EP1569683B1 - Modified natriuretic compounds, conjugates, and uses thereof - Google Patents
Modified natriuretic compounds, conjugates, and uses thereof Download PDFInfo
- Publication number
- EP1569683B1 EP1569683B1 EP03812053A EP03812053A EP1569683B1 EP 1569683 B1 EP1569683 B1 EP 1569683B1 EP 03812053 A EP03812053 A EP 03812053A EP 03812053 A EP03812053 A EP 03812053A EP 1569683 B1 EP1569683 B1 EP 1569683B1
- Authority
- EP
- European Patent Office
- Prior art keywords
- natriuretic compound
- natriuretic
- conjugates
- lys
- bnp
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Expired - Lifetime
Links
- 150000001875 compounds Chemical class 0.000 title claims abstract description 217
- 230000001452 natriuretic effect Effects 0.000 title claims abstract description 208
- 239000002934 diuretic Substances 0.000 title claims abstract description 207
- 230000000694 effects Effects 0.000 claims abstract description 51
- 102100039339 Atrial natriuretic peptide receptor 1 Human genes 0.000 claims abstract description 31
- ZOOGRGPOEVQQDX-UUOKFMHZSA-N 3',5'-cyclic GMP Chemical compound C([C@H]1O2)OP(O)(=O)O[C@H]1[C@@H](O)[C@@H]2N1C(N=C(NC2=O)N)=C2N=C1 ZOOGRGPOEVQQDX-UUOKFMHZSA-N 0.000 claims abstract description 29
- 230000027455 binding Effects 0.000 claims abstract description 26
- 238000004519 manufacturing process Methods 0.000 claims abstract description 26
- 238000011282 treatment Methods 0.000 claims abstract description 19
- 238000001990 intravenous administration Methods 0.000 claims abstract description 9
- 230000004936 stimulating effect Effects 0.000 claims abstract description 5
- 238000007920 subcutaneous administration Methods 0.000 claims abstract description 5
- 101710102163 Atrial natriuretic peptide receptor 1 Proteins 0.000 claims abstract 2
- 230000021615 conjugation Effects 0.000 claims description 85
- 125000000217 alkyl group Chemical group 0.000 claims description 25
- 239000003814 drug Substances 0.000 claims description 20
- 229920001515 polyalkylene glycol Polymers 0.000 claims description 17
- 230000008901 benefit Effects 0.000 claims description 16
- 239000008194 pharmaceutical composition Substances 0.000 claims description 15
- 108091005804 Peptidases Proteins 0.000 claims description 12
- 230000015556 catabolic process Effects 0.000 claims description 11
- 238000006731 degradation reaction Methods 0.000 claims description 11
- 239000004365 Protease Substances 0.000 claims description 10
- 125000003827 glycol group Chemical group 0.000 claims description 9
- 125000005647 linker group Chemical group 0.000 claims description 4
- 238000007918 intramuscular administration Methods 0.000 claims description 3
- 230000002035 prolonged effect Effects 0.000 claims description 3
- 230000007515 enzymatic degradation Effects 0.000 claims description 2
- 210000003722 extracellular fluid Anatomy 0.000 claims 2
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 claims 1
- 230000001746 atrial effect Effects 0.000 claims 1
- 206010019280 Heart failures Diseases 0.000 abstract description 40
- 206010007559 Cardiac failure congestive Diseases 0.000 abstract description 38
- 125000003275 alpha amino acid group Chemical group 0.000 abstract description 23
- 210000002216 heart Anatomy 0.000 abstract description 16
- 230000004087 circulation Effects 0.000 abstract description 8
- 238000002560 therapeutic procedure Methods 0.000 abstract description 6
- 239000000562 conjugate Substances 0.000 description 211
- XEKOWRVHYACXOJ-UHFFFAOYSA-N Ethyl acetate Chemical compound CCOC(C)=O XEKOWRVHYACXOJ-UHFFFAOYSA-N 0.000 description 128
- YMWUJEATGCHHMB-UHFFFAOYSA-N Dichloromethane Chemical compound ClCCl YMWUJEATGCHHMB-UHFFFAOYSA-N 0.000 description 123
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 121
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 105
- 108090000765 processed proteins & peptides Proteins 0.000 description 103
- 235000001014 amino acid Nutrition 0.000 description 100
- 229940024606 amino acid Drugs 0.000 description 98
- 238000006243 chemical reaction Methods 0.000 description 97
- 150000001413 amino acids Chemical class 0.000 description 95
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 90
- CSNNHWWHGAXBCP-UHFFFAOYSA-L Magnesium sulfate Chemical compound [Mg+2].[O-][S+2]([O-])([O-])[O-] CSNNHWWHGAXBCP-UHFFFAOYSA-L 0.000 description 64
- 239000000243 solution Substances 0.000 description 59
- 239000000203 mixture Substances 0.000 description 58
- ZMANZCXQSJIPKH-UHFFFAOYSA-N Triethylamine Chemical compound CCN(CC)CC ZMANZCXQSJIPKH-UHFFFAOYSA-N 0.000 description 57
- 101100455752 Caenorhabditis elegans lys-3 gene Proteins 0.000 description 56
- 108020001621 Natriuretic Peptide Proteins 0.000 description 54
- 102000004571 Natriuretic peptide Human genes 0.000 description 54
- 239000000692 natriuretic peptide Substances 0.000 description 54
- 229920001223 polyethylene glycol Polymers 0.000 description 52
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 50
- 235000019439 ethyl acetate Nutrition 0.000 description 49
- WYURNTSHIVDZCO-UHFFFAOYSA-N Tetrahydrofuran Chemical compound C1CCOC1 WYURNTSHIVDZCO-UHFFFAOYSA-N 0.000 description 44
- 239000003921 oil Substances 0.000 description 43
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 42
- 238000000034 method Methods 0.000 description 42
- 239000000377 silicon dioxide Substances 0.000 description 38
- 102000004196 processed proteins & peptides Human genes 0.000 description 35
- 125000001176 L-lysyl group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C([H])([H])C([H])([H])C([H])([H])C(N([H])[H])([H])[H] 0.000 description 33
- 108010038640 atrial natriuretic factor receptor A Proteins 0.000 description 33
- 229910052943 magnesium sulfate Inorganic materials 0.000 description 33
- UIIMBOGNXHQVGW-UHFFFAOYSA-M Sodium bicarbonate Chemical class [Na+].OC([O-])=O UIIMBOGNXHQVGW-UHFFFAOYSA-M 0.000 description 30
- 108090000623 proteins and genes Proteins 0.000 description 30
- 239000011541 reaction mixture Substances 0.000 description 29
- 235000018977 lysine Nutrition 0.000 description 28
- 238000006467 substitution reaction Methods 0.000 description 28
- 239000004472 Lysine Substances 0.000 description 27
- 238000004440 column chromatography Methods 0.000 description 27
- 102000004190 Enzymes Human genes 0.000 description 26
- 108090000790 Enzymes Proteins 0.000 description 26
- 229940088598 enzyme Drugs 0.000 description 26
- 102000004169 proteins and genes Human genes 0.000 description 26
- 239000000651 prodrug Substances 0.000 description 25
- 229940002612 prodrug Drugs 0.000 description 25
- 210000004027 cell Anatomy 0.000 description 24
- 235000018102 proteins Nutrition 0.000 description 24
- 238000003786 synthesis reaction Methods 0.000 description 23
- 230000015572 biosynthetic process Effects 0.000 description 22
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 21
- DTQVDTLACAAQTR-UHFFFAOYSA-N Trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-N 0.000 description 20
- 239000000047 product Substances 0.000 description 20
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 19
- 102000005962 receptors Human genes 0.000 description 19
- 108020003175 receptors Proteins 0.000 description 19
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 18
- 238000002330 electrospray ionisation mass spectrometry Methods 0.000 description 18
- 125000002059 L-arginyl group Chemical group O=C([*])[C@](N([H])[H])([H])C([H])([H])C([H])([H])C([H])([H])N([H])C(=N[H])N([H])[H] 0.000 description 17
- 238000003776 cleavage reaction Methods 0.000 description 17
- 210000001035 gastrointestinal tract Anatomy 0.000 description 17
- 238000004128 high performance liquid chromatography Methods 0.000 description 17
- 230000007017 scission Effects 0.000 description 17
- 239000004475 Arginine Substances 0.000 description 16
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 16
- 229920001184 polypeptide Polymers 0.000 description 16
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 15
- 229940079593 drug Drugs 0.000 description 15
- LMDZBCPBFSXMTL-UHFFFAOYSA-N 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide Chemical compound CCN=C=NCCCN(C)C LMDZBCPBFSXMTL-UHFFFAOYSA-N 0.000 description 14
- HEDRZPFGACZZDS-UHFFFAOYSA-N Chloroform Chemical compound ClC(Cl)Cl HEDRZPFGACZZDS-UHFFFAOYSA-N 0.000 description 14
- 150000001732 carboxylic acid derivatives Chemical class 0.000 description 14
- 238000003756 stirring Methods 0.000 description 14
- 230000004071 biological effect Effects 0.000 description 13
- 210000004899 c-terminal region Anatomy 0.000 description 13
- 229910000030 sodium bicarbonate Inorganic materials 0.000 description 13
- 101800000407 Brain natriuretic peptide 32 Proteins 0.000 description 12
- 241000700159 Rattus Species 0.000 description 12
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 12
- 238000003818 flash chromatography Methods 0.000 description 12
- 229920000642 polymer Polymers 0.000 description 12
- 238000000746 purification Methods 0.000 description 12
- NQTADLQHYWFPDB-UHFFFAOYSA-N N-Hydroxysuccinimide Chemical compound ON1C(=O)CCC1=O NQTADLQHYWFPDB-UHFFFAOYSA-N 0.000 description 11
- 102000035195 Peptidases Human genes 0.000 description 11
- 108010076504 Protein Sorting Signals Proteins 0.000 description 11
- 239000013543 active substance Substances 0.000 description 11
- -1 analogs Substances 0.000 description 11
- 238000002360 preparation method Methods 0.000 description 11
- 239000011780 sodium chloride Substances 0.000 description 11
- 108090000631 Trypsin Proteins 0.000 description 10
- 102000004142 Trypsin Human genes 0.000 description 10
- 230000006870 function Effects 0.000 description 10
- 239000011734 sodium Substances 0.000 description 10
- 239000007787 solid Substances 0.000 description 10
- 239000000126 substance Substances 0.000 description 10
- 239000012588 trypsin Substances 0.000 description 10
- 101800001288 Atrial natriuretic factor Proteins 0.000 description 9
- 101800001890 Atrial natriuretic peptide Proteins 0.000 description 9
- YXFVVABEGXRONW-UHFFFAOYSA-N Toluene Chemical compound CC1=CC=CC=C1 YXFVVABEGXRONW-UHFFFAOYSA-N 0.000 description 9
- PFYXSUNOLOJMDX-UHFFFAOYSA-N bis(2,5-dioxopyrrolidin-1-yl) carbonate Chemical compound O=C1CCC(=O)N1OC(=O)ON1C(=O)CCC1=O PFYXSUNOLOJMDX-UHFFFAOYSA-N 0.000 description 9
- NSQLIUXCMFBZME-MPVJKSABSA-N carperitide Chemical compound C([C@H]1C(=O)NCC(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@H](C(NCC(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CSSC[C@@H](C(=O)N1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)=O)[C@@H](C)CC)C1=CC=CC=C1 NSQLIUXCMFBZME-MPVJKSABSA-N 0.000 description 9
- 230000008878 coupling Effects 0.000 description 9
- 238000010168 coupling process Methods 0.000 description 9
- 238000005859 coupling reaction Methods 0.000 description 9
- 238000003780 insertion Methods 0.000 description 9
- 230000037431 insertion Effects 0.000 description 9
- 230000017854 proteolysis Effects 0.000 description 9
- HPNRHPKXQZSDFX-UHFFFAOYSA-N 2-[[2-[[2-[[2-[[2-[[6-amino-2-[[52-[[2-[[2-[[2-[[5-amino-2-[[2-[[2-[[6-amino-2-[[1-(2-amino-3-hydroxypropanoyl)pyrrolidine-2-carbonyl]amino]hexanoyl]amino]-4-methylsulfanylbutanoyl]amino]-3-methylbutanoyl]amino]-5-oxopentanoyl]amino]acetyl]amino]-3-hydroxypropanoyl]amino]acetyl]amino]-40-(4-aminobutyl)-49-benzyl-28-butan-2-yl-31,43-bis(3-carbamimidamidopropyl)-34-(carboxymethyl)-16,19,22,25-tetrakis(hydroxymethyl)-10-(2-methylpropyl)-37-(2-methylsulfanylethyl)-6,9,12,15,18,21,24,27,30,33,36,39,42,45,48,51-hexadecaoxo-1,2-dithia-5,8,11,14,17,20,23,26,29,32,35,38,41,44,47,50-hexadecazacyclotripentacontane-4-carbonyl]amino]hexanoyl]amino]-3-methylbutanoyl]amino]-4-methylpentanoyl]amino]-5-carbamimidamidopentanoyl]amino]-5-carbamimidamidopentanoyl]amino]-3-(1H-imidazol-5-yl)propanoic acid Chemical compound N1C(=O)C(NC(=O)CNC(=O)C(CO)NC(=O)CNC(=O)C(CCC(N)=O)NC(=O)C(NC(=O)C(CCSC)NC(=O)C(CCCCN)NC(=O)C2N(CCC2)C(=O)C(N)CO)C(C)C)CSSCC(C(=O)NC(CCCCN)C(=O)NC(C(C)C)C(=O)NC(CC(C)C)C(=O)NC(CCCNC(N)=N)C(=O)NC(CCCNC(N)=N)C(=O)NC(CC=2N=CNC=2)C(O)=O)NC(=O)CNC(=O)C(CC(C)C)NC(=O)CNC(=O)C(CO)NC(=O)C(CO)NC(=O)C(CO)NC(=O)C(CO)NC(=O)C(C(C)CC)NC(=O)C(CCCNC(N)=N)NC(=O)C(CC(O)=O)NC(=O)C(CCSC)NC(=O)C(CCCCN)NC(=O)C(CCCNC(N)=N)NC(=O)CNC(=O)C1CC1=CC=CC=C1 HPNRHPKXQZSDFX-UHFFFAOYSA-N 0.000 description 8
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 8
- 102400001282 Atrial natriuretic peptide Human genes 0.000 description 8
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 8
- 239000000556 agonist Substances 0.000 description 8
- 238000003556 assay Methods 0.000 description 8
- 239000008280 blood Substances 0.000 description 8
- 210000004369 blood Anatomy 0.000 description 8
- 239000000872 buffer Substances 0.000 description 8
- 239000003795 chemical substances by application Substances 0.000 description 8
- 238000010828 elution Methods 0.000 description 8
- 238000009472 formulation Methods 0.000 description 8
- 238000000338 in vitro Methods 0.000 description 8
- 239000007788 liquid Substances 0.000 description 8
- 229940054205 natrecor Drugs 0.000 description 8
- YLQBMQCUIZJEEH-UHFFFAOYSA-N tetrahydrofuran Natural products C=1C=COC=1 YLQBMQCUIZJEEH-UHFFFAOYSA-N 0.000 description 8
- FPQQSJJWHUJYPU-UHFFFAOYSA-N 3-(dimethylamino)propyliminomethylidene-ethylazanium;chloride Chemical compound Cl.CCN=C=NCCCN(C)C FPQQSJJWHUJYPU-UHFFFAOYSA-N 0.000 description 7
- 241000282465 Canis Species 0.000 description 7
- 108010050286 Dendroaspis natriuretic peptide Proteins 0.000 description 7
- 239000002202 Polyethylene glycol Substances 0.000 description 7
- 230000004913 activation Effects 0.000 description 7
- 230000001154 acute effect Effects 0.000 description 7
- 125000000539 amino acid group Chemical group 0.000 description 7
- 238000013459 approach Methods 0.000 description 7
- 235000018417 cysteine Nutrition 0.000 description 7
- 238000005516 engineering process Methods 0.000 description 7
- 238000002474 experimental method Methods 0.000 description 7
- 238000001727 in vivo Methods 0.000 description 7
- 230000004048 modification Effects 0.000 description 7
- 238000012986 modification Methods 0.000 description 7
- 230000000269 nucleophilic effect Effects 0.000 description 7
- 230000001225 therapeutic effect Effects 0.000 description 7
- SSHIXEILTLPAQT-WHFBIAKZSA-N Gln-Asp Chemical compound NC(=O)CC[C@H](N)C(=O)N[C@@H](CC(O)=O)C(O)=O SSHIXEILTLPAQT-WHFBIAKZSA-N 0.000 description 6
- 108010051815 Glutamyl endopeptidase Proteins 0.000 description 6
- MDCTVRUPVLZSPG-BQBZGAKWSA-N His-Asp Chemical compound OC(=O)C[C@@H](C(O)=O)NC(=O)[C@@H](N)CC1=CNC=N1 MDCTVRUPVLZSPG-BQBZGAKWSA-N 0.000 description 6
- KFZMGEQAYNKOFK-UHFFFAOYSA-N Isopropanol Chemical compound CC(C)O KFZMGEQAYNKOFK-UHFFFAOYSA-N 0.000 description 6
- 125000000010 L-asparaginyl group Chemical group O=C([*])[C@](N([H])[H])([H])C([H])([H])C(=O)N([H])[H] 0.000 description 6
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 6
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 6
- 125000000637 arginyl group Chemical class N[C@@H](CCCNC(N)=N)C(=O)* 0.000 description 6
- 230000001684 chronic effect Effects 0.000 description 6
- 238000012217 deletion Methods 0.000 description 6
- 230000037430 deletion Effects 0.000 description 6
- 239000000706 filtrate Substances 0.000 description 6
- 125000003630 glycyl group Chemical group [H]N([H])C([H])([H])C(*)=O 0.000 description 6
- 230000007062 hydrolysis Effects 0.000 description 6
- 238000006460 hydrolysis reaction Methods 0.000 description 6
- RAXXELZNTBOGNW-UHFFFAOYSA-N imidazole Natural products C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 6
- QARBMVPHQWIHKH-UHFFFAOYSA-N methanesulfonyl chloride Chemical compound CS(Cl)(=O)=O QARBMVPHQWIHKH-UHFFFAOYSA-N 0.000 description 6
- 230000035772 mutation Effects 0.000 description 6
- VLKZOEOYAKHREP-UHFFFAOYSA-N n-Hexane Chemical class CCCCCC VLKZOEOYAKHREP-UHFFFAOYSA-N 0.000 description 6
- 239000012044 organic layer Substances 0.000 description 6
- 230000000144 pharmacologic effect Effects 0.000 description 6
- 230000002829 reductive effect Effects 0.000 description 6
- 230000000717 retained effect Effects 0.000 description 6
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 5
- 102100034605 Atrial natriuretic peptide receptor 3 Human genes 0.000 description 5
- 102000012421 C-Type Natriuretic Peptide Human genes 0.000 description 5
- 101800000060 C-type natriuretic peptide Proteins 0.000 description 5
- 108090000087 Carboxypeptidase B Proteins 0.000 description 5
- 102000003670 Carboxypeptidase B Human genes 0.000 description 5
- 101000924488 Homo sapiens Atrial natriuretic peptide receptor 3 Proteins 0.000 description 5
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 5
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 5
- IBIDRSSEHFLGSD-YUMQZZPRSA-N Val-Arg Chemical compound CC(C)[C@H](N)C(=O)N[C@H](C(O)=O)CCCN=C(N)N IBIDRSSEHFLGSD-YUMQZZPRSA-N 0.000 description 5
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Chemical group CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 5
- 238000010521 absorption reaction Methods 0.000 description 5
- 210000000170 cell membrane Anatomy 0.000 description 5
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 5
- 239000012634 fragment Substances 0.000 description 5
- 102000037865 fusion proteins Human genes 0.000 description 5
- 108020001507 fusion proteins Proteins 0.000 description 5
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 5
- 239000004615 ingredient Substances 0.000 description 5
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 5
- 210000004379 membrane Anatomy 0.000 description 5
- 239000012528 membrane Substances 0.000 description 5
- 239000000863 peptide conjugate Substances 0.000 description 5
- LPNYRYFBWFDTMA-UHFFFAOYSA-N potassium tert-butoxide Chemical compound [K+].CC(C)(C)[O-] LPNYRYFBWFDTMA-UHFFFAOYSA-N 0.000 description 5
- 239000000843 powder Substances 0.000 description 5
- 239000002904 solvent Substances 0.000 description 5
- 125000006850 spacer group Chemical group 0.000 description 5
- 238000012360 testing method Methods 0.000 description 5
- IBIDRSSEHFLGSD-UHFFFAOYSA-N valinyl-arginine Natural products CC(C)C(N)C(=O)NC(C(O)=O)CCCN=C(N)N IBIDRSSEHFLGSD-UHFFFAOYSA-N 0.000 description 5
- 241000271566 Aves Species 0.000 description 4
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical compound OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 4
- 101500027325 Homo sapiens Atrial natriuretic peptide Proteins 0.000 description 4
- 101500026735 Homo sapiens Brain natriuretic peptide 32 Proteins 0.000 description 4
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 4
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 4
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical group OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 4
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical group OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 4
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 4
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical group C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 4
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical group OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 4
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 4
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 4
- ZYTPOUNUXRBYGW-YUMQZZPRSA-N Met-Met Chemical compound CSCC[C@H]([NH3+])C(=O)N[C@H](C([O-])=O)CCSC ZYTPOUNUXRBYGW-YUMQZZPRSA-N 0.000 description 4
- 239000007832 Na2SO4 Substances 0.000 description 4
- KDLHZDBZIXYQEI-UHFFFAOYSA-N Palladium Chemical compound [Pd] KDLHZDBZIXYQEI-UHFFFAOYSA-N 0.000 description 4
- PMZURENOXWZQFD-UHFFFAOYSA-L Sodium Sulfate Chemical compound [Na+].[Na+].[O-]S([O-])(=O)=O PMZURENOXWZQFD-UHFFFAOYSA-L 0.000 description 4
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 4
- 239000004473 Threonine Substances 0.000 description 4
- 108010001957 Ularitide Proteins 0.000 description 4
- 102400001279 Urodilatin Human genes 0.000 description 4
- 239000002253 acid Substances 0.000 description 4
- 230000009471 action Effects 0.000 description 4
- 235000004279 alanine Nutrition 0.000 description 4
- 150000001408 amides Chemical class 0.000 description 4
- 238000004458 analytical method Methods 0.000 description 4
- 235000009582 asparagine Nutrition 0.000 description 4
- 230000009286 beneficial effect Effects 0.000 description 4
- 150000005829 chemical entities Chemical class 0.000 description 4
- 239000013058 crude material Substances 0.000 description 4
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 4
- 230000029087 digestion Effects 0.000 description 4
- 201000010099 disease Diseases 0.000 description 4
- 230000002526 effect on cardiovascular system Effects 0.000 description 4
- 230000002124 endocrine Effects 0.000 description 4
- 230000002255 enzymatic effect Effects 0.000 description 4
- 150000002148 esters Chemical class 0.000 description 4
- 239000008187 granular material Substances 0.000 description 4
- ZSIAUFGUXNUGDI-UHFFFAOYSA-N hexan-1-ol Chemical compound CCCCCCO ZSIAUFGUXNUGDI-UHFFFAOYSA-N 0.000 description 4
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 4
- 210000003000 inclusion body Anatomy 0.000 description 4
- 238000001802 infusion Methods 0.000 description 4
- 238000002347 injection Methods 0.000 description 4
- 239000007924 injection Substances 0.000 description 4
- 230000002452 interceptive effect Effects 0.000 description 4
- 229960000310 isoleucine Drugs 0.000 description 4
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 4
- 230000000670 limiting effect Effects 0.000 description 4
- 238000004949 mass spectrometry Methods 0.000 description 4
- 108010085203 methionylmethionine Proteins 0.000 description 4
- 210000000496 pancreas Anatomy 0.000 description 4
- 230000036470 plasma concentration Effects 0.000 description 4
- 239000013612 plasmid Substances 0.000 description 4
- BWHMMNNQKKPAPP-UHFFFAOYSA-L potassium carbonate Chemical compound [K+].[K+].[O-]C([O-])=O BWHMMNNQKKPAPP-UHFFFAOYSA-L 0.000 description 4
- 238000004007 reversed phase HPLC Methods 0.000 description 4
- 229910052938 sodium sulfate Inorganic materials 0.000 description 4
- 239000003826 tablet Substances 0.000 description 4
- VZGDMQKNWNREIO-UHFFFAOYSA-N tetrachloromethane Chemical compound ClC(Cl)(Cl)Cl VZGDMQKNWNREIO-UHFFFAOYSA-N 0.000 description 4
- 239000004474 valine Substances 0.000 description 4
- 0 *C(CCC1)C1OCCCCCC(C1*=C1)=O Chemical compound *C(CCC1)C1OCCCCCC(C1*=C1)=O 0.000 description 3
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 3
- BNODVYXZAAXSHW-IUCAKERBSA-N Arg-His Chemical compound NC(=N)NCCC[C@H](N)C(=O)N[C@H](C(O)=O)CC1=CNC=N1 BNODVYXZAAXSHW-IUCAKERBSA-N 0.000 description 3
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 3
- 241000283690 Bos taurus Species 0.000 description 3
- 108090000317 Chymotrypsin Proteins 0.000 description 3
- FKLJPTJMIBLJAV-UHFFFAOYSA-N Compound IV Chemical compound O1N=C(C)C=C1CCCCCCCOC1=CC=C(C=2OCCN=2)C=C1 FKLJPTJMIBLJAV-UHFFFAOYSA-N 0.000 description 3
- 239000004471 Glycine Substances 0.000 description 3
- 108010078321 Guanylate Cyclase Proteins 0.000 description 3
- 102000014469 Guanylate cyclase Human genes 0.000 description 3
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 3
- AFVFQIVMOAPDHO-UHFFFAOYSA-N Methanesulfonic acid Chemical compound CS(O)(=O)=O AFVFQIVMOAPDHO-UHFFFAOYSA-N 0.000 description 3
- 102000003729 Neprilysin Human genes 0.000 description 3
- 108090000028 Neprilysin Proteins 0.000 description 3
- 102220580184 Non-receptor tyrosine-protein kinase TYK2_K14R_mutation Human genes 0.000 description 3
- 241000286209 Phasianidae Species 0.000 description 3
- YGYAWVDWMABLBF-UHFFFAOYSA-N Phosgene Chemical compound ClC(Cl)=O YGYAWVDWMABLBF-UHFFFAOYSA-N 0.000 description 3
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 3
- 101500026748 Rattus norvegicus Brain natriuretic peptide 45 Proteins 0.000 description 3
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 3
- 230000003213 activating effect Effects 0.000 description 3
- 150000001335 aliphatic alkanes Chemical group 0.000 description 3
- 229940125364 angiotensin receptor blocker Drugs 0.000 description 3
- 229960001230 asparagine Drugs 0.000 description 3
- 229940009098 aspartate Drugs 0.000 description 3
- 230000000975 bioactive effect Effects 0.000 description 3
- 230000000903 blocking effect Effects 0.000 description 3
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 3
- 230000000747 cardiac effect Effects 0.000 description 3
- 229960002376 chymotrypsin Drugs 0.000 description 3
- 230000008602 contraction Effects 0.000 description 3
- 239000012043 crude product Substances 0.000 description 3
- ZOOGRGPOEVQQDX-UHFFFAOYSA-N cyclic GMP Natural products O1C2COP(O)(=O)OC2C(O)C1N1C=NC2=C1NC(N)=NC2=O ZOOGRGPOEVQQDX-UHFFFAOYSA-N 0.000 description 3
- 150000001945 cysteines Chemical class 0.000 description 3
- 230000034994 death Effects 0.000 description 3
- 231100000517 death Toxicity 0.000 description 3
- 230000003247 decreasing effect Effects 0.000 description 3
- 230000001627 detrimental effect Effects 0.000 description 3
- 238000009826 distribution Methods 0.000 description 3
- 230000001882 diuretic effect Effects 0.000 description 3
- 239000003937 drug carrier Substances 0.000 description 3
- 239000012149 elution buffer Substances 0.000 description 3
- 230000029142 excretion Effects 0.000 description 3
- 239000000194 fatty acid Substances 0.000 description 3
- 229930195712 glutamate Natural products 0.000 description 3
- 125000000291 glutamic acid group Chemical group N[C@@H](CCC(O)=O)C(=O)* 0.000 description 3
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 3
- 235000011187 glycerol Nutrition 0.000 description 3
- 230000006872 improvement Effects 0.000 description 3
- 238000002955 isolation Methods 0.000 description 3
- 229920001427 mPEG Polymers 0.000 description 3
- 229930182817 methionine Natural products 0.000 description 3
- HPNRHPKXQZSDFX-OAQDCNSJSA-N nesiritide Chemical compound C([C@H]1C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@H](C(N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CSSC[C@@H](C(=O)N1)NC(=O)CNC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](CCSC)NC(=O)[C@H](CCCCN)NC(=O)[C@H]1N(CCC1)C(=O)[C@@H](N)CO)C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1N=CNC=1)C(O)=O)=O)[C@@H](C)CC)C1=CC=CC=C1 HPNRHPKXQZSDFX-OAQDCNSJSA-N 0.000 description 3
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 3
- 229910052700 potassium Inorganic materials 0.000 description 3
- 238000002953 preparative HPLC Methods 0.000 description 3
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 3
- 235000000346 sugar Nutrition 0.000 description 3
- 239000000725 suspension Substances 0.000 description 3
- UWHCKJMYHZGTIT-UHFFFAOYSA-N tetraethylene glycol Chemical compound OCCOCCOCCOCCO UWHCKJMYHZGTIT-UHFFFAOYSA-N 0.000 description 3
- 230000000699 topical effect Effects 0.000 description 3
- 231100000419 toxicity Toxicity 0.000 description 3
- 230000001988 toxicity Effects 0.000 description 3
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 3
- IUCCYQIEZNQWRS-DWWHXVEHSA-N ularitide Chemical compound C([C@H]1C(=O)NCC(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@H](C(NCC(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CSSC[C@@H](C(=O)N1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](C)NC(=O)[C@@H](N)[C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)=O)[C@@H](C)CC)C1=CC=CC=C1 IUCCYQIEZNQWRS-DWWHXVEHSA-N 0.000 description 3
- 230000002792 vascular Effects 0.000 description 3
- 229940124549 vasodilator Drugs 0.000 description 3
- 239000003071 vasodilator agent Substances 0.000 description 3
- NXLNNXIXOYSCMB-UHFFFAOYSA-N (4-nitrophenyl) carbonochloridate Chemical compound [O-][N+](=O)C1=CC=C(OC(Cl)=O)C=C1 NXLNNXIXOYSCMB-UHFFFAOYSA-N 0.000 description 2
- UUUHXMGGBIUAPW-UHFFFAOYSA-N 1-[1-[2-[[5-amino-2-[[1-[5-(diaminomethylideneamino)-2-[[1-[3-(1h-indol-3-yl)-2-[(5-oxopyrrolidine-2-carbonyl)amino]propanoyl]pyrrolidine-2-carbonyl]amino]pentanoyl]pyrrolidine-2-carbonyl]amino]-5-oxopentanoyl]amino]-3-methylpentanoyl]pyrrolidine-2-carbon Chemical compound C1CCC(C(=O)N2C(CCC2)C(O)=O)N1C(=O)C(C(C)CC)NC(=O)C(CCC(N)=O)NC(=O)C1CCCN1C(=O)C(CCCN=C(N)N)NC(=O)C1CCCN1C(=O)C(CC=1C2=CC=CC=C2NC=1)NC(=O)C1CCC(=O)N1 UUUHXMGGBIUAPW-UHFFFAOYSA-N 0.000 description 2
- NGNBDVOYPDDBFK-UHFFFAOYSA-N 2-[2,4-di(pentan-2-yl)phenoxy]acetyl chloride Chemical compound CCCC(C)C1=CC=C(OCC(Cl)=O)C(C(C)CCC)=C1 NGNBDVOYPDDBFK-UHFFFAOYSA-N 0.000 description 2
- VHYFNPMBLIVWCW-UHFFFAOYSA-N 4-Dimethylaminopyridine Chemical compound CN(C)C1=CC=NC=C1 VHYFNPMBLIVWCW-UHFFFAOYSA-N 0.000 description 2
- SLXKOJJOQWFEFD-UHFFFAOYSA-N 6-aminohexanoic acid Chemical compound NCCCCCC(O)=O SLXKOJJOQWFEFD-UHFFFAOYSA-N 0.000 description 2
- 108010064733 Angiotensins Proteins 0.000 description 2
- 241000272517 Anseriformes Species 0.000 description 2
- JHFNSBBHKSZXKB-VKHMYHEASA-N Asp-Gly Chemical group OC(=O)C[C@H](N)C(=O)NCC(O)=O JHFNSBBHKSZXKB-VKHMYHEASA-N 0.000 description 2
- KZMGYPLQYOPHEL-UHFFFAOYSA-N Boron trifluoride etherate Chemical compound FB(F)F.CCOCC KZMGYPLQYOPHEL-UHFFFAOYSA-N 0.000 description 2
- 229940127291 Calcium channel antagonist Drugs 0.000 description 2
- KXDHJXZQYSOELW-UHFFFAOYSA-M Carbamate Chemical compound NC([O-])=O KXDHJXZQYSOELW-UHFFFAOYSA-M 0.000 description 2
- BVKZGUZCCUSVTD-UHFFFAOYSA-L Carbonate Chemical compound [O-]C([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-L 0.000 description 2
- 208000024172 Cardiovascular disease Diseases 0.000 description 2
- BRLQWZUYTZBJKN-UHFFFAOYSA-N Epichlorohydrin Chemical compound ClCC1CO1 BRLQWZUYTZBJKN-UHFFFAOYSA-N 0.000 description 2
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 2
- 241000282412 Homo Species 0.000 description 2
- 101000749809 Homo sapiens 2',3'-cyclic-nucleotide 3'-phosphodiesterase Proteins 0.000 description 2
- 101000796277 Homo sapiens C-type natriuretic peptide Proteins 0.000 description 2
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 2
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 2
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 2
- LRQKBLKVPFOOQJ-YFKPBYRVSA-N L-norleucine Chemical compound CCCC[C@H]([NH3+])C([O-])=O LRQKBLKVPFOOQJ-YFKPBYRVSA-N 0.000 description 2
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 2
- 240000007472 Leucaena leucocephala Species 0.000 description 2
- 235000010643 Leucaena leucocephala Nutrition 0.000 description 2
- YQAIUOWPSUOINN-IUCAKERBSA-N Lys-Val Chemical group CC(C)[C@@H](C(O)=O)NC(=O)[C@@H](N)CCCCN YQAIUOWPSUOINN-IUCAKERBSA-N 0.000 description 2
- DRRXXZBXDMLGFC-IHRRRGAJSA-N Lys-Val-Leu Chemical group CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@@H](N)CCCCN DRRXXZBXDMLGFC-IHRRRGAJSA-N 0.000 description 2
- 241000124008 Mammalia Species 0.000 description 2
- 239000012359 Methanesulfonyl chloride Substances 0.000 description 2
- MQUQNUAYKLCRME-INIZCTEOSA-N N-tosyl-L-phenylalanyl chloromethyl ketone Chemical compound C1=CC(C)=CC=C1S(=O)(=O)N[C@H](C(=O)CCl)CC1=CC=CC=C1 MQUQNUAYKLCRME-INIZCTEOSA-N 0.000 description 2
- 102220583971 Non-receptor tyrosine-protein kinase TYK2_K27R_mutation Human genes 0.000 description 2
- 102000007399 Nuclear hormone receptor Human genes 0.000 description 2
- 102000007079 Peptide Fragments Human genes 0.000 description 2
- 108010033276 Peptide Fragments Proteins 0.000 description 2
- 108090000882 Peptidyl-Dipeptidase A Proteins 0.000 description 2
- 102000004270 Peptidyl-Dipeptidase A Human genes 0.000 description 2
- 208000004880 Polyuria Diseases 0.000 description 2
- PXIPVTKHYLBLMZ-UHFFFAOYSA-N Sodium azide Chemical compound [Na+].[N-]=[N+]=[N-] PXIPVTKHYLBLMZ-UHFFFAOYSA-N 0.000 description 2
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 2
- 229930006000 Sucrose Natural products 0.000 description 2
- 239000008186 active pharmaceutical agent Substances 0.000 description 2
- 239000000443 aerosol Substances 0.000 description 2
- 125000003545 alkoxy group Chemical group 0.000 description 2
- 229960002684 aminocaproic acid Drugs 0.000 description 2
- 210000002403 aortic endothelial cell Anatomy 0.000 description 2
- 210000001367 artery Anatomy 0.000 description 2
- 239000011230 binding agent Substances 0.000 description 2
- 230000033228 biological regulation Effects 0.000 description 2
- 230000017531 blood circulation Effects 0.000 description 2
- 210000004556 brain Anatomy 0.000 description 2
- 239000012267 brine Substances 0.000 description 2
- 239000000480 calcium channel blocker Substances 0.000 description 2
- 125000004432 carbon atom Chemical group C* 0.000 description 2
- BVKZGUZCCUSVTD-UHFFFAOYSA-N carbonic acid Chemical compound OC(O)=O BVKZGUZCCUSVTD-UHFFFAOYSA-N 0.000 description 2
- 239000003153 chemical reaction reagent Substances 0.000 description 2
- 230000001268 conjugating effect Effects 0.000 description 2
- 238000010276 construction Methods 0.000 description 2
- 230000009260 cross reactivity Effects 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 230000035487 diastolic blood pressure Effects 0.000 description 2
- 235000014113 dietary fatty acids Nutrition 0.000 description 2
- 102000038379 digestive enzymes Human genes 0.000 description 2
- 108091007734 digestive enzymes Proteins 0.000 description 2
- 238000007865 diluting Methods 0.000 description 2
- 239000012153 distilled water Substances 0.000 description 2
- 230000035619 diuresis Effects 0.000 description 2
- 229940030606 diuretics Drugs 0.000 description 2
- 239000002552 dosage form Substances 0.000 description 2
- 229940088679 drug related substance Drugs 0.000 description 2
- 210000001198 duodenum Anatomy 0.000 description 2
- 230000008030 elimination Effects 0.000 description 2
- 238000003379 elimination reaction Methods 0.000 description 2
- 239000003995 emulsifying agent Substances 0.000 description 2
- 239000000839 emulsion Substances 0.000 description 2
- 210000002889 endothelial cell Anatomy 0.000 description 2
- NLFBCYMMUAKCPC-KQQUZDAGSA-N ethyl (e)-3-[3-amino-2-cyano-1-[(e)-3-ethoxy-3-oxoprop-1-enyl]sulfanyl-3-oxoprop-1-enyl]sulfanylprop-2-enoate Chemical compound CCOC(=O)\C=C\SC(=C(C#N)C(N)=O)S\C=C\C(=O)OCC NLFBCYMMUAKCPC-KQQUZDAGSA-N 0.000 description 2
- TUEYHEWXYWCDHA-UHFFFAOYSA-N ethyl 5-methylthiadiazole-4-carboxylate Chemical compound CCOC(=O)C=1N=NSC=1C TUEYHEWXYWCDHA-UHFFFAOYSA-N 0.000 description 2
- HYXRUZUPCFVWAH-UHFFFAOYSA-N ethyl 6-hydroxyhexanoate Chemical compound CCOC(=O)CCCCCO HYXRUZUPCFVWAH-UHFFFAOYSA-N 0.000 description 2
- 229930195729 fatty acid Natural products 0.000 description 2
- 150000004665 fatty acids Chemical class 0.000 description 2
- 239000000499 gel Substances 0.000 description 2
- 210000002837 heart atrium Anatomy 0.000 description 2
- FHHGCKHKTAJLOM-UHFFFAOYSA-N hexaethylene glycol monomethyl ether Chemical compound COCCOCCOCCOCCOCCOCCO FHHGCKHKTAJLOM-UHFFFAOYSA-N 0.000 description 2
- 102000047974 human CNP Human genes 0.000 description 2
- 229920001477 hydrophilic polymer Polymers 0.000 description 2
- WGCNASOHLSPBMP-UHFFFAOYSA-N hydroxyacetaldehyde Natural products OCC=O WGCNASOHLSPBMP-UHFFFAOYSA-N 0.000 description 2
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 2
- 230000003993 interaction Effects 0.000 description 2
- 150000002632 lipids Chemical class 0.000 description 2
- 210000004185 liver Anatomy 0.000 description 2
- 239000007937 lozenge Substances 0.000 description 2
- 108010017391 lysylvaline Chemical group 0.000 description 2
- 230000014759 maintenance of location Effects 0.000 description 2
- 239000000463 material Substances 0.000 description 2
- 125000001360 methionine group Chemical group N[C@@H](CCSC)C(=O)* 0.000 description 2
- 125000000956 methoxy group Chemical group [H]C([H])([H])O* 0.000 description 2
- 238000012544 monitoring process Methods 0.000 description 2
- 238000000465 moulding Methods 0.000 description 2
- 229960001267 nesiritide Drugs 0.000 description 2
- 150000002823 nitrates Chemical class 0.000 description 2
- 231100000252 nontoxic Toxicity 0.000 description 2
- 230000003000 nontoxic effect Effects 0.000 description 2
- 238000003305 oral gavage Methods 0.000 description 2
- BVJSUAQZOZWCKN-UHFFFAOYSA-N p-hydroxybenzyl alcohol Chemical compound OCC1=CC=C(O)C=C1 BVJSUAQZOZWCKN-UHFFFAOYSA-N 0.000 description 2
- 230000036961 partial effect Effects 0.000 description 2
- 238000012510 peptide mapping method Methods 0.000 description 2
- 238000010647 peptide synthesis reaction Methods 0.000 description 2
- 239000012071 phase Substances 0.000 description 2
- 239000004033 plastic Substances 0.000 description 2
- 229920003023 plastic Polymers 0.000 description 2
- 229920001451 polypropylene glycol Polymers 0.000 description 2
- 230000012495 positive regulation of renal sodium excretion Effects 0.000 description 2
- 229910000027 potassium carbonate Inorganic materials 0.000 description 2
- 108010080850 prepro-brain natriuretic peptide Proteins 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- 229940024999 proteolytic enzymes for treatment of wounds and ulcers Drugs 0.000 description 2
- 238000003127 radioimmunoassay Methods 0.000 description 2
- 238000011084 recovery Methods 0.000 description 2
- 230000036454 renin-angiotensin system Effects 0.000 description 2
- 230000004044 response Effects 0.000 description 2
- 150000003839 salts Chemical class 0.000 description 2
- 229920006395 saturated elastomer Polymers 0.000 description 2
- 238000012216 screening Methods 0.000 description 2
- 150000003335 secondary amines Chemical group 0.000 description 2
- 210000003491 skin Anatomy 0.000 description 2
- 229910052708 sodium Inorganic materials 0.000 description 2
- HPALAKNZSZLMCH-UHFFFAOYSA-M sodium;chloride;hydrate Chemical compound O.[Na+].[Cl-] HPALAKNZSZLMCH-UHFFFAOYSA-M 0.000 description 2
- 238000005063 solubilization Methods 0.000 description 2
- 230000007928 solubilization Effects 0.000 description 2
- 238000010183 spectrum analysis Methods 0.000 description 2
- 239000005720 sucrose Substances 0.000 description 2
- 230000001839 systemic circulation Effects 0.000 description 2
- FYSNRJHAOHDILO-UHFFFAOYSA-N thionyl chloride Chemical compound ClS(Cl)=O FYSNRJHAOHDILO-UHFFFAOYSA-N 0.000 description 2
- 210000001519 tissue Anatomy 0.000 description 2
- 125000001493 tyrosinyl group Chemical group [H]OC1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 2
- 230000024883 vasodilation Effects 0.000 description 2
- 230000002883 vasorelaxation effect Effects 0.000 description 2
- 210000003462 vein Anatomy 0.000 description 2
- ORRBNCQQMJCLJE-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 12-[2-[2-[2-[2-[2-[2-(2-methoxyethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]dodecanoate Chemical compound COCCOCCOCCOCCOCCOCCOCCOCCCCCCCCCCCC(=O)ON1C(=O)CCC1=O ORRBNCQQMJCLJE-UHFFFAOYSA-N 0.000 description 1
- RPRXLBHGPKXNHT-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 16-[2-[2-[2-[2-[2-[2-(2-methoxyethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]hexadecanoate Chemical compound COCCOCCOCCOCCOCCOCCOCCOCCCCCCCCCCCCCCCC(=O)ON1C(=O)CCC1=O RPRXLBHGPKXNHT-UHFFFAOYSA-N 0.000 description 1
- LUYZLOWOHSXOFL-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 2-(2-methoxyethoxy)ethyl carbonate Chemical compound COCCOCCOC(=O)ON1C(=O)CCC1=O LUYZLOWOHSXOFL-UHFFFAOYSA-N 0.000 description 1
- JCUAHGNZBWSEIM-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 2-[2-(2-methoxyethoxy)ethoxy]ethyl carbonate Chemical compound COCCOCCOCCOC(=O)ON1C(=O)CCC1=O JCUAHGNZBWSEIM-UHFFFAOYSA-N 0.000 description 1
- NAYUZWZHFWEFQE-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 2-[2-[2-[2-[2-(2-hexadecoxyethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethyl carbonate Chemical compound CCCCCCCCCCCCCCCCOCCOCCOCCOCCOCCOCCOC(=O)ON1C(=O)CCC1=O NAYUZWZHFWEFQE-UHFFFAOYSA-N 0.000 description 1
- AOLJNKLSWQDTGN-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 2-[2-[2-[2-[2-[2-(2-hexoxyethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethyl carbonate Chemical compound CCCCCCOCCOCCOCCOCCOCCOCCOCCOC(=O)ON1C(=O)CCC1=O AOLJNKLSWQDTGN-UHFFFAOYSA-N 0.000 description 1
- TWLRVFVQAWWAPO-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 2-methoxyethyl carbonate Chemical compound COCCOC(=O)ON1C(=O)CCC1=O TWLRVFVQAWWAPO-UHFFFAOYSA-N 0.000 description 1
- PIOXCDYNXGCBQG-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 6-[1,3-bis[2-[2-[2-(2-heptoxyethoxy)ethoxy]ethoxy]ethoxy]propan-2-yloxycarbonylamino]hexanoate Chemical compound CCCCCCCOCCOCCOCCOCCOCC(COCCOCCOCCOCCOCCCCCCC)OC(=O)NCCCCCC(=O)ON1C(=O)CCC1=O PIOXCDYNXGCBQG-UHFFFAOYSA-N 0.000 description 1
- YJCODYWYSSZLSH-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 6-[1,3-bis[2-[2-[2-(2-methoxyethoxy)ethoxy]ethoxy]ethoxy]propan-2-yloxycarbonylamino]hexanoate Chemical compound COCCOCCOCCOCCOCC(COCCOCCOCCOCCOC)OC(=O)NCCCCCC(=O)ON1C(=O)CCC1=O YJCODYWYSSZLSH-UHFFFAOYSA-N 0.000 description 1
- BVAUMRCGVHUWOZ-ZETCQYMHSA-N (2s)-2-(cyclohexylazaniumyl)propanoate Chemical compound OC(=O)[C@H](C)NC1CCCCC1 BVAUMRCGVHUWOZ-ZETCQYMHSA-N 0.000 description 1
- LJRDOKAZOAKLDU-UDXJMMFXSA-N (2s,3s,4r,5r,6r)-5-amino-2-(aminomethyl)-6-[(2r,3s,4r,5s)-5-[(1r,2r,3s,5r,6s)-3,5-diamino-2-[(2s,3r,4r,5s,6r)-3-amino-4,5-dihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-6-hydroxycyclohexyl]oxy-4-hydroxy-2-(hydroxymethyl)oxolan-3-yl]oxyoxane-3,4-diol;sulfuric ac Chemical compound OS(O)(=O)=O.N[C@@H]1[C@@H](O)[C@H](O)[C@H](CN)O[C@@H]1O[C@H]1[C@@H](O)[C@H](O[C@H]2[C@@H]([C@@H](N)C[C@@H](N)[C@@H]2O)O[C@@H]2[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O2)N)O[C@@H]1CO LJRDOKAZOAKLDU-UDXJMMFXSA-N 0.000 description 1
- HTSGKJQDMSTCGS-UHFFFAOYSA-N 1,4-bis(4-chlorophenyl)-2-(4-methylphenyl)sulfonylbutane-1,4-dione Chemical compound C1=CC(C)=CC=C1S(=O)(=O)C(C(=O)C=1C=CC(Cl)=CC=1)CC(=O)C1=CC=C(Cl)C=C1 HTSGKJQDMSTCGS-UHFFFAOYSA-N 0.000 description 1
- RKDVKSZUMVYZHH-UHFFFAOYSA-N 1,4-dioxane-2,5-dione Chemical compound O=C1COC(=O)CO1 RKDVKSZUMVYZHH-UHFFFAOYSA-N 0.000 description 1
- PFNCOYVEMJYEED-UHFFFAOYSA-N 16-bromohexadecanoic acid Chemical compound OC(=O)CCCCCCCCCCCCCCCBr PFNCOYVEMJYEED-UHFFFAOYSA-N 0.000 description 1
- NAZYQHGLIWSKPI-UHFFFAOYSA-N 2-(2,5-dioxopyrrolidin-1-yl)oxycarbonyloxyethyl hexanoate Chemical compound CCCCCC(=O)OCCOC(=O)ON1C(=O)CCC1=O NAZYQHGLIWSKPI-UHFFFAOYSA-N 0.000 description 1
- GIAFURWZWWWBQT-UHFFFAOYSA-N 2-(2-aminoethoxy)ethanol Chemical compound NCCOCCO GIAFURWZWWWBQT-UHFFFAOYSA-N 0.000 description 1
- QCPQKTPNZOREOY-UHFFFAOYSA-N 2-[2-(2,5-dioxopyrrolidin-1-yl)oxycarbonyloxyethoxy]ethyl dodecanoate Chemical compound CCCCCCCCCCCC(=O)OCCOCCOC(=O)ON1C(=O)CCC1=O QCPQKTPNZOREOY-UHFFFAOYSA-N 0.000 description 1
- QZUFBUBUCKGVOI-UHFFFAOYSA-N 2-[2-[2-(2,5-dioxopyrrolidin-1-yl)oxycarbonyloxyethoxy]ethoxy]ethyl hexanoate Chemical compound CCCCCC(=O)OCCOCCOCCOC(=O)ON1C(=O)CCC1=O QZUFBUBUCKGVOI-UHFFFAOYSA-N 0.000 description 1
- UOFCAQWHTQFNHS-UHFFFAOYSA-N 2-[2-[2-[2-[2-(2-hexadecoxyethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethanol Chemical compound CCCCCCCCCCCCCCCCOCCOCCOCCOCCOCCOCCO UOFCAQWHTQFNHS-UHFFFAOYSA-N 0.000 description 1
- AGWKUHGLWHMYTG-UHFFFAOYSA-N 2-[2-[2-[2-[2-[2-(2-methoxyethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethanol Chemical compound COCCOCCOCCOCCOCCOCCOCCO AGWKUHGLWHMYTG-UHFFFAOYSA-N 0.000 description 1
- MHEDPJJXDOOCQO-UHFFFAOYSA-N 2-hexyldecanoyl chloride Chemical compound CCCCCCCCC(C(Cl)=O)CCCCCC MHEDPJJXDOOCQO-UHFFFAOYSA-N 0.000 description 1
- DKIDEFUBRARXTE-UHFFFAOYSA-N 3-mercaptopropanoic acid Chemical compound OC(=O)CCS DKIDEFUBRARXTE-UHFFFAOYSA-N 0.000 description 1
- MZCACYLMMMXSKC-UHFFFAOYSA-N 32 amino acid peptide Chemical compound C=1C=CC=CC=1CC(C(=O)NC(CC=1C2=CC=CC=C2NC=1)C(=O)NC(C(C)C)C(=O)NC(CCCCN)C(=O)NC(C(C)C)C(=O)NC(CCC(N)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(O)=O)NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(CCCNC(N)=N)NC(=O)C(CCCNC(N)=N)NC(=O)C(CCSC)NC(=O)C(CCCCN)NC(=O)C(CC=1C2=CC=CC=C2NC=1)NC(=O)C(CCCCN)NC(=O)C(CCCCN)NC(=O)C(CC(C)C)NC(=O)C(CC(C)C)NC(=O)C(CCCCN)NC(=O)C(CC=1C2=CC=CC=C2NC=1)NC(=O)C(CC(C)C)NC(=O)C(CC(O)=O)NC(=O)C(CO)NC(=O)C(NC(=O)C(NC(=O)C(CCC(O)=O)NC(=O)C(CCC(N)=O)NC(=O)C(CO)NC(=O)C(CC(C)C)NC(=O)C1N(CCC1)C(=O)C1NCCC1)C(C)O)CC1=CC=CC=C1 MZCACYLMMMXSKC-UHFFFAOYSA-N 0.000 description 1
- 229960000549 4-dimethylaminophenol Drugs 0.000 description 1
- 239000005541 ACE inhibitor Substances 0.000 description 1
- 102400000345 Angiotensin-2 Human genes 0.000 description 1
- 101800000733 Angiotensin-2 Proteins 0.000 description 1
- 102000015427 Angiotensins Human genes 0.000 description 1
- MTYLORHAQXVQOW-AVGNSLFASA-N Arg-Lys-Met Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCSC)C(O)=O MTYLORHAQXVQOW-AVGNSLFASA-N 0.000 description 1
- HMQDRBKQMLRCCG-GMOBBJLQSA-N Asp-Arg-Ile Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O HMQDRBKQMLRCCG-GMOBBJLQSA-N 0.000 description 1
- 241000416162 Astragalus gummifer Species 0.000 description 1
- 102400000667 Brain natriuretic peptide 32 Human genes 0.000 description 1
- 101800002247 Brain natriuretic peptide 45 Proteins 0.000 description 1
- 101100129088 Caenorhabditis elegans lys-2 gene Proteins 0.000 description 1
- 102000055006 Calcitonin Human genes 0.000 description 1
- 108060001064 Calcitonin Proteins 0.000 description 1
- 241000282472 Canis lupus familiaris Species 0.000 description 1
- KXDHJXZQYSOELW-UHFFFAOYSA-N Carbamic acid Chemical group NC(O)=O KXDHJXZQYSOELW-UHFFFAOYSA-N 0.000 description 1
- 102000014914 Carrier Proteins Human genes 0.000 description 1
- 108010078791 Carrier Proteins Proteins 0.000 description 1
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 1
- 108091026890 Coding region Proteins 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- ZXCAQANTQWBICD-DCAQKATOSA-N Cys-Lys-Val Chemical compound CC(C)[C@@H](C(=O)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CS)N ZXCAQANTQWBICD-DCAQKATOSA-N 0.000 description 1
- LEVWYRKDKASIDU-QWWZWVQMSA-N D-cystine Chemical compound OC(=O)[C@H](N)CSSC[C@@H](N)C(O)=O LEVWYRKDKASIDU-QWWZWVQMSA-N 0.000 description 1
- 108020004414 DNA Proteins 0.000 description 1
- 241000208011 Digitalis Species 0.000 description 1
- 240000001879 Digitalis lutea Species 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 238000002965 ELISA Methods 0.000 description 1
- 102000005593 Endopeptidases Human genes 0.000 description 1
- 108010059378 Endopeptidases Proteins 0.000 description 1
- 241000283073 Equus caballus Species 0.000 description 1
- IAYPIBMASNFSPL-UHFFFAOYSA-N Ethylene oxide Chemical compound C1CO1 IAYPIBMASNFSPL-UHFFFAOYSA-N 0.000 description 1
- 241000282324 Felis Species 0.000 description 1
- 230000005526 G1 to G0 transition Effects 0.000 description 1
- 241000287828 Gallus gallus Species 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- CCBIBMKQNXHNIN-ZETCQYMHSA-N Gly-Leu-Gly Chemical compound NCC(=O)N[C@@H](CC(C)C)C(=O)NCC(O)=O CCBIBMKQNXHNIN-ZETCQYMHSA-N 0.000 description 1
- YHYDTTUSJXGTQK-UWVGGRQHSA-N Gly-Met-Leu Chemical group CSCC[C@H](NC(=O)CN)C(=O)N[C@@H](CC(C)C)C(O)=O YHYDTTUSJXGTQK-UWVGGRQHSA-N 0.000 description 1
- 101000969688 Homo sapiens Macrophage-expressed gene 1 protein Proteins 0.000 description 1
- 108090000144 Human Proteins Proteins 0.000 description 1
- 102000003839 Human Proteins Human genes 0.000 description 1
- CZGUSIXMZVURDU-JZXHSEFVSA-N Ile(5)-angiotensin II Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC=1C=CC=CC=1)C([O-])=O)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(N)=[NH2+])NC(=O)[C@@H]([NH3+])CC([O-])=O)C(C)C)C1=CC=C(O)C=C1 CZGUSIXMZVURDU-JZXHSEFVSA-N 0.000 description 1
- 102000004877 Insulin Human genes 0.000 description 1
- 108090001061 Insulin Proteins 0.000 description 1
- 102000014150 Interferons Human genes 0.000 description 1
- 108010050904 Interferons Proteins 0.000 description 1
- AHLPHDHHMVZTML-BYPYZUCNSA-N L-Ornithine Chemical compound NCCC[C@H](N)C(O)=O AHLPHDHHMVZTML-BYPYZUCNSA-N 0.000 description 1
- 125000000570 L-alpha-aspartyl group Chemical group [H]OC(=O)C([H])([H])[C@]([H])(N([H])[H])C(*)=O 0.000 description 1
- ZGUNAGUHMKGQNY-ZETCQYMHSA-N L-alpha-phenylglycine zwitterion Chemical compound OC(=O)[C@@H](N)C1=CC=CC=C1 ZGUNAGUHMKGQNY-ZETCQYMHSA-N 0.000 description 1
- 125000003440 L-leucyl group Chemical group O=C([*])[C@](N([H])[H])([H])C([H])([H])C(C([H])([H])[H])([H])C([H])([H])[H] 0.000 description 1
- 125000000769 L-threonyl group Chemical group [H]N([H])[C@]([H])(C(=O)[*])[C@](O[H])(C([H])([H])[H])[H] 0.000 description 1
- 125000000510 L-tryptophano group Chemical group [H]C1=C([H])C([H])=C2N([H])C([H])=C(C([H])([H])[C@@]([H])(C(O[H])=O)N([H])[*])C2=C1[H] 0.000 description 1
- 101150118523 LYS4 gene Proteins 0.000 description 1
- 241000283953 Lagomorpha Species 0.000 description 1
- 239000004166 Lanolin Substances 0.000 description 1
- NTRAGDHVSGKUSF-AVGNSLFASA-N Leu-Arg-Arg Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CCCN=C(N)N)C(O)=O NTRAGDHVSGKUSF-AVGNSLFASA-N 0.000 description 1
- 241000914000 Lutjanus adetii Species 0.000 description 1
- ATIPDCIQTUXABX-UWVGGRQHSA-N Lys-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@@H](N)CCCCN ATIPDCIQTUXABX-UWVGGRQHSA-N 0.000 description 1
- ZOKVLMBYDSIDKG-CSMHCCOUSA-N Lys-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@@H](N)CCCCN ZOKVLMBYDSIDKG-CSMHCCOUSA-N 0.000 description 1
- MYTOTTSMVMWVJN-STQMWFEESA-N Lys-Tyr Chemical compound NCCCC[C@H](N)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 MYTOTTSMVMWVJN-STQMWFEESA-N 0.000 description 1
- 102100021285 Macrophage-expressed gene 1 protein Human genes 0.000 description 1
- UASDAHIAHBRZQV-YUMQZZPRSA-N Met-Arg Chemical compound CSCC[C@H](N)C(=O)N[C@H](C(O)=O)CCCNC(N)=N UASDAHIAHBRZQV-YUMQZZPRSA-N 0.000 description 1
- 241000699670 Mus sp. Species 0.000 description 1
- 206010028980 Neoplasm Diseases 0.000 description 1
- AHLPHDHHMVZTML-UHFFFAOYSA-N Orn-delta-NH2 Natural products NCCCC(N)C(O)=O AHLPHDHHMVZTML-UHFFFAOYSA-N 0.000 description 1
- UTJLXEIPEHZYQJ-UHFFFAOYSA-N Ornithine Natural products OC(=O)C(C)CCCN UTJLXEIPEHZYQJ-UHFFFAOYSA-N 0.000 description 1
- 208000012868 Overgrowth Diseases 0.000 description 1
- 241000282320 Panthera leo Species 0.000 description 1
- 108090000284 Pepsin A Proteins 0.000 description 1
- 102000057297 Pepsin A Human genes 0.000 description 1
- 108090001050 Phosphoric Diester Hydrolases Proteins 0.000 description 1
- 102000004861 Phosphoric Diester Hydrolases Human genes 0.000 description 1
- 239000004698 Polyethylene Substances 0.000 description 1
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- WFIVLLFYUZZWOD-RHYQMDGZSA-N Pro-Lys-Thr Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(O)=O WFIVLLFYUZZWOD-RHYQMDGZSA-N 0.000 description 1
- GOOHAUXETOMSMM-UHFFFAOYSA-N Propylene oxide Chemical compound CC1CO1 GOOHAUXETOMSMM-UHFFFAOYSA-N 0.000 description 1
- 241000287530 Psittaciformes Species 0.000 description 1
- 241000700157 Rattus norvegicus Species 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 108090000783 Renin Proteins 0.000 description 1
- 102100028255 Renin Human genes 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- 241000220317 Rosa Species 0.000 description 1
- 238000012300 Sequence Analysis Methods 0.000 description 1
- BMKNXTJLHFIAAH-CIUDSAMLSA-N Ser-Ser-Leu Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(O)=O BMKNXTJLHFIAAH-CIUDSAMLSA-N 0.000 description 1
- JURQXQBJKUHGJS-UHFFFAOYSA-N Ser-Ser-Ser-Ser Chemical compound OCC(N)C(=O)NC(CO)C(=O)NC(CO)C(=O)NC(CO)C(O)=O JURQXQBJKUHGJS-UHFFFAOYSA-N 0.000 description 1
- 241000287231 Serinus Species 0.000 description 1
- 241000272534 Struthio camelus Species 0.000 description 1
- 206010042434 Sudden death Diseases 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 1
- 229920001615 Tragacanth Polymers 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- FEXILLGKGGTLRI-NHCYSSNCSA-N Val-Leu-Asn Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](C(C)C)N FEXILLGKGGTLRI-NHCYSSNCSA-N 0.000 description 1
- 101710136524 X polypeptide Proteins 0.000 description 1
- PDHHWOKQXONSOA-UHFFFAOYSA-N [4-[(4-nitrophenoxy)carbonyloxymethyl]phenyl] 6-[2-[2-[2-[2-[2-(2-methoxyethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]hexanoate Chemical compound C1=CC(OC(=O)CCCCCOCCOCCOCCOCCOCCOCCOC)=CC=C1COC(=O)OC1=CC=C([N+]([O-])=O)C=C1 PDHHWOKQXONSOA-UHFFFAOYSA-N 0.000 description 1
- 238000009825 accumulation Methods 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 239000004480 active ingredient Substances 0.000 description 1
- 210000000577 adipose tissue Anatomy 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 230000001270 agonistic effect Effects 0.000 description 1
- 150000001298 alcohols Chemical class 0.000 description 1
- 150000001346 alkyl aryl ethers Chemical class 0.000 description 1
- 125000002947 alkylene group Chemical group 0.000 description 1
- 208000026935 allergic disease Diseases 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- 125000003277 amino group Chemical group 0.000 description 1
- 239000002333 angiotensin II receptor antagonist Substances 0.000 description 1
- 229950006323 angiotensin ii Drugs 0.000 description 1
- 229940044094 angiotensin-converting-enzyme inhibitor Drugs 0.000 description 1
- 239000005557 antagonist Substances 0.000 description 1
- 230000003466 anti-cipated effect Effects 0.000 description 1
- 230000003276 anti-hypertensive effect Effects 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 235000006708 antioxidants Nutrition 0.000 description 1
- 239000002249 anxiolytic agent Substances 0.000 description 1
- 239000008365 aqueous carrier Substances 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 150000001508 asparagines Chemical class 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 238000003149 assay kit Methods 0.000 description 1
- 239000012298 atmosphere Substances 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- 230000004888 barrier function Effects 0.000 description 1
- 239000011324 bead Substances 0.000 description 1
- KCXMKQUNVWSEMD-UHFFFAOYSA-N benzyl chloride Chemical compound ClCC1=CC=CC=C1 KCXMKQUNVWSEMD-UHFFFAOYSA-N 0.000 description 1
- 229940073608 benzyl chloride Drugs 0.000 description 1
- 125000001797 benzyl group Chemical group [H]C1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])* 0.000 description 1
- 239000002876 beta blocker Substances 0.000 description 1
- 229940097320 beta blocking agent Drugs 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 238000010256 biochemical assay Methods 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- 230000008499 blood brain barrier function Effects 0.000 description 1
- 210000004204 blood vessel Anatomy 0.000 description 1
- 210000001218 blood-brain barrier Anatomy 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- 229920005605 branched copolymer Polymers 0.000 description 1
- 239000007853 buffer solution Substances 0.000 description 1
- 210000004900 c-terminal fragment Anatomy 0.000 description 1
- BBBFJLBPOGFECG-VJVYQDLKSA-N calcitonin Chemical compound N([C@H](C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N1[C@@H](CCC1)C(N)=O)C(C)C)C(=O)[C@@H]1CSSC[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1 BBBFJLBPOGFECG-VJVYQDLKSA-N 0.000 description 1
- 229960004015 calcitonin Drugs 0.000 description 1
- 230000009460 calcium influx Effects 0.000 description 1
- 201000011510 cancer Diseases 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- OKTJSMMVPCPJKN-YPZZEJLDSA-N carbon-10 atom Chemical class [10C] OKTJSMMVPCPJKN-YPZZEJLDSA-N 0.000 description 1
- 125000005587 carbonate group Chemical group 0.000 description 1
- 230000003683 cardiac damage Effects 0.000 description 1
- 239000002327 cardiovascular agent Substances 0.000 description 1
- 229940125692 cardiovascular agent Drugs 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 150000003943 catecholamines Chemical class 0.000 description 1
- 238000000423 cell based assay Methods 0.000 description 1
- 239000013592 cell lysate Substances 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 230000009920 chelation Effects 0.000 description 1
- 238000007385 chemical modification Methods 0.000 description 1
- 235000013330 chicken meat Nutrition 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 238000002648 combination therapy Methods 0.000 description 1
- 238000002967 competitive immunoassay Methods 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 239000002131 composite material Substances 0.000 description 1
- 239000007891 compressed tablet Substances 0.000 description 1
- 238000013270 controlled release Methods 0.000 description 1
- 238000011443 conventional therapy Methods 0.000 description 1
- 239000006071 cream Substances 0.000 description 1
- 239000010779 crude oil Substances 0.000 description 1
- 229960003067 cystine Drugs 0.000 description 1
- 210000000172 cytosol Anatomy 0.000 description 1
- 230000007812 deficiency Effects 0.000 description 1
- 230000003413 degradative effect Effects 0.000 description 1
- 230000002939 deleterious effect Effects 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- 238000002405 diagnostic procedure Methods 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- OGQYPPBGSLZBEG-UHFFFAOYSA-N dimethyl(dioctadecyl)azanium Chemical compound CCCCCCCCCCCCCCCCCC[N+](C)(C)CCCCCCCCCCCCCCCCCC OGQYPPBGSLZBEG-UHFFFAOYSA-N 0.000 description 1
- 150000002009 diols Chemical class 0.000 description 1
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 1
- 208000035475 disorder Diseases 0.000 description 1
- 239000002270 dispersing agent Substances 0.000 description 1
- 238000004821 distillation Methods 0.000 description 1
- 238000011833 dog model Methods 0.000 description 1
- 238000011143 downstream manufacturing Methods 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 238000009585 enzyme analysis Methods 0.000 description 1
- 210000002615 epidermis Anatomy 0.000 description 1
- 210000002919 epithelial cell Anatomy 0.000 description 1
- RTZKZFJDLAIYFH-UHFFFAOYSA-N ether Chemical group CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 1
- 150000002170 ethers Chemical class 0.000 description 1
- 125000004494 ethyl ester group Chemical group 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 238000000855 fermentation Methods 0.000 description 1
- 230000004151 fermentation Effects 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- 238000004508 fractional distillation Methods 0.000 description 1
- 125000000524 functional group Chemical group 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- 229920000578 graft copolymer Polymers 0.000 description 1
- 239000000122 growth hormone Substances 0.000 description 1
- 208000019622 heart disease Diseases 0.000 description 1
- XXMIOPMDWAUFGU-UHFFFAOYSA-N hexane-1,6-diol Chemical compound OCCCCCCO XXMIOPMDWAUFGU-UHFFFAOYSA-N 0.000 description 1
- JMOLZNNXZPAGBH-UHFFFAOYSA-N hexyldecanoic acid Chemical compound CCCCCCCCC(C(O)=O)CCCCCC JMOLZNNXZPAGBH-UHFFFAOYSA-N 0.000 description 1
- 229950004531 hexyldecanoic acid Drugs 0.000 description 1
- 230000013632 homeostatic process Effects 0.000 description 1
- 238000000265 homogenisation Methods 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 230000028993 immune response Effects 0.000 description 1
- 230000002163 immunogen Effects 0.000 description 1
- 230000005847 immunogenicity Effects 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 239000003701 inert diluent Substances 0.000 description 1
- 239000003112 inhibitor Substances 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 230000000297 inotrophic effect Effects 0.000 description 1
- 239000004041 inotropic agent Substances 0.000 description 1
- 229940125396 insulin Drugs 0.000 description 1
- 229940047124 interferons Drugs 0.000 description 1
- 230000000968 intestinal effect Effects 0.000 description 1
- 210000004347 intestinal mucosa Anatomy 0.000 description 1
- 238000001361 intraarterial administration Methods 0.000 description 1
- 238000010255 intramuscular injection Methods 0.000 description 1
- 239000007927 intramuscular injection Substances 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 150000002500 ions Chemical class 0.000 description 1
- 230000007794 irritation Effects 0.000 description 1
- 125000000741 isoleucyl group Chemical group [H]N([H])C(C(C([H])([H])[H])C([H])([H])C([H])([H])[H])C(=O)O* 0.000 description 1
- 230000000366 juvenile effect Effects 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- JJTUDXZGHPGLLC-UHFFFAOYSA-N lactide Chemical compound CC1OC(=O)C(C)OC1=O JJTUDXZGHPGLLC-UHFFFAOYSA-N 0.000 description 1
- 229940039717 lanolin Drugs 0.000 description 1
- 235000019388 lanolin Nutrition 0.000 description 1
- 125000001909 leucine group Chemical group [H]N(*)C(C(*)=O)C([H])([H])C(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 239000006210 lotion Substances 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 230000003295 lusitropic effect Effects 0.000 description 1
- 150000002669 lysines Chemical class 0.000 description 1
- 230000002934 lysing effect Effects 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 230000010534 mechanism of action Effects 0.000 description 1
- 230000008384 membrane barrier Effects 0.000 description 1
- 229910021645 metal ion Inorganic materials 0.000 description 1
- 239000004530 micro-emulsion Substances 0.000 description 1
- 239000007932 molded tablet Substances 0.000 description 1
- 230000009149 molecular binding Effects 0.000 description 1
- 238000001823 molecular biology technique Methods 0.000 description 1
- VYQNWZOUAUKGHI-UHFFFAOYSA-N monobenzone Chemical compound C1=CC(O)=CC=C1OCC1=CC=CC=C1 VYQNWZOUAUKGHI-UHFFFAOYSA-N 0.000 description 1
- 239000000178 monomer Substances 0.000 description 1
- 230000002107 myocardial effect Effects 0.000 description 1
- 230000010117 myocardial relaxation Effects 0.000 description 1
- 210000004165 myocardium Anatomy 0.000 description 1
- 210000004898 n-terminal fragment Anatomy 0.000 description 1
- 239000002833 natriuretic agent Substances 0.000 description 1
- 102000027424 natriuretic peptide receptors Human genes 0.000 description 1
- 108091008599 natriuretic peptide receptors Proteins 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- LGQLOGILCSXPEA-UHFFFAOYSA-L nickel sulfate Chemical compound [Ni+2].[O-]S([O-])(=O)=O LGQLOGILCSXPEA-UHFFFAOYSA-L 0.000 description 1
- 229910000363 nickel(II) sulfate Inorganic materials 0.000 description 1
- 239000012299 nitrogen atmosphere Substances 0.000 description 1
- 235000015097 nutrients Nutrition 0.000 description 1
- 239000007764 o/w emulsion Substances 0.000 description 1
- 230000009965 odorless effect Effects 0.000 description 1
- 239000002674 ointment Substances 0.000 description 1
- 239000006186 oral dosage form Substances 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 239000003960 organic solvent Substances 0.000 description 1
- 229960003104 ornithine Drugs 0.000 description 1
- 229910052763 palladium Inorganic materials 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 239000004031 partial agonist Substances 0.000 description 1
- 239000006072 paste Substances 0.000 description 1
- 235000010603 pastilles Nutrition 0.000 description 1
- 229960001639 penicillamine Drugs 0.000 description 1
- WXZMFSXDPGVJKK-UHFFFAOYSA-N pentaerythritol Chemical compound OCC(CO)(CO)CO WXZMFSXDPGVJKK-UHFFFAOYSA-N 0.000 description 1
- 229940111202 pepsin Drugs 0.000 description 1
- 108010011903 peptide receptors Proteins 0.000 description 1
- 102000014187 peptide receptors Human genes 0.000 description 1
- 230000035699 permeability Effects 0.000 description 1
- 230000002688 persistence Effects 0.000 description 1
- 235000019271 petrolatum Nutrition 0.000 description 1
- 239000000546 pharmaceutical excipient Substances 0.000 description 1
- 239000000825 pharmaceutical preparation Substances 0.000 description 1
- 230000003285 pharmacodynamic effect Effects 0.000 description 1
- 239000008363 phosphate buffer Substances 0.000 description 1
- 239000002953 phosphate buffered saline Substances 0.000 description 1
- WTJKGGKOPKCXLL-RRHRGVEJSA-N phosphatidylcholine Chemical group CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCCC=CCCCCCCCC WTJKGGKOPKCXLL-RRHRGVEJSA-N 0.000 description 1
- 230000004962 physiological condition Effects 0.000 description 1
- 229960005235 piperonyl butoxide Drugs 0.000 description 1
- 229920001983 poloxamer Polymers 0.000 description 1
- 229920001281 polyalkylene Chemical group 0.000 description 1
- 229920001748 polybutylene Polymers 0.000 description 1
- 229920000573 polyethylene Polymers 0.000 description 1
- 229950008882 polysorbate Drugs 0.000 description 1
- 229920000136 polysorbate Polymers 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 239000011591 potassium Substances 0.000 description 1
- 229940070017 potassium supplement Drugs 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 150000003138 primary alcohols Chemical class 0.000 description 1
- DNIAPMSPPWPWGF-UHFFFAOYSA-N propylene glycol Substances CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 1
- 230000002797 proteolythic effect Effects 0.000 description 1
- 238000010791 quenching Methods 0.000 description 1
- 230000000171 quenching effect Effects 0.000 description 1
- 229920005604 random copolymer Polymers 0.000 description 1
- 230000004648 relaxation of smooth muscle Effects 0.000 description 1
- 230000013878 renal filtration Effects 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 238000002390 rotary evaporation Methods 0.000 description 1
- 102220102317 rs114829239 Human genes 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 238000007493 shaping process Methods 0.000 description 1
- 238000009097 single-agent therapy Methods 0.000 description 1
- 239000002002 slurry Substances 0.000 description 1
- 210000002460 smooth muscle Anatomy 0.000 description 1
- 239000001488 sodium phosphate Substances 0.000 description 1
- 229910000162 sodium phosphate Inorganic materials 0.000 description 1
- 238000010532 solid phase synthesis reaction Methods 0.000 description 1
- 238000000638 solvent extraction Methods 0.000 description 1
- 239000011877 solvent mixture Substances 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 239000007921 spray Substances 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 239000007858 starting material Substances 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 150000008163 sugars Chemical group 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 230000004083 survival effect Effects 0.000 description 1
- 239000000375 suspending agent Substances 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 238000010189 synthetic method Methods 0.000 description 1
- 239000008399 tap water Substances 0.000 description 1
- 235000020679 tap water Nutrition 0.000 description 1
- 238000011191 terminal modification Methods 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- 239000002562 thickening agent Substances 0.000 description 1
- 125000000341 threoninyl group Chemical group [H]OC([H])(C([H])([H])[H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- 231100000041 toxicology testing Toxicity 0.000 description 1
- 239000000196 tragacanth Substances 0.000 description 1
- 235000010487 tragacanth Nutrition 0.000 description 1
- 229940116362 tragacanth Drugs 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 230000009261 transgenic effect Effects 0.000 description 1
- ZIBGPFATKBEMQZ-UHFFFAOYSA-N triethylene glycol Chemical compound OCCOCCOCCO ZIBGPFATKBEMQZ-UHFFFAOYSA-N 0.000 description 1
- 230000001960 triggered effect Effects 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- RYFMWSXOAZQYPI-UHFFFAOYSA-K trisodium phosphate Chemical compound [Na+].[Na+].[Na+].[O-]P([O-])([O-])=O RYFMWSXOAZQYPI-UHFFFAOYSA-K 0.000 description 1
- 125000000430 tryptophan group Chemical group [H]N([H])C(C(=O)O*)C([H])([H])C1=C([H])N([H])C2=C([H])C([H])=C([H])C([H])=C12 0.000 description 1
- 238000011144 upstream manufacturing Methods 0.000 description 1
- 210000002700 urine Anatomy 0.000 description 1
- 210000004291 uterus Anatomy 0.000 description 1
- 210000003556 vascular endothelial cell Anatomy 0.000 description 1
- 210000004509 vascular smooth muscle cell Anatomy 0.000 description 1
- 230000003639 vasoconstrictive effect Effects 0.000 description 1
- 239000005526 vasoconstrictor agent Substances 0.000 description 1
- 239000007762 w/o emulsion Substances 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- 239000008215 water for injection Substances 0.000 description 1
- 238000005303 weighing Methods 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C08—ORGANIC MACROMOLECULAR COMPOUNDS; THEIR PREPARATION OR CHEMICAL WORKING-UP; COMPOSITIONS BASED THEREON
- C08G—MACROMOLECULAR COMPOUNDS OBTAINED OTHERWISE THAN BY REACTIONS ONLY INVOLVING UNSATURATED CARBON-TO-CARBON BONDS
- C08G65/00—Macromolecular compounds obtained by reactions forming an ether link in the main chain of the macromolecule
- C08G65/02—Macromolecular compounds obtained by reactions forming an ether link in the main chain of the macromolecule from cyclic ethers by opening of the heterocyclic ring
- C08G65/32—Polymers modified by chemical after-treatment
- C08G65/329—Polymers modified by chemical after-treatment with organic compounds
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/56—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule
- A61K47/59—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes
- A61K47/60—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes the organic macromolecular compound being a polyoxyalkylene oligomer, polymer or dendrimer, e.g. PEG, PPG, PEO or polyglycerol
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/04—Inotropic agents, i.e. stimulants of cardiac contraction; Drugs for heart failure
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/12—Antihypertensives
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
- C07K14/58—Atrial natriuretic factor complex; Atriopeptin; Atrial natriuretic peptide [ANP]; Cardionatrin; Cardiodilatin
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/72—Receptors; Cell surface antigens; Cell surface determinants for hormones
-
- C—CHEMISTRY; METALLURGY
- C08—ORGANIC MACROMOLECULAR COMPOUNDS; THEIR PREPARATION OR CHEMICAL WORKING-UP; COMPOSITIONS BASED THEREON
- C08L—COMPOSITIONS OF MACROMOLECULAR COMPOUNDS
- C08L2203/00—Applications
- C08L2203/02—Applications for biomedical use
Definitions
- the present invention relates to the field of natriuretic compound conjugates and variant natriuretic compounds, and uses of these in the treatment of congestive heart disease and conditions related to this condition.
- the compositions of the present invention provide a pharmacologically active natriuretic agent and prodrug that may be used in a formulation suitable for oral, nasal, intravenous, or subcutaneous administration.
- the invention also provides methods of preparing the natriuretic compound conjugates, compounds, and formulations containing them, as well as methods of using these conjugates and compounds.
- the natriuretic compound conjugates comprise a natriuretic peptide including an NPR-A binding motif, at least one modifying moiety conjugation site, and also include at least one modifying moiety attached to the modifying moiety conjugation site.
- the compound conjugates have retained pharmacological activity of the native natriuretic peptide, and have enhanced characteristics, such as improved bioavailability, enhanced resistance to proteolytic activity, and/or prolonged activity in the blood stream.
- the present invention is also related to the field of recombinant peptides and proteins, as well as methods for preparing these recombinant peptides and proteins.
- analogs of natriuretic peptides and proteins are disclosed herein.
- the analog natriuretic compounds of the invention may be described in some embodiments as having an amino acid sequence that has at least one substituted amino acid relative to the native sequence of the corresponding natriuretic peptide.
- Cardiovascular diseases constitute the leading cause of death in the United Sates regardless of gender or ethnicity.
- congestive heart failure (CHF) is the only one that is increasing in prevalence (Massie and Shah 1997; Packer and Cohn 1999).
- CHF congestive heart failure
- the number of hospital discharges and the number of deaths due to CHF both rose roughly 2.5-fold from 1979 to 1999.
- Direct and indirect costs for treating CHF have been estimated as high as $56 billion (Hussar 2002). Hospital expenses for the treatment of HF are more than double those for all forms of cancer combined (O'Connell and Bristow 1994).
- CHF is a common cause of death, is accompanied by high indirect costs for treatment, and has a high mortality rate.
- the one-year mortality rate is about 20% (American Heart Association 2001).
- the probability for readmission for the same condition is very high, and several studies of readmission have recently been performed (Chin and Goldman 1997; Krumholz, Parent et al. 1997; Krumholz, Chen et al. 2000). Readmission rates in excess of 35% within one year of diagnosis are typical (Tsuchihashi, Tsutsui et al. 2001).
- Such frequent recurrence results in multiple emergency care visits and inpatient hospitalizations (Krumholz, Parent et al. 1997). Multiple hospitalizations and inadequate therapeutics define the current situation faced by those who suffer from CHF.
- BNP Brain type natriuretic peptide
- ADP atrial natriuretic peptide
- BNP is an endogenous peptide produced by the heart. It is first produced as prepro-BNP and is subsequently shortened twice to the active form, a 32-amino acid peptide with one disulfide bond.
- BNP binds to the natriuretic peptide receptor A (NPR-A), a membrane bound protein on the cell surface.
- NPR-A natriuretic peptide receptor A
- BNP accomplishes the cardio-vascular, renal, and endocrine effects with which it is associated. Regulation of BNP is accomplished by several different means. BNP molecules that bind to NPR-A and stimulate cGMP production are removed from circulation, but there are other means by which BNP is eliminated without invoking a response. The most common means of removal is through binding to the clearance receptor, natriuretic peptide receptor C (NPR-C).
- NPR-C natriuretic peptide receptor C
- NPR-C neutral endopeptidase
- BNP cyclic guanosine monophosphate
- NPR-A natriuretic peptide receptor A
- BNP has become important as a diagnostic marker to detect patients who are at high risk of developing CHF (Yamamoto, Burnett et al. 1996; McDonagh, Robb et al. 1998; Richards, Nicholls et al. 1998; Nagaya, Nishikimi et al. 2000; Kawai, Hata et al. 2001; Maisel, Krishnaswamy et al. 2002; McNairy, Gardetto et al. 2002).
- BNP functions to relieve cardiac decompensation in several ways. As the name implies, BNP leads to the excretion of sodium and an increase in urine output, which lessen congestion. It also functions as a vasodilator, the effects of which are enhanced by several other actions. Most notable of these functions are the roles BNP plays in the interference of the renin-angiotensin-aldosterone system (RAAS). It leads to inhibition of renin, which is a key enzyme in the generation of the vasoconstrictive peptide angiotensin. It inhibits the overgrowth of epithelial cells lining vascular tissue, which left unchecked, can greatly reduce blood flow. A final way that BNP functions to relieve cardiac decompensation is its lusitropic effects. It improves myocardial relaxation of the ventricles, resulting in lower diastolic blood pressure.
- RAAS renin-angiotensin-aldosterone system
- hBNP neuropeptide
- Natrecor® Nesiritide
- Natrecor ® was the first drug approved for the treatment of CHF in over twelve years. It is administered by intravenous continuous infusion over a period of 48 hours. As the drug is expensive and requires hospitalization, Natrecor ® is only used for the most acute cases. Despite this expense and inconvenience, Natrecor ® may be considered less expensive than some other therapies by reducing the amount of time patients spend in intensive care units.
- Natriuretic compound conjugates comprise a natriuretic compound that includes a natriuretic protein receptor A binding motif (an NPR-A), at least one modifying moiety conjugation site, and at least one modifying moiety attached to said modifying moiety conjugation site.
- an NPR-A natriuretic protein receptor A binding motif
- the natriuretic compound conjugate can have modified hydrophilic characteristics relative to the native natriuretic compound that does not include a modifying moiety as described herein.
- the modifying moiety may take the form of an oligomer of any variety of sizes, shapes, substitutions, and configurations.
- improved characteristics of the natriuretic compound conjugates of the invention having a modifying moiety, relative to unmodified (unconjugated) natriuretic compound include improved ability of the natriuretic compound to pass through the GI tract and enter the blood stream; improved hydrophilicity, hydrophobicity, or amphiphilicity of the natriuretic compound; improved solubility of the natriuretic compound in aqueous environments or organic solvents; improved ability of the natriuretic compound to cross cell membranes; improved ability of the natriuretic compound to traverse the blood-brain barrier; improved ability of the natriuretic compound to target a certain receptor, cell, tissue, or organ; and improved pharmacokinetic profile of the natriuretic compound.
- a preferred embodiment of the present invention is a non-immunogenic peptide conjugate that has increased resistance to degradative enzymes and is suitable for oral delivery and transport across the intestinal epithelium.
- the invention also provides several methods for the preparation of the natriuretic compound conjugates.
- These modifying moieties can for example, take the form of linear and branched PEG or other polymeric structure.
- amino acid is defined herein as any naturally occurring, artificial, or synthetic amino acid in either its L or D stereoisomeric forms, unless otherwise specified.
- the term “residue” is used interchangeably with the term “amino acid”, and is often designated as having a particular position in a given sequence of amino acids.
- hBNP(1-32)K3R, K14R, K27R designates a triple mutant hBNP having that hBNP sequence defined above with the substitution of arginine for lysine at residue position 3 (i.e. K3R), the substitution of arginine for lysine at residue position 14 (i.e. K14R), and the substitution of arginine for lysine at position 27 (i.e. K27R).
- Other mutants are defined in an analogous manner.
- Amphiphilic means the ability to dissolve in both water and lipids
- amphiphilic moiety and “amphiphile” means a moiety which is amphiphilic and/or which, when attached to a polypeptide or non-polypeptide drug, increases the amphiphilicity of the resulting conjugate, e.g., PEG-fatty acid oligomer, sugar fatty acid oligomer.
- Effective amount refers to a nontoxic but sufficient amount to provide the desired therapeutic effect. As will be pointed out below, the exact amount required will vary from subject to subject, depending on age, general condition of the subject, the severity of the condition being treated, the particular biologically active agent administered, and the like. An appropriate "effective" amount in any individual case may be determined by one of ordinary skill in the art by reference to the pertinent texts and literature and/or by using routine experimentation.
- Hydrolyzable refers to molecular bonds which are hydrolyzed under physiological conditions.
- Hydrophilic means the ability to dissolve in water, and the term “hydrophilic moiety” or “hydrophile” refers to a moiety which is hydrophilic and/or which when attached to another chemical entity, increases the hydrophilicity of such chemical entity. Examples include, but are not limited to, sugars and polyalkylene moieties such as polyethylene glycol.
- “Lower alkyl” refers to substituted or unsubstituted alkyl moieties having from 1 to 6 carbon atoms.
- “Monodispersed” refers to a mixture of compounds wherein about 100 percent of the compounds in the mixture have the same molecular weight.
- “Pharmaceutically acceptable” with respect to a component, such as a salt, carrier, excipient or diluent of a composition according to the present invention is a component that is compatible with the other ingredients of the composition, in that it can be combined with the natriuretic compound conjugates of the present invention without eliminating the biological activity of the biologically active agent and is suitable for use with subjects as provided herein without undue adverse side effects (such as toxicity, irritation, and allergic response). Side effects are “undue” when their risk outweighs the benefit provided by the pharmaceutical composition.
- Examples of pharmaceutically acceptable components include, without limitation, any of the standard pharmaceutical carriers such as phosphate buffered saline solutions, water, emulsions such as oil/water emulsion, microemulsions and various types of wetting agents.
- Prodrug refers to a biologically active agent that has been chemically derivitized such that, upon administration to a subject, the prodrug is metabolized to yield the biologically active agent.
- Treat” or “treating” as used herein refers to any type of treatment that imparts a benefit to a subject afflicted with a disease or illness, including improvement in the condition of the subject (e.g ., in one or more symptoms), delay in the progression of the condition, prevention or delay of the onset of the disease or illness, enhancement of normal physiological functionality, etc.
- Figure 1 - illustrates the mode of action and the regulation of BNP.
- Figure 2 A representative scheme for oligomer activation and conjugation following a three-tiered conjugation strategy.
- Class 1 modifying moieties are non-hydrolysable
- Class 2 modifying moieties are micropegylated
- Class 3 modifying moieties are fully hydrolysable.
- Natriuretic compound conjugates comprise a natriuretic compound that includes a natriuretic peptide receptor A binding motif (NPR-A), at least one modifying moiety conjugation site, and at least one modifying moiety attached to said modifying moiety conjugation site.
- NPR-A natriuretic peptide receptor A binding motif
- the natriuretic compound conjugate can have modified hydrophilic characteristics related to the native natriuretic compound that does not include a modifying moiety as described herein.
- the modifying moiety may take the form of an oligomer of any variety of sizes, shapes, substitutions, and configurations.
- natriuretic compound conjugates of the invention include a natriuretic compound which includes a binding site for a natriuretic peptide receptor, such as NPR-A, as well as a conjugation site for coupling a modifying moiety thereto.
- a natriuretic compound which includes a binding site for a natriuretic peptide receptor, such as NPR-A, as well as a conjugation site for coupling a modifying moiety thereto.
- the natriuretic compound may have the amino acid sequence of a native natriuretic peptide such as ANP, BNP, CNP or DNP, urodilatin, from any of a variety of species, such as humans, canines, and rats.
- a native natriuretic peptide such as ANP, BNP, CNP or DNP, urodilatin
- Preferred native natriuretic peptides are human BNP, rat BNP, canine BNP, or hANP.
- Native sequences are also intended to include pro-natriuretic peptides and pre-pro peptides.
- the natriuretic compound may also be a biologically active analog of a native natriuretic peptide (a natriuretic analog).
- a biologically active analog can be a native natriuretic compound with truncations, deletions, insertions, substitutions, replacements, side chain extensions, and fusion proteins, or combinations of the foregoing which do not eliminate the biological activity of the original compound.
- the analog will include a native or artificial NPR-A binding motif and will retain some or all of the activity for binding NPR-A.
- the analog will include a natriuretic molecule binding motif, such as an NPR-A binding motif.
- the natriuretic peptide may, for example, be defined by the sequence:
- X 1 is lysine
- X 2 is one to four amino acids.
- X 2 may be S, SS, SSS, SSSS, K, KS, KSS, or KSSS.
- K is included as X 2 or part of the sequences of X 2 , a modifying moiety conjugation site.
- the natriuretic compound may, for example, have the structure:
- Z 2 can be lysine or arginine.
- Z 2 is lysine
- a modifying moiety conjugation site is provided.
- Z 1 is lysine
- Z 2 may be other than lysine
- Z 1 may be other than lysine.
- X 1 and X 2 may be any N-terminal and C-terminal tail amino acid sequence obtained from any natriuretic peptide.
- the natriuretic compound analog comprises an amino acid sequence:
- X 1 , X 2 and X 3 are each independently selected from the group consisting of Lys and amino acids other than Lys, and wherein at least one of X 1 , X 2 and X 3 is Lys and at least one of X 1 , X 2 and X 3 is an amino acid other than Lys; and
- C 1 and C 2 are cysteines and may be coupled by a disulfide bond. It will be appreciated that the unconjugated peptide analog is also an aspect of the invention.
- X 1 , X 2 and X 3 is Arg.
- X 1 is Lys
- X 2 is Arg
- X 3 is Arg.
- This embodiment may also include an amino acid sequence as described herein, N-terminal to X 1 and/or C-terminal to X 3 .
- the N-terminal tail sequence when present, may be S-or SP-
- the C-terminal tail when present, may be -VLRRH, -VLRR, -VLR, -VL, or -V.
- the N-terminal and/or C-terminal tail sequence is present and is specifically not N-terminal and C-terminal tail of hBNP or a fragment thereof.
- the natriuretic peptide analog includes an amino acid sequence:
- X 1 and X 2 are an amino acid comprising a modifying moiety conjugation site coupled to the modifying moiety and the other is any other amino acid or an unconjugated Lys.
- X 1 is Lys coupled at its side chain to the modifying moiety and X 2 is another amino acid, for example Gly or Arg.
- X 2 is Lys coupled at its side chain to the modifying moiety and X 1 is another amino acid, for example Gly, Arg, or an amino acid other than lysine.
- X 1 is Lys coupled at its side chain to the modifying moiety and X 2 is an unconjugated Lys.
- X 2 is Lys coupled at its side chain to the modifying moiety and X 1 is an unconjugated Lys. It will be appreciated that the unconjugated peptide is also an aspect of the invention.
- BNP includes Lys residues in the native sequence that preferably serve as the conjugation sites for the oligomer.
- BNP includes Lys residues in the native sequence that preferably serve as the conjugation sites for the oligomer.
- the Lys may be replaced with another amino acid, such as arginine.
- a positively charged amino acid residue is replaced with a Lys residue, for example, in the ANP peptide (native sequence), Arg 27 can be replaced with Lys.
- the natriuretic compound is defined as the native hBNP amino acid sequence with one or more Lys residues are inserted within the hBNP sequence and/or added to an end of the hBNP sequence, and/or one or more native Lys residues deleted or replaced with conservative substitutions. Preferably such substitution or insertion is in one or more of the tail amino acid sequences of the natriuretic peptide.
- the conjugation site may in some embodiments be inserted, replaced or added at or near the N-terminal tail, e.g., an insertion or substitution within the N-terminal tail amino acid sequence, preferably at the N-terminus, or positioned 1, 2, 3, 4 or 5 amino acids from the N-terminus, or alternatively, positioned I, 2, 3, 4, 5, 6, 7, 8, or 9 amino acids in an N-terminal direction from the N-terminal Cys that forms a part of the Cys bridge creating the loop.
- an insertion or substitution within the N-terminal tail amino acid sequence preferably at the N-terminus, or positioned 1, 2, 3, 4 or 5 amino acids from the N-terminus, or alternatively, positioned I, 2, 3, 4, 5, 6, 7, 8, or 9 amino acids in an N-terminal direction from the N-terminal Cys that forms a part of the Cys bridge creating the loop.
- natriuretic peptide analogs will include the loop component of a native natriuretic peptide, such as Cys 10 -Cys 26 of hBNP in which Cys 10 and Cys 26 are coupled by a disulfide bond thereby forming a loop.
- the loop may include substitutions, deletions, and/or insertions of amino acids differing from the native sequences, so long as such substitutions, deletions, and/or insertions do not eliminate the activity of the native sequences.
- the natriuretic loop may include a native loop having one or more conservative substitutions which do not eliminate the natriuretic activity of the loop, e.g., in some cases that loop will have the sequence of the native loop (e.g., the native loop of hBNP) and have 1, 2, 3, 4, 5, 6, 7 or 8 conservative substitutions.
- the loop is shortened by removing a set of amino acids that does not eliminate biological activity.
- the peptide analog includes the Cys 10 -Cys 26 loop of hBNP in which Lys14 is replaced with Gly or Arg.
- the SSSS component of the loop is altered or deleted.
- the natriuretic peptide loops or analogs of the native loops may include an N-terminal tail and/or a C-terminal tail, such as the tails of native natriuretic peptides, e.g., hBNP 19 and hBN(P 2)7-32 .
- the tails are single amino acids or peptides that do not eliminate biological activity.
- the tails may include substitutions, deletions, and/or insertions of amino acids differing from the native sequences, so long as such substitutions, deletions, and/or insertions do not eliminate the beneficial activity of the native sequences.
- the tail or tails are based on native sequences, but truncated by one or more amino acids.
- the N-terminal tail when present, may selected from the following hBNP segments 8-9, 7-9, 6-9, 5-9, 4-9, 3-9, 2-9, and 1-9; and any of the foregoing segments in which one or more Lys residues is replaced with a Gly or Arg residue.
- a C-terminal tail when present, may be selected from: hBNP segments 27-28, 27-29, 27-30, 27-31, and 27-32; and any of the foregoing hBNP segments wherein one or more Lys residues is replaced with a Gly or an Arg residue.
- Examples of preferred loop-plus-tail natriuretic peptides include hBNP segment 1-29; hBNP segment 1-26; and either of the foregoing hBNP segments in which one or more Lys residues are replaced with a Gly or an Arg.
- R 1 is selected from the group consisting of: (H); Gly-; Ser-Gly-; Asp/Lys/Gly-Ser-Gly-; Arg/His/Gln-Asp/Lys/Gly-Ser-Gly-; Met/Val-Arg/His/Gln-Asp/Lys/Gly-Ser-Gly-; Thr/Met-Met/Val-Arg/His/His/Gln-Asp/Lys/Gly-Ser-Gly-; Thr/Met-Met/Val-Arg/His/His/Gln-Asp/Lys/Gly-Ser-Gly-; Thr/Met-Met/Val-Arg/His/His/His/Gln-Asp/Lys/Gly-Ser-Gly-; Thr/Met-Met/Val-Arg/His/His/His/Gln-Asp/Lys/Gly
- Still another set of analogs is described in Scios, European Patent EP0542863B1, issued November 26, 1997 , which describes a fusion protein which comprises from N-terminal to C-terminal: a carrier protein of about 10 to about 50 kDa which does not contain Glu residues or Asp-Gly sequences as a Staph V8 cleavage site; a Staph V8 cleavage comprising a Glu residue or Asp-Gly sequence positioned at the C-terminal of said carrier; and ; and a peptide not containing a Staph V8 cleavage site fused to said cleavage site; wherein said fusion protein exhibits a pI of about 8.0 or greater.
- the patent also describes the use of an N-terminal leader of 6 to 20 amino acids.
- natriuretic peptide analogs suitable for use in the present invention are described in Daiichi's U.S. Patent Publication No. 20020086843, published on July 4, 2002 , which describes a physiologically active polypeptide X-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH [where the 2 cysteines are bridged] wherein X is H, H-Gly-Ser-Gly-, or H-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-.
- the hydropathic index of amino acids can be considered.
- the importance of the hydropathic amino acid index in conferring interactive biologic function on a polypeptide is generally understood in the art. It is accepted that the relative hydropathic character of the amino acid contributes to the secondary structure of the resultant polypeptide, which in turn defines the interaction of the protein with other molecules.
- Each amino acid has been assigned a hydropathic index on the basis of its hydrophobicity and charge characteristics as follows: isoleucine (+4.5); valine (+4.2); leucine (+3.8); phenylalanine (+2.8); cysteine/cystine (+2.5); methionine (+1.9); alanine (+1.8); glycine (-0.4); threonine (-0.7); serine (-0.8); tryptophan (-0.9); tyrosine (-1.3); proline (-1.6); histidine (-3.2); glutamate (-3.5); glutamine (-3.5); aspartate (-3.5); asparagines (-3.5); Lys (-3.9); and Arg (-4.5).
- amino acids can be substituted by other amino acids having a similar hydropathic index or score and still result in a polypeptide with similar biological activity, i.e ., still obtain a biological functionally equivalent polypeptide.
- substitution of amino acids whose hydropathic indices are within ⁇ 2 of each other is preferred, those which are within ⁇ 1 of each other are particularly preferred, and those within ⁇ 0.5 of each other are even more particularly preferred.
- Patent 4,554,101 the following hydrophilicity values have been assigned to amino acid residues: Arg (+3.0); Lys ( ⁇ 3.0); aspartate ( ⁇ 3.0 ⁇ 1); glutamate ( ⁇ 3.0 ⁇ 1); serine (+0.3); asparagine (+0.2); glutamine (+0.2); glycine (0); threonine (-0.4); proline (-0.5 ⁇ 1); alanine (-0.5); histidine (-0.5); cysteine (-1.0); methionine (-1.3); valine (-1.5); leucine (-1.8); isoleucine (-1.8); tyrosine (-2.3); phenylalanine (-2.5); tryptophan (-3.4).
- an amino acid can be substituted for another having a similar hydrophilicity value and still obtain a biologically equivalent, and in particular, an immunologically equivalent polypeptide.
- substitution of amino acids whose hydrophilicity values are within ⁇ 2 of each other is preferred, those which are within ⁇ 1 of each other are particularly preferred, and those within ⁇ 0.5 of each other are even more particularly preferred.
- amino acid substitutions/insertions can be based on the relative similarity of the amino acid side-chain substituents, for example, their hydrophobicity, hydrophilicity, charge, size, and the like.
- Exemplary substitutions i.e ., amino acids that can be interchanged without significantly altering the biological activity of the polypeptide
- substitutions i.e ., amino acids that can be interchanged without significantly altering the biological activity of the polypeptide
- amino acids that take various of the foregoing characteristics into consideration are well known to those skill in the art and include, for example Arg and Lys; glutamate and aspartate; serine and threonine; glutamine and asparagine; and valine, leucine and isoleucine.
- natriuretic peptide (e.g., BNP) analogs can be prepared by a variety of recognized peptide synthesis techniques including, but not limited to, classical (solution) methods, solid phase methods, semi-synthetic methods, and recombinant DNA methods.
- Modifying moieties are moieties that modify the natriuretic compound, such as a BNP peptide compound, and provide the compound with desired properties as described herein.
- the modifying moiety can reduce the rate of degradation of the natriuretic compound in various environments (such as the GI tract, and/or the bloodstream), such that less of the natriuretic compound is degraded in the modified form than would be degraded in the absence of the modifying moiety in such environments.
- Preferred modifying moieties are those which permit the natriuretic compound conjugate to retain a therapeutically significant percentage of the biological activity of the parent natriuretic compound.
- moieties that can be attached to the natriuretic compound to form the natriuretic compound conjugates described herein that modify the stability, solubility, and/or biological activity of the parent natriuretic compound.
- moieties include hydrophilic polymers or oligomers, amphiphilic polymers or oligomers, and lipophilic polymers or oligomers.
- the polymers can include weak or degradable linkages in their backbones.
- the polyalkylene glycols can include hydrolytically unstable linkages, such as lactide, glycolide, carbonate, ester, carbamate and the like, which are susceptible to hydrolysis. This allows the polymers to be cleaved into lower molecular weight fragments. Examples of such polymers are described, for example, in U.S. Patent No. 6,153,211 to Hubbell et al.
- hydrophilic, amphiphilic, and lipophilic polymers and oligomers are described in more detail below.
- the hydrophilic moiety may be various hydrophilic moieties as will be understood by those skilled in the art including, but not limited to, polyalkylene glycol moieties, other hydrophilic polymers, sugar moieties, polysorbate moieties, and combinations thereof.
- Polyalkylene glycols are compounds with repeat alkylene glycol units.
- the units are all identical (e.g., polyethylene glycol or polypropylene glycol).
- the alkylene units are different (e.g., polyethylene-co-propylene glycol, or PLURONICS ® ).
- the polymers can be random copolymers (for example, where ethylene oxide and propylene oxide are co-polymerized) or branched or graft copolymers.
- Polyethylene glycol, or PEG is a preferred polyalkylene glycol, and is useful in biological applications because it has highly desirable properties and is generally regarded as safe (GRAS) by the Food and Drug Administration.
- PEG has the formula -(CH 2 CH 2 O) n -, where n can range from about 2 to about 4000 or more.
- PEG typically is colorless, odorless, water-soluble or water-miscible (depending on molecular weight), heat stable, chemically inert, hydrolytically stable, and generally nontoxic.
- PEG is also biocompatible, and typically does not produce an immune response in the body.
- Preferred PEG moieties of the invention include a number of PEG subunits selected from the following ranges shown in order of increasing preference: 2-50, 2-40, 2-30, 2-25, 2-20, 2-15, 2-10.
- the modifying moieties will include 2, 3, 4, 5, 6, 7, 8,9, or 10 subunits.
- the PEG may be monodispersed (e.g., as previously described by the applicants in U.S. Patent Application Nos. 09/873,731 and 09/873,797, both filed June 4, 2001 the entire disclosures of which are incorporated herein by reference) or polydispersed as commonly supplied on the market.
- monodispersed it is meant that the polyalkylene glycol can have a single molecular weight, or a relatively narrow range of molecular weights.
- One advantage of using the relatively low molecular weight, monodispersed polymers is that they form easily defined conjugate molecules, which can facilitate both reproducible synthesis and FDA approval.
- the PEG can be a linear polymer with a hydroxyl group at each terminus (before being conjugated to the remainder of the natriuretic compound).
- the PEG can also be an alkoxy PEG, such as methoxy-PEG (or mPEG), where one terminus is a relatively inert alkoxy group, while the other terminus is a hydroxyl group (that is coupled to the natriuretic compound).
- the PEG can also be branched, which can in one embodiment be represented as R(-PEG-OH) m in which R represents a central (typically polyhydric) core agent such as pentaerythritol or glycerol, and m represents the number of arms.
- Each branch can be different and can be terminated, for example, with ethers and/or esters.
- the number of arms m can range from three to a hundred or more, and one or more of the terminal hydroxyl groups can be coupled to the remainder of the natriuretic compound, or otherwise subject to chemical modification.
- Other branched PEG include those represented by the formula (CH 3 O-PEG-) p R-Z, where p equals 2 or 3, R represents a central core such as Lys or glycerol, and Z represents a group such as carboxyl that is subject to ready chemical activation.
- the pendant PEG has reactive groups, such as carboxyls, along the PEG backbone rather than, or in addition to, the end of the PEG chains.
- Forked PEG can be represented by the formula PEG(-LCHX 2 ) n is another form of branched PEG, where L is a linking group and X is an activated terminal group.
- polyethylene glycol or PEG represents or includes all forms of linear or branched PEG, and polyalkalene glycol or PEG includes all forms of linear or branched PEG.
- the modifying moiety may be a straight or branched polymeric moiety comprising one or more straight or branched polyalkylene glycol moieties and/or one or more straight or branched, substituted or unsubstituted alkyl moieties.
- the modifying moiety specifically does not consist of an alkyl moiety and in other embodiments, the modifying moiety specifically does not consist of an alkane moiety.
- the polyalkylene glycol moieties in some embodiments include from 2 to 25 polyalkylene glycol subunits, more preferably from 2 to 20, ideally from 2 to 15.
- the polyalkylene glycol moieties in some embodiments comprise PEG.
- the alkyl moieties in some embodiments are preferably from 2 to 20, more preferably from 2 to 15, more preferably from 2 to 10 carbon atoms.
- the alkyl moieties are preferably alkane moieties.
- the modifying moiety has have a formula: wherein each C is independently selected and is an alkyl moiety having m carbons and m is from 1 to 20, preferably 2 to 15, still more preferably 2 to 10; and each PAG is independently selected and is a polyalkylene glycol moiety having n subunits and n is from 2 to 25, preferably 2 to 18, more preferably 2 to 16; each X is independently selected and is a linking moiety coupling PAG to C, and is preferably -C-, -O-, -C(O)-, -NH-, -NHC(O)-, or -C(O)NH-.
- the Cm-X moiety is absent, and the PAGn moiety is terminated with an -OH moiety or an -OCH3 moiety.
- the PAG may be methoxy-terminated or hydroxy-terminated PEG, having 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 subunits.
- the modifying moiety may, for example, have a formula: Wherein each C is independently selected and is an alkyl moiety having m carbons and m is from 1 to 20, preferably I to 15, still more preferably 1 to 10; and each PAG is independently selected and is a polyalkylene glycol moiety having n subunits and n is from 2 to 25, preferably 2 to 18, more preferably 2 to 16; each X is independently selected and is a linking moiety coupling PAG to C, and is preferably consisting of -C-, -O-, -C(O)-, -NH-, -NHC(O)-, or -C(O)NH-; each o is independently selected and is from 1 to 15, preferably 1 to 13, more preferably 1 to 9, more preferably 1 to 6.
- the pharmaceutical characteristics, such as hydrophilicity / lipophilicity of the conjugates according to embodiments of the present invention can be varied by adjusting the number of PEG monomers, the type and length of alkyl chain, the nature of the PEG-peptide linkage, and the number of conjugation sites.
- the exact nature of the PEG-peptide linkage can be varied such that it is stable and/or sensitive to hydrolysis at physiological pH or in plasma.
- the natriuretic compound conjugates of the invention can have a different level of biological activity relative to the corresponding unconjugated natriuretic compound conjugates.
- the natriuretic compound retains some or all of the activity of the unmodified form, but by virtue of factors such as the degree of conjugation with modifying moieties, selection of conjugation sites on the molecule and selection of modifying moieties, is less susceptible to in vivo degradation, and thus, has an increased plasma half life.
- the natriuretic compounds of the invention may be modified to include a modifying moiety at one, two, three, four, five, or more sites on the natriuretic compound structure at appropriate attachment (i.e., modifying moiety conjugation) sites suitable for facilitating the association of a modifying moiety thereon.
- suitable conjugation sites may comprise an amino acid residue, such as a Lys amino acid residue.
- the biologically active agent functions, in part, by binding to an active site in a receptor.
- a functional group such as an amino acid residue
- the agent no longer binds in the active site.
- the peptide has a particular affinity for binding NPR-A.
- the affinity that the BNP has for the receptor may be the same, or may be reduced.
- the natriuretic compound conjugates have less activity than the native, unconjugated natriuretic compound conjugates, but retain improved characteristics relative to unconjugated natriuretic compound conjugates, such as increased resistance to proteolysis and plasma half life or ability to cross a cell membrane. It is envisioned that reduced activity can be preferred, for example, when long term release of the natriuretic compound is desirable.
- the natriuretic compound conjugates are monoconjugates. In other embodiments, the natriuretic compound conjugates are multi-conjugates, such as di-conjugates, tri-conjugates, tetra-conjugates, penta-conjugates and the like. The number of modifying moieties on the natriuretic compound is limited only by the number of conjugation sites on the natriuretic compound. In still other embodiments, the natriuretic compound conjugates of the present invention are a mixture of mono-di-, tri, tetra, and/or penta-modifying moiety conjugates.
- the biologically active natriuretic compound is hBNP, which includes within its 32 native amino acid sequence includes four preferred conjugation sites, including the N-terminus, Lys 3 , Lys 14 and Lys 27 .
- the work of the inventors points to monoconjugates conjugated at the N-terminus, Lys 3 , Lys 14 or Lys 27 , and diconjugates at Lys 3 /Lys 14 and Lys 3 /Lys 27 as highly preferred strategies for hBNP and related natriuretic peptides and analogs.
- the modifying moiety is preferably covalently coupled to the natriuretic compound. More than one moiety on the modifying moiety may be covalently coupled to the natriuretic compound. Coupling may employ hydrolysable or non-hydrolysable bonds or mixtures of the two (i.e., different bonds at different conjugation sites).
- the natriuretic compound is coupled to the modifying moiety utilizing a hydrolysable bond (e.g., an ester, carbonate or carbamate bond).
- a hydrolysable bond e.g., an ester, carbonate or carbamate bond.
- a prodrug approach may be desirable where the natriuretic compound-modifying moiety conjugate is inactive (i.e., the conjugate lacks the ability to affect the body through the natriuretic compound's primary mechanism of action), such as when the modifying moiety conjugation site is in a binding region of natriuretic compound.
- Use of a hydrolyzable coupling can also provide for a time-release or controlled-release effect, administering the natriuretic compound over a given time period as one or more modifying moieties are cleaved from their respective natriuretic compound-modifying moiety conjugates to provide the active drug.
- the natriuretic compound is coupled to the modifying moiety utilizing a non-hydrolyzable bond (e.g., a carbamate, amide, or ether bond).
- a non-hydrolyzable bond may be preferable when it is desirable to allow the natriuretic compound-modifying moiety conjugate to circulate in the bloodstream for an extended period of time, preferably at least 2 hours.
- Bonds used to covalently couple the natriuretic compound to the modifying moiety in a non-hydrolysable fashion are typically selected from the group consisting of covalent bond(s), ester moieties, carbonate moieties, carbamate moieties, amide moieties and secondary amine moieties.
- a partial prodrug approach may be used, in which a portion of the modifying moiety is hydrolyzed.
- U.S. Patent 6,309,633 (the entire disclosure of which is incorporated herein by reference) describes modifying moieties comprising hydrophilic and lipophilic components in which the lipophilic components hydrolyze in vivo to yield a micropegylated conjugate.
- More than one modifying moiety may be coupled to the natriuretic compound.
- the modifying moieties in the plurality are preferably the same. However, it is to be understood that the modifying moieties in the plurality may be different from one another, or, alternatively, some of the modifying moieties in the plurality may be the same and some may be different.
- all of the bonds coupling the plurality of modifying moieties to the natriuretic compound may be hydrolyzable, but have varying degrees of hydrolyzability such that, for example, one or more of the modifying moieties may be rapidly removed from the natriuretic compound by hydrolysis in the body and one or more of the modifying moieties is slowly removed from the natriuretic compound by hydrolysis in the body.
- the modifying moiety may be coupled to the natriuretic compound at various nucleophilic residues of the drug including, but not limited to, nucleophilic hydroxyl functions and/or amino functions. Nucleophilic hydroxyl functions may be found, for example, at serine and/or tyrosine residues, and nucleophilic amino functions may be found, for example, at histidine and/or Lys residues, and/or at the one or more N-terminus of the polypeptide. When a modifying moiety is coupled to the N-terminus of the natriuretic peptide, coupling preferably forms a secondary amine.
- reaction conditions e.g., selected molar ratios, solvent mixtures and/or pH
- conjugation at the amino functionality of Lys may be suppressed by maintaining the pH of the reaction solution below the pK a of Lys.
- the mixture of natriuretic compound conjugates may be separated and isolated utilizing, for example, HPLC to provide natriuretic compound conjugates, for example mono-, di-, or tri-conjugates.
- the degree of conjugation e.g., whether the isolated molecule is a mono-, di-, or tri-conjugate
- a particular isolated conjugate may be determined and/or verified utilizing various techniques as will be understood by those skilled in the art including, but not limited to, mass spectroscopy.
- the particular conjugate structure (e.g., Lys 3 , Lys 14 , Lys 27 , or the N-terminus of hBNP monoconjugate) may be determined and/or verified utilizing various techniques as will be understood by those skilled in the art including, but not limited to, sequence analysis, peptide mapping, selective enzymatic cleavage, and/or endopeptidase cleavage.
- One or more of the reaction sites on the natriuretic compound may be blocked by, for example, reacting the natriuretic compound with a suitable blocking reagent such as N-tert-butoxycarbonyl (t-BOC), or N-(9-fluorenylmethyloxycarbonyl) (N-FMOC).
- a suitable blocking reagent such as N-tert-butoxycarbonyl (t-BOC), or N-(9-fluorenylmethyloxycarbonyl) (N-FMOC).
- This process may be preferred, for example, when it is desired to form an unsaturated natriuretic compound conjugate (i.e., a conjugate wherein not all nucleophilic residues are conjugated) having a modifying moiety at one or more of the N-terminus of the polypeptide.
- the substantially monodispersed mixture of blocked natriuretic compounds may be reacted with the substantially monodispersed mixture of activated modifying moieties to provide a mixture of natriuretic compound conjugates having modifying moiety(s) coupled to one or more nucleophilic residues and having blocking moieties coupled to other nucleophilic residues.
- the natriuretic compound-modifying moiety conjugates may be de-blocked as will be understood by those skilled in the art. If necessary, the mixture of natriuretic compound conjugates may then be separated as described above to provide a mixture of natriuretic compound conjugates. Alternatively, the mixture of natriuretic compound-modifying moiety conjugates may be separated prior to de-blocking.
- compositions including the natriuretic compound conjugates described herein can be prepared. Such compositions typically include the modified natriuretic compound in combination with, or in admixture with, a pharmaceutically acceptable carrier.
- the carrier must, of course, be acceptable in the sense of being compatible with any other ingredients in the pharmaceutical composition and should not be deleterious to the patient.
- the carrier may be a solid or a liquid, or both, and is preferably formulated with the prodrug as a unit-dose formulation, for example, a tablet, which may contain from about 0.01 or 0.5% to about 95% or 99% by weight of the natriuretic compound conjugate.
- the pharmaceutical compositions may be prepared by any of the well-known techniques of pharmacy including, but not limited to, admixing the components, optionally including one or more accessory ingredients.
- compositions according to embodiments of the present invention include those suitable for oral, rectal, nasal, topical, inhalation (e.g., via an aerosol) buccal (e.g., sub-lingual), vaginal, parenteral (e.g., subcutaneous, intramuscular, intradermal, intraarticular, intrapleural, intraperitoneal, intracerebral, intraarterial, or intravenous), topical (i.e., both skin and mucosal surfaces, including airway surfaces) and transdermal administration, although the most suitable route in any given case will depend on the nature and severity of the condition being treated and on the nature of the particular prodrug which is being used.
- buccal e.g., sub-lingual
- vaginal e.g., parenteral (e.g., subcutaneous, intramuscular, intradermal, intraarticular, intrapleural, intraperitoneal, intracerebral, intraarterial, or intravenous)
- parenteral e.g., subcutaneous,
- compositions suitable for oral administration may be presented in discrete units, such as capsules, cachets, lozenges, or tablets, each containing a predetermined amount of the prodrug; as a powder or granules; as a solution or a suspension in an aqueous or non-aqueous liquid; or as an oil-in-water or water-in-oil emulsion.
- Such formulations may be prepared by any suitable method of pharmacy that includes the step of bringing into association the prodrug and a suitable carrier (which may contain one or more accessory ingredients as noted above).
- the pharmaceutical composition according to embodiments of the present invention are prepared by uniformly and intimately admixing the prodrug with a liquid or finely divided solid carrier, or both, and then, if necessary, shaping the resulting mixture.
- a tablet may be prepared by compressing or molding a powder or granules containing the prodrug, optionally with one or more accessory ingredients.
- Compressed tablets may be prepared by compressing, in a suitable machine, the mixture in a free-flowing form, such as a powder or granules optionally mixed with a binder, lubricant, inert diluent, and/or surface active/dispersing agent(s).
- Molded tablets may be made by molding, in a suitable machine, the powdered compound moistened with an inert liquid binder.
- compositions suitable for buccal (sub-lingual) administration include lozenges comprising the prodrug in a flavored base, usually sucrose and acacia or tragacanth; and pastilles comprising the prodrug in an inert base such as gelatin and glycerin or sucrose and acacia.
- compositions according to embodiments of the present invention suitable for parenteral administration comprise sterile aqueous and non-aqueous injection solutions of the prodrug, which preparations are preferably isotonic with the blood of the intended recipient. These preparations may contain anti-oxidants, buffers, bacteriostats and solutes which render the composition isotonic with the blood of the intended recipient.
- Aqueous and non-aqueous sterile suspensions may include suspending agents and thickening agents.
- compositions may be presented in unit ⁇ dose or multi-dose containers, for example sealed ampoules and vials, and may be stored in a freeze-dried (lyophilized) condition requiring only the addition of the sterile liquid carrier, for example, saline or water-for-injection immediately prior to use.
- sterile liquid carrier for example, saline or water-for-injection immediately prior to use.
- Extemporaneous injection solutions and suspensions may be prepared from sterile powders, granules and tablets of the kind previously described.
- an injectable, stable, sterile composition comprising a prodrug in a unit dosage form in a sealed container may be provided.
- the prodrug is provided in the form of a lyophilizate which is capable of being reconstituted with a suitable pharmaceutically acceptable carrier to form a liquid composition suitable for injection thereof into a subject.
- the unit dosage form typically comprises from about 10 mg to about 10 grams of the prodrug.
- a sufficient amount of emulsifying agent which is physiologically acceptable may be employed in sufficient quantity to emulsify the prodrug in an aqueous carrier.
- emulsifying agent is phosphatidyl choline.
- compositions suitable for topical application to the skin preferably take the form of an ointment, cream, lotion, paste, gel, spray, aerosol, or oil.
- Carriers which may be used include petroleum jelly, lanolin, polyethylene glycols, alcohols, transdermal enhancers, and combinations of two or more thereof.
- compositions suitable for transdermal administration may be presented as discrete patches adapted to remain in intimate contact with the epidermis of the recipient for a prolonged period of time.
- Compositions suitable for transdermal administration may also be delivered by iontophoresis (see, for example, Pharmaceutical Research 3 (6):318 (1986 )) and typically take the form of an optionally buffered aqueous solution of the prodrug.
- Suitable formulations comprise citrate or bis ⁇ tris buffer (pH 6) or ethanol/water and contain from 0.1 to 0.2M active ingredient.
- natriuretic compound conjugates and pharmaceutical formulations of the invention exhibit one or more improved characteristics relative to the unmodified (unconjugated) biologically active natriuretic compound
- the addition of the modifying moiety can protect the biologically active natriuretic compound, from degradation in various environments (such as the gastrointestinal tract (GI tract)), such that less of it is degraded in the unmodified form than would be degraded in the absence of the modifying moiety in such environments.
- certain modified forms of the invention can be orally administered in a dosage that ultimately provides a pharmaceutically acceptable amount of the biologically active natriuretic compound in systemic circulation.
- natriuretic compound can survive in the GI tract and enter the bloodstream such that the biologically active natriuretic compound is systemically present in a pharmacologically active amount sufficient to trigger production of cGMP.
- the addition of the modifying moiety improves the delivery of orally administered unconjugated natriuretic compound into the bloodstream upon oral administration relative to the delivery of orally administered unconjugated natriuretic compound into the bloodstream. More preferably, the improvement of the delivery of active compound into the bloodstream for orally administered natriuretic compound conjugates is at least 2 times the delivery of orally administered unconjugated parent biologically active natriuretic compound, into the bloodstream.
- the improvement of the delivery of active compound into the bloodstream for orally administered natriuretic compound conjugates is at least 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 300, 400, or 500 times the delivery of orally administered unmodified (unconjugated) biologically active natriuretic compound, into the bloodstream.
- administration of the natriuretic compound conjugates of the invention can provide greater bioavailability of the biologically active natriuretic compound relative to administration of unmodified biologically active natriuretic compound.
- An oral route of administration may reduce hospital costs associated with other CHF therapies and/or expand the therapeutic use of hBNP to include early stage and chronic CHF as well as acute CHF.
- the invention provides a method of preparing a medicament for treating a disease condition susceptible to treatment using a natriuretic peptide compound by administering to a subject in need thereof a therapeutically effective amount of a natriuretic compound conjugate of the invention.
- the natriuretic compound conjugate may be suitably administered by a variety of routes, including for example, parenteral and enteral routes. Examples of preferred routes include oral, subcutaneous, sublingual, buccal, nasal, intravenous and intramuscular.
- natriuretic compound conjugates for the treatment of heart failure.
- the natriuretic compound conjugates can be presented as a monotherapy, preferably in an oral dosage form alone.
- the natriuretic compound conjugates may be used together with more conventional therapeutic agents as part of a combination therapy.
- the primary categories of drugs that are currently used include the following:
- Diuretics alleviate the fluid accumulation and resultant stretching of the heart associated with CHF.
- Vasodilators expand arteries and veins, allowing for increased blood flow.
- Inotropic agents increase the force of contraction of cardiac muscle.
- Digitalis drugs - increase force of contraction of the heart and reduce heart rate.
- Angiotensin converting enzyme (ACE) inhibitors inhibit the production of the vasoconstrictor angiotensin II in the last stage of its synthesis.
- Angiotensin receptor blockers (ARB's) - permit angiotensin to be produced, but inhibit its arterial activity.
- Calcium channel blockers - inhibit calcium influx, resulting in vascular and smooth muscle relaxation.
- Beta-blockers block the action of catecholamines, resulting in less stress on the heart and lower force and rate of contraction.
- natriuretic compound conjugates can be considered first in relation to the other approaches to treat CHF and compared to the current use of the natriuretic peptide in its unmodified form, that is continuously infused.
- the oral natriuretic compound conjugates of the invention exhibit natriuretic and diuretic properties that may be expected to relieve congestion through the elimination of sodium and excess water. Such functions are currently addressed with diuretics and potassium supplements.
- the natriuretic compound conjugates of the invention are expected to possess vascular and myocardial relaxant properties that are currently effected using vasodilators, calcium channel blockers, and nitrates.
- the natriuretic compound conjugates of the invention are expected to inhibit the renin-angiotensin-aldosterone system (RAAS) currently effected using ACE inhibitors and ARB's. Moreover, the natriuretic compound conjugates are expected to lack the negative effects and risk of sudden death associated with the inotropic and digitalis drugs. The natriuretic compound conjugates may have many, if not all, of the benefits of several groups of cardiovascular drugs while having a reduced amount of or lacking the negative effects of conventional therapies.
- RAAS renin-angiotensin-aldosterone system
- NATRECOE neuropeptide, made by Scios, Inc., Sunnyvale, CA
- Some of the advantages can be attributed to the enhanced pharmacokinetic profile that amphiphilic oligomers according to embodiments of the present invention provide.
- resistance to degradation by proteases such as NEP
- a significant advantage may result from the ability of BNP or ANP conjugated with such oligomers to be delivered orally.
- NATRECOR ® is dosed by continuous infusion over 48 hours and carries a high cost per dose plus hospital costs.
- An oral hBNP compound conjugate according to embodiments of the present invention may be dosed at an overall lower cost, and may be available on an outpatient basis and may be self-administered.
- oral conjugates according to embodiments of the present invention can be used for those suffering with the gradual onset of chronic CHF.
- the ease of administration, reduced demand on hospital resources, and/or lower cost support the utility of an the natriuretic compound conjugates as a preventative therapy, self administered (e.g., at home) for those patients who are at high risk of heart failure.
- Oral preparations of the hBNP compound conjugate according to embodiments of the present invention are thus expected to have many, if not all the benefits of Natrecor ® , with the advantages of an improved pharmacokinetic profile, greater ease of administration, reduced hospitalization expenses, expansion of indication to include chronic CHF, and/or utility in early-stage cardiovascular disease.
- Subjects taking or inclined to take the parent natriuretic compound can alternatively (or additionally) take the natriuretic compound preparation described herein.
- patients suffering from disorders that are conventionally treated using a parenterally administered natriuretic compound, such as NATRECOR ® can be treated using an effective amount of the modified form of that agent described herein.
- the natriuretic compound can be administered via inhalation or, more preferably, oral administration.
- the invention provides a method of delivering a biologically active agent to a subject, wherein the biologically active agent is orally administered as a component of a modified natriuretic compound of the invention, a portion of the orally administered natriuretic compound survives intact in the GI tract and traverses the intestinal wall to enter the bloodstream, and after leaving the GI tract, some or all of the natriuretic compound is hydrolyzed in vivo to yield a pharmaceutically acceptable amount of the biologically active agent.
- the hydrolysis may, for example, take place in the bloodstream or in the liver.
- the modified forms of the natriuretic compound enhances the oral bioavailability of the orally administered biologically active agent relative to the oral bioavailability of a corresponding orally administered unconjugated biologically active agent.
- any natriuretic the use of which is in the scope of present invention, will vary somewhat from agent to agent, and patient to patient, and will depend upon factors such as the age and condition of the patient and the route of delivery. Such dosages can be determined in accordance with routine pharmacological procedures known to those skilled in the art. As a general proposition, a dosage from about 0.1 to about 50 mg/kg will have therapeutic efficacy, with all weights being calculated based upon the weight of the patient. Toxicity concerns at the higher level may restrict intravenous dosages to a lower level such as up to about 10 mg/kg, with all weights being calculated based upon the weight of the active base. A dosage from about 10 mg/kg to about 50 mg/kg may be employed for oral administration.
- a dosage from about 0.5 mg/kg to 5 mg/kg may be employed for intramuscular injection.
- the frequency of administration is usually one, two, or three times per day or as necessary to control the condition.
- the duration of treatment depends on the type of condition being treated and may be for as long as the life of the patient.
- Suitable subjects to be treated according to the present invention include, but are not limited to, avian and mammalian subjects, preferably mammalian. Mammals according to the present invention include but are not limited to canine, felines, bovines, caprines, equines, ovines, porcines, rodents ( e.g . rats and mice), lagomorphs, primates, humans, and the like, and encompass mammals in utero. Any mammalian subject in need of being treated according to the present invention is suitable. Human subjects are preferred. Human subjects of both genders and at any stage of development ( i.e ., neonate, infant, juvenile, adolescent, adult) can be treated according to the present invention.
- Illustrative avians according to the present invention include chickens, ducks, turkeys, geese, quail, pheasant, ratites ( e.g ., ostrich) and domesticated birds ( e.g ., parrots and canaries), and include birds in ovo.
- ratites e.g ., ostrich
- domesticated birds e.g ., parrots and canaries
- Natriuretic peptide analogs of the invention may induce the cardiovascular, renal, and/or endocrine effects that are associated with the native peptide.
- Cell based assays may be used to show which conjugates are proficient agonists of the human natriuretic peptide receptor A, leading to the suitable production of cGMP.
- Biochemical assays may be used to show which conjugates offer the suitable protection against proteolytic enzymes.
- In vivo experiments may be used to show which conjugates afford a desirable bioavailability. Leading conjugates can be tested in established dog models. Desirable candidates may be subjected to detailed pharmacokinetic, pharmacodynamic, and toxicity studies in rats and dogs.
- BNP conjugates according to embodiments of the present invention will be useful for the treatment of early-stage, chronic, and acute congestive heart failure.
- novel peptides and novel conjugates of the invention can be tested for agonist activity at the human natriuretic peptide receptor A (NPR-A) in vitro.
- NPR-A human natriuretic peptide receptor A
- the vasorelaxant, natriuretic, and diuretic properties of BNP are ascribed to a secondary messenger, cyclic GMP (cGMP).
- the production of cGMP is accomplished by guanylate cyclase, an enzyme that is activated when BNP binds to NPR-A.
- cGMP production can be measured in cultures of human aortic endothelial cells that endogenously express NPR-A.
- the relative activity of the natriuretic compound conjugates and natriuretic peptide analogs of the invention can be determined by the level of cGMP production in these cells.
- the conjugates of the invention can be tested for increased resistance to proteases.
- drugs that are delivered orally are subjected to digestive enzymes such as pepsin, trypsin, and/or chymotrypsin.
- these enzymes may be particularly problematic.
- peptide conjugation has been shown to increase resistance to these enzymes.
- Digestive enzyme cocktails can be used to test for increased resistance of hBNP conjugates and other conjugates of the invention to proteases of the digestive tract.
- Natriuretic compound conjugates are preferably less susceptible to proteolytic degradation than corresponding unconjugated natriuretic compounds, i.e., the conjugates digest more slowly than the corresponding unconjugated compound.
- the conjugates can be tested for oral bioavailability. Oral bioavailability of the conjugates can be tested in rats, for example.
- the conjugates can be administered to the gastrointestinal tract by oral gavage and the presence of hBNP conjugates in the bloodstream can be assayed using available radioimmunoassay procedures.
- Conjugates according to embodiments of the present invention may preferably be orally and/or perorally available, i.e., a therapeutically significant amount of the conjugate can be delivered by the oral and/or peroral routes.
- the conjugate may retain some or all of the activity of native natriuretic peptide (e.g., hBNP) with the additional benefits of oral administration.
- hBNP native natriuretic peptide
- Such a compound may lower costs associated with treatment of acute CHF and/or expand the applicability of this therapeutic to include early stage and chronic CHF:
- the invention provides a method of generating data comprising assaying a natriuretic compound assaying a natriuretic compound conjugate of the invention or a series of such natriuretic compound conjugates, and compiling data resulting from such assaying.
- the data itself is therefore understood to constitute yet another embodiment of the invention, as well as the use of this data.
- Hexaethyleneglycol monohexadecyl ether, I (0.202 g, 0.4 mmol) was dissolved in acetonitrile (5 mL) and disuccinimidyl carbonate (DSC, 0.157 g , 0.6 mmol) was added. Then triethylamine (0.12 g , 1.2 mmol) was added dropwise and after 10 min the reaction mixture became clear. Reaction was stirred overnight at RT. After stirring for ⁇ 16 hours, the crude reaction was evaporated to dryness and then dissolved in saturated NaHCO 3 (10 mL), washed with ethyl acetate (2 x 20 mL), dried over MgSO 4 , and evaporated to dryness.
- DSC disuccinimidyl carbonate
- Monodispersed mPEG7-C16-acid V (324 mg, 544 mmol) was dissolved in 15 ml of anhydrous methylene chloride and then solution of N-hydroxysuccinimide (94 mg, 816 mmol) and 1-ethyl-3-(3'-dimethylaminopropyl) carbodiimide.
- HCl EDCI ⁇ HCl, 156 mg, 816 mmol
- Reaction was stirred for 24 hours, then washed with 1N HCl, water, dried over MgSO filtered and concentrated. Crude material was purified by flash chromatography (silica, gradient elution: 2-5 % methanol in CHCl 3 ), to afford monodispersed activated MPEG7-C16 VI as a clear oil (290 mg, 77%).
- Monodispersed mPEG7-C12-acid I 500 mg, 0.78 mmol was dissolved in 20 ml of anhydrous methylene chloride and then solution of N-hydroxysuccinimide (160 mg, 1.39 mmol) and 1-ethyl-3-(3'-dimethylaminopropyl)carbodiimide.
- HCl EDCI ⁇ HCl, 233 mg, 1.390 mmol
- Reaction was stirred for 24 hours, then washed with 1N HCl, water, dried over MgSO 4 , filtered and concentrated. Crude material was purified by flash chromatography (silica, gradient elution: 2-5 % methanol in CHCl 3 ), to afford monodispersed activated MPEG7-C16 VI as a clear oil (370 mg, 62%).
- Carboxylic acid III (0.80 g, 1.95 mmol) was dissolved in 16 mL CH 2 Cl 2 and placed under N 2 . To the solution, 0.486 g (2.5 mmol) EDC and 0.288 g (2.5 mmol) N-hydroxysuccinimide (NHS) were added. After five hours, another 0.2 g EDC and 0.12 g NHS were added to drive reaction to completion. When TLC indicated that no unreacted carboxylic acid remained, the mixture was diluted with 60 mL CH 2 Cl 2 and washed with cold 1N HCl (1x 100 mL), cold water (2 x 100 mL) and brine (3 x 100 mL).
- the oligomer IV (0.562 g, 1.09 mmol) was dissolved in 15 mL dry CH 2 Cl 2 . To this solution was added 0.23 mL (1.64 mmol) TEA and 0.329 g (1.64 mmol) p-nitro-phenylchloroformate. The reaction was stirred overnight at room temperature. The mixture was then diluted with a further 15 mL CH 2 Cl 2 and washed with 15 mL 1N HCl followed by 15 mL water. The organics were dried over MgSO 4 , filtered and concentrated to dryness.
- a solution of 1,6-hexanediol was prepared from 6.311 g of the diol (53.41 mmol) and 180 mL of dry THF. The solution was cooled to 0 °C and placed under a N 2 atmosphere. Potassium tert -butoxide (5.996 g, 53.41 mmol) was added to the solution and the resulting mixture was stirred for one hour. I (10.0 g, 26.7 mmol) in 30 mL THF was added to the mixture. All was stirred for a further 30 minutes at 0 °C, then allowed to warm to room temperature and stirred overnight. The reaction mixture was filtered through Celite.
- the oligomer V (0.605 g, 1.09 mmol) was dissolved in 15 mL dry CH 2 Cl 2 . To this solution was added 0.23 mL (1.64 mmol) TEA and 0.329 g (1.64 mmol) p -nitro-phenylchloroformate. The reaction was stirred overnight at room temperature. The mixture was then diluted with a further 15 mL CH 2 Cl 2 and washed with 15 mL 1N HCl followed by 15 mL water. The organics were dried over MgSO 4 , filtered and concentrated to dryness.
- the present example describes methods by which a oligomeric moiety of the present invention may be activated.
- MPEG-alkyl-acid I (0.544 mmol, 1.0 eq.) was dissolved in 15 ml of anhydrous methylene chloride and then solution of N-hydroxysuccinimide (0.816 mmol, 1.5 eq.) and 1-ethyl-3-(3'-dimethylaminopropyl) carbodiimide.
- HCl (EDCI ⁇ HCl, 0.816 mmol, 1.5 eq.) in anhydrous methylene chloride added. Reaction was stirred for several hours, then washed with 1N HCl, water, dried over MgSO 4 , filtered and concentrated. Crude material was purified by flash chromatography (silica, gradient elution: 2-5 % methanol in CHCl 3 ), to afford activated MPEG-alkyl-acid II .
- the present example is provided to demonstrate the utility of the present invention for providing natriuretic compound conjugates that have been modified to include virtually all classes of oligomeric moieties, particularly non-hydrolyzed oligomers, micropegylated oligomers, and hydrolyzable oligomers.
- the present hBNP conjugates were synthesized utilizing various oligomers conjugated at different positions on the peptide.
- the conjugates having the best combination of traits have become the lead candidates for more extensive in vivo testing.
- the native hBNP was obtained from a contract peptide synthesis company.
- the amphiphilic oligomers that were used in the conjugation came from a supply of oligomers and from oligomers designed and synthesized specifically for conjugation to hBNP.
- the conjugation followed a three-tiered conjugation strategy as illustrated in Figure 2 .
- Class 1 oligomers were tested first. Because extensive conjugation with Class 1 oligomers lessened activity, tri and tetra conjugates with Class 2 oligomers were investigated. Because Class 2 oligomers were not as efficacious, two pro-drug conjugates (Class 3 oligomers) were evaluated.
- a first class of conjugates is non-hydrolysable.
- the drug substance that is dosed i.e., the conjugate
- the conjugate is the substance that acts at the receptor.
- the oligomer and its attachment to the peptide remain intact from the time of dosing to the time of clearance.
- These oligomers may generally be comprised of an alkyl portion and a PEG portion.
- the lengths of the alkyl and PEG portions can be altered and the order can be switched.
- the extent of conjugation (e.g. mono-, diconjugate) can also be manipulated.
- a second class of conjugates are micropegylated.
- the alkyl portion of the oligomer is cleaved once the conjugate is in the bloodstream.
- These conjugates may be particularly useful when conjugation occurs within a region of the natriuretic pepide that is necessary for binding to receptor, NPR-A.
- the first class of oligomers may be beneficial to stability and delivery, but may be detrimental to activity.
- the second class of conjugates reduces or eliminates that problem.
- the amphiphilic oligomer remains intact through the digestive tract and enhances absorption in the upper duodenum. Once in circulation, the alkyl portion is cleaved.
- a smaller oligomer is attached to the circulating peptide when it reaches the receptor.
- the decreased steric hindrance leads to increased activity at the receptor.
- a third class of conjugates is fully hydrolysable.
- the entire oligomer is cleaved once the conjugate is absorbed.
- these conjugates may be particularly useful when conjugation occurs within a region that is necessary for binding.
- the third class of conjugates may completely obviate the possibility of the oligomer interfering with receptor binding. In this case, the conjugate remains intact through the digestive tract. Once the conjugate is absorbed, the oligomer is cleaved, which releases the native peptide in circulation.
- hBNP Conjugation of hBNP.
- the carboxyl group of the amphiphilic oligomer (C 6 PEG 7 ) is activated with N-hydroxy succinimide, a common activating group in peptide chemistry. Once activated, the oligomers are attached to the peptide either in aqueous or DMSO solution.
- hBNP has four sites for conjugation: three Lys residues and the N-terminus.
- PEG-alkyl Oligomers By varying the relative length of the alkane (hydrophobic) and PEG (hydrophilic) components, the amphiphilicity and solution structure of the conjugate can be improved.
- the PEG portion is very flexible in solution and may play an important role in resistance to enzymes.
- the alkyl portion may enhance absorption in the gut and/or enable interaction with cell membranes. The latter feature may be particularly important when the target is a membrane-bound protein on the cell surface, such as NPR-A.
- the choice of the oligomer may determine the effectiveness of the conjugate in terms of enzyme stability and oral bioavailability.
- hBNP Conjugates Purification of hBNP Conjugates.
- the reaction mixtures are purified on a preparative HPLC column (C-18) with a solvent gradient system made of isopropanol/water (0.1% trifluoroacetic acid). The solvent is evaporated and lyophilized to give dry products. Purity of the conjugates is determined by reversed-phase HPLC and mass spectrometry.
- the triconjugate and or tetraconjugate could be formed as the exclusive product.
- the triconjugate featured oligomer attachment at Lys3, Lys14, and Lys27.
- the tetra conjugate added a fourth attachment at the N-terminus. Initially all the available mono, di, tri, and tetra conjugates were isolated for testing activity in vitro. Based on the activity data, the Lys3 monoconjugates when using Class I oligomers were focused.
- micropegylation (Class 2) was synthesized based on the theory that, because Lys14 and Lys27 are in (or proximal to) the binding portion of BNP, micropeg conjugation of these sites would enable the peptide to be more fully conjugated and still retain activity.
- the amphiphilic oligomer remains intact through the digestive tract and enhances absorption in the upper duodenum. Once in circulation, the alkyl portion is cleaved. Thus, a smaller oligomer is attached to the circulating peptide when it reaches the receptor.
- Tri- and tetra- conjugates of this class were synthesized both before and after cleavage of the alkyl group. Even after the alkyl groups were cleaved, small PEG units attached to BNP at three or four sites were detrimental to activity (data shown in the next section), though these conjugates retained a therapeutically significant degree of activity.
- reaction mixtures were purified on a preparative HPLC column (C18) with a solvent gradient system made of isopropanol/water (0.1% trifluoroacetic acid). The solvent was evaporated and lyophilized to provide the conjugates was dry powders. Purities of the conjugates were determined by reverse-phase HPLC and mass spectrometry.
- Native BNP was examined in the assay to provide a measure of activity for the native, wild-type hBNP peptide.
- the native hBNP peptide used was the 1-32 amino acid sequence, SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH, (SEQ ID NO: ) in which C 10 and C 26 are joined by a disulfide bond to form a bond.
- SEQ ID NO: The results and structures of twenty-nine of the constructs are provided in Table 1.
- the BNP conjugates were assessed for EC50 and Emax, and these values were compared to those obtained under the same experimental conditions for the native peptide. These data as compared to native BNP (1-32 aa) without an oligomeric moiety are provided in Table 1.
- the mono-1, mono-2, mono-3 and mono-4 are the monoconjugates of BNP and labeled as in the order they elute on HPLC.
- the mono-1 BNP is the BNP peptide conjugate that that includes the indicated modifying moiety (oligomer structure) at the Lys-3 BNP residue.
- the mono-2 and mono-3 co-elute on HPLC and its a mixture of Lys-14 and Lys-27.
- the diconjugates are generally obtained as a mixtures that elute closely together on HPLC.
- the major diconujates are Lys3/Lys14 and Lys3/Lys27.
- the predominant triconjugate is conjugated at Lys3, Lys14, and Lys27.
- the product identified as "mono-4" includes the modifying moiety (oligomer) at the N-terminus of the BNP peptide.
- the "mono-1” includes the modifying moiety conjugated at Lys3 of the BNP peptide.
- the "mono-2” product includes the modifying moiety (oligomer) conjugated at Lys 14 of the BNP peptide, or at Lys 27 of the BNP peptide.
- these candidate peptides include by way of a partial list, peptides, peptide fragments and whole peptides, and multi-constructs peptides prepared and/or isolated from the following assembly of bioequivalent peptides/proteins.
- cGMP cyclic GMP
- the production of cGMP is accomplished by guanylate cyclase, an enzyme that is activated when BNP binds to the natriuretic peptide receptor A (NPR-A) on the surface of endothelial cells.
- NPR-A natriuretic peptide receptor A
- the ability of the conjugates with either non-hydrolyzable (Class 1) or micropegylated (Class 2) oligomers to stimulate the production of cGMP in human aortic endothelial cells (HAEC) expressing the natriuretic peptide receptor-A (NPR-A) was evaluated.
- the conjugates were tested with and without the alkyl portion attached.
- the conjugates with fully hydrolyzable oligomers (Class 3) were not evaluated in this assay because the compound that is ultimately released in circulation is the native peptide.
- Tri- and tetra-conjugates utilizing non-hydrolyzable (Class 1) oligomers were less active. Therefore, tri- and tetra-conjugates utilizing micropegylated (Class 2) oligomers were prepared and tested. The in vitro data generated from these Class 2 oligomers is presented in Table 2.
- Figure 3 shows the activity curves for various Lys-3 conjugates utilizing Class 1 oligomers.
- the four conjugates in Table 2 demonstrates an average E max and an average EC 50 closest to those the activity obtained with native forms of the BNP peptide ( Table 3 ) and were thus evaluated further in other assays.
- HAEC Primary HAEC were purchased from Clonetics for cGMP screening. Cells were plated into 12 well plates the day before the experiment. On the day of the experiment, cells were pre-incubated for 10 min at 37 °C with 0.5 mM IBMX to inhibit phosphodiesterases. Test compounds were added to the cells for an additional 60 min at 37 °C and the incubation was stopped by lysing cells to measure cGMP.
- An ELISA-based cGMP kit was used to measure cGMP production (CatchPoint-cyclic GMP Fluorescent Assay Kit, catalog #R8074, Molecular Devices Corp, Sunnyvale, CA). This kit measures cGMP via a competitive immunoassay in 96-well format.
- the natriuretic compound that were active in vitro are being tested for their stability in the presence of various proteases, such as trypsin and chymotrypsin.
- the stability of these compounds conjugated to proteases can be determined by the half-lives of the compound conjugates in the presence of trypsin and chymotrypsin.
- several conjugates evaluated in these assays had a longer half-life than did native hBNP. For example, see Figure 4 .
- Conjugates were incubated with the enzyme for 2 to 120 minutes at 37°C. Digestions were stopped by adding a 1:1 1% trifluoroacetic acid (TFA): isopropanol quenching solution. Digestion of the hBNP conjugates were compared to the digestion of native hBNP in each experiment. The amount of parent compound remaining in each sample was quantitated by HPLC analysis.
- TFA trifluoroacetic acid
- the conjugates that were active in vitro were tested for their oral bioavailabily in rats.
- the conjugates were administered to the gastrointestinal tract by oral gavage and the presence of hBNP conjugates in the bloodstream was assayed using available radioimmunoassay procedures.
- the antibodies for detection of hBNP are specific; cross reactivity with rat BNP is less than 1%. Consequently, cross reactivity and interference by endogenous rat BNP was not an issue.
- Rats were fasted overnight and tap water was provided ad libitum (except for a period of no water for 2 hours pre-dosing until 1 hour post dosing).
- rat Prior to dosing, rats were weighed and distributed throughout the dosing groups by body weight so that each dosing group weighed approximately the same. Five rats were used per time point. Conjugates were administered in a liquid fatty acid formulation at a dose of 2.5 mg/kg. Blood samples were taken at 5, 15, 30, and 60 min after dosing. Central venous blood for all dosing experiments was collected and centrifuged. Plasma samples were frozen at -80 °C for analysis.
- hBNP conjugates were measured by a commercial immunoradiometric assay (IRMA) specific for the quantitative determination of human BNP in plasma (SHIONORIATM BNP, Catalog # 127024, Shionogi & Co., Ltd, Osaka, Japan).
- IRMA immunoradiometric assay
- Plasma EDTA coated plastic polyethylene telepthalate
- Samples were stored in plastic tubes at -80 °C in non-frost free freezers until analysis. 500 ⁇ L of sample were used for the IRMA.
- the four conjugates that were dosed in rats were all detectable in circulation five minutes after dosing ( Figure 5 ). These four conjugates were BNP-002, BN-021, BN-022, and BN-024.
- the present example is provided to demonstrate the utility for the present invention in the creation of multi-conjugate forms of the bioactive peptide of choice.
- the present description will describe a monoconjugate, a diconjugate and a triconjugate form of the human natriuretic peptide, hBNP. Protocol for conjugating to hBNP:
- the oligomers would be attached via the same procedure used for conjugation to hBNP. One difference will be more of the activated oligomer may be added (1 - 10 equivalents; preferably 3-5 equivalents).
- Lysines are in the tails of the sequence. Multiple conjugation sites would presumably afford greater stability in the presence of proteases. The lack of conjugation sites within the loop is advantageous for binding at the NPR-A binding motif.
- a peptide conjugate such as hBNP conjugate
- Conjugate screening is used to determine which of the conjugates retain the activity of the native peptide and show enhanced resistance to enzymes.
- the conjugates that have a desirable combination of traits e.g., agonist activity at the receptor, resistance to proteolysis, and oral bioavailability
- Monoconjugate hBNP use sites Lys 3 or Lys 14, or Lys 27, or at the N-terminus of the peptide.
- h-BNP (1 equiv) was dissolved in DMSO (1 ml / 35 mg of h-BNP).
- the activated oligomer (1.1 equiv) was dissolved in a minimal amount of THF and added to the solution of h-BNP in DMSO.
- the reaction was monitored by HPLC. Samples for HPLC monitoring were prepared by taking 50 ⁇ L of the reaction and diluting it in 500 ⁇ L of H 2 O containing 0.1% TFA. Reactions were carried out for 45 min. If reactions were not immediately purified they were frozen until purification could be performed.
- h-BNP (1 equiv) was dissolved in DMSO (1 ml / 35 mg of h-BNP). Once h-BNP was dissolved, TEA (120 equiv) was added and the solution stirred for 5 min. Then the activated oligomer (2.2 equiv for diconjugate, 4 equiv for triconjugate, 5 equiv for tetraconjugate) was dissolved in a minimal amount of THF and added to the solution of h-BNP in DMSO. The reaction was monitored by HPLC. Samples for HPLC monitoring were prepared by taking 50 ⁇ L of the reaction and diluting it in 500 ⁇ L of H 2 O containing 0.1% TFA. Reactions were carried out for 45 min. If reactions were not immediately purified they were frozen until purification could be performed.
- Diconjugate hBNP use sites Lys 3, and Lys 14, or Lys 3 and Lys 27 site on hBNP.
- Triconjugate hBNP use sites Lys 3, Lys 14 and Lys 27.
- the present example is provided to demonstrate the utility of the present invention for providing a variety of forms of bioactive BNP-like peptide and peptide fragments thereof for use in the practice of the present invention. These variant forms, or analogs, are characterized by the presence of one or more mutated amino acids in place of a naturally occurring amino acid from the corresponding native peptide/protein.
- An oral route of administration will require a large volume supply of BNP peptide. Due to the high cost and supply volume limitations associated with synthetic means to supply BNP, a recombinant technology will be preferred for preparing the conjugated BNP peptide. A recombinant technology for the supply of peptide for the production of the conjugate is described here.
- the goal is to select a high expression recombinant technology that is known to express small proteins (> 10,000K) free of glycosylation and have the peptides secreted in soluble form for easy isolation.
- E-coli based expression system ( U.S. 5,114,923, Seilhamer et. al. is incorporated herein by reference), is used for production of bulk BNP for the approved drug Natrecor®.
- Use of the E-coli bacterial system is well known and well utilized in the industry for the past many decades for recombinant production of single chain proteins.
- the E-coli system is in general a simpler system for laboratory uses.
- Many new E-coli systems have been developed with high cell density to provide high yield of protein expression.
- there exists a limitation to the use of an E-coli based system because of its tendency to secrete the protein in its insoluble form into an inclusion body and to be improperly folded (improper disulfide bond between cysteine amino acid residues). These limitations often leads to high cost of goods, expensive down stream processing steps must be implemented to isolate the protein from inclusion body, and refolding the improperly folded protein to its natural state.
- the natriuretic compound may also be a multi-petide having two or more natriuretic compound units in sequence and optionally including a spacer sequence between the natriuretic compound unit, and the construct may also optionally comprise a leader and/or extendor sequence at either or both ends of the natriuretic peptide compound.
- the multipeptide may have the following structures:
- n may, for example be 1, 2, 3, 4, 5, 6, 7, 8, 9, 10;
- NP is a natriuretic peptide or natriuretic peptide analog:
- Spacer may, for example be an enzyme degradation site that is not present in NP (e.g., Asp-Asp-Ala-Gly-Glu);
- Leader may for example be a single amino acid, an amino acid sequence, a peptide (e.g., leader peptide or signal peptide), or a protein; and Leader is selected to block the N-terminus from conjugation, assists in purification of the multipeptide (e.g., (His)6-Ala-Asp-Gly-Glu - cleavable by enzyme cocktail: V8 protease (endoproteinase Glu-C) and endoproteinase, (Asp-N)), improves solubility and/or assists in excretion from the cell, (e.g., Ala-Asp-Gly-Glu); and Leader is preferably cleavable from the multipeptide by enzymatic or chemical cleavage;
- Extension may for example be a single amino acid, an amino acid sequence, a peptide (e.g., leader peptide or signal peptide), or a protein; and Extension is selected to block the C-terminus from conjugation, assist in purification of the multipeptide (e.g., (His)6-Ala-Asp-Gly-Glu), improves solubility, and/or assists in excretion from the cell, (e.g., Ala-Asp-Gly-Glu - cleavable by enzyme cocktail: V8 protease (endoproteinase Glu-C) and endoproteinase (Asp-N)); and Extension is preferably cleavable from the multipeptide by enzymatic or chemical cleavage.
- a peptide e.g., leader peptide or signal peptide
- Extension is selected to block the C-terminus from conjugation, assist in purification of the multipeptide (e.g., (His)6
- an enzyme degradation site preferably an enzyme degradation site that is not present in NP (e.g., Glu-Ala-Gly-Glu).
- the leader in this construct may again be a signal peptide for causing a cell to excrete the BNP, such as Ala-Asp-Gly-Glu.
- An "extension" that may be used in the construct that would assist in the purification of the multipeptide may also be included (e.g., (His)6-Ala-Asp-Gly-Glu).
- An enzyme that may be used to cleave the peptide conjugate is V8 protease (endoproteinase Glu-C). The resulting product is NP-Glu.
- the invention also provides a pro-X-polypeptide, where X is a natriuretic peptide.
- the Pro-X-peptide for BNP can be designed to carry a leader peptide as the Pro moiety and which can be linked to BNP sequence via an enzymatic cleavage site.
- a gene sequence can be designed that encodes the expression of peptide as pro-BNP peptide in the selected recombinant technology.
- the pro-moiety can also be selected to aid more efficient purification from the fermentation scheme.
- Pro-BNP peptide can be conjugated post-expression with the oligomer and then the pro moiety can be cleaved by a selected enzyme, mobilized or immobilized, to provide the BNP conjugate which can be more easily purified via conventional chromatographic methods in high yield.
- Specific enzyme cleavage sites will be included between pro moiety and BNP sequence so that the pro moiety can be enzymatically cleaved to yield the BNP sequence.
- the pro-BNP construct will be assessd with a synthetic pro-BNP model having a BNP sequence and additional specific amino acids.
- This synthetic model will be conjugated with oligomer and subjected to cleavage by a specific enzyme to monitor the production of BNP-Oligomer conjugate.
- the leader sequence can include a small peptide with a specific enzyme cleavage sequence based on the synthetic model. Other functional amino acid sequences can also be inserted in the leader/spacer sequence to allow easy purification of the pro-BNP protein.
- the leader sequence can also serve as the pro-moiety to protect the N-terminus from undesired modification during conjugation and can be cleaved upon specific enzyme treatment. Other features can also be build into the leader peptide sequences to allow ease of isolation as pro-BNP or as pro-BNP oligomer conjugate.
- the leader peptide can also be attached to the C-terminus of the BNP sequence.
- the leader peptide can also be designed to allow attachment of known fusion proteins.
- leader sequences will be provided at the N-terminus or/and C-terminus of BNP for insertion into the expression gene sequence or expression cassette of the selected recombinant technology.
- the expression sequence of a known fusion protein (Gaken et al, 2000) can also be inserted into the expression gene in one of the constructs.
- the positive transgenic isolates or cells can be isolated and grown for evaluation for the expression of the designed proteins.
- Expressed proteins can be purified and sequenced.
- the purified pro-BNP constructs can then be evaluated. Selected cell lines can be characterized and selected for selection future use.
- the coding sequence for the full length of pro-petapeptide BNP-1 can be provided according to the following formula: Leader-NP-[Spacer-NP] n where:
- the NP can be released using a Trypsin and Carboxypeptidse B enzyme cocktail.
- Pro-pentapeptide BNP-1 (3.20 x 10-4 mmol) is dissolved in 5 mL of DMSO. To the solution is added 45 uL of triethylamine. The solution is allowed to stir for 5 minutes before a solution of activated PEG7-hexyl oligomer (19.6 x 10-4 mmol) in ethanol is added. After the reaction has progressed such that HPLC analysis indicates that the pro-multipeptide has been consumed (or the concentration of pro-multipeptide is no longer decreasing), the reaction is quenched by addition of 0.5 mL of 50% aqueous acetic acid solution. The reaction mixture is then processed and exchanged into 100 mM Tris-HCl Buffer, pH 7.6. The major composition of this mixture is expected to be conjugated multipeptide at Lys3 of each BNP unit.
- Tris-HCl solution of the product mixture from Example 2(a) is analyzed by HPLC to determine the polypeptide concentration therein.
- a solution of trypsin (TPCK treated; from bovine pancreas) is prepared in 100 mM Tris-HCl Buffer, pH 7.6.
- a solution of carboxypeptidase B (from porcine pancreas) is prepared in 100 mM Tris-HCl Buffer, pH 7.6.
- the crude mixture (1 mol eq.) is then allowed to react with trypsin (1.39 x 10 -3 mol eq) and carboxypeptidase B (4.56 x 10 4 mol eq.). After 30 minutes, the reaction is quenched by addition of 1% trifluoroacetic acid in acetonitrile. The product mixture of the reaction is processed and analyzed by HPLC. Retention time (versus that of reference standards) and mass spectral analysis are used to determine identity.
- the expected products of the reaction are Lys3 hexyl-PEG7-conjugated BNP, Lys14 hexyl-PEG7-oligomer-conjugated BNP, Lys 27 hexyl-PEG7-oligomer-conjugated BNP, Di hexyl-PEG7- oligomer conjugated BNP, Des Arg-His BNP and Des Arg-His hexyl-PEG7-oligomer conjugated (Lys3 or Lys14 or Lys27) BNP.
- the major composition of this mixture is Lys3-hexyl-PEG7-conjugated BNP.
- Example 2(b) Each major product obtained from the conjugation reaction described in Example 2(b) is isolated using reversed-phase HPLC.
- a column (1.0 cm. i.d. x 25 cm. length) is packed with a commercially available C18 stationary phase known to be useful for the resolution of polypeptides and proteins, and then is incorporated into an HPLC system.
- the system is equilibrated with elution buffer that comprises a mixture of 75% mobile phase A (H2O with 0.1% trifluoroacetic acid) and 25% mobile phase B (acetonitrile with 0.1% trifluoroacetic acid).
- Tris-HCl solution of the product mixture from Example 21(a) is applied to the column, and the major products are separated and eluted using a gradient elution in which the percentage of the acetonitrile component is increased from 25%-55% over 120 minutes.
- Fractions are collected and analyzed by HPLC to determine the identity and purity of the product therein. Common fractions of each product are pooled, and the solvent is removed by rotary evaporation. The identity and purity of each product peak are determined by HPLC and mass spectrometry.
- the expected products consist of 3 multipeptide monoconjugates (conjugated at either Lys3 or Lys 14 or Lys 27 of each unit of BNP), 3 multipeptide diconjugate (conjugated at Lys3&Lys14 or Lys14& Lys27 or Lys27&Lys3), 1 multipeptide triconjuagte (conjugated at Lys3, Lys14 and Lys 27) and 1 multipeptide tetraconjugate (conjugated at N-terminal of leader peptide, Lys3, Lys14 and Lys 27)
- the conjugate, monoconjugated Lys3-hexyl-PEG7-oligomer pro-pentapeptide BNP-1, that is obtained using the procedure described in Example 3 is dissolved in 100 mM Tris-HCl Buffer, pH 7.6, and the resulting solution is analyzed by HPLC to determine the polypeptide concentration therein.
- a solution of trypsin (TPCK treated; from bovine pancreas) is prepared in 100 mM Tris-HCl Buffer, pH 7.6.
- a solution of carboxypeptidase B (from porcine pancreas) is prepared in 100 mM Tris-HCl Buffer, pH 7.6.
- the crude mixture (1 mol eq.) is then allowed to react with trypsin (1.39 x 10-3 mol eq.) and carboxypeptidase B (4.56 x 10-4 mol eq.). After 30 minutes, the reaction is quenched by addition of 1% trifluoroacetic acid in acetonitrile. The products are processed and analyzed by HPLC. Retention time (compared to that of reference standards) and mass spectral analysis are used to determine identity. The expected products of the reaction are respective of each conjugates used.
- Monoconjugated Lys3- hexyl-PEG7-oligomer-conjugated pro-pentapeptide BNP-1 is to provide Lys3 -hexyl-PEG7-oligomer-conjugated BNP and Des Arg-His Lys3-hexyl-PEG7-oligomer-conjugated BNP.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- General Chemical & Material Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Animal Behavior & Ethology (AREA)
- Cardiology (AREA)
- Gastroenterology & Hepatology (AREA)
- Genetics & Genomics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Endocrinology (AREA)
- Toxicology (AREA)
- Zoology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Molecular Biology (AREA)
- Heart & Thoracic Surgery (AREA)
- Epidemiology (AREA)
- Cell Biology (AREA)
- Immunology (AREA)
- Polymers & Plastics (AREA)
- Hospice & Palliative Care (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Separation Using Semi-Permeable Membranes (AREA)
- Medicinal Preparation (AREA)
Applications Claiming Priority (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US42915102P | 2002-11-26 | 2002-11-26 | |
| US429151P | 2002-11-26 | ||
| PCT/US2003/037996 WO2004047871A2 (en) | 2002-11-26 | 2003-11-12 | Modified naturetic compounds, conjugates, and uses thereof |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| EP1569683A2 EP1569683A2 (en) | 2005-09-07 |
| EP1569683B1 true EP1569683B1 (en) | 2010-03-03 |
Family
ID=32393512
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP03812053A Expired - Lifetime EP1569683B1 (en) | 2002-11-26 | 2003-11-12 | Modified natriuretic compounds, conjugates, and uses thereof |
Country Status (12)
| Country | Link |
|---|---|
| US (1) | US7662773B2 (https=) |
| EP (1) | EP1569683B1 (https=) |
| JP (1) | JP2006515579A (https=) |
| CN (1) | CN100558398C (https=) |
| AT (1) | ATE459370T1 (https=) |
| AU (2) | AU2003297583B2 (https=) |
| BR (1) | BR0316560A (https=) |
| CA (1) | CA2504287A1 (https=) |
| DE (1) | DE60331584D1 (https=) |
| PL (1) | PL377813A1 (https=) |
| SG (1) | SG159387A1 (https=) |
| WO (1) | WO2004047871A2 (https=) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9623085B2 (en) | 2011-09-02 | 2017-04-18 | Capricor Therapeutics, Inc. | Chimeric natriuretic peptide compositions and methods of preparation |
Families Citing this family (86)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US7524635B2 (en) * | 2003-04-17 | 2009-04-28 | Biosite Incorporated | Methods and compositions for measuring natriuretic peptides and uses thereof |
| US20060110359A1 (en) * | 2002-09-06 | 2006-05-25 | Juan Sanchez-Ramos | Cellular delivery of natriuretic peptides |
| WO2004022003A2 (en) * | 2002-09-06 | 2004-03-18 | University Of South Florida | Materials and methods for treatment of allergic diseases |
| US20080214437A1 (en) * | 2002-09-06 | 2008-09-04 | Mohapatra Shyam S | Methods and compositions for reducing activity of the atrial natriuretic peptide receptor and for treatment of diseases |
| WO2004047871A2 (en) | 2002-11-26 | 2004-06-10 | Nobex Corporation | Modified naturetic compounds, conjugates, and uses thereof |
| US7648962B2 (en) | 2002-11-26 | 2010-01-19 | Biocon Limited | Natriuretic compounds, conjugates, and uses thereof |
| AU2004264958B2 (en) | 2003-08-13 | 2010-04-15 | Biocon, Ltd | Micro-particle fatty acid salt solid dosage formulations for therapeutic agents |
| AU2005227870A1 (en) * | 2004-02-17 | 2005-10-13 | University Of South Florida | Materials and methods for treatment of inflammatory and cell proliferation disorders |
| CA2559228C (en) | 2004-04-21 | 2016-06-21 | Enobia Pharma Inc. | Bone delivery conjugates and method of using same to target proteins to bone |
| WO2006005140A2 (en) | 2004-07-15 | 2006-01-19 | The University Of Queensland | Proteinaceous compounds and uses therefor |
| WO2006076471A2 (en) * | 2005-01-12 | 2006-07-20 | Nobex Corporation | Bnp conjugates and methods of use |
| US7300494B2 (en) * | 2005-02-24 | 2007-11-27 | Hamilton Sundstrand Corporation | On-board inert gas generation system with compressor surge protection |
| PL1865976T3 (pl) | 2005-04-07 | 2012-11-30 | Cardiorentis Ag | Zastosowanie peptydu natriuretycznego do leczenia niewydolności serca |
| HRP20150247T1 (hr) * | 2005-07-29 | 2015-04-10 | Nektar Therapeutics | Postupci za dobijanje polimernih reagenasa |
| US7803901B2 (en) | 2005-09-16 | 2010-09-28 | Mayo Foundation For Medical Education And Research | Polypeptides with natriuresis activity |
| WO2007047834A2 (en) * | 2005-10-18 | 2007-04-26 | Biocon Limited | Oral peptide conjugates for metabolic diseases |
| EP2004633A4 (en) | 2006-03-30 | 2009-08-26 | Palatin Technologies Inc | LINEAR NATRIURETIC PEPTIDE CONSTRUCTS |
| CA2647143A1 (en) | 2006-03-30 | 2007-10-11 | Palatin Technologies, Inc. | Cyclic natriuretic peptide constructs |
| WO2007127487A2 (en) * | 2006-04-28 | 2007-11-08 | University Of South Florida | Materials and methods for reducing inflammation by inhibition of the atrial natriuretic peptide receptor |
| EP2687223B2 (en) | 2006-05-30 | 2024-11-20 | Mayo Foundation For Medical Education And Research | Detecting and treating dementia |
| US8486635B2 (en) | 2006-05-30 | 2013-07-16 | Mayo Foundation For Medical Education And Research | Detecting and treating dementia |
| CA2685300C (en) | 2006-06-01 | 2017-01-03 | Mayo Foundation For Medical Education And Research | Immunity to folate receptors |
| WO2008088582A2 (en) | 2006-08-04 | 2008-07-24 | Mayo Foundation For Medical Education And Research | Methods and materials related to trail isoforms |
| US8283318B2 (en) | 2006-09-08 | 2012-10-09 | Mayo Foundation For Medical Education And Research | Aquaretic and natriuretic polypeptides lacking vasodilatory activity |
| BRPI0811052A2 (pt) | 2007-04-12 | 2015-01-27 | Univ Minnesota | Composições de proteção de isquemia/reperfusão e métodos de uso. |
| KR20080098216A (ko) * | 2007-05-04 | 2008-11-07 | 한미약품 주식회사 | 캐리어 물질을 이용한 나트륨 배설 펩타이드 약물 결합체 |
| EP2217620A2 (en) | 2007-11-21 | 2010-08-18 | BioMarin Pharmaceutical Inc. | Variants of c-type natriuretic peptide |
| WO2009156481A1 (en) * | 2008-06-25 | 2009-12-30 | Ascendis Pharma As | Pegylated bnp |
| WO2010033240A2 (en) | 2008-09-19 | 2010-03-25 | Nektar Therapeutics | Carbohydrate-based drug delivery polymers and conjugates thereof |
| EP2334335A1 (en) | 2008-09-19 | 2011-06-22 | Nektar Therapeutics | Polymer conjugates of cd-np peptides |
| PT2432489T (pt) | 2009-05-20 | 2016-12-07 | Biomarin Pharm Inc | Variantes do péptido natriurético de tipo c |
| US20120108514A1 (en) | 2009-07-09 | 2012-05-03 | University Of Iowa Research Foundation | Long acting atrial natriuretic peptide (la-anp) and methods for use thereof |
| US20120208756A1 (en) | 2009-07-23 | 2012-08-16 | Igisu Co., Ltd | Composition for external preparation for skin |
| EP2569327B1 (en) | 2010-04-27 | 2016-05-25 | Agency For Science, Technology And Research | Eif4e binding peptides |
| WO2012013597A1 (de) * | 2010-07-28 | 2012-02-02 | Justus-Liebig-Universität Giessen | Stoffe und deren verwendung zur beeinflussung natriuretischer peptidrezeptoren |
| WO2012088608A1 (en) | 2010-12-27 | 2012-07-05 | Enobia Canada Limited Partnership | Compositions comprising natriuretic peptides and methods of use thereof |
| US20120277155A1 (en) | 2011-02-25 | 2012-11-01 | Medtronic, Inc. | Therapy for kidney disease and/or heart failure |
| WO2012118042A1 (ja) | 2011-02-28 | 2012-09-07 | 独立行政法人国立循環器病研究センター | 悪性腫瘍転移抑制用医薬 |
| US10184942B2 (en) | 2011-03-17 | 2019-01-22 | University Of South Florida | Natriuretic peptide receptor as a biomarker for diagnosis and prognosis of cancer |
| WO2013027680A1 (ja) | 2011-08-19 | 2013-02-28 | 独立行政法人国立循環器病研究センター | ナトリウム利尿ペプチド受容体gc-aアゴニスト及びgc-bアゴニストを組み合わせてなる悪性腫瘍の増悪防止用医薬 |
| CN103906761B (zh) | 2011-08-30 | 2016-12-21 | 梅约医学教育与研究基金会 | 利钠多肽 |
| KR20140084201A (ko) | 2011-10-19 | 2014-07-04 | 알렉시온 파마 홀딩 | 알칼리성 포스파타제 및/또는 나트륨이뇨 펩티드를 포함하는 조성물 및 그의 사용 방법 |
| WO2013103896A1 (en) | 2012-01-06 | 2013-07-11 | Mayo Foundation For Medical Education And Research | Treating cardiovascular or renal diseases |
| SG11201405721VA (en) * | 2012-03-19 | 2014-10-30 | Madeleine Pharmaceuticals Ρτy Ltd | Method of producing a recombinant peptide |
| US10052366B2 (en) | 2012-05-21 | 2018-08-21 | Alexion Pharmaceuticsl, Inc. | Compositions comprising alkaline phosphatase and/or natriuretic peptide and methods of use thereof |
| TW201442721A (zh) * | 2013-01-23 | 2014-11-16 | Daiichi Sankyo Co Ltd | 糖鏈修飾心房利尿鈉肽 |
| WO2016007873A1 (en) | 2014-07-11 | 2016-01-14 | The Regents Of The University Of Michigan | Compositions and methods for treating craniosynostosis |
| MX389350B (es) | 2014-12-05 | 2025-03-19 | Alexion Pharma Inc | Fosfatasas alcalinas recombinantes y usos de las mismas para el tratamiento de convulsiones. |
| JP6868561B2 (ja) | 2015-01-28 | 2021-05-12 | アレクシオン ファーマシューティカルズ, インコーポレイテッド | アルカリホスファターゼ欠損を有する被験者を治療する方法 |
| CA2986086A1 (en) * | 2015-05-29 | 2016-12-08 | Igisu Co., Ltd. | Cyclyc peptide, and medicine, external preparation and cosmetic each containing said cyclic peptide |
| CN108350440A (zh) | 2015-08-17 | 2018-07-31 | 阿雷克森制药公司 | 碱性磷酸酯的制造 |
| JP6868617B2 (ja) | 2015-09-28 | 2021-05-12 | アレクシオン ファーマシューティカルズ, インコーポレイテッド | 低ホスファターゼ血症の組織非特異的アルカリホスファターゼ(tnsalp)酵素補充療法に有効な投薬計画の特定 |
| JP2018533571A (ja) | 2015-10-30 | 2018-11-15 | アレクシオン ファーマシューティカルズ, インコーポレイテッド | 患者の頭蓋縫合早期癒合症を治療するための方法 |
| ES3064816T3 (en) * | 2016-01-08 | 2026-04-29 | Ascendis Pharma Growth Disorders As | Controlled-release cnp agonists with reduced side-effects |
| CA3007976C (en) * | 2016-01-08 | 2023-09-26 | Ascendis Pharma Growth Disorders A/S | Cnp prodrugs with large carrier moieties |
| DK3400019T3 (da) * | 2016-01-08 | 2022-10-24 | Ascendis Pharma Growth Disorders As | CNP-prodrugs med bærerbinding ved ringenheden |
| IL259827B2 (en) * | 2016-01-08 | 2025-07-01 | Ascendis Pharma Growth Disorders As | Controlled-release CNP agonists with low initial NPR-B activity |
| WO2017118700A1 (en) | 2016-01-08 | 2017-07-13 | Ascendis Pharma Growth Disorders A/S | Controlled-release cnp agonists with increased nep stability |
| EP3400021A1 (en) | 2016-01-08 | 2018-11-14 | Ascendis Pharma Growth Disorders A/S | Controlled-release cnp agonists with low npr-c binding |
| WO2017155569A1 (en) | 2016-03-08 | 2017-09-14 | Alexion Pharmaceuticals, Inc. | Methods for treating hypophosphatasia in children |
| JP7613826B2 (ja) | 2016-04-01 | 2025-01-15 | アレクシオン ファーマシューティカルズ, インコーポレイテッド | アルカリホスファターゼによって筋力低下を治療すること |
| US10898549B2 (en) | 2016-04-01 | 2021-01-26 | Alexion Pharmaceuticals, Inc. | Methods for treating hypophosphatasia in adolescents and adults |
| US10988744B2 (en) | 2016-06-06 | 2021-04-27 | Alexion Pharmaceuticals, Inc. | Method of producing alkaline phosphatase |
| EP3500289B1 (en) | 2016-08-18 | 2024-10-09 | Alexion Pharmaceuticals, Inc. | Asfotase alfa for use in treating tracheobronchomalacia |
| US10307398B2 (en) | 2016-09-20 | 2019-06-04 | Regents Of The University Of Minnesota | Resuscitation composition and methods of making and using |
| US11564974B2 (en) * | 2016-09-29 | 2023-01-31 | Ascendis Pharma Growth Disorders A/S | Combination therapy with controlled-release CNP agonists |
| US11072642B2 (en) | 2016-11-09 | 2021-07-27 | Mayo Foundation For Medical Education And Research | MANP analogues |
| CA3056433A1 (en) * | 2017-03-22 | 2018-09-27 | Pharmain Corporation | Npra agonists, compositions, and uses thereof |
| EP3600383A4 (en) | 2017-03-31 | 2020-10-28 | Alexion Pharmaceuticals, Inc. | METHODS OF TREATMENT OF HYPOPHOSPHATASIA (HPP) IN ADULTS AND ADOLESCENTS |
| WO2019050977A1 (en) | 2017-09-05 | 2019-03-14 | Torque Therapeutics, Inc. | REVERSIBLE LINKS AND THEIR USE |
| CA3074826A1 (en) | 2017-09-05 | 2019-03-14 | Torque Therapeutics, Inc. | Therapeutic protein compositions and methods of making and using the same |
| JP7216332B2 (ja) | 2018-03-20 | 2023-02-01 | 日油株式会社 | 分岐型単分散ポリエチレングリコール、中間体およびその製造方法 |
| US11913039B2 (en) | 2018-03-30 | 2024-02-27 | Alexion Pharmaceuticals, Inc. | Method for producing recombinant alkaline phosphatase |
| US12268733B2 (en) | 2018-08-10 | 2025-04-08 | Alexion Pharmaceuticals, Inc. | Methods of treating neurofibromatosis type 1 and related conditions with alkaline phosphatase |
| PL3877402T3 (pl) | 2018-11-09 | 2025-12-01 | Mayo Foundation For Medical Education And Research | Leczenie skojarzone nadciśnienia tętniczego |
| KR102022118B1 (ko) * | 2019-01-07 | 2019-09-18 | 주식회사 아스트로젠 | 중추신경계 질환의 예방 또는 치료용 세린 유도체 화합물 |
| MX2021008708A (es) | 2019-02-11 | 2021-09-21 | Ascendis Pharma Growth Disorders As | Formulaciones farmaceuticas secas de conjugados de peptido natriuretico tipo c (cnp). |
| CN110278941B (zh) * | 2019-07-11 | 2021-05-28 | 西安国际医学中心有限公司 | 一种含有钠尿肽的离体心脏保护液 |
| CA3161266A1 (en) | 2019-12-09 | 2021-06-17 | Alexion Pharmaceuticals, Inc. | Alkaline phosphatase polypeptides and methods of use thereof |
| CN111978390B (zh) * | 2020-08-31 | 2022-10-14 | 上海景泽生物技术有限公司 | 聚乙二醇修饰的rhBNP及其用途 |
| CN111848776B (zh) * | 2020-08-31 | 2022-03-18 | 江苏璟泽生物医药有限公司 | 聚乙二醇修饰的rhBNP及其制备方法 |
| AU2021337652B2 (en) | 2020-09-04 | 2025-01-30 | Alexion Pharmaceuticals, Inc. | Methods for treating bone mineralization disorders |
| BR112023016048A2 (pt) | 2021-02-12 | 2023-11-14 | Alexion Pharma Inc | Polipeptídeos de fosfatase alcalina e métodos de uso dos mesmos |
| US20240369535A1 (en) * | 2021-09-07 | 2024-11-07 | Mayo Foundation For Medical Education And Research | METHODS AND MATERIALS FOR DETERMINING pGC TARGET DOSAGE |
| CN114316020A (zh) * | 2021-12-28 | 2022-04-12 | 南京岚煜生物科技有限公司 | 一种bnp重组蛋白及其制备方法和应用 |
| US12427185B2 (en) | 2023-09-05 | 2025-09-30 | E-Star Biotech, LLC | Formulations of MANP and uses thereof |
Family Cites Families (90)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4044196A (en) * | 1972-03-30 | 1977-08-23 | Bayer Aktiengesellschaft | Crosslinked copolymers of α,β-olefinically unsaturated dicarboxylic anhydrides |
| US4179337A (en) * | 1973-07-20 | 1979-12-18 | Davis Frank F | Non-immunogenic polypeptides |
| CA1188988A (en) * | 1981-07-02 | 1985-06-18 | Alan G. Walton | Chondroitin drug complexes |
| EP0092918B1 (en) * | 1982-04-22 | 1988-10-19 | Imperial Chemical Industries Plc | Continuous release formulations |
| US4569794A (en) * | 1984-12-05 | 1986-02-11 | Eli Lilly And Company | Process for purifying proteins and compounds useful in such process |
| US5037741A (en) * | 1986-08-18 | 1991-08-06 | The Coca Cola Company | Enzymatic method for the synthesis and separation of peptides |
| JP2544929B2 (ja) * | 1987-06-17 | 1996-10-16 | 第一化学薬品 株式会社 | 新規生理活性ペプチド |
| US5114923A (en) | 1988-05-31 | 1992-05-19 | California Biotechnology Inc. | Recombinant techniques for production of novel natriuretic and vasodilator peptides |
| CA1339210C (en) | 1988-05-31 | 1997-08-05 | John Lewicki | Recombinant techniques for production of novel natriuretic and vasodilator peptides |
| JP2539665B2 (ja) * | 1988-06-20 | 1996-10-02 | 日本臓器製薬株式会社 | 神経疾患治療剤 |
| JP2561513B2 (ja) | 1988-07-04 | 1996-12-11 | 塩野義製薬株式会社 | γ−ANPを認識するモノクローナル抗体 |
| JPH0720857B2 (ja) | 1988-08-11 | 1995-03-08 | テルモ株式会社 | リポソームおよびその製法 |
| IT1229514B (it) | 1989-01-30 | 1991-09-03 | Farmhispania S A A Montme | Glicoconiugati anfifilici sintetici per impiego neurologico. |
| DK0385476T4 (da) | 1989-03-01 | 1999-12-20 | Shionogi & Co | Fysiologisk aktivt polypeptid og DNA |
| US20020086843A1 (en) | 1989-03-01 | 2002-07-04 | Daiichi Pure Chemicals Co., Ltd. | Physiologically active polypeptide and DNA |
| US5342940A (en) * | 1989-05-27 | 1994-08-30 | Sumitomo Pharmaceuticals Company, Limited | Polyethylene glycol derivatives, process for preparing the same |
| DE69032598T2 (de) | 1989-06-23 | 1999-03-11 | Genentech, Inc., South San Francisco, Calif. | Zusammensetzungen und methoden zur synthese des b-rezeptors für das natriuretische protein und verwendungsmethoden |
| US5108568A (en) * | 1989-07-07 | 1992-04-28 | The United States Of America As Represented By The Administrator Of The National Aeronautics And Space Administration | Controlled method of reducing electrophoretic mobility of macromolecules, particles or cells |
| US5013556A (en) | 1989-10-20 | 1991-05-07 | Liposome Technology, Inc. | Liposomes with enhanced circulation time |
| SE8904407L (sv) | 1989-12-29 | 1991-06-30 | Qingpingfeng | Medikament foer behandling av hjaertsvikt |
| IE912365A1 (en) * | 1990-07-23 | 1992-01-29 | Zeneca Ltd | Continuous release pharmaceutical compositions |
| US5202239A (en) | 1990-08-07 | 1993-04-13 | Scios Nova Inc. | Expression of recombinant polypeptides with improved purification |
| JP3026354B2 (ja) | 1990-09-27 | 2000-03-27 | 壽之 松尾 | ヒトcnp遺伝子及び前駆体蛋白 |
| US5853746A (en) | 1991-01-31 | 1998-12-29 | Robert Francis Shaw | Methods and compositions for the treatment and repair of defects or lesions in cartilage or bone using functional barrier |
| ATE253639T1 (de) | 1991-08-19 | 2003-11-15 | Daiichi Suntory Pharma Co Ltd | Verfahren zur herstellung von peptiden |
| JP2665850B2 (ja) * | 1991-11-14 | 1997-10-22 | 塩野義製薬株式会社 | hBNPのC端を認識するモノクロ−ナル抗体 |
| GB9211686D0 (en) | 1992-06-03 | 1992-07-15 | Medisinsk Innovation A S | Chemical compounds |
| WO1995028952A1 (de) | 1992-12-09 | 1995-11-02 | Haemopep Pharma Gmbh | Verwendung der brain natriuretic peptide (bnp), phosphoryliertes urodilatin, phosphoryliertes cdd/anp sowie deren kombinationen |
| US6191105B1 (en) * | 1993-05-10 | 2001-02-20 | Protein Delivery, Inc. | Hydrophilic and lipophilic balanced microemulsion formulations of free-form and/or conjugation-stabilized therapeutic agents such as insulin |
| US5359030A (en) * | 1993-05-10 | 1994-10-25 | Protein Delivery, Inc. | Conjugation-stabilized polypeptide compositions, therapeutic delivery and diagnostic formulations comprising same, and method of making and using the same |
| US5681811A (en) | 1993-05-10 | 1997-10-28 | Protein Delivery, Inc. | Conjugation-stabilized therapeutic agent compositions, delivery and diagnostic formulations comprising same, and method of making and using the same |
| US5512459A (en) * | 1993-07-20 | 1996-04-30 | Bionebraska, Inc. | Enzymatic method for modification or recombinant polypeptides |
| ATE200026T1 (de) | 1993-08-28 | 2001-04-15 | Univ Sheffield | Behandlung von laminitis |
| US6525022B1 (en) | 1993-11-12 | 2003-02-25 | Genentech, Inc. | Receptor specific atrial natriuretic peptides |
| US6037145A (en) | 1994-09-07 | 2000-03-14 | Suntory Limited | Process for production of protein |
| NO319913B1 (no) * | 1994-12-09 | 2005-10-03 | Shionogi & Co | Fremgangsmate til sandwichimmunoassay for N-peptid |
| US5932462A (en) | 1995-01-10 | 1999-08-03 | Shearwater Polymers, Inc. | Multiarmed, monofunctional, polymer for coupling to molecules and surfaces |
| WO1997014740A1 (en) | 1995-10-19 | 1997-04-24 | Receptagen Corporation | Discrete-length polyethylene glycols |
| DE69733560T2 (de) * | 1996-03-04 | 2006-05-11 | Scios Inc., Fremont | TESTVERFAHREN UND REAGENZIEN ZUR QUANTIFIZIERUNG VON hBNP |
| EP0894004B2 (en) | 1996-03-22 | 2007-02-21 | Curis, Inc. | Method for enhancing functional recovery of motor coordination, speech or sensory perception after central nervous system ischemia or trauma |
| US6028055A (en) | 1996-10-22 | 2000-02-22 | Genetech, Inc. | Receptor selective BNP |
| CA2269656A1 (en) | 1996-10-22 | 1998-04-30 | Genentech, Inc. | Receptor specific brain natriuretic peptide (bnp) |
| AU6820898A (en) | 1997-04-04 | 1998-10-30 | Novo Nordisk A/S | Natriuretic peptide derivatives |
| GB9716790D0 (en) | 1997-08-07 | 1997-10-15 | Creative Peptides Sweden Ab | Recombinant DNA molecules comprising multimeric copies of a gene sequence and expression thereof |
| US20040005669A1 (en) * | 1997-08-07 | 2004-01-08 | Stefan Stahl | Recombinant expression of insulin C-peptide |
| US6013630A (en) | 1997-08-21 | 2000-01-11 | Curagen Corporation | Atrial natriuretic factor mutants and ischemic stroke |
| ES2244052T5 (es) | 1997-10-24 | 2011-03-28 | SHIONOGI & CO., LTD. | Procedimiento de inhibición de la descomposición de péptidos natriuréticos y procedimento mejorado de dosificado de péptidos natriuréticos con la ayuda de los indicados péptidos. |
| US6495514B1 (en) * | 1998-01-21 | 2002-12-17 | Mercer University | Method for reducing inflammation and inducing an analgesic effect and compounds thereof |
| NZ506839A (en) * | 1998-03-09 | 2003-05-30 | Zealand Pharma As | Pharmacologically active peptide conjugates having a reduced tendency towards enzymatic hydrolysis |
| US6117644A (en) * | 1998-06-04 | 2000-09-12 | Ottawa Heart Institute Research Corporation | Predicting and detecting cardiac allograft rejection |
| US6703381B1 (en) * | 1998-08-14 | 2004-03-09 | Nobex Corporation | Methods for delivery therapeutic compounds across the blood-brain barrier |
| SE9802946D0 (sv) | 1998-09-02 | 1998-09-02 | Europrofil Ab | Förfarande och listarrangemang för att täcka skarvar eller skapa övergångar i samband med ytbeläggningar |
| JP3799465B2 (ja) * | 1998-09-28 | 2006-07-19 | 参天製薬株式会社 | ナトリウム利尿ペプチドを有効成分とする涙液分泌促進または角結膜障害治療用点眼剤 |
| WO2000043034A2 (en) | 1999-01-26 | 2000-07-27 | Eli Lilly And Company | Monodisperse hexameric acylated insulin analog formulations |
| CA2373680C (en) * | 1999-05-17 | 2008-07-29 | Conjuchem Inc. | Protection of endogenous therapeutic peptides from peptidase activity through conjugation to blood components |
| AU5043900A (en) | 1999-05-24 | 2000-12-12 | Mayo Foundation For Medical Education And Research | Adenovirus vectors encoding brain natriuretic peptide |
| US6309633B1 (en) * | 1999-06-19 | 2001-10-30 | Nobex Corporation | Amphiphilic drug-oligomer conjugates with hydroyzable lipophile components and methods for making and using the same |
| KR100345214B1 (ko) * | 1999-08-17 | 2002-07-25 | 이강춘 | 생체적합성 고분자가 수식된 펩타이드의 비점막 전달 |
| US6610043B1 (en) * | 1999-08-23 | 2003-08-26 | Bistech, Inc. | Tissue volume reduction |
| US6713454B1 (en) * | 1999-09-13 | 2004-03-30 | Nobex Corporation | Prodrugs of etoposide and etoposide analogs |
| US6541508B2 (en) * | 1999-09-13 | 2003-04-01 | Nobex Corporation | Taxane prodrugs |
| US7127290B2 (en) | 1999-10-01 | 2006-10-24 | Cardiac Pacemakers, Inc. | Cardiac rhythm management systems and methods predicting congestive heart failure status |
| US6638906B1 (en) * | 1999-12-13 | 2003-10-28 | Nobex Corporation | Amphiphilic polymers and polypeptide conjugates comprising same |
| US6407211B1 (en) | 1999-12-17 | 2002-06-18 | Mayo Foundation For Medical Education And Research | Chimeric natriuretic peptides |
| JP4237375B2 (ja) * | 2000-03-31 | 2009-03-11 | アスビオファーマ株式会社 | 虚血性疾患の処置又は予防に用いる医薬組成物 |
| DK1313697T3 (da) * | 2000-08-29 | 2006-04-10 | Nobex Corp | Immunregulatoriske forbindelser, derivater deraf samt anvendelse deraf |
| US6867183B2 (en) * | 2001-02-15 | 2005-03-15 | Nobex Corporation | Pharmaceutical compositions of insulin drug-oligomer conjugates and methods of treating diseases therewith |
| US7060675B2 (en) * | 2001-02-15 | 2006-06-13 | Nobex Corporation | Methods of treating diabetes mellitus |
| US7632647B2 (en) * | 2001-04-13 | 2009-12-15 | Biosite Incorporated | Use of B-type natriuretic peptide as a prognostic indicator in acute coronary syndromes |
| US20030219734A1 (en) * | 2001-04-13 | 2003-11-27 | Biosite Incorporated | Polypeptides related to natriuretic peptides and methods of their identification and use |
| FR2823993B1 (fr) * | 2001-04-27 | 2003-06-20 | Rhodia Chimie Sa | Dispersion colloidale aqueuse stable, son procede de preparation |
| EP1322957B1 (en) * | 2001-05-04 | 2009-08-12 | Biosite Incorporated | Diagnostic markers of acute coronary syndromes and methods of use thereof |
| US7713932B2 (en) * | 2001-06-04 | 2010-05-11 | Biocon Limited | Calcitonin drug-oligomer conjugates, and uses thereof |
| US6858580B2 (en) * | 2001-06-04 | 2005-02-22 | Nobex Corporation | Mixtures of drug-oligomer conjugates comprising polyalkylene glycol, uses thereof, and methods of making same |
| US6835802B2 (en) * | 2001-06-04 | 2004-12-28 | Nobex Corporation | Methods of synthesizing substantially monodispersed mixtures of polymers having polyethylene glycol moieties |
| US6713452B2 (en) * | 2001-06-04 | 2004-03-30 | Nobex Corporation | Mixtures of calcitonin drug-oligomer conjugates comprising polyalkylene glycol, uses thereof, and methods of making same |
| US6828305B2 (en) * | 2001-06-04 | 2004-12-07 | Nobex Corporation | Mixtures of growth hormone drug-oligomer conjugates comprising polyalkylene glycol, uses thereof, and methods of making same |
| US6828297B2 (en) | 2001-06-04 | 2004-12-07 | Nobex Corporation | Mixtures of insulin drug-oligomer conjugates comprising polyalkylene glycol, uses thereof, and methods of making same |
| US6737913B2 (en) * | 2001-06-15 | 2004-05-18 | Silicon Laboratories, Inc. | Differential mode circuitry and method of calibrating same without matched external current sources |
| US6770625B2 (en) | 2001-09-07 | 2004-08-03 | Nobex Corporation | Pharmaceutical compositions of calcitonin drug-oligomer conjugates and methods of treating diseases therewith |
| UY27439A1 (es) | 2001-09-07 | 2003-04-30 | Nobex Corp | Procedimiento para sintetizar un conjunto de oligomero-polipeptido insulina, conjugado oligomero-polipeptido de proinsulina, composicion de conjugado oligomero-insulina, procedimiento para sintetizar un conjugado oligomero-polipeptido c-peptido, conj |
| US7030082B2 (en) * | 2001-09-07 | 2006-04-18 | Nobex Corporation | Pharmaceutical compositions of drug-oligomer conjugates and methods of treating disease therewith |
| US7312192B2 (en) * | 2001-09-07 | 2007-12-25 | Biocon Limited | Insulin polypeptide-oligomer conjugates, proinsulin polypeptide-oligomer conjugates and methods of synthesizing same |
| US6913903B2 (en) * | 2001-09-07 | 2005-07-05 | Nobex Corporation | Methods of synthesizing insulin polypeptide-oligomer conjugates, and proinsulin polypeptide-oligomer conjugates and methods of synthesizing same |
| US7196059B2 (en) * | 2001-09-07 | 2007-03-27 | Biocon Limited | Pharmaceutical compositions of insulin drug-oligomer conjugates and methods of treating diseases therewith |
| US20040063630A1 (en) * | 2002-03-18 | 2004-04-01 | Scios, Inc. | Treatment of congestive heart failure with natriuretic peptide and a diuretic |
| JP2006514607A (ja) | 2002-07-31 | 2006-05-11 | コンジュケム,インコーポレーテッド | 長時間持続性ナトリウム排泄増加性ペプチド誘導体 |
| US20040152769A1 (en) | 2002-11-09 | 2004-08-05 | Ekwuribe Nnochiri Nkem | Modified carbamate-containing prodrugs and methods of synthesizing same |
| WO2004047871A2 (en) | 2002-11-26 | 2004-06-10 | Nobex Corporation | Modified naturetic compounds, conjugates, and uses thereof |
| US20060198819A1 (en) * | 2003-08-08 | 2006-09-07 | Novo Nordisk Healthcare A/G | Use of galactose oxidase for selective chemical conjugation of protractor molecules to proteins of therapeutic interest |
-
2003
- 2003-11-12 WO PCT/US2003/037996 patent/WO2004047871A2/en not_active Ceased
- 2003-11-12 BR BR0316560-4A patent/BR0316560A/pt not_active IP Right Cessation
- 2003-11-12 AU AU2003297583A patent/AU2003297583B2/en not_active Ceased
- 2003-11-12 AT AT03812053T patent/ATE459370T1/de not_active IP Right Cessation
- 2003-11-12 EP EP03812053A patent/EP1569683B1/en not_active Expired - Lifetime
- 2003-11-12 CA CA002504287A patent/CA2504287A1/en not_active Abandoned
- 2003-11-12 PL PL377813A patent/PL377813A1/pl not_active Application Discontinuation
- 2003-11-12 SG SG200703827-6A patent/SG159387A1/en unknown
- 2003-11-12 DE DE60331584T patent/DE60331584D1/de not_active Expired - Lifetime
- 2003-11-12 CN CNB2003801091794A patent/CN100558398C/zh not_active Expired - Fee Related
- 2003-11-26 JP JP2004555809A patent/JP2006515579A/ja active Pending
- 2003-11-26 US US10/723,933 patent/US7662773B2/en not_active Expired - Fee Related
-
2010
- 2010-04-13 AU AU2010201455A patent/AU2010201455A1/en not_active Abandoned
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9623085B2 (en) | 2011-09-02 | 2017-04-18 | Capricor Therapeutics, Inc. | Chimeric natriuretic peptide compositions and methods of preparation |
Also Published As
| Publication number | Publication date |
|---|---|
| AU2010201455A1 (en) | 2010-05-06 |
| US20040203081A1 (en) | 2004-10-14 |
| SG159387A1 (en) | 2010-03-30 |
| WO2004047871A3 (en) | 2005-03-17 |
| US7662773B2 (en) | 2010-02-16 |
| WO2004047871A2 (en) | 2004-06-10 |
| BR0316560A (pt) | 2005-10-04 |
| EP1569683A2 (en) | 2005-09-07 |
| ATE459370T1 (de) | 2010-03-15 |
| DE60331584D1 (de) | 2010-04-15 |
| HK1087327A1 (zh) | 2006-10-13 |
| AU2003297583B2 (en) | 2010-01-14 |
| PL377813A1 (pl) | 2006-02-20 |
| JP2006515579A (ja) | 2006-06-01 |
| AU2003297583A1 (en) | 2004-06-18 |
| CA2504287A1 (en) | 2004-06-10 |
| CN1741814A (zh) | 2006-03-01 |
| CN100558398C (zh) | 2009-11-11 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP1569683B1 (en) | Modified natriuretic compounds, conjugates, and uses thereof | |
| US7648962B2 (en) | Natriuretic compounds, conjugates, and uses thereof | |
| US20080207505A1 (en) | Bna Conjugates and Methods of Use | |
| ES2610356T3 (es) | Polipéptidos recombinantes extendidos y composiciones que comprenden los mismos | |
| CN106117344B (zh) | 双酰化glp-1衍生物 | |
| US20160304576A1 (en) | Glucagon analogues | |
| US7312192B2 (en) | Insulin polypeptide-oligomer conjugates, proinsulin polypeptide-oligomer conjugates and methods of synthesizing same | |
| CN103209711A (zh) | 双-酰化的glp-1衍生物 | |
| JP2004534783A (ja) | ポリアルキレングリコールを含む成長ホルモン剤−オリゴマー抱合体の混合物、それらの使用、およびそれらの製造方法 | |
| US20200254065A1 (en) | Long-acting glp-2 analogs | |
| US20130143815A1 (en) | Growth hormone conjugates | |
| US20240247080A1 (en) | Glp1/gip/npy2 receptor triple agonists | |
| HK1087327B (en) | Modified natriuretic compounds, conjugates, and uses thereof | |
| EP4582441A2 (en) | Multimeric polypeptides and uses thereof | |
| KR20260022948A (ko) | Glp-1/gip 이중 수용체 작용제, glp-1/gcg 이중 수용체 작용제, 및 glp-1/gip/gcg 삼중 수용체 작용제 | |
| CN120757630A (zh) | 一种cnp类似物及其应用 | |
| OA16287A (en) | Glucagon analogues. |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| 17P | Request for examination filed |
Effective date: 20050627 |
|
| AK | Designated contracting states |
Kind code of ref document: A2 Designated state(s): AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IT LI LU MC NL PT RO SE SI SK TR |
|
| AX | Request for extension of the european patent |
Extension state: AL LT LV MK |
|
| DAX | Request for extension of the european patent (deleted) | ||
| RAP1 | Party data changed (applicant data changed or rights of an application transferred) |
Owner name: BIOCON LIMITED |
|
| 17Q | First examination report despatched |
Effective date: 20080404 |
|
| GRAP | Despatch of communication of intention to grant a patent |
Free format text: ORIGINAL CODE: EPIDOSNIGR1 |
|
| GRAS | Grant fee paid |
Free format text: ORIGINAL CODE: EPIDOSNIGR3 |
|
| GRAA | (expected) grant |
Free format text: ORIGINAL CODE: 0009210 |
|
| AK | Designated contracting states |
Kind code of ref document: B1 Designated state(s): AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IT LI LU MC NL PT RO SE SI SK TR |
|
| REG | Reference to a national code |
Ref country code: GB Ref legal event code: FG4D |
|
| REG | Reference to a national code |
Ref country code: CH Ref legal event code: EP |
|
| REG | Reference to a national code |
Ref country code: IE Ref legal event code: FG4D |
|
| REF | Corresponds to: |
Ref document number: 60331584 Country of ref document: DE Date of ref document: 20100415 Kind code of ref document: P |
|
| REG | Reference to a national code |
Ref country code: NL Ref legal event code: VDEP Effective date: 20100303 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: AT Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20100303 Ref country code: FI Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20100303 Ref country code: SI Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20100303 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: RO Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20100303 Ref country code: NL Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20100303 Ref country code: EE Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20100303 Ref country code: ES Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20100614 Ref country code: GR Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20100604 Ref country code: BE Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20100303 Ref country code: SE Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20100303 Ref country code: CY Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20100303 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: BG Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20100603 Ref country code: SK Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20100303 Ref country code: CZ Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20100303 |
|
| PLBE | No opposition filed within time limit |
Free format text: ORIGINAL CODE: 0009261 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: NO OPPOSITION FILED WITHIN TIME LIMIT |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: DK Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20100303 Ref country code: PT Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20100705 |
|
| 26N | No opposition filed |
Effective date: 20101206 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: IT Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20100303 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: MC Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20101130 |
|
| REG | Reference to a national code |
Ref country code: CH Ref legal event code: PL |
|
| GBPC | Gb: european patent ceased through non-payment of renewal fee |
Effective date: 20101112 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: CH Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20101130 Ref country code: LI Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20101130 |
|
| REG | Reference to a national code |
Ref country code: FR Ref legal event code: ST Effective date: 20110801 |
|
| REG | Reference to a national code |
Ref country code: DE Ref legal event code: R119 Ref document number: 60331584 Country of ref document: DE Effective date: 20110601 Ref country code: DE Ref legal event code: R119 Ref document number: 60331584 Country of ref document: DE Effective date: 20110531 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: FR Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20101130 Ref country code: IE Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20101112 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: GB Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20101112 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: HU Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20100904 Ref country code: LU Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20101112 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: TR Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20100303 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: DE Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20110531 |