EP1196602A1 - Die sequenz der dihydroorotat-dehydrogenase aus corynebacterium glutamicum und deren einsatz bei der mikrobiellen produktion von pyrimidinen und/oder mit pyrimidin verwandten verbindungen - Google Patents

Die sequenz der dihydroorotat-dehydrogenase aus corynebacterium glutamicum und deren einsatz bei der mikrobiellen produktion von pyrimidinen und/oder mit pyrimidin verwandten verbindungen

Info

Publication number
EP1196602A1
EP1196602A1 EP00942126A EP00942126A EP1196602A1 EP 1196602 A1 EP1196602 A1 EP 1196602A1 EP 00942126 A EP00942126 A EP 00942126A EP 00942126 A EP00942126 A EP 00942126A EP 1196602 A1 EP1196602 A1 EP 1196602A1
Authority
EP
European Patent Office
Prior art keywords
pyrimidine
corynebacterium glutamicum
dihydroorotate dehydrogenase
sequence
polypeptide
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Withdrawn
Application number
EP00942126A
Other languages
English (en)
French (fr)
Inventor
Matthias Mack
Karin Herbster
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Sygnis Pharma AG
Original Assignee
Axaron Bioscience AG
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Axaron Bioscience AG filed Critical Axaron Bioscience AG
Publication of EP1196602A1 publication Critical patent/EP1196602A1/de
Withdrawn legal-status Critical Current

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • C07K14/34—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Corynebacterium (G)

Definitions

  • the present invention is concerned with the production process of pyrimidines by fermentation using a genetically modified organism.
  • This invention consists in the sequence of the dihydroorotate dehydrogenase from Corynebac erium glutamicum and its use for the microbial production of pyrimidines and / or compounds related to pyrimidine.
  • the pyrimidine nucleotides are pyrimidine derivatives and as such activated precursors of DNA and KNA and for many biosynthetic pathways
  • a pyrimidine base is present in the pyrimidine nucleosides cytidine, uridine, deoxycytidine and deoxythyidine linked to a pentose, the pyridine nucleotides are the phosphate esters of the pyrimidine nucleosides.
  • Pyrimidine nucleosides and pyrimidine nucleotides and their derivatives are also important starting compounds for the synthesis of valuable drugs, such as CDP-choline, orotic acid or UMP (a review of this is available from Kuninaka, A. in Biotechnology, Vol. 6 (Ed .: Rehm, H.-J. and Reed, G.), VCH, Weinheim, Deutsch-la d, 1996, pp. 561-612)
  • microorganisms can synthesize their pyrimidine nucleotides both de novo and from pyrimidine bases and pyrimidine nucleosides offered from outside. Pyrimidine bases and / or pyrimidine nucleosides do not normally occur intracellularly. However, they can be formed in excess under some growth conditions and are then excreted in the culture medium. Therefore, microorganisms can be used for the fermentative production of pyrimidine nucleotides and / or related compounds.
  • the biosynthetic performance of the microorganisms for pyrimidine nucleotides can be optimized by genetic modification of the pyrimidine biosynthetic pathway. Genetic modification means that the number of gene copies and / or the speed of transcription of the genes for the pyrimidine synthesis pathway is increased. As a result, the proportion of gene product and the intracellular enzymatic activity. An increased enzymatic activity leads to an increased conversion of compounds offered in the nutrient medium to pyrimidine nucleotides and / or related compounds and thus increases the synthesis performance.
  • the invention is concerned with the new pyrD gene for the dihydroorotate dehydrogenase of the pyrimidine biosynthetic pathway from Coryne bacterium glutamicum and its use for the production of pyrimidine nucleotides and / or compounds related to pyrimidine.
  • the SEQ ID NO. 2 describes a polypeptide sequence.
  • the pyrD gene encodes a polypeptide of 322 amino acids with a molecular weight of 33953.
  • the present invention also relates to functional derivatives of this polypeptide, which can be obtained if one in SEQ ID NO. 2 by deletion, insertion or substitution or by a combination of deletion, insertion and substitution one or more amino acids, preferably replaced up to 25% of the amino acids, preferably up to 15%.
  • the term functional derivative means that the enzyme activity of the derivative is still in the same order of magnitude as that of the polypeptide with the sequence SEQ ID NO. Second
  • polynucleotide sequences which encode the polypeptides described above.
  • the polynucleotide sequences can be generated starting from sequences which are isolated from Corynebacterium glutamicum (ie SEQ ID NO. 1) by modifying these sequences by site-directed mutagenesis or after retranslating the corresponding polypeptide with the genetic one Code to perform a total chemical synthesis.
  • polynucleotide sequences can best be used in the form of gene constructs for the transformation of host organisms, preferably microorganisms.
  • These gene constructs consist of at least one copy of one of the polynucleotides together with at least one regulatory sequence. Regulatory sequences include promoters, terminators, enhancers and ribosomal binding sites.
  • Preferred host organisms for the transformation with these gene constructs are Corynebacterium and Bacillus species, any eukaryotic microorganism can also be used for this, preferably yeast strains of the genus Ashbya, Candida, Pichia, Saccharomyces and Hansenula.
  • a pyrimidine derivative is a compound with a pyrimidine ring, which can be prepared by transforming a host organism with one of the polynucleotides corresponding to the present invention.
  • the trained personnel are familiar with the processes and procedures for cultivating microorganisms and isolating pyrimidines from a microbial production.
  • DNA from the genome of Corynejbacterium glutamicum ATCC 13032 can be obtained by standard methods which have already been described, e.g. B. by J. Altenbuchner and J. Cullum (1984, Mol. Gen. Genet. 195: 134-138).
  • the genome library can be prepared according to standard regulations (for example: Sambrook, J. et al. (1989) Molecular cloning: a laboratory manual, Cold Spring Harbor Laboratory Press) with any cloning vector, for example pBluescript II KS- (Stratagene) or ZAP Express TM (Stratagene). Any fragment size can be used, preferably Sau3AI fragments with a length of 2-9 kb, which can be integrated into cloning vectors with digested BamEl.
  • E. coli clones can be selected from the genome library shown in Example 1.
  • E. coli cells are cultivated according to standard ancestors in suitable media (e.g. LB supplemented with 100 mg / 1 ampicillin), and the plasmid DNA can then be isolated. If one clones genome fragments from the DNA of Corynebacterium glutamicum in pBluescript II KS- (see Example 1), the DNA can be sequenced with the help of the oligonucleotides 5 '-AATTAACCCTCAC-TAAAGGG-3' and 5 '-GTAATACGACTCACTATAGGGC-3'.
  • nucleotide sequences can e.g. using the BLASTX algorithm (Altschul et al. (1990) J. Mol. Biol. 215: 403-410). In this way, one can discover new sequences and elucidate the function of these new genes.
  • Example 3 When the E. coli clones were analyzed as described in Example 2, followed by the analysis of the sequences obtained in Example 3, a sequence was obtained as described with SEQ ID NO. 1 is described. When using the BLASTX algorithm (see Example 3), this sequence showed similarity with the dihydroorotate dehydrogenase (PyrD; EC 1.3.3.1) from different organisms. The greatest similarity was with the dihydroorotate dehydrogenase from .Mycoiacterium leprae (SWISSPROT P46727; 67% agreement at the amino acid level).
  • the gene for the dihydroorotate dehydrogenase from Corynebacterium glutamicum can be inserted into the Corynebacterium glutamicum or in with the aid of suitable cloning and / or expression systems introduce any other microorganism. Genetically modified microorganisms can be produced that differ from the wild type in the activity or the number of copies of the genes. These novel, genetically modified strains can be used to produce pyrimidine and / or compounds related to pyrimidine.

Landscapes

  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Health & Medical Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)

Abstract

Die vorliegende Erfindung besteht aus Nucleotidsequenzen eines Gens (pyrD) für die Pyrimidinbiosynthese aus Corynebacterium glutamicum und ihrem Einsatz zur mikrobiellen Produktion von Pyrimidinen.

Description

Die Sequenz der Dihydroorotat-Dehydrogenase aus Corynebacterium glutamicum und deren Einsatz bei der mikrobiellen Produktion von Pyrimidinen und/oder mit Pyrimidin verwandten Verbindungen
Beschreibung
Die vorliegende Erfindung befaßt sich mit dem Produktionsprozeß von Pyrimidinen durch Fermentation mit Hilfe eines gentechnisch veränderten Organismus . Diese Erfindung besteht in der Sequenz der Dihydroorotat-Dehydrogenase aus Corynebac erium glutamicum und deren Einsatz zur mikrobiellen Produktion von Pyrimidinen und/oder von mit Pyrimidin verwandten Verbindungen.
Der Biosyntheseweg für Pyrimidine ist für alle lebenden Organismen essentiell (ein Übersichtsartikel hierzu findet sich von Switzer, R. L. und Quinn, C. L. in Bacillus subtilis (Hrsg.: Sonenshein, A. L . , Hoch, J. A. und Losick, R. , American Society for Microbiology, Washington, D.C.), 1993, S. 343-358. Die Pyri- midinnucleotide sind Pyrimidinderivate und als solche aktivierte Vorstufen der DNA und KNA und für viele Biosynthesewege. In den Pyrimidinnucleosiden Cytidin, Uridin, Deoxycytidin und Deoxythy- idin ist eine Pyrimidinbase an eine Pentose gebunden, die Pyri- idinnucleotide sind die Phosphatester der Pyrimidinnucleoside. Pyrimidinnucleoside und Pyrimidinnucleotide und deren Derivate sind auch wichtige AusgangsVerbindungen zur Synthese wertvoller Arzneimittel, wie z.B. CDP-Cholin, Orotsäure oder UMP (ein Über- sichtsartikel hierzu gibt es von Kuninaka, A. in Biotechnology, Vol. 6 (Hrsg.: Rehm, H.-J. und Reed, G. ) , VCH, Weinheim, Deutsch- la d, 1996, S. 561-612)
Viele, aber nicht alle Mikroorganismen können ihre Pyrimidinnucleotide sowohl de novo als auch aus von außen angebotenen Pyri- midinbasen und Pyrimidinnucleosiden synthetisieren. Pyrimidin- basen und/oder Pyrimidinnucleoside kommen normalerweise nicht intrazellulär vor. Sie können jedoch unter manchen Wachstumsbedingungen im Überschuß gebildet werden und werden dann in das Kulturmedium ausgeschieden. Darum lassen sich Mikroorganismen zur fermentativen Produktion von Pyrimidinnucleotiden und/oder ver- wandten Verbindungen einsetzen.
Die Biosyntheseleistung der Mikroorganismen für Pyrimidinnucleotide läßt sich durch gentechnische Veränderung des Pyrimidinbio- synthesewegs optimieren. Gentechnische Veränderung bedeutet hier- bei, daß die Anzahl der Genkopien und/oder die Geschwindigkeit der Transkription der Gene für den Pyrimidinsyntheseweg erhöht wird. Als Folge hiervon steigt der Anteil an Genprodukt und die intrazelluläre enzymatische Aktivität. Eine erhöhte enzymatische Aktivität führt zu einer vermehrten Umwandlung von im Nährmedium angebotenen Verbindungen zu Pyrimidinnucleotiden und/oder verwandten Verbindungen und steigert so die Syntheseleistung. So konnte man zeigen, daß z.B. ein Anstieg der Aktivität der Dihydroorotat-Dehydrogenase, die die Oxidation von (_?) -Dihydroorotat zu Orotat katalysiert - dies ist die vierte Stufe bei der de novo Pyri idinbiosynthese für Pyrimidinnucleotide - die UMP-Synthese- leistung in Corynebacterium ammoniagenes erhöht (Nudler, A. A., Garibyan, A. G. und Bourd, G. I. (1991) FEMS Microbiol. Lett. 82:263-266) .
Die Erfindung befaßt sich mit dem neuen pyrD-Gen für die Dihydroorotat-Dehydrogenase des Pyrimidinbiosynthesewegs aus Coryne- bacterium glutamicum und seinem Einsatz zur Herstellung von Pyrimidinnucleotiden und/oder mit Pyrimidin verwandten Verbindungen.
Ein Teil der Erfindung besteht in dem pyrD-Genprodukt . Die SEQ ID NR. 2 beschreibt eine Polypeptidseguenz . Das pyrD-Gen kodiert ein Polypeptid aus 322 Aminosäuren mit einem Molekulargewicht von 33953. Die vorliegende Erfindung befaßt sich aber auch mit funk- tionellen Derivaten dieses Polypeptids, die man erhalten kann, wenn man in der SEQ ID NR. 2 durch Deletion, Insertion oder Substitution oder durch eine Kombination von Deletion, Insertion und Substitution eine oder mehrere Aminosäuren, vorzugsweise bis zu 25% der Aminosäuren ersetzt, am besten bis zu 15%. Der Ausdruck funktionelles Derivat bedeutet, daß die Enzymaktivität des Derivats noch in der gleichen Größenordnung liegt wie die des Polypeptids mit der Sequenz SEQ ID NR. 2.
Ein weiterer Teil der Erfindung besteht in den Polynucleotidse- quenzen, die die oben beschriebenen Polypeptide kodieren. Die Po- l nucleotidsequenzen lassen sich ausgehend von Sequenzen, die man aus Corynebacterium glutamicum isoliert (d.h. SEQ ID NR. 1) , er- zeugen, in dem man diese Sequenzen durch ortsgerichtete Muta- genese modifiziert oder nach Rückübersetzung des entsprechenden Polypeptids mit dem genetischen Code eine chemische Totalsynthese aus führ .
Diese Polynucleotidsequenzen können am besten in Form von Genkon- strukten zur Transformation von WirtsOrganismen, vorzugsweise von Mikroorganismen, eingesetzt werden. Diese Genkonstrukte bestehen zumindest aus einer Kopie eines der Polynucleotide zusammen mit zumindest einer regulatorischen Sequenz. Regulatorische Sequenzen umfassen Promotoren, Terminatoren, Verstärker und ribosomale Bindungsstellen . Bevorzugte Wirtsorganismen für die Transformation mit diesen Gen- konstrukten sind Corynebacterium- und Bacillus-Arten, auch jeden eukaryontischen Mikroorganismus kann man dafür einsetzen, vorzugsweise Hefestämme der Gattung Ashbya, Candida , Pichia , Saccharomyces und Hansenula .
Ein weiterer Teil der Erfindung besteht im Herstellungsprozeß für Pyrimidine und Pyrimidinderivate mit Hilfe der Kultivierung eines Wirtsorganismus, der in der oben beschriebenen Art transformiert ist, und in der nachfolgenden Isolierung der Pyrimidine. Unter einem Pyrimidinderivat versteht man eine Verbindung mit einem Pyrimidinring, das sich dadurch herstellen läßt, daß man einen Wirtsorganismus mit einem der der hier vorliegenden Erfindung entsprechenden Polynucleotide transformiert.
Die Verfahren und Vorgehensweisen zur Kultivierung von Mikroorganismen und zur Isolierung von Pyrimidinen aus einer mikrobiellen Produktion sind dem geschulten Personal geläufig.
Die folgenden Beispiele beschreiben, wie die Erfindung entstand und ihre Anwendung bei der gentechnischen Veränderung von Mikroorganismen zur erhöhten Produktionsleistung von Pyrimidinnucleo- tiden und/oder verwandten Verbindungen.
Beispiel 1
Darstellung einer Genombibliothek aus Corynebacterium glutamicum ATCC 13032
DNA aus dem Genom von Corynejbacterium glutamicum ATCC 13032 läßt sich nach Standardmethoden gewinnen, die bereits beschrieben sind, z. B. von J. Altenbuchner und J. Cullum (1984, Mol. Gen. Genet. 195:134-138). Die Genombibliothek läßt sich nach Standardvorschriften (z.B.: Sambrook, J. et al . (1989) Molecular cloning: a laboratory manual , Cold Spring Harbor Laboratory Press) mit einem beliebigen Klonierungsvektor herstellen, z.B. pBluescript II KS- (Stratagene) oder ZAP Express™ (Stratagene) . Dabei kann man jede beliebige Fragmentgröße benutzen, vorzugsweise Sau3AI- Fragmente mit einer Länge von 2-9 kb, die sich in Klonierungsvek- toren mit verdautem BamEl einbinden lassen. Beispiel 2
Analyse der Nucleinsäuresequenz der Genombibliothek
Einzelne E. coli-Klone kann man aus der im Beispiel 1 dargestellten Genombibliothek auswählen. E. coli-Zellen werden nach Standardvorfahren in geeigneten Medien kultiviert (z.B. LB ergänzt mit 100 mg/1 Ampicillin) , und danach läßt sich die Plasmid-DNA isolieren. Klont man Genomfragmente aus der DNA von Corynebacte- rium glutamicum in pBluescript II KS- (siehe Beispiel 1) , läßt sich die DNA mit Hilfe der Oligonucleotide 5 ' -AATTAACCCTCAC- TAAAGGG-3 ' und 5 ' -GTAATACGACTCACTATAGGGC-3 ' sequenzieren.
Beispiel 3
Computeranalyse der Sequenzen der isolierten Nukleinsäuren
Die Nucleotidsequenzen lassen sich z.B. mit Hilfe des BLASTX-Al- gorith us (Altschul et al . (1990) J. Mol. Biol . 215: 403-410) aneinanderfügen. Auf diesem Weg kann man neuartige Sequenzen entdecken und die Funktion dieser neuartigen Gene aufklären.
Beispiel 4
Identifizierung eines E. coli-Klons, der das Gen für die Dihydroorotat-Dehydrogenase (EC 1.3.3.1) enthält
Bei der Analyse der E. coli-Klone, wie sie im Beispiel 2 beschrieben wurde, an die sich die im Beispiel 3 beschriebene Analyse der dabei erhaltenen Sequenzen anschloß, ergab sich eine Sequenz, wie sie mit SEQ ID NR. 1 beschrieben ist. Bei der Anwendung des BLASTX-Algorithmus (siehe Beispiel 3) ergab diese Sequenz Ähnlichkeit mit der Dihydroorotat-Dehydrogenase (PyrD; EC 1.3.3.1) aus verschiedenen Organismen. Die größte Ähnlichkeit war mit der Dihydroorotat-Dehydrogenase aus .Mycoiacterium leprae gegeben (SWISSPROT P46727; 67% Übereinstimmung auf der Stufe der Aminosäuren) .
Beispiel 5
Der Einsatz des Gens für die Dihydroorotat-Dehydrogenase (pyrD) aus Corynebacteri um glutamicum zur Produktion von Pyrimidin und/ oder mit Pyrimidin verwandten Verbindungen
Das Gen für die Dihydroorotat-Dehydrogenase aus Corynebacterium glutamicum kann man mit Hilfe geeigneter Klonierungs- und/oder Expressions Systeme in das Corynebacterium glutamicum oder in einen beliebigen anderen Mikroorganismus einführen. Es lassen sich gentechnisch veränderte Mikroorganismen herstellen, die sich vom Wildtyp in der Aktivität oder der Anzahl der Kopien der Gene unterscheiden. Diese neuartigen, gentechnisch veränderten Stämme kann man zur Produktion von Pyrimidin und/oder mit Pyrimidin verwandten Verbindungen einsetzen.
Sequenzliste
(I) Allgemeine Angaben
(1) Anmelder:
(A) Name: BASF-LYNX Bioscience AG (B) Straße: Im Neuenheimer Feld 515
(C) Stadt: Heidelberg
(D) Land: Deutschland
(E) Postleitzahl: 69120
(F) Telephon: 06221/4546 (G) Telefax: 06221/454770
(2) Titel: Die Sequenz der Dihydroorotat-Dehydrogenase aus
Corynebacterium glutamicum und deren Einsatz zur mikrobiellen Produktion von Pyrimidinen und/oder mit Pyrimidin verwandten Verbindungen
(3) Anzahl der Sequenzen: 2
(4) Art der vom Computer lesbaren Form:
(A) Datenträger: Diskette
(B) Computer: IBM PC kompatibel
(C) Betriebssystem: Windows NT
(D) Software: Microsof ®word 97 SR-1
(I) Angaben zur SEQ ID NR. 1:
(1) Sequenzcharakteristika:
(A) Länge: 966
(B) Art: Nucleinsäure
(C) Strangtyp: Doppelsträng
(D) Topologie: linear
(2) Art des Moleküls: DNA
(3) hypothetisch: nein
(4) Antisense: nein ( 5 ) Herkunft :
(A) Organismus: Corynebacterium glutamicum
(6) Beschreibung der Sequenz: SEQ ID NR. 1:
ATGGAAAAAATCATCGCAGTGCACGATGATTCCCTCTCCCAGGAAGTCTTCGGCGTCACCTTCCC ACGACCACTAGGCCTCGCCGCAGGTTTCGACAAAAACGCATCAATGGCTGATGCCTGGGGTGCCG TTGGATTCGGATACGCCGAACTTGGCACCGTCACCGCCTCCCCACAGCCAGGAAACCCCACCCCG CGCCTTTTCCGCCTGCCTGCCGACAAAGCTATCTTGAACCGCATGGGATTCAACAACCTGGGTGC AGCAGAAGTCGCAAAAAACCTGCGCAACCGGAAATCCACCGATGTCATCGGCATCAACATCGGTA AAACCAAAGTGGTTCCCGCTGAACACGCAGTAGATGACTACCGCCGTTCTGCATCTTTGTTAGGT GATCTTGCTGATTACCTGGTTGTCAACGTTTCCTCCCCCAACACTCCGGGTCTCCGCGATCTGCA GGCTGTGGAATCTTTGCGACCAATCCTCGCCGCAGTGCAGGAATCCACCACCGTCCCAGTCTTGG TGAAAATCGCACCAGACCTCTCCGACGAAGACATCGACGCCGTAGCTGACCTGGCAGTTGAGCTC AAACTCGCCGGAATCGTAGCCACCAATACCACCATTTCCCGCGAAGGCCTCAACACTCCTTCAGG TGAAGTCGAAGCCATGGGTGCTGGCGGAATCTCCGGTGCTCCAGTAGCAGCCCGATCTTTGGAGG TACTCAAGCGCCTCTACGCACGGGTAGGCAAAGAGATGGTGTTGATCTCTGTCGGTGGCATCAGC ACCCCTGAGCAAGCCTGGGAACGCATCACCTCCGGCGCAACCCTTCTGCAGGGATACACCCCATT CATCTACGGTGGCCCCGATTGGATCAGAGATATCCACCTTGGTATCGCCAAGCAGCTGAAAGCTC ACGGTCTGCGCAACATCGCTGACGCTGTGGGCAGCGAATTGGAGTGGAAGAACTAA
(1) Angaben zur SEQ ID NR. 2:
(1) Sequenzcharakteristika:
(A) Länge: 322
(B) Art: Aminosäure
(C) Strangtyp: eine Kette (D) Topologie: linear
(2) Art des Moleküls: Aminosäure
(3) hypothetisch: nein
(4) Antisense: nein (5) Herkunft:
(B) Organismus: Corynebacterium glutamicum
(6) Beschreibung der Sequenz: SEQ ID NR. 2:
MEKIIAVHDDSLSQEVFGVTFPRPLGLAAGFDKNASMADAWGAVGFGYAELGTVTASPQPGNPTP RLFRLPADKAILNRMGFNNLGAAFVAKNLRNRKSTDVIGINIGKTKVVPAEHAVDDYRRSASLLG DLADYLWNVSSPNTPGLRDLQAVESLRPILAAVQESTTVPVLVKIAPDLSDEDIDAVADLAVEL KLAGIVATNTTISREGLNTPSGEVEAMGAGGISGAPVAARSLEVLKRLYARVGKEMVLISVGGIS TPEQAWERITSGATLLQGYTPFIYGGPDWIRDIHLGIAKQLKAHGLRNIADAVGSELEWKN

Claims

Patentansprüche
1. Ein Polypeptid mit Dihydroorotat-Dehydrogenaseaktivität , das aus der folgenden Gruppe ausgewählt wurde:
(a) ein Polypeptid mit einer Aminosäuresequenz, wie sie in der SEQ ID NR. 2 beschrieben ist,
(b) ein Polypeptid, das im Vergleich zu (a) durch Deletion, Insertion oder Substitution einer oder mehrerer Aminosäuren verändert ist.
2. Ein Polynucleotid, das ein dem Anspruch 1 entsprechendes Polypeptid kodiert.
3. Ein Genkonstruk , das zumindest aus einer Kopie eines dem Anspruch 2 entsprechenden Polynucleotids zusammen mit zumindest einer regulatorischen Sequenz besteht.
4. Ein Wir sOrganismus, der mit einem dem Anspruch 3 entsprechenden Gen transformiert ist.
5. Ein Prozeß zur Produktion von Pyrimidinen und Pyrimidin- derivaten, bei dem ein dem Anspruch 4 entsprechender Wirtsorganismus kultiviert und in der Folge das Pyrimidin oder das Pyrimidinderivat isoliert wird.
EP00942126A 1999-06-25 2000-06-23 Die sequenz der dihydroorotat-dehydrogenase aus corynebacterium glutamicum und deren einsatz bei der mikrobiellen produktion von pyrimidinen und/oder mit pyrimidin verwandten verbindungen Withdrawn EP1196602A1 (de)

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
DE19929364 1999-06-25
DE19929364A DE19929364A1 (de) 1999-06-25 1999-06-25 Die Sequenz der Dihydroorotat-Dehydrogenase aus Corynebacterium glutamicum und deren Einsatz bei der mikrobiellen Produktion von Pyrimidinen und/oder mit Pyrimidin verwandten Verbindungen
PCT/EP2000/005850 WO2001000847A1 (de) 1999-06-25 2000-06-23 Die sequenz der dihydroorotat-dehydrogenase aus corynebacterium glutamicum und deren einsatz bei der mikrobiellen produktion von pyrimidinen und/oder mit pyrimidin verwandten verbindungen

Publications (1)

Publication Number Publication Date
EP1196602A1 true EP1196602A1 (de) 2002-04-17

Family

ID=7912678

Family Applications (1)

Application Number Title Priority Date Filing Date
EP00942126A Withdrawn EP1196602A1 (de) 1999-06-25 2000-06-23 Die sequenz der dihydroorotat-dehydrogenase aus corynebacterium glutamicum und deren einsatz bei der mikrobiellen produktion von pyrimidinen und/oder mit pyrimidin verwandten verbindungen

Country Status (8)

Country Link
EP (1) EP1196602A1 (de)
KR (1) KR20020026470A (de)
CN (1) CN1358229A (de)
AU (1) AU5685400A (de)
CA (1) CA2377482A1 (de)
DE (1) DE19929364A1 (de)
WO (1) WO2001000847A1 (de)
ZA (1) ZA200200581B (de)

Families Citing this family (16)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6958228B2 (en) 2000-08-02 2005-10-25 Degussa Ag Nucleotide sequence which code for the metH gene
US6942996B2 (en) 2000-08-02 2005-09-13 Degussa Ag Isolated polynucleotide from Corynebacterium encoding a homocysteine methyltransferase
DE10039044A1 (de) 2000-08-10 2002-02-21 Degussa Neue für das IysR1-Gen kodierende Nukleotidsequenzen
DE10039043A1 (de) 2000-08-10 2002-02-21 Degussa Neue für das luxR-Gen kodierende Nukleotidsequenzen
DE10039049A1 (de) 2000-08-10 2002-02-21 Degussa Neue für das IysR3-Gen kodierende Nukleotidsequenzen
EP1313759A1 (de) 2000-08-26 2003-05-28 Degussa AG Nukleotidsequenzen die das ccpa2 gen kodieren
US6812016B2 (en) 2000-09-02 2004-11-02 Degussa Ag Nucleotide sequences which code for the metY gene
US6815196B2 (en) 2000-09-02 2004-11-09 Degussa Ag Nucleotide sequences encoding o-succinylhomoserine sulfhydrylase
US6759224B2 (en) 2000-09-09 2004-07-06 Degussa Ag Nucleotide sequences which code for the sahH gene
WO2002020792A1 (en) 2000-09-09 2002-03-14 Degussa Ag Efflux protein dep33 of corynebacterium glutamicum
DE10045496A1 (de) 2000-09-14 2002-03-28 Degussa Neue für das ptsi-Gen kodierende Nukleotidsequenzen
DE10055869A1 (de) 2000-11-10 2002-05-29 Degussa Neue für das nadA-Gen kodierende Nukleotidsequenzen
DE10055870A1 (de) 2000-11-10 2002-05-29 Degussa Neue für das nadC-Gen kodierende Nukleotidsequenzen
CN102304490B (zh) * 2011-09-05 2013-07-10 南京工业大学 高效表达乳清酸磷酸核糖转移酶和乳清苷酸脱羧酶的重组菌及其构建方法
CN110564660B (zh) * 2019-09-18 2023-03-21 苏州华赛生物工程技术有限公司 生产乳清酸的重组微生物及方法
CN112391329B (zh) * 2020-11-12 2023-07-25 江南大学 一种抗酸胁迫能力提高的大肠杆菌工程菌及其应用

Family Cites Families (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JPH0710235B2 (ja) * 1987-10-19 1995-02-08 協和醗酵工業株式会社 発酵法によるオロット酸の製造法
EP0471466A3 (en) * 1990-08-03 1992-07-08 Eli Lilly And Company Dna sequences which impart resistance to the fungicide 8-chloro-4-(2-chloro-4-fluorophenoxy)quinoline

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See references of WO0100847A1 *

Also Published As

Publication number Publication date
KR20020026470A (ko) 2002-04-10
CA2377482A1 (en) 2001-01-04
DE19929364A1 (de) 2000-12-28
CN1358229A (zh) 2002-07-10
WO2001000847A1 (de) 2001-01-04
AU5685400A (en) 2001-01-31
ZA200200581B (en) 2003-03-26

Similar Documents

Publication Publication Date Title
EP1196602A1 (de) Die sequenz der dihydroorotat-dehydrogenase aus corynebacterium glutamicum und deren einsatz bei der mikrobiellen produktion von pyrimidinen und/oder mit pyrimidin verwandten verbindungen
EP1194565A1 (de) Gene aus corynebacterium glutamicum für die folsäurebiosynthese und ihr einsatz zur mikrobiellen herstellung von folsäure
EP1700864A1 (de) Verfahren zur fermentativen Herstellung von S-Adenosylmethionin
WO2001000802A2 (de) Teilsequenzen der gene des primär- und sekundärmetabolismus aus corynebacterium glutamicum
EP0751995A1 (de) Riboflavin-biosynthesis in fungi
DE69333419T2 (de) Synthese von chinasäure aus glykose
DE102008063234B4 (de) Biotechnologische Herstellung von Riboflavin mit hoher Ausbeute
EP0668917B1 (de) Riboflavin-synthese in hefen
WO1998029539A2 (de) Teilsequenzen von genen der purinbiosynthese aus ashbya gossypii und deren verwendung in der mikrobiellen riboflavinsynthese
US5281531A (en) Host and vector for producing D-ribose
EP1244776B1 (de) Tetrahydropyrimidin-dioxygenase-gen, dadurch kodierte polypeptide und verfahren zur deren herstellung
DE2839052A1 (de) Mikrobiologisches verfahren
EP0938584A2 (de) Verfahren zur herstellung von (s)- oder (r)-3,3,3-trifluor-2-hydroxy-2-methylpropionsaüre
DE4024158A1 (de) Klonierung und ueberexpression von glucose-6-phosphat-dehydrogenase aus leuconostoc dextranicus
Luehrsen et al. The sequence of Tetrahymena thermophila 5S ribosomal ribonucleic acid
DE60032630T2 (de) Gdp-4-keto-6-deoxy-d-mannose-3,5-epimerase-4-reduktasegene aus arabidopsis
DE69233447T2 (de) Biotin-Operon
WO2011076370A1 (de) Sucrosemutase mit verbesserter produktspezifität
EP2499253A2 (de) Mikroorganismen mit gesteigerter sucrosemutaseaktivität
JP3290473B2 (ja) ビオチンオペロン
WO2023111055A1 (de) Besonders geeignete 3-desoxyarabinoheptulosanat-7-phosphat-synthase zur fermentativen herstellung von ortho-aminobenzoesäure
EP0285949A2 (de) Genetische Kontrolleinheit und Klonierungs- und Expressionssystem
DE4118450C2 (de) DNA-Fragment enthaltend ein Sucrosephosphorylase-Gen und Verfahren zur Herstellung von Sucrosephosphorylase
EP1322764A2 (de) Verfahren zur verbesserten herstellung von cyanophycin und dessen folgeprodukte
JPH09289894A (ja) 新規ｍｕｒＦ遺伝子

Legal Events

Date Code Title Description
PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

17P Request for examination filed

Effective date: 20020119

AK Designated contracting states

Kind code of ref document: A1

Designated state(s): AT BE CH CY DE DK ES FI FR GB GR IE IT LI LU MC NL PT SE

AX Request for extension of the european patent

Free format text: AL;LT PAYMENT 20020119;LV PAYMENT 20020119;MK;RO PAYMENT 20020119;SI PAYMENT 20020119

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN

18D Application deemed to be withdrawn

Effective date: 20040103