Gin Arg Pro Gly Gin ser 35 40 45

Pro Arg Arg Leu Ile Tyr Lys Val Ser Asn Arg Phe Ser Gly Val Pro 50 55 60

Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile 65 70 75 80

Ser Arg Val Glu Ala Glu Asp Val Gly Val Tyr Tyr Cys Ser Gin Ser 85 90 95

Thr His Phe Pro Arg Thr 100

<210> 20 <211> 102 <212> PRT <213> Artificial Sequence <220> <223> Synthetically generated peptide <400> 20

Asp Val Val Met Thr Gin Ser Pro Leu Ser Leu Pro Val Thr Leu Gly 15 10 15

Gin Pro Ala Ser Ile Ser Cys Arg Ser Ser Gin Ser Leu Val Ser Ser 20 25 30

Lys Gly Asn Thr Tyr Leu His Trp Phe Gin Gin Arg Pro Gly Gin Ser 35 40 45

Pro Arg Arg Leu Ile Tyr Lys Val Ser Asn Arg Phe Ser Gly Val Pro 50 55 60

Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile 65 70 75 80

Ser Arg Val Glu Ala Glu Asp Val Gly Val Tyr Tyr Cys Ser Gin Ser 85 90 95

Thr His Phe Pro Arg Thr 100

<210 21 <211> 102 <212> PRT <213> Artificial Sequence <220> <223> Synthetically generated peptide <400> 21

Asp Ile Val Met Thr Gin Thr Pro Leu Ser Leu Ser Val Thr Pro Gly 15 10 15

Gin Pro Ala Ser Ile Ser Cys Arg Ser Ser Gin ser Leu Val ser ser 20 25 30

Lys Gly Asn Thr Tyr Leu His Trp Tyr Leu Gin Lys Pro Gly Gin ser 35 40 45

Pro Gin Leu Leu Ile Tyr Lys Val Ser Asn Arg Phe Ser Gly Val Pro 50 55 60

Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile 65 70 75 80

Ser Arg Val Glu Ala Glu Asp Val Gly Val Tyr Tyr Cys Ser Gin Ser 85 90 95

Thr His Phe Pro Arg Thr 100

<210> 22 <211> 102 <212> PRT <213> Artificial Sequence <220> <223> Synthetically generated peptide <400> 22

Asp Ile Val Met Thr Gin Thr Pro Leu Ser Leu Ser Val Thr Pro Gly 15 10 15

Gin Pro Ala Ser Ile Ser Cys Arg Ser Ser Gin Ser Leu Val ser Ser 20 25 30

Lys Gly Asn Thr Tyr Leu His Trp Tyr Leu Gin Lys Pro Gly Gin Pro 35 40 45

Pro Gin Leu Leu Ile Tyr Lys Val Ser Asn Arg Phe Ser Gly Val Pro 50 55 60

Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile 65 70 75 80

Ser Arg Val Glu Ala Glu Asp Val Gly Val Tyr Tyr Cys ser Gin ser 85 90 95

Thr His Phe Pro Arg Thr 100

<210> 23 <211> 102 <212> PRT <213> Artificial Sequence <220> <223> Synthetically generated peptide <400> 23

Asp Ile Val Met Thr Gin Ser Pro Leu ser Leu Pro Val Thr Pro Gly 15 10 15

Glu Pro Ala Ser Ile Ser Cys Arg Ser ser Gin ser Leu Val ser ser 20 25 30

Lys Gly Asn Thr Tyr Leu His Trp Tyr Leu Gin Lys Pro Gly Gin ser 35 40 45

Pro Gin Leu Leu Ile Tyr Lys Val ser Asn Arg Phe ser Gly Val Pro 50 55 60

Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile 65 70 75 80

Ser Arg Val Glu Ala Glu Asp Val Gly Val Tyr Tyr Cys Ser Gin Ser 85 90 95

Thr His Phe Pro Arg Thr 100

<210> 24 <211> 102 <212> PRT <213> Artificial Sequence <220> <223> Synthetically generated peptide <400> 24

Asp Ile Val Met Thr Gin Ser Pro Leu Ser Leu Pro Val Thr Pro Gl y 15 10 15

Glu Pro Ala Ser Ile Ser Cys Arg Ser Ser Gin Ser Leu Val ser Ser 20 25 30

Lys Gl y Asn Thr Tyr Leu His Trp Tyr Leu Gin Lys Pro Gl y Gin Ser 35 40 45

Pro Gin Leu Leu Ile Tyr Lys Val Ser Asn Arg Phe Ser Gl y Val Pro 50 55 60

Asp Arg Phe ser Gl y ser Gl y Ser Gl y Thr Asp Phe Thr Leu Lys Ile 65 70 75 80

Ser Arg Val Glu Ala Glu Asp Val Gl y Val Tyr Tyr Cys Ser Gin Ser 85 90 95

Thr His Phe Pro Arg Thr 100

<210> 25 <211> 102 <212> PRT <213> Artificial Sequence <220> <223> Synthetically generated peptide <400> 25

Asp Ile Val Met Thr Gin Thr Pro Leu Ser Ser Pro Val Thr Leu Gly 15 10 15

Gin Pro Ala ser Ile Ser cys Arg Ser Ser Gin ser Leu Val ser ser 20 25 30

Lys Gly Asn Thr Tyr Leu His Trp Leu Gin Gin Arg Pro Gly Gin Pro 35 40 45

Pro Arg Leu Leu Ile Tyr Lys Val Ser Asn Arg Phe ser Gly Val Pro 50 55 60

Asp Arg Phe Ser Gly Ser Gly Ala Gly Thr Asp Phe Thr Leu Lys Ile 65 70 75 80

Ser Arg Val Glu Ala Glu Asp Val Gly Val Tyr Tyr Cys Ser Gin Ser 85 90 95

Thr His Phe Pro Arg Thr 100

<210> 26 <211> 102 <212> PRT <213> Artificial Sequence <220> <223> Synthetically generated peptide <400> 26

Asp lie Gin Met Thr Gin Ser Pro Ser Ser Leu Ser Ala Ser Val Gly 15 10 15

Asp Arg Val Thr Ile Thr Cys Arg Ser Ser Gin Ser Leu Val Ser Ser 20 25 30

Lys Gly Asn Thr Tyr Leu His Trp Tyr Gin Gin Lys Pro Gly Lys Ala 35 40 45

Pro Lys Leu Leu Ile Tyr Lys Val Ser Asn Arg Phe Ser Gly Val Pro 50 55 60

Ser Arg Phe Ser Gly ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile 65 70 75 80

Ser Ser Leu Gin Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Ser Gin Ser 85 90 95

Thr His Phe Pro Arg Thr 100

<210> 27 <211> 110 <212> PRT <213> Artificial Sequence <220> <223> Synthetically generated peptide <400> 27

Gin Val Gin Leu Val Gin ser Gly Alá Glu Val Lys Lys Pro Gly Alá 15 10 15

Ser Val Lys Val ser Cys Lys Alá ser Gly Phe Thr Phe ser Arg Tyr 20 25 30

Ala Met ser Trp Val Arg Gin Ala Pro Gly Gin Gly Leu Glu Trp Met 35 40 45

Gly Glu lie Ser ser Gly Gly Ser Tyr Pro Tyr Tyr Pro Asp Thr Val 50 55 60

Thr Gly Arg Val Thr Met Thr Arg Asp Thr Ser lie Ser Thr Ala Tyr 65 70 75 80

Met Glu Leu Ser Arg Leu Arg Ser Asp Asp Thr Ala Val Tyr Tyr Cys 85 90 95

Ala Arg Val Leu Tyr Tyr Asp Tyr Asp Gly Asp Arg Ile Glu 100 105 110

<210> 28 <211 > 110 <212> PRT <213> Artificial Sequence <220> <223> Synthetically generated peptide <400> 28

Gin Val Gin Leu Val Gin Ser Gl y Ala Glu Val Lys Lys Pro Gly Al a 15 10 15

Ser Val Lys Val Ser Cys Lys Al a Ser Gly Phe Thr Phe Ser Arg Tyr 20 25 30

Ala Met Ser Trp Val Arg Gin Ala Pro Gly Gin Arg Leu Glu Trp Met 35 40 45

Gly Glu Ile Ser Ser Gly Gly Ser Tyr Pro Tyr Tyr Pro Asp Thr Val 50 55 60

Thr Gly Arg Val Thr Ile Thr Arg Asp Thr Ser Ala Ser Thr Ala Tyr 65 70 75 80

Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95

Ala Arg Val Leu Tyr Tyr Asp Tyr Asp Gly Asp Arg Ile Glu 100 105 110

<210> 29 <211 > 110 <212> PRT <213> Artificial Sequence <220> <223> Synthetically generated peptide <400> 29

Gin Val Gin Leu Val Gin Ser Gly Alá Glu Val Lys Lys Pro Gly Alá 15 10 15

Ser Val Lys Val Ser Cys Lys Alá Ser Gly Phe Thr Phe Ser Arg Tyr 20 25 30

Ala Met Ser Trp Val Arg Gin Ala Thr Gly Gin Gly Leu Glu Trp Met 35 40 45

Gly Glu Ile Ser Ser Gly Gly Ser Tyr Pro Tyr Tyr Pro Asp Thr Val 50 55 60

Thr Gly Arg Val Thr Met Thr Arg Asn Thr ser Ile ser Thr Alá Tyr 65 70 75 80

Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95

Ala Arg Val Leu Tyr Tyr Asp Tyr Asp Gly Asp Arg Ile Glu 100 105 110

<210> 30 <211 > 110 <212> PRT <213> Artificial Sequence <220> <223> Synthetically generated peptide <400> 30

Gin val Gin Leu Val Gin Ser Gl y Ala Glu Val Lys Lys Pro Gly Al a 15 10 15

Ser val Lys Val Ser Cys Lys Al a Ser Gly Phe Thr Phe Ser Arg Tyr 20 25 30

Ala Met Ser Trp Val Arg Gin Ala Pro Gly Gin Gly Leu Glu Trp Met 35 40 45

Gly Glu Ile Ser Ser Gly Gly Ser Tyr Pro Tyr Tyr Pro Asp Thr Val 50 55 60

Thr Gly Arg Val Thr Met Thr Thr Asp Thr Ser Thr Ser Thr Ala Tyr 65 70 75 80

Met Glu Leu Arg Ser Leu Arg Ser Asp Asp Thr Ala Val Tyr Tyr Cys 85 90 95

Ala Arg Val Leu Tyr Tyr Asp Tyr Asp Gly Asp Arg Ile Glu 100 105 110

<210 31 <211 > 110 <212> PRT <213> Artificial Sequence <220> <223> Synthetically generated peptide <400> 31

Gin Val Gin Leu Val Gin ser Gly Ala Glu Val Lys Lys Pro Gly Ala 15 10 15

Ser val Lys Val Ser Cys Lys Val ser Gly Phe Thr Phe Ser Arg Tyr 20 25 30

Ala Met Ser Trp Val Arg Gin Ala Pro Gly Lys Gly Leu Glu Trp Met 35 40 45

Gly Glu lie Ser Ser Gly Gly Ser Tyr Pro Tyr Tyr Pro Asp Thr Val 50 55 60

Thr Gly Arg Val Thr Met Thr Glu Asp Thr ser Thr Asp Thr Ala Tyr 65 70 75 80

Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95

Ala Thr Val Leu Tyr Tyr Asp Tyr Asp Gly Asp Arg île Glu 100 105 110

<210> 32 <211 > 110 <212> PRT <213> Artificial Sequence <220> <223> Synthetically generated peptide <400> 32

Gin Met Gin Leu Val Gin Ser Gl y Ala Glu Val Lys Lys Thr Gly ser 15 10 15 ser Val Lys Val Ser Cys Lys Al a ser Gly Phe Thr Phe ser Arg Tyr 20 25 30

Ala Met Ser Trp Val Arg Gin Ala Pro Gly Gin Ala Leu Glu Trp Met 35 40 45

Gly Glu lie Ser Ser Gly Gly ser Tyr Pro Tyr Tyr Pro Asp Thr Val 50 55 60

Thr Gly Arg Val Thr Ile Thr Arg Asp Arg ser Met ser Thr Ala Tyr 65 70 75 80

Met Glu Leu Ser Ser Leu Arg ser Glu Asp Thr Ala Met Tyr Tyr Cys 85 90 95

Ala Arg Val Leu Tyr Tyr Asp Tyr Asp Gly Asp Arg Ile Glu 100 105 110

<210> 33 <211> 110 <212> PRT <213> Artificial Sequence <220> <223> Synthetically generated peptide <400> 33

Gin Val Gin Leu Val Gin Ser Gly Alá Glu Val Lys Lys Pro Gly Alá 15 10 15

Ser Val Lys Val Ser Cys Lys Alá Ser Gly Phe Thr Phe Ser Arg Tyr 20 25 30

Ala Met Ser Trp Val Arg Gin Ala Pro Gly Gin Gly Leu Glu Trp Met 35 40 45

Gly Glu lie Ser Ser Gly Gly ser Tyr Pro Tyr Tyr Pro Asp Thr Val 50 55 60

Thr Gly Arg Val Thr Met Thr Arg Asp Thr ser Thr ser Thr Val Tyr 65 70 75 80

Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95

Ala Arg Val Leu Tyr Tyr Asp Tyr Asp Gly Asp Arg Ile Glu 100 105 110

<210> 34 <211 > 108 <212> PRT <213> Artificial Sequence <220> <223> Synthetically generated peptide <400> 34

Gin Met Gin Leu Val Gin ser Gly Pro Glu Val Lys Lys Pro Gly Thr 15 10 15

Ser Val Lys Val Ser cys Lys Alá Ser Gly Phe Thr Phe Ser Arg Tyr 20 25 30

Ala Met Ser Trp Val Arg Gin Arg Gin Arg Leu Glu Trp Ile Gly Glu 35 40 45

Ile Ser Ser Gly Gly ser Tyr Pro Tyr Tyr Pro Asp Thr val Thr Gly 50 55 60

Arg Val Thr Ile Thr Arg Asp Met Ser Thr Ser Thr Alá Tyr Met Glu 65 70 75 80

Leu Ser Ser Leu Arg ser Glu Asp Thr Ala Val Tyr Tyr cys Ala Alá 85 90 95

Val Leu Tyr Tyr Asp Tyr Asp Gly Asp Arg Ile Glu 100 105

<210> 35 <211 > 110 <212> PRT <213> Artificial Sequence <220> <223> Synthetically generated peptide <400> 35

Glu Val Gin Leu Val Glu Ser Gly Gly Gly Leu Val Gin Pro Gly Gly 15 10 15

Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Arg Tyr 20 25 30

Ala Met Ser Trp Val Arg Gin Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45

Ala Glu Ile Ser Ser Gly Gly Ser Tyr Pro Tyr Tyr Pro Asp Thr Val 50 55 60

Thr Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr 65 70 75 80

Leu Gin Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95

Ala Arg Val Leu Tyr Tyr Asp Tyr Asp Gly Asp Arg Ile Glu 100 105 110

<210> 36 <211 > 111 <212> PRT <213> Artificial Sequence <220> <223> Synthetically generated peptide <400> 36

Glu Val Gin Leu Val Glu Ser Gly Gly Gly Leu Val Gin Pro Gly Arg 15 10 15

Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Arg Tyr 20 25 30

Ala Met Ser Trp Val Arg Gin Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45

Ser Glu Ile Ser Ser Gly Gly Ser Tyr Pro Tyr Tyr Pro Asp Thr Val 50 55 60

Thr Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr 65 70 75 80

Leu Gin Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Leu Tyr Tyr Cys 85 90 95

Ala Lys Asp Val Leu Tyr Tyr Asp Tyr Asp Gly Asp Arg Ile Glu 100 105 110

<210> 37 <211 > 110 <212> PRT <213> Artificial Sequence <220> <223> Synthetically generated peptide <400 37

Gin Val Gin Leu Val Glu Ser Gly Gly Gly Leu Val Lys Pro Gly Gly 15 10 15

Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Arg Tyr 20 25 30

Ala Met Ser Trp Ile Arg Gin Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45

Ser Glu Ile Ser Ser Gly Gly Ser Tyr Pro Tyr Tyr Pro Asp Thr Val 50 55 60

Thr Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr 65 70 75 80

Leu Gin Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95

Ala Arg Val Leu Tyr Tyr Asp Tyr Asp Gly Asp Arg Ile Glu 100 105 110

<210> 38 <211 > 110 <212> PRT <213> Artificial Sequence <220> <223> Synthetically generated peptide <400> 38

Glu Val Gin Leu Val Glu ser Gly Gly Gly Leu Val Lys Pro Gly Gly 15 10 15

Ser Leu Arg Leu Ser cys Ala Ala ser Gly Phe Thr Phe Ser Arg Tyr 20 25 30

Ala Met ser Trp val Arg Gin Ala Pro Gly Lys Gly Leu Glu Trp val 35 40 45

Gly Glu lie Ser Ser Gly Gly Ser Tyr Pro Tyr Tyr Pro Asp Thr Val 50 55 60

Thr Gly Arg Phe Thr Ile ser Arg Asp Asp Ser Lys Asn Thr Leu Tyr 65 70 75 80

Leu Gin Met Asn Ser Leu Lys Thr Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95

Thr Thr Val Leu Tyr Tyr Asp Tyr Asp Gly Asp Arg Ile Glu 100 105 110

<210> 39 <211> 110 <212> PRT <213> Artificial Sequence <220> <223> Synthetically generated peptide <400> 39

Glu Val Gin Leu Val Glu Ser Gly Gly Gly Val Val Arg Pro Gl y Gl y 15 10 15

Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Arg Tyr 20 25 30

Ala Met Ser Trp Val Arg Gin Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45

Ser Glu Ile Ser Ser Gly Gly Ser Tyr Pro Tyr Tyr Pro Asp Thr Val 50 55 60

Thr Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr 65 70 75 80

Leu Gin Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Leu Tyr His Cys 85 90 95

Ala Arg Val Leu Tyr Tyr Asp Tyr Asp Gly Asp Arg Ile Glu 100 105 110

<210> 40 <211 > 110 <212> PRT <213> Artificial Sequence <220> <223> Synthetically generated peptide <400> 40

Glu Val Gin Leu Val Glu Ser Gly Gly Gly Leu Val Lys Pro Gly Gly 15 10 15

Ser Leu Arg Leu Ser Cys Al a Al a Ser Gly Phe Thr Phe Ser Arg Tyr 20 25 30

Ala Met Ser Trp Val Arg Gin Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45

Ser Glu lie Ser Ser Gly Gly Ser Tyr Pro Tyr Tyr Pro Asp Thr Val 50 55 60

Thr Gly Arg Phe Thr Ile Ser Arg Asp Asn Alá Lys Asn ser Leu Tyr 65 70 75 80

Leu Gin Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr cys 85 90 95

Al a Arg Val Leu Tyr Tyr Asp Tyr Asp Gly Asp Arg Ile Glu 100 105 110

<210> 41 <211 > 110 <212> PRT <213> Artificial Sequence <220> <223> Synthetically generated peptide <400> 41

Glu Val Gin Leu Leu Glu Ser Gly Gly Gly Leu Val Gin Pro Gly Gly 15 10 15

Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Arg Tyr 20 25 30

Ala Met Ser Trp Val Arg Gin Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45

Ser Glu Ile Ser Ser Gly Gly Ser Tyr Pro Tyr Tyr Pro Asp Thr Val 50 55 60

Thr Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr 65 70 75 80

Leu Gin Met Asn Ser Leu Arg Ala Glu Asp Thr Al a Val Tyr Tyr Cys 85 90 95

Al a Lys Val Leu Tyr Tyr Asp Tyr Asp Gly Asp Arg Ile Glu 100 105 110

<210> 42 <211 > 110 <212> PRT <213> Artificial Sequence <220> <223> Synthetically generated peptide <400> 42

Gin Val Gin Leu Val Glu Ser Gly Gly Gly Val Val Gin Pro Gly Arg 15 10 15

Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Arg Tyr 20 25 30

Ala Met Ser Trp Val Arg Gin Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45

Ala Glu Ile Ser Ser Gly Gly Ser Tyr Pro Tyr Tyr Pro Asp Thr Val 50 55 60

Thr Gly Arg Phe Thr Ile Ser Arg Asp Asn ser Lys Asn Thr Leu Tyr 65 70 75 80

Leu Gin Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95

Ala Lys Val Leu Tyr Tyr Asp Tyr Asp Gly Asp Arg Ile Glu 100 105 110

<210> 43 <211> 110 <212> PRT <213> Artificial Sequence <220> <223> Synthetically generated peptide <400> 43

Gin Val Gin Leu Val Glu Ser Gly Gly Gly Val Val Gin Pro Gly Arg 15 10 15

Ser Leu Arg Leu ser cys Ala Ala ser Gly Phe Thr Phe ser Arg Tyr 20 25 30

Ala Met Ser Trp Val Arg Gin Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45

Ala Glu Ile Ser Ser Gly Gly Ser Tyr Pro Tyr Tyr Pro Asp Thr Val 50 55 60

Thr Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr 65 70 75 80

Leu Gin Met Asn Ser Leu Arg Ala Glu Asp Thr Al a Val Tyr Tyr Cys 85 90 95

Al a Arg Val Leu Tyr Tyr Asp Tyr Asp Gly Asp Arg Ile Glu 100 105 110

<210> 44 <211 > 110 <212> PRT <213> Artificial Sequence <220> <223> Synthetically generated peptide <400> 44

Gin Val Gin Leu Val Glu Ser Gly Gly Gly Val Val Gin Pro Gly Arg 15 10 15

Ser Leu Arg Leu Ser Cys Ala Ala ser Gly Phe Thr Phe ser Arg Tyr 20 25 30

Ala Met Ser Trp Val Arg Gin Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45

Ala Glu Ile Ser Ser Gly Gly Ser Tyr Pro Tyr Tyr Pro Asp Thr Val 50 55 60

Thr Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr 65 70 75 80

Leu Gin Met Asn ser Leu Arg Ala Glu Asp Thr Ala val Tyr Tyr Cys 85 90 95

Ala Lys Val Leu Tyr Tyr Asp Tyr Asp Gly Asp Arg Ile Glu 100 105 110

<210> 45 <211 > 110 <212> PRT <213> Artificial Sequence <220> <223> Synthetically generated peptide <400> 45

Gin Val Gin Leu Val Glu Ser Gly Gly Gly Val Val Gin Pro Gly Arg 15 10 15

Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Arg Tyr 20 25 30

Ala Met Ser Trp Val Arg Gin Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45

Ala Glu Ile Ser Ser Gly Gly Ser Tyr Pro Tyr Tyr Pro Asp Thr Val 50 55 60

Thr Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr 65 70 75 80

Leu Gin Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95

Ala Arg Val Leu Tyr Tyr Asp Tyr Asp Gly Asp Arg Ile Glu 100 105 110 <210> 46

<211 > 111 <212> PRT <213> Artificial Sequence <220 <223> Synthetically generated peptide <400 46

Glu Val Gin Leu Val Glu Ser Gl y Gl y Val Val Val Gin Pro Gly Gly 15 10 15

Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Arg Tyr 20 25 30

Ala Met Ser Trp Val Arg Gin Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45

Ser Glu Ile Ser Ser Gly Gly Ser Tyr Pro Tyr Tyr Pro Asp Thr Val 50 55 60

Thr Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Ser Leu Tyr 65 70 75 80

Leu Gin Met Asn Ser Leu Arg Thr Glu Asp Thr Ala Leu Tyr Tyr Cys 85 90 95

Ala Lys Asp Val Leu Tyr Tyr Asp Tyr Asp Gly Asp Arg Ile Glu 100 105 110

<210> 47 <211 > 110 <212> PRT <213> Artificial Sequence <220> <223> Synthetically generated peptide <400> 47

Glu Val Gin Leu Val Glu ser Gly Gly Gly Leu Val Gin Pro Gly Gly 15 10 15

Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Arg Tyr 20 25 30

Ala Met Ser Trp Val Arg Gin Al a Pro Gly Lys Gly Leu Glu Trp Val 35 40 45

Ser Glu Ile Ser Ser Gly Gly Ser Tyr Pro Tyr Tyr Pro Asp Thr Val 50 55 60

Thr Gly Arg Phe Thr Ile Ser Arg Asp Asn Al a Lys Asn Ser Leu Tyr 65 70 75 80

Leu Gin Met Asn Ser Leu Arg Asp Glu Asp Thr Al a Val Tyr Tyr Cys 85 90 95

Al a Arg Val Leu Tyr Tyr Asp Tyr Asp Gly Asp Arg Ile Glu 100 105 110

<210> 48 <211> 110 <212> PRT <213> Artificial Sequence <220> <223> Synthetically generated peptide <400> 48

Glu Val Gin Leu Val Glu Ser Gly Gly Gly Leu Val Gin Pro Gly Arg 15 10 15

Ser Leu Arg Leu Ser Cys Thr Ala Ser Gly Phe Thr Phe Ser Arg Tyr 20 25 30

Ala Met Ser Trp Phe Arg Gin Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45

Gly Glu Ile Ser Ser Gly Gly Ser Tyr Pro Tyr Tyr Pro Asp Thr Val 50 55 60

Thr Gly Arg Phe Thr Ile Ser Arg Asp Gly Ser Lys Ser Ile Ala Tyr 65 70 75 80

Leu Gin Met Asn Ser Leu Lys Thr Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95

Thr Arg Val Leu Tyr Tyr Asp Tyr Asp Gly Asp Arg Ile Glu 100 105 110

<210> 49 <211 > 110 <212> PRT <213> Artificial Sequence <220> <223> Synthetically generated peptide <400> 49

Glu Val Gin Leu Val Glu Ser Gly Gly Gly Leu Val Gin Pro Gly Gly 15 10 15

Ser Leu Arg Leu Ser Cys Al a Al a Ser Gly Phe Thr Phe Ser Arg Tyr 20 25 30

Ala Met Ser Trp Val Arg Gin Ala Pro Gly Lys Gly Leu Glu Tyr Val 35 40 45

Ser Glu lie Ser Ser Gly Gly ser Tyr Pro Tyr Tyr Pro Asp Thr Val 50 55 60

Thr Gly Arg Phe Thr Ile ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr 65 70 75 80

Leu Gin Met Gly Ser Leu Arg Ala Glu Asp Met Ala Val Tyr Tyr Cys 85 90 95

Ala Arg Val Leu Tyr Tyr Asp Tyr Asp Gly Asp Arg Ile Glu 100 105 110 <210> 50 <211 > 125 <212> PRT <213> Mus musculus <400> 50

Glu Val Gin Leu Val Glu Ser Gly Gly Gly Leu Val Arg Pro Gl y Gl y 15 10 15

Ser Leu Lys Leu Phe Cys Ala Ala Ser Gly Phe Thr Phe Ser Arg Tyr 20 25 30

Ala Met Ser Trp Val Arg Gin Ser Pro Glu Lys Arg Leu Glu Trp Val 35 40 45

Ala Glu Ile Ser Ser Gly Gly Ser Tyr Pro Tyr Tyr Pro Asp Thr Val 50 55 60

Thr Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Leu Tyr 65 70 75 80

Leu Glu Met Ser Ser Leu Lys Ser Glu Asp Thr Ala Met Tyr Tyr Cys 85 90 95

Ala Arg Val Leu Tyr Tyr Asp Tyr Asp Gly Asp Arg Ile Glu Val Met 100 105 110

Asp Tyr Trp Gly Gin Gly Thr Ala Val Ile Val Ser Ser 115 120 125 <210> 51 <211> 112 <212> PRT <213> Mus musculus <400> 51

Asp Val Val Met Thr Gin Ser Pro Leu Ser Leu Ser Val Ser Leu Gly 15 10 15

Asp Gin Ala Ser Ile Ser Cys Arg Ser Ser Gin Ser Leu Val Ser Ser 20 25 30

Lys Gly Asn Thr Tyr Leu His Trp Tyr Leu Gin Lys Pro Gly Gin Ser 35 40 45

Pro Lys Phe Leu Ile Tyr Lys Val Ser Asn Arg Phe Ser Gly Val Pro 50 55 60

Asp Arg Phe Ser Gly ser Gly ser Gly Thr Asp Phe Thr Leu Lys Ile 65 70 75 80

Ser Arg Val Ala Ala Glu Asp Leu Gly Val Tyr Phe Cys ser Gin ser 85 90 95

Thr His Phe Pro Arg Thr Phe Gly Gly Gly Thr Thr Leu Glu Ile Lys 100 105 110 <210> 52 <211 > 125 <212> PRT <213> Homo sapiens <400 52

Glu Val Gin Leu Val Glu Ser Gly Gly Gly Leu Val Gin Pro Gly Gly 15 10 15

Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30

Trp Met Ser Trp Val Arg Gin Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45

Ala Asn Ile Lys Gin Asp Gly Ser Glu Lys Tyr Tyr Val Asp Ser Val 50 55 60

Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr 65 70 75 80

Leu Gin Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95

Ala Arg Asp Pro Met Thr Thr Val Val Lys Pro Ser Leu Ala Thr Asn 100 105 110

Asp Tyr Trp Gly Gin Gly Thr Leu Val Thr Val Ser Ser 115 120 125 <210> 53 <211> 112

<212> PRT <213> Homo sapiens <400> 53

Asp Val Val Met Thr Gin Ser Pro Leu Ser Leu Pro Val Thr Pro Gly 15 10 15

Glu Pro Ala Ser Ile Ser Cys Arg Ser Ser Gin Ser Leu Leu His Ser 20 25 30

Asn Gly Tyr Asn Tyr Leu Asp Trp Tyr Leu Gin Lys Pro Gly Gin Ser 35 40 45

Pro Gin Leu Leu Ile Tyr Leu Gly Ser Asn Arg Ala Ser Gly Val Pro 50 55 60

Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile 65 70 75 80

Ser Arg Val Glu Ala Glu Asp Val Gly Val Tyr Tyr Cys Met Gin Ala 85 90 95

Leu Gin Thr Pro Leu Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys 100 105 110 <210> 54 <211 > 125 <212> PRT <213> Mus musculus <400 54

Glu Val Gin Leu Val Glu Ser Gly Gly Gly Leu Val Arg Pro Gly Gly 15 10 15

Ser Leu Lys Leu Phe Cys Ala Ala Ser Gly Phe Thr Phe ser Arg Tyr 20 25 30

Ala Met Ser Trp Val Arg Gin Ser Pro Glu Lys Arg Leu Glu Trp Val 35 40 45

Ala Glu Ile Ser Ser Gly Gly Ser Tyr Pro Tyr Tyr Pro Asp Thr Val 50 55 60

Thr Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Leu Tyr 65 70 75 80

Leu Glu Met Ser Ser Leu Lys Ser Glu Asp Thr Ala Met Tyr Tyr Cys 85 90 95

Ala Arg Val Leu Tyr Tyr Asp Tyr Asp Gly Asp Arg Ile Glu Val Met 100 105 110

Asp Tyr Trp Gly Gin Gly Thr Ala Val Ile Val Ser Ser 115 120 125 <210> 55 <211 > 125 <212> PRT <213> Homo sapiens <400> 55

Glu Val Gin Leu Val Glu Ser Gly Gly Gly Leu Val Gin Pro Gly Gly 15 10 15

Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30

Trp Met Ser Trp Val Arg Gin Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45

Ala Asn Ile Lys Gin Asp Gly Ser Glu Lys Tyr Tyr Val Asp Ser Val 50 55 60

Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr 65 70 75 80

Leu Gin Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95

Ala Arg Asp Pro Met Thr Thr Val Val Lys Pro Ser Leu Ala Thr Asn 100 105 110

Asp Tyr Trp Gl y Gin Gl y Thr Leu Val Thr Val Ser Ser 115 120 125 <210> 56 <211> 112 <212> PRT <213> Mus musculus <400> 56

Asp Val Val Met Thr Gin Ser Pro Leu Ser Leu Ser Val Ser Leu Gl y 15 10 15

Asp Gin Ala Ser Ile ser cys Arg ser ser Gin ser Leu val ser ser 20 25 30

Lys Gl y Asn Thr Tyr Leu His Trp Tyr Leu Gin Lys Pro Gl y Gin Ser 35 40 45

Pro Lys Phe Leu Ile Tyr Lys Val Ser Asn Arg Phe Ser Gl y Val Pro 50 55 60

Asp Arg Phe Ser Gl y Ser Gl y Ser Gl y Thr Asp Phe Thr Leu Lys Ile 65 70 75 80

Ser Arg Val Ala Ala Glu Asp Leu Gly Val Tyr Phe Cys Ser Gin Ser 85 90 95

Thr His Phe Pro Arg Thr Phe Gly Gly Gly Thr Thr Leu Glu Ile Lys 100 105 110 <210> 57 <211 > 112 <212> PRT <213> Homo sapiens <400 57

Asp Val Val Met Thr Gin Ser Pro Leu Ser Leu Pro Val Thr Pro Gly 15 10 15

Glu Pro Ala Ser Ile Ser cys Arg Ser Ser Gin Ser Leu Leu His Ser 20 25 30

Asn Gly Tyr Asn Tyr Leu Asp Trp Tyr Leu Gin Lys Pro Gly Gin Ser 35 40 45

Pro Gin Leu Leu Ile Tyr Leu Gly Ser Asn Arg Ala Ser Gly Val Pro 50 55 60

Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile 65 70 75 80

Ser Arg Val Glu Ala Glu Asp Val Gly Val Tyr Tyr Cys Met Gin Ala 85 90 95

Leu Gin Thr Pro Leu Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys 100 105 110 <210> 58 <211 > 125 <212> PRT <213> Homo sapiens <400> 58

Glu Val Gin Leu Val Glu Ser Gly Gly Gly Leu Val Gin Pro Gly Gly 15 10 15

Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30

Trp Met Ser Trp Val Arg Gin Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45

Ala Asn Ile Lys Gin Asp Gly Ser Glu Lys Tyr Tyr Val Asp Ser Val 50 55 60

Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr 65 70 75 80

Leu Gin Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95

Ala Arg Asp Pro Met Thr Thr Val Val Lys Pro Ser Leu Ala Thr Asn 100 105 110

Asp Tyr Trp Gly Gin Gly Thr Leu Val Thr Val Ser Ser 115 120 125

<210> 59 <211 > 125 <212> PRT <213> Artificial Sequence <220> <223> Synthetically generated peptide <400> 59

Glu Val Gin Leu Val Glu Ser Gly Gly Gly Leu Val Gin Pro Gly Gly 15 10 15

Ser Leu Arg Leu Ser cys Ala Ala Ser Gly Phe Thr Phe Ser Arg Tyr 20 25 30

Ala Met Ser Trp Val Arg Gin Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45

Ala Glu Ile Ser Ser Gly Gly Ser Tyr Pro Tyr Tyr Pro Asp Thr Val 50 55 60

Thr Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr 65 70 75 80

Leu Gin Met Asn Ser Leu Arg Ala Glu Asp Thr Ala val Tyr Tyr Cys 85 90 95

Ala Arg Val Leu Tyr Tyr Asp Tyr Asp Gly Asp Arg Ile Glu Val Met 100 105 110

Asp Tyr Trp Gly Gin Gly Thr Leu Val Thr Val Ser Ser 115 120 125 <210> 60 <211 > 112 <212> PRT <213> Homo sapiens <400> 60

Asp Val Val Met Thr Gin Ser Pro Leu Ser Leu Pro Val Thr Pro Gl y 15 10 15

Glu Pro Ala Ser Ile Ser Cys Arg Ser Ser Gin Ser Leu Leu His Ser 20 25 30

Asn Gl y Tyr Asn Tyr Leu Asp Trp Tyr Leu Gin Lys Pro Gl y Gin Ser 35 40 45

Pro Gin Leu Leu Ile Tyr Leu Gl y Ser Asn Arg Ala Ser Gl y Val Pro 50 55 60

Asp Arg Phe Ser Gl y Ser Gl y Ser Gl y Thr Asp Phe Thr Leu Lys Ile 65 70 75 80

Ser Arg Val Glu Ala Glu Asp Val Gl y Val Tyr Tyr Cys Met Gin Ala 85 90 95

Leu Gin Thr Pro Leu Thr Phe Gl y Gl y Gly Thr Lys Val Glu Ile Lys 100 105 110

<210> 61 <211> 111 <212> PRT <213> Artificial Sequence <220 <223> Synthetically generated peptide <400 61

Asp Val Val Met Thr Gin Ser Pro Leu Ser Leu Pro Val Thr Pro Gl y 15 10 15

Glu Pro Ala Ser Ile Ser Cys Arg Ser Ser Gin Ser Leu Val Ser Ser 20 25 30

Lys Gl y Asn Thr Tyr Leu His Trp Tyr Leu Gin Lys Pro Gl y Gin Ser 35 40 45

Pro Gin Phe Leu Ile Tyr Lys Val Ser Asn Arg Phe Ser Gl y Val Pro 50 55 60

Asp Arg Phe Ser Gly ser Gly ser Gly Thr Asp Phe Thr Leu Lys Ile 65 70 75 80

Ser Arg Val Glu Ala Glu Asp Val Gly Val Tyr Cys ser Gin ser Thr 85 90 95

His Phe Pro Arg Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys 100 105 110 <210> 62 <211 > 112 <212> PRT <213> Homo sapiens <400> 62

Asp Val Val Met Thr Gin Ser Pro Leu Ser Leu Pro Val Thr Pro Gly 15 10 15

Glu Pro Ala ser Ile Ser Cys Arg Ser Ser Gin Ser Leu Leu His Ser 20 25 30

Asn Gly Tyr Asn Tyr Leu Asp Trp Tyr Leu Gin Lys Pro Gly Gin Ser 35 40 45

Pro Gin Leu Leu Ile Tyr Leu Gly Ser Asn Arg Ala Ser Gly Val Pro 50 55 60

Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile 65 70 75 80

Ser Arg Val Glu Ala Glu Asp Val Gly Val Tyr Tyr Cys Met Gin Ala 85 90 95

Leu Gin Thr Pro Leu Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys 100 105 110

<210> 63 <211> 112 <212> PRT <213> Artificial Sequence <220 <223> Synthetically generated peptide <400 63

Asp Val Val Met Thr Gin Ser Pro Leu Ser Leu Pro Val Thr Pro Gly 15 10 15

Glu Pro Ala Ser Ile Ser Cys Arg Ser Ser Gin Ser Leu Val Ser Ser 20 25 30

Lys Gly Asn Thr Tyr Leu His Trp Tyr Leu Gin Lys Pro Gly Gin Ser 35 40 45

Pro Gin Leu Leu Ile Tyr Lys Val ser Asn Arg Phe ser Gly Val Pro 50 55 60

Asp Arg Phe ser Gly ser Gly ser Gly Thr Asp Phe Thr Leu Lys Ile 65 70 75 80

Ser Arg Val Glu Ala Glu Asp Val Gly Val Tyr Tyr Cys ser Gin ser 85 90 95

Thr His Phe Pro Arg Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys 100 105 110

<210> 64 <211 >454 <212> PRT <213> Artificial Sequence <220> <223> Synthetically generated peptide <400> 64

Glu Val Gin Leu Val Glu Ser Gly Gly Gly Leu Val Gin Pro Gly Gly 15 10 15

Ser Leu Arg Leu Ser Cys Al a Al a Ser Gly Phe Thr Phe Ser Arg Tyr 20 25 30

Ala Met Ser Trp Val Arg Gin Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45

Ala Glu Ile Ser Ser Gly Gly Ser Tyr Pro Tyr Tyr Pro Asp Thr Val 50 55 60

Thr Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr 65 70 75 80

Leu Gin Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95

Ala Arg Val Leu Tyr Tyr Asp Tyr Asp Gly Asp Arg Ile Glu Val Met 100 105 110

Asp Tyr Trp Gly Gin Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr 115 120 125

Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser 130 135 140

Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu 145 150 155 160

Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His 165 170 175

Thr Phe Pro Ala Val Leu Gin Ser Ser Gly Leu Tyr ser Leu ser ser 180 185 190

Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gin Thr Tyr Ile Cys 195 200 205

Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu 210 215 220

Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro 225 230 235 240

Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys 245 250 255

Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val 260 265 270

Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp 275 280 285

Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gin Tyr 290 295 300

Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gin Asp 305 310 315 320

Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu 325 330 335

Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gin Pro Arg 340 345 350

Glu Pro Gin Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys 355 360 365

Asn Gin Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp 370 375 380

Ile Ala Val Glu Trp Glu Ser Asn Gly Gin Pro Glu Asn Asn Tyr Lys 385 390 395 400

Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser 405 410 415

Lys Leu Thr Val Asp Lys Ser Arg Trp Gin Gin Gly Asn Val Phe Ser 420 425 430

Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gin Lys Ser 435 440 445

Leu Ser Leu Ser Pro Gly 450

<210> 65 <211> 98 <212> PRT <213> Artificial Sequence <220> <223> Synthetically generated peptide <400> 65

Glu Val Gin Leu Val Glu ser Gly Gly Gly Leu Val Gin Pro Gly Gly 15 10 15 ser Leu Arg Leu Ser Cys Ala Alá ser Gly Phe Thr Phe ser Arg Tyr 20 25 30

Ala Met Ser Trp Val Arg Gin Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45

Ala Glu lie Ser Ser Gly Gly ser Tyr Pro Tyr Tyr Pro Asp Thr Val 50 55 60

Thr Gly Arg Phe Thr Ile ser Arg Asp Asn Ala Lys Asn ser Leu Tyr 65 70 75 80

Leu Gin Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95

Ala Arg

<210> 66 <211> 219 <212> PRT <213> Artificial Sequence <220> <223> Synthetically generated peptide <400> 66

Asp Val Val Met Thr Gin ser Pro Leu ser Leu Pro Val Thr Pro Gly 15 10 15

Glu Pro Ala Ser lie ser Cys Arg ser ser Gin ser Leu Val ser ser 20 25 30

Lys Gly Asn Thr Tyr Leu His Trp Tyr Leu Gin Lys Pro Gly Gin ser 35 40 45

Pro Gin Phe Leu Ile Tyr Lys Val ser Asn Arg Phe ser Gly Val Pro 50 55 60

Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile 65 70 75 80

Ser Arg Val Glu Ala Glu Asp Val Gly Val Tyr Phe Cys Ser Gin Ser 85 90 95

Thr His Phe Pro Arg Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys 100 105 110

Arg Thr Val Ala Alá Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu 115 120 125

Gin Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe 130 135 140

Tyr Pro Arg Glu Ala Lys Val Gin Trp Lys Val Asp Asn Al a Leu Gin 145 150 155 160

Ser Gly Asn Ser Gin Glu Ser Val Thr Glu Gin Asp Ser Lys Asp Ser 165 170 175

Thr Tyr Ser Leu Ser ser Thr Leu Thr Leu Ser Lys Al a Asp Tyr Glu 180 185 190

Lys His Lys Val Tyr Al a Cys Glu Val Thr His Gin Gly Leu ser ser 195 200 205

Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys 210 215

<210> 67 <211 > 100 <212> PRT <213> Artificial Sequence <220> <223> Synthetically generated peptide <400> 67

Asp Val Val Met Thr Gin Ser Pro Leu Ser Leu Pro Val Thr Pro Gl y 15 10 15

Glu Pro Ala Ser Ile ser Cys Arg Ser Ser Gin Ser Leu Val Ser Ser 20 25 30

Lys Gl y Asn Thr Tyr Leu His Trp Tyr Leu Gin Lys Pro Gl y Gin Ser 35 40 45

Pro Gin Phe Leu Ile Tyr Lys Val Ser Asn Arg Phe Ser Gl y Val Pro 50 55 60

Asp Arg Phe Ser Gl y ser Gl y Ser Gl y Thr Asp Phe Thr Leu Lys Ile 65 70 75 80

Ser Arg Val Glu Ala Glu Asp Val Gl y Val Tyr Phe Cys ser Gin ser 85 90 95

Thr His Phe Pro 100

<210> 68 <211> 219 <212> PRT <213> Artificial Sequence <220 <223> Synthetically generated peptide <400 68

Asp Val Val Met Thr Gin ser Pro Leu ser Leu Pro Val Thr Pro Gly 15 10 15

Glu Pro Ala Ser île ser Cys Arg ser ser Gin ser Leu Val ser ser 20 25 30

Lys Gly Asn Thr Tyr Leu His Trp Tyr Leu Gin Lys Pro Gly Gin ser 35 40 45

Pro Gin Leu Leu Ile Tyr Lys Val ser Asn Arg Phe ser Gly Val Pro 50 55 60

Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile 65 70 75 80

Ser Arg Val Glu Ala Glu Asp Val Gly Val Tyr Tyr cys Ser Gin Ser 85 90 95

Thr His Phe Pro Arg Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys 100 105 110

Arg Thr Val Ala Ala Pro ser Val Phe Ile Phe Pro Pro ser Asp Glu 115 120 125

Gin Leu Lys ser Gly Thr Ala ser Val Val Cys Leu Leu Asn Asn Phe 130 135 140

Tyr Pro Arg Glu Ala Lys Val Gin Trp Lys Val Asp Asn Ala Leu Gin 145 150 155 160

Ser Gly Asn Ser Gin Glu ser Val Thr Glu Gin Asp ser Lys Asp ser 165 170 175

Thr Tyr Ser Leu Ser ser Thr Leu Thr Leu ser Lys Ala Asp Tyr Glu 180 185 190

Lys His Lys Val Tyr Ala Cys Glu Val Thr His Gin Gly Leu ser ser 195 200 205

Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys 210 215

<210> 69 <211 > 100 <212> PRT <213> Artificial Sequence <220> <223> Synthetically generated peptide <400> 69

Asp Val Val Met Thr Gin Ser Pro Leu Ser Leu Pro Val Thr Pro Gl y 15 10 15

Glu Pro Ala Ser Ile Ser Cys Arg Ser Ser Gin Ser Leu Val Ser Ser 20 25 30

Lys Gl y Asn Thr Tyr Leu His Trp Tyr Leu Gin Lys Pro Gl y Gin Ser 35 40 45

Pro Gin Leu Leu Ile Tyr Lys Val Ser Asn Arg Phe Ser Gl y Val Pro 50 55 60

Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile 65 70 75 80

Ser Arg Val Glu Ala Glu Asp Val Gly Val Tyr Phe Cys Ser Gin Ser 85 90 95

Thr His Phe Pro 100

Claims 1. An isolated protein that comprises a heavy chain variable domain sequence and a light chain variable domain sequence that can form an antigen binding site that binds to human TNF-like weak inducer of apoptosis (TWEAK), wherein the heavy chain variable domain sequence of the protein comprises framework regions that are at least 95% identical to the framework regions of the amino acid sequence set forth in SEQ ID NO: 59; and wherein the light chain variable domain sequence of the protein comprises framework regions that are at least 95% identical to the framework regions of the amino acid sequence set forth in SEQ ID NO: 61 or 63, and wherein the protein comprises the following complementarity determining regions (CDRs): CDRH1 consisting of the amino acid sequence: GFTFSRYAMS (SEQ ID NO: 1); CDRH2 consisting of the amino acid sequence: EISSGGSYPYYPDTVTG (SEQ ID NO: 2); CDRH3 consisting of the amino acid sequence: VLYYDYDGDRIEVMDY (SEQ ID NO: 3); CDRL1 consisting of the amino acid sequence: RSSQSLVSSKGNTYLH (SEQ ID NO: 8); CDRL2 consisting of the amino acid sequence: KVSNRFS (SEQ ID NO: 9); and CDRL3 consisting of the amino acid sequence: SQSTHFPRT (SEQ ID NO: 10). 2. The isolated protein of claim 1, wherein the light chain variable domain sequence of the protein comprises framework regions that are at least 95% identical to the amino acid sequence set forth in SEQ ID NO: 63. 3. The isolated protein of claim 1, wherein the heavy chain variable domain sequence of the protein comprises framework regions that are 100% identical to the framework regions of the amino acid sequence set forth in SEQ ID NO: 59. 4. The isolated protein of claim 1, wherein the light chain variable domain sequence of the protein comprises framework regions that are 100% identical to the framework regions of the amino acid sequence set forth in SEQ ID NO: 63. 5. The isolated protein of claim 1, wherein the heavy chain variable domain sequence comprises the amino acid sequence set forth in SEQ ID NO:59 and the light chain variable domain sequence comprises the amino acid sequence set forth in SEQ ID NO:61. 6. The isolated protein of claim 1, wherein the heavy chain variable domain sequence comprises the amino acid sequence set forth in SEQ ID NO:59 and the light chain variable domain sequence comprises the amino acid sequence set forth in SEQ ID NO:63. 7. The protein of any one of claims 1 to 6, wherein the protein is a full length antibody. 8. The protein of claim 7, wherein the antibody is an IgG 1. 9. The protein of any one of claims 1 to 8 that comprises a human Fc region or a human Fc region with three or fewer amino acid substitutions. 10. The protein of any one of claims 1 to 6, wherein the protein is a Fab, F(ab’)2, Fv, or scFv. 11. A pharmaceutical composition comprising a protein according to any one of claims 1 to 10 and a pharmaceutically acceptable carrier. 12. The protein of any one of claims 1 to 10 or the pharmaceutical composition of claim 11, for use as a medicament. 13. The protein of any one of claims 1 to 10 or the pharmaceutical composition of claim 11, for use in treating a disorder selected from the group consisting of: (a) an inflammatory or immune disorder; (b) a neuronal disorder, optionally a mechanical neuronal trauma, a neurodegenerative disorder or a neuronal disorder primarily characterized by destruction or death of nerve cells; (c) cachexia; (d) idiopathic pulmonary fibrosis; and (e) progressive muscular atrophy. 14. An isolated protein comprising a heavy chain variable domain sequence and a light chain variable domain sequence that can form an antigen binding site that binds to human TWEAK, wherein the heavy chain variable domain sequence comprises the following CDRs: CDRH1 consisting of the amino acid sequence: GFTFSRYAMS (SEQ ID NO: 1); CDRH2 consisting of the amino acid sequence: EISSGGSYPYYPDTVTG (SEQ ID NO: 2); and CDRH3 consisting of the amino acid sequence: VLYYDYDGDRIEVMDY (SEQ ID NO: 3); and wherein the light chain variable domain sequence comprises the following CDRs: CDRL1 consisting of the amino acid sequence: RSSQSLVSSKGNTYLH (SEQ ID NO: 8); CDRL2 consisting of the amino acid sequence: KVSNRFS (SEQ ID NO: 9); and CDRL3 consisting of the amino acid sequence: SQSTHFPRT (SEQ ID NO: 10), for use in treating a disorder selected from the group consisting of progressive muscular atrophy, cachexia, and idiopathic pulmonary fibrosis. 15. The protein for use according to claim 14, wherein the protein comprises a heavy chain comprising the amino acid sequence set forth in SEQ ID NO:64 and a light chain comprising the amino acid sequence set forth in SEQ ID NO:66 or 68. 16. A pharmaceutical composition comprising (i) the protein as defined in claim 14 or claim 15; and (ii) a pharmaceutically acceptable carrier, for use in treating a disorder selected from the group consisting of progressive muscular atrophy, cachexia, and idiopathic pulmonary fibrosis. 17. The protein for use according to any one of claims 13-15 or the pharmaceutical composition for use according to claim 13 or claim 16, wherein the disorder is progressive muscular atrophy. 18. The protein for use according to any one of claims 13-15 or the pharmaceutical composition for use according to claim 13 or claim 16, wherein the disorder is cachexia.

Patentansprüche 1. Isoliertes Protein, das einevariable Schwerkettendomäne-Sequenz und eine variable Leichtkettendomäne-Sequenz umfasst, das eine Antigen-bindende Stelle bilden kann, die sich an menschliche, TNF-artige schwache Apoptose-Erreger (TNF-like Weak Inducers of Apotosis - TWEAK) bindet, wobei die variable Schwerkettendomäne-Sequenz des Proteins Gerüstregionen umfasst, die zu wenigstens 95 % mit den Gerüstregionen der in SEQ ID NO: 59 dargestellten Aminosäuresequenz identisch sind; und wobei die variable Leichtkettendomäne-Sequenzdes Proteins Gerüstregionen umfasst, die zu wenigstens 95 % mit den Gerüstregionen der in SEQ ID NO: 61 oder 63 dargestellten

Aminosäuresequenz identisch sind, und wobei das Protein die folgenden Komplementaritäts-bestimmenden Regionen (Complementarity Determining Regions - CDRs) umfasst: CDRH1, bestehend aus der Aminosäuresequenz: GFTFSRYAMS (SEQ ID NO: 1); CDRH2, bestehend aus der Aminosäuresequenz: EISSGGSYPYYPDTVTG (SEQ ID NO: 2); CDRH3, bestehend aus der Aminosäuresequenz: VLYYDYDGDRIEVMDY (SEQ ID NO: 3); CDRL1, bestehend aus der Aminosäuresequenz: RSSQSLVSSKGNTYLH (SEQ ID NO: 8); CDRL2, bestehend aus der Aminosäuresequenz: KVNRFS (SEQ ID NO: 9); und CDRL3, bestehend aus der Aminosäuresequenz: SQSTHFPRT (SEQ ID NO: 10). 2. Isoliertes Protein nach Anspruch 1, wobei die variable Leichtkettendomäne-Sequenz des Proteins Gerüstregionen umfasst, die zu wenigstens 95 % mit der in SEQ ID NO: 63 dargestellten Aminosäuresequenz identisch sind. 3. Isoliertes Protein nach Anspruch 1, wobei die variable Schwerkettendomäne-Sequenz des Proteins Gerüstregionen umfasst, die zu 100 % mit den Gerüstregionen der in SEQ ID NO: 59 dargestellten Aminosäuresequenz identisch sind. 4. Isoliertes Protein nach Anspruch 1, wobei die variable Leichtkettendomäne-Sequenz des Proteins Gerüstregionen umfasst, die zu 100 % mit den Gerüstregionen der in SEQ ID NO: 63 dargestellten Aminosäuresequenzen identisch sind. 5. Isoliertes Protein nach Anspruch 1, wobei die variable Schwerkettendomäne-Sequenz die in SEQ ID NO: 59 dargestellte Aminosäuresequenz umfasst und die Leichtkettendomäne-Sequenz die in SEQ ID NO: 61 dargestellte Aminosäuresequenz umfasst. 6. Isoliertes Protein nach Anspruch 1, wobei die variable Schwerkettendomäne-Sequenz die in SEQ ID NO: 59 dargestellte Aminosäuresequenz umfasst und die Leichtkettendomäne-Sequenz die in SEQ ID NO: 63 dargestellte Aminosäuresequenz umfasst. 7. Protein nach einem der Ansprüche 1 bis 6, wobei das Protein ein Volllängenantikörper ist. 8. Protein nach Anspruch 7, wobei der Antikörper ein IgG 1 ist. 9. Protein nach einem der Ansprüche 1 bis 8, das eine menschliche Fc-Region oder eine menschliche Fc-Region mit drei oder weniger Aminosäuresubstitutionen umfasst. 10. Protein nach einem der Ansprüche 1 bis 6, wobei das Protein ein Fab, F(ab’)2, Fv oder scFv ist. 11. Pharmazeutische Zusammensetzung, die ein Protein nach einem der Ansprüche 1 bis 10 und einen pharmazeutisch unbedenklichen Trägerstoff umfasst. 12. Protein nach einem der Ansprüche 1 bis 10 oder pharmazeutische Zusammensetzung nach Anspruch 11 zur Verwendung als Medikament. 13. Protein nach einem der Ansprüche 1 bis 10 oder pharmazeutische Zusammensetzung nach Anspruch 11 zu Verwendung bei der Behandlung einer Erkrankung, die ausgewählt ist aus der Gruppe bestehend aus: (a) einer Entzündungserkrankung oder Immunerkrankung; (b) einer neuronalen Erkrankung, optional einem mechanischen neuronalen Trauma, einer neurodegenerativen

Erkrankung odereiner neuronalen Erkrankung, die primär durch die Zerstörung oder den Tod von Nervenzellen gekennzeichnet ist; (c) Kachexie; (d) idiopathischer pulmonaler Fibrose; und (e) progressiver Muskelatrophie. 14. Isoliertes Protein, umfassend eine variable Schwerkettendomäne-Sequenz und eine variable Leichtkettendomäne-Sequenz, das eine antigenbindende Stelle bilden kann, die sich an humanes TWEAK bindet, wobei die variable Schwerkettendomäne-Sequenz die folgenden CDRs umfasst: CDRH1, bestehend aus der Aminosäuresequenz: GFTFSRYAMS (SEQ ID NO: 1); CDRFI2, bestehend aus der Aminosäuresequenz: EISSGGSYPYYPDTVTG (SEQ ID NO: 2); und CDRH3, bestehend aus der Aminosäuresequenz: VLYYDYDGDRIEVMDY (SEQ ID NO: 3); und wobei die variable Leichtkettendomäne-Sequenz die folgenden CDRs umfasst: CDRL1, bestehend aus der Aminosäuresequenz: RSSQSLVSSKGNTYLH (SEQ ID NO: 8); CDRL2, bestehend aus der Aminosäuresequenz: KVNRFS (SEQ ID NO: 9); und CDRL3, bestehend aus der Aminosäuresequenz: SQSTHFPRT (SEQ ID NO: 10), zur Verwendung bei der Behandlung einer Erkrankung, die ausgewählt ist aus der Gruppe bestehend aus progressiver Muskelatrophie, Kachexie und idiopathischer pulmonaler Fibrose. 15. Protein zur Verwendung nach Anspruch 14, wobei das Protein eine variable Schwerkettendomäne-Sequenz enthält, welche die in SEQ ID NO: 64 dargestellte Aminosäuresequenz umfasst und eine Leichtkettendomäne-Sequenz, welche die in SEQ ID NO: 66 oder 68 dargestellte Aminosäuresequenz umfasst. 16. Pharmazeutische Zusammensetzung, umfassend (i) das Protein, wie in Anspruch 14 oder Anspruch 15 definiert; und (ii) einen pharmazeutisch unbedenklichen Trägerstoff, zur Verwendung bei der Behandlung einer Erkrankung, die ausgewählt ist aus der Gruppe bestehend aus progressiver Muskelatrophie, Kachexie und idiopathischer pulmonaler Fibrose. 17. Protein zur Verwendung nach einem der Ansprüche 13-15 oder pharmazeutische Zusammensetzung zur Verwendung nach Anspruch 13 oder Anspruch 16, wobei die Erkrankung progressive Muskelatrophie ist. 18. Protein zur Verwendung nach einem der Ansprüche 13-15 oder pharmazeutische Zusammensetzung zur Verwendung nach Anspruch 13 oder Anspruch 16, wobei die Erkrankung Kachexie ist.

Revendications 1. Protéine isolée qui comprend une séquence de domaine variable de chaîne lourde et une séquence de domaine variable de chaîne légère qui forment un site de liaison de l’antigène qui se lie à l’inducteur faible de l’apoptose de type TNF (TWEAK) humain, dans laquelle la séquence de domaine variable de chaîne lourde de la protéine comprend des régions charpentes qui sont au moins identiques à 95 % avec les régions charpentes de la séquence d’acides aminés représentée par la SEQ ID NO : 59 ; et dans laquelle la séquence de domaine variable de chaîne légère de la protéine comprend des régions charpentes qui sont au moins identiques à 95 % avec les régions charpentes de la séquence d’acides aminés représentée par la SEQ ID NO : 61 ou 63, et dans laquelle la protéine comprend les régions déterminant la complémentarité (CDR) suivantes : la CDRH1 constituée de la séquence d’acides aminés : GFTFSRYAMS (SEQ ID NO : 1) ; la CDRH2 constituée de la séquence d’acides aminés : EISSGGSYPYYPDTVTG (SEQ ID NO : 2) ; la CDRH3 constituée de la séquence d’acides aminés : VLYYDYDGDRIEVMDY (SEQ ID NO : 3) ; la CDRL1 constituée de la séquence d’acides aminés : RSSQSLVSSKGNTYLH (SEQ ID NO : 8) ; la CDRL2 constituée de la séquence d’acides aminés : KVSNRFS (SEQ ID NO : 9) ; et la CDRL3 constituée de la séquence d’acides aminés : SQSTHFPRT (SEQ ID NO : 10). 2. Protéine isolée selon la revendication 1, dans laquelle la séquence de domaine variable de chaîne légère de la protéine comprend des régions charpentes qui sont au moins identiques à 95 % avec la séquence d’acides aminés représentée par la SEQ ID NO : 63. 3. Protéine isolée selon la revendication 1, dans laquelle la séquence de domaine variable de chaîne lourde de la protéine comprend des régions charpentes qui sont identiques à 100 % avec les régions charpentes de la séquence d’acides aminés représentée par la SEQ ID NO : 59. 4. Protéine isolée selon la revendication 1, dans laquelle la séquence de domaine variable de chaîne légère de la protéine comprend des régions charpentes qui sont au moins identiques à 100 % avec les régions charpentes de la séquence d’acides aminés représentée par la SEQ ID NO : 63. 5. Protéine isolée selon la revendication 1, dans laquelle la séquence de domaine variable de chaîne lourde comprend la séquence d’acides aminés représentée par la SEQ ID NO : 59 et la séquence de domaine variable de chaîne légère comprend la séquence d’acides aminés représentée par la SEQ ID NO : 61. 6. Protéine isolée selon la revendication 1, dans laquelle la séquence de domaine variable de chaîne lourde comprend la séquence d’acides aminés représentée par la SEQ ID NO : 59 et la séquence de domaine variable de chaîne légère comprend la séquence d’acides aminés représentée par la SEQ ID NO : 63. 7. Protéine selon l’une quelconque des revendications 1 à 6, dans laquelle la protéine est un anticorps pleine longueur. 8. Protéine selon la revendication 7, dans laquelle l’anticorps est une lgG1. 9. Protéine selon l’une quelconque des revendications 1 à 8 qui comprend une région Fc humaine ou une région Fc humaine avec trois substitutions d’acides aminés ou moins. 10. Protéine selon l’une quelconque des revendications 1 à 6, dans laquelle la protéine est un Fab, F(ab’)2, Fvou scFv. 11. Composition pharmaceutique comprenant une protéine selon l’une quelconque des revendications 1 à 10 et un support pharmaceutiquement acceptable. 12. Protéine selon l’une quelconque des revendications 1 à 10 ou composition pharmaceutique selon la revendication 11, pour une utilisation en tant que médicament. 13. Protéine selon l’une quelconque des revendications 1 à 10 ou composition pharmaceutique selon la revendication 11, pour une utilisation dans le traitement d’un trouble choisi dans le groupe constitué de : (a) un trouble inflammatoire ou immunitaire ; (b) un trouble neuronal, éventuellement un traumatisme neuronal mécanique, un trouble neurodégénératif ou un trouble neuronal principalement caractérisé par la destruction ou la mort des cellules nerveuses ; (c) la cachexie ; (d) la fibrose pulmonaire idiopathique ; et (e) l’atrophie musculaire progressive. 14. Protéine isolée comprenant une séquence de domaine variable de chaîne lourde et une séquence de domaine variable de chaîne légère qui peuvent former un site de liaison de l’antigène qui se lie au TWEAK humain, dans laquelle la séquence de domaine variable de chaîne lourde comprend les CDR suivantes : la CDRH1 constituée de la séquence d’acides aminés : GFTFSRYAMS (SEQ ID NO : 1) ; la CDRH2 constituée de la séquence d’acides aminés : EISSGGSYPYYPDTVTG (SEQ ID NO : 2) ; et la CDRH3 constituée de la séquence d’acides aminés : VLYYDYDGDRIEVMDY (SEQ ID NO : 3) ; et dans laquelle la séquence de domaine variable de chaîne légère comprend les CDR suivantes : la CDRL1 constituée de la séquence d’acides aminés : RSSQSLVSSKGNTYLH (SEQ ID NO : 8) ; la CDRL2 constituée de la séquence d’acides aminés : KVSNRFS (SEQ ID NO : 9) ; et la CDRL3 constituée de la séquence d’acides aminés : SQSTHFPRT (SEQ ID NO : 10), pour une utilisation dans le traitement d’un trouble choisi dans le groupe constitué de l’atrophie musculaire progressive, la cachexie, et la fibrose pulmonaire idiopathique. 15. Protéine pour une utilisation selon la revendication 14, dans laquelle la protéine comprend une chaîne lourde comprenant la séquence d’acides aminés représentée par la SEQ ID NO : 64 et une chaîne légère comprenant la séquence d’acides aminés représentée par la SEQ ID NO : 66 ou 68. 16. Composition pharmaceutique comprenant (i) la protéine telle que définie dans la revendication 14 ou la revendication 15 ; et (ii) un support pharmaceutiquement acceptable, pour une utilisation dans le traitement d’un trouble choisi dans le groupe constitué de l’atrophie musculaire progressive, la cachexie, et la fibrose pulmonaire idiopathique. 17. Protéine pour une utilisation selon l’une quelconque des revendications 13 à 15, ou composition pharmaceutique pour une utilisation selon la revendication 13 ou la revendication 16, dans laquelle le trouble est l’atrophie musculaire progressive. 18. Protéine pour une utilisation selon l’une quelconque des revendications 13 à 15, ou composition pharmaceutique pour une utilisation selon la revendication 13 ou la revendication 16, dans laquelle le trouble est la cachexie.

Claims

I. tóois-i): ms«# laAsPssb 33$?;mkésmc variét;! ss sssss^i; és ggjf:::kéanÿ|4âïiy vanâfciâiÿ 1 'W 4>·~<ς· xi '5 A «' A JxV i.nUt's' x? « k'"1 ' Ci V? s'i!« J S5ç^ '•‘K' V ' S* ! „ - asoptàc^ind-ivicrnoc ; îvvtAK'; kAïOi# anoi s imsNse mmAmc v^fssöihs oom^nsseK^f-u^M oïvVïn \ V tV< '\ 55. Ix k5 x 5 ?>χ·ΐ»χ <X < '' '«S'· ri x ' V ' c cl * » ' \0 " 5< y \ x ' '< χ ix "'*> χχ \ a ' 5" îC , V \ 'ί, X N * ' ' ο 0 x 0' k*'v„x χ ' 5, V χ ' \ χχ 3' ' \'' X 5: \Λ ir-ii^ \ „ ^ i S ' ΐ\ Μ ο " χ χ χ \ " 5" 5 'Vx' xCOixx'* ' *' kv x-5 v:g me« a isî'asfjo g Kkmkkèè k'i:T;îs:i"g:??:·ggiggi frseqbia&as* icgiőkaí. (CHR'i «kNal-rsacm V ''S'"' ' *'5 χ ' ’’f-C'v'' '“''s' A» si Cî «ix xi x ' SX^x X 5 Αχ 5χ s 3* ' X 3x''“* X'f 1' Ap'>: 'V' , X ' »xix X ï'kv, ï,i'i>:'x >>t > ί Ι'-'Ο x ' '> χ·- ' Vív X tx-VMs.") gbÜ !;> Νχ> -X' XX?··'X 3 »"mm, 'ί-ϊκχΑΓο'Χ' ‘ X 5°ΝΙ 1 C' '-ky ,.5g χΧ'Χ,'χχΧχΧΧχϊ.'ίΧΤ';; -. ,,-X C !,.' NO ciXy-gi'· ,VWCS; ^ i'“'X ? X'' 5 gx XiXX_X ô^xiîx'kx V^'1 ‘ X " ' !x - Ά’ xi- ' 5 ,' 3 CS #£#1# SfTiéiy as SOATHPOOÏ filll|5íNÖSí0} |, Λ s| X X ' 5 < ' '* * x X x X X X 'C'Aj^JxVï X * t' X X "<Xî'x XX"' X' X ' v3CSi:-3;oi'x'âÎ 'x3ft«!n.SÄ, «ineSy<-K '«^assfcKi «OO Om as-snosak a SEQ ID NO XX «»mí: ssssvíí;>;=3v· kcs-k'vâxciâvai X. AxC. i igéfíyponí i-mm;! ïgoîsH xOxx akxi .g Ιϊ,-βΑΓ}«· riohs?.X«<5c v-anàb««?. me-mso-AxO-xia;« 'S!V«‘ »5 5' 5' x">x ' 0 Ό ' χ'χΧΐ " '"- ï x k XX « >» ‘ "X x-x X x 5"x ^ Màsvà%mv&. 4 '\x ' ixkix' x!- " ! -5χΧ' X xX 5 ; VÏiiXe ï À! -S le ï ' kx«it>»x.'ix»î>x 'xxâBxS'i.'! «χ ;X:''3!'3Ct-!"x<'"-xi5 p,- v s;t"?g -m; îkxax 5" g' - - xg\ !CCg χ'χγκϊ\ ' s= ΑΓ0 U> ίχΟ C.' ccabx .^«-νΐ^ν «t'*'"*''’ "Amgitest gi Az î :gèî'yoosî sï«ri?"! -îoîsIï fahöisö. ghgi a nehs^âris vaxäsxki? «of^sS'Xkv^csa a 6ΓΐΟ IC ^ a"®naiî &iï5!fv>fxÎx'-sï&kva{x,:è? g;sXa!:xx;-;-|x gj. 3 ho^nyüíé^ vaxébilO ik^kkcgxgkvxgcx; a ?ÆQ *C Nv' SS-SBikil gkXXC'gSx' iXgkviîAikXÎ SkiXikî'igkig é. As ; iSjà'sypk-xÎ Sííiíiii'xí: ic-jisll feheisîî. ai>s; a íXíhéxkUAi'í vaíistilO dOfkOx-kskv&noa a i>VJ i5.C5-'!if'tí «ί5·;Igcik;·k-sggkggnciat tsXakï;g:¾;. gs is vxíiáblils dixîîàîikcekvxfx.k; 3 SEO Si.s skX::«5·: axkXkxSV 'xkakv'xXkk X; XiitaÍAiaCkk :¾ A.f !-*. x*k x ' x~x ' ΑΧ x x < ♦ x 5 ï xi X X ί x «S ' x\ \xV ·< '* ' 6. A : sÉSlSi® |«v: Sq{?í 1. S. A;·: 'ϊ·~δ. «asypcrkoix Xá-'n-iSlyik« scgihtl lahjsss·. isi-i^ài-i Pc ikKiiOí vagy «gv 5^555-=-- ->s -- \5'k553k'l'C x'' 'ix'kx55 χ,Ί 'S fe ' ίχχ « 'gt xixxSv'^xii1 «1x1 Έ ii jix't :1D, A:·? !··€ igér«y»05;tok: b;k;n«lyike &ísíí?>;í ah<;l a íehikiS Fao Fv ^#V scFv' II. Cy%v&s«{is£s5ll sié&a-s?5:ény::. «φ «g: 1-5¾. igisaypoïvok kscviaíyike s£*?ialí ffelspaMI *" oy;kiyscíííá;5:í«íiik!;5 «H?09ó«r5a$ó fcos<!ß*f*>& ^ 12. :.AK, ;-Kk igásviiorlok bár^slyke 3»;«··ηΕ fanàf«* vís«v 3 :1:;1:kIcjélwösrit323fkAl gyógys^íkáscai: kéök*·''·'^ gyágyíxiísrikkil: vsíó inii-B^iúáh;*. 13 A:·1 A-10 «gîàî'yiXiCxiok klfggkvikg sgi·«:;:;; fgi:éî;-k vagy & il igéayüös^ sc^-íaíí <jyö9y3Sg|íi iaisíí.ilAlÁAl' · a«áí:Oi csopoítixil választod residslitrií^s&íjQf;» ^¾¾)¾^ v;>;g feifxíai:aai!k5:rí.:· « 'V Î 'ï S X 3 y ('X J X ssSs-j _______ w xxlyáíS «b; lasgs íkíxleiíekskgsyik gsott asaifeöfi ri-Sxli^gika? ΐ«3β§« tfa^asa f'ayikxiiAIA-asískv 1:;ί:0:;>&;ϊ<· vatiy s.··-··' klOk «gkdisíkíiikkgkg 3»bs* ehASijikaii Sí.; ii'®íPíááv ksay Aifiigyhlssá laUa.awK: PPéPAisii ...... Λ" (4) IdsslpASiás kiéáíiibiíökis és: x«; piy.'Qí-'-íSi.'jciv :;g.\kik;gx/adák IÁk: ilA^ipt leAége. :A3*;y b-rtaliïiaic egy «^«ίχ^ί^,. dossé« skbkvíbkká· ég «ay kcApú?áí'c idSâïSSbt,A:3íSky«Sí5Si3t.:: âii^diysÎï ciyktïk iíJk·;:js>?:ko?i£.helyííi tss«B«k alííOEí':! sm#:3:MlbM !ikssiJ m "·^ η pop tó ο tó rvx A tód o:1 tóttóRAR; któotók aotó s aohoRâno vaoáctó:; dóókéosóíeHksostó is köveiké,:tó CDR-:skai timaknaoaa CDRH 1. ssfsxtóy a GFTP SR /AMS (SStó äO RO: · i saanftó smiraasav^ekvöroátKsí &k : CDRHv sov-ly so któSGGoYkVYRDTVTG iSYQ :0 ND: 2> k.oîork aotótóaevtóAskyseoatótó áa. «S CDRHi. anavy a VkYtóDktóOtóíApv'tóOY' ;;>Rö k) Rö; :i; aoiartó ívr.tóoaavtótósky-tóctóöás ai;: ék íRjsSs RliOknyOiO vatósbitós dötótóvsaetóar!:::·;:;; ;s tóAstótótó COR-Otób ieslsaaokiks ODRL1. araky a;: RSSCsSLVSSKGHTYl.kï <5ΕΟ tp RO: §;j ovonaa savtóso-savasvokvonetóbó: Ok. CDRl.2; aratók a k'V-SNRr-S -ocG ID NC>. tó svédét: a:Tnoosav-a;:0:v*octóbo: af Os GÔRLl: aastóy aa SOSÏHFPR1 ;8EO :0 RO '0} aaebeb aaskeseavAkekyeodOx,: ál agy móRépósióssijg kektóPáébes: ytóo RYhRslÓtóRtóS, ómtóy à k4vístó>?tó> ítótóioRötó ytóssOötó: pes3«:saa<v itóaósaavadas. oaotósstó éo itóogáMa uaktóbíóató IS. Aa 14, któoyaooi aa-jend fotóitóastóksasa eaad ieoéstó. as:tó a tódtól a SSO iO tó> Sa aaaaab aas>aoaav-aaaavesidâï tabakns-ab oehtóiOxtób: tó; :s SRO ;D 00. 66 vagy Só aaetótó aastóavtóvaaekNtóató.M tóbtótóoab któtóytóáosbtó ás;, tfk Övdayeaoróaató.! Itóaktósviny. «mdy 4 kátósRosklbíS áss.: Π; s 14. vagy -6 tgOsyoxnbaa rasxdsiOoaot; leasees sia {i tótó gyitóyaoatósssssílsg s&ligaítóaió notósm agy ísstóáfenasság ksstólséóso vgtó Itóássafsátóaia, ssastóy a kövíRtósaS sssopofibéí esRayaioii; ptógassaepv btós'asonasdás;. dRcbdós: ét Haara-Rtó tótótódióató 17. A 1 1S vtóaypafsktó btóeestóka sasoens; tótóasskptódsas saátó tóbskv: vagy a 10, ysgy 10: igóoyponí kaoretó fetóasKtósásrs sssni gyogyàaaak kèsssfesiéïsy/ghai a rasxtóitómsaég a piASiassysv tósosaosvasláa,
18. A látótól yéoyíx-aask stóí'asdyvp .sase'tób tótóssaastótóssrp -sais;;* tósstóH- -vagy :s 13. vagy 16. ayeoypssa; s-aedrA fsilóbabtódtób avant gyc$gy;ss.an:; kOskkassse·;. «hoi a ívsnsktóeaassaOk a csscs'otós