DK147484C - Fremgangsmaade til fremstilling af derivater af 4-desacetyl-vincaleucoblastin-c-3-carboxhydrazid - Google Patents

Fremgangsmaade til fremstilling af derivater af 4-desacetyl-vincaleucoblastin-c-3-carboxhydrazid

Info

Publication number
DK147484C
DK147484C DK160679A DK160679A DK147484C DK 147484 C DK147484 C DK 147484C DK 160679 A DK160679 A DK 160679A DK 160679 A DK160679 A DK 160679A DK 147484 C DK147484 C DK 147484C
Authority
DK
Denmark
Prior art keywords
vincaleucoblastin
desacetyl
carbox
hydrazide
preparing derivatives
Prior art date
Application number
DK160679A
Other languages
Danish (da)
English (en)
Other versions
DK160679A (da
DK147484B (da
Inventor
George Joseph Cullinan
Koert Gerzon
Original Assignee
Lilly Co Eli
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Lilly Co Eli filed Critical Lilly Co Eli
Publication of DK160679A publication Critical patent/DK160679A/da
Priority to DK13983A priority Critical patent/DK148655C/da
Priority to DK14083A priority patent/DK148510C/da
Publication of DK147484B publication Critical patent/DK147484B/da
Application granted granted Critical
Publication of DK147484C publication Critical patent/DK147484C/da

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D519/00Heterocyclic compounds containing more than one system of two or more relevant hetero rings condensed among themselves or condensed with a common carbocyclic ring system not provided for in groups C07D453/00 or C07D455/00
    • C07D519/04Dimeric indole alkaloids, e.g. vincaleucoblastine
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents

Landscapes

  • Organic Chemistry (AREA)
  • Chemical & Material Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Animal Behavior & Ethology (AREA)
  • Medicinal Chemistry (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Organic Low-Molecular-Weight Compounds And Preparation Thereof (AREA)
  • Saccharide Compounds (AREA)
  • Nitrogen And Oxygen Or Sulfur-Condensed Heterocyclic Ring Systems (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Low-Molecular Organic Synthesis Reactions Using Catalysts (AREA)
DK160679A 1978-04-20 1979-04-19 Fremgangsmaade til fremstilling af derivater af 4-desacetyl-vincaleucoblastin-c-3-carboxhydrazid DK147484C (da)

Priority Applications (2)

Application Number Priority Date Filing Date Title
DK13983A DK148655C (da) 1978-04-20 1983-01-14 Analogifremgangsmaade til fremstilling af derivater af 4-desacetyl-vincaleucoblastin-c-3-carboxhydrazid
DK14083A DK148510C (da) 1978-04-20 1983-01-14 Analogifremgangsmaade til fremstilling af derivater af 4-desacetyl-vincaleucoblastin-c-3-carboxhydrazid

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US05/899,032 US4166810A (en) 1978-04-20 1978-04-20 Derivatives of 4-desacetyl VLB C-3 carboxyhydrazide
US89903278 1978-04-20

Publications (3)

Publication Number Publication Date
DK160679A DK160679A (da) 1979-10-21
DK147484B DK147484B (da) 1984-08-27
DK147484C true DK147484C (da) 1985-03-25

Family

ID=25410402

Family Applications (1)

Application Number Title Priority Date Filing Date
DK160679A DK147484C (da) 1978-04-20 1979-04-19 Fremgangsmaade til fremstilling af derivater af 4-desacetyl-vincaleucoblastin-c-3-carboxhydrazid

Country Status (32)

Country Link
US (1) US4166810A (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html)
EP (1) EP0005051B1 (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html)
JP (1) JPS54141798A (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html)
AR (1) AR228940A1 (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html)
AT (1) AT369010B (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html)
AU (1) AU527109B2 (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html)
BE (1) BE875652A (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html)
BG (3) BG33294A3 (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html)
CA (1) CA1097629A (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html)
CH (1) CH643269A5 (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html)
CS (3) CS218583B2 (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html)
DD (1) DD143075A5 (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html)
DE (1) DE2964130D1 (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html)
DK (1) DK147484C (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html)
EG (1) EG14867A (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html)
ES (2) ES479754A1 (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html)
FI (1) FI791286A7 (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html)
FR (1) FR2423495A1 (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html)
GB (1) GB2019396B (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html)
GR (1) GR69987B (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html)
HU (1) HU181431B (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html)
IE (1) IE48213B1 (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html)
IL (1) IL57168A (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html)
LU (1) LU81166A1 (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html)
NZ (1) NZ190213A (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html)
PH (1) PH14163A (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html)
PL (3) PL125470B1 (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html)
PT (1) PT69496A (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html)
RO (3) RO80084A (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html)
SU (3) SU1225490A3 (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html)
YU (1) YU93179A (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html)
ZA (1) ZA791856B (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html)

Families Citing this family (24)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4322351A (en) * 1980-08-25 1982-03-30 Eli Lilly And Company Antineoplastic 4'-formylamino and 4'-acetylamino VLB, and derivatives thereof
EP0123441B1 (en) * 1983-03-30 1990-10-03 Lilly Industries Limited Vincaleukoblastine derivatives
US4675400A (en) * 1985-06-17 1987-06-23 Eli Lilly And Company Bifunctional derivatives of 4-desacetyl indole-dihydroindole alkaloids
US4667030A (en) * 1985-06-17 1987-05-19 Eli Lilly And Company Hydrazide succinimide derivatives of antineoplastic indole-dihydroindole alkaloids
US4801688A (en) * 1986-05-27 1989-01-31 Eli Lilly And Company Hydrazone immunoglobulin conjugates
US5043336A (en) * 1990-04-03 1991-08-27 Eli Lilly And Company Cyclic imide derivatives of 4-desacetyl VLB c-3 carboxhydrazide
US5043340A (en) * 1990-04-03 1991-08-27 Eli Lilly And Company Derivatives of 4-desacetyl VLB C-3 carboxhydrazide
DE60231868D1 (de) * 2001-04-24 2009-05-20 Purdue Research Foundation Folat-mimetika und deren folatrezeptorbindende konjugate
EP2060272A3 (en) * 2002-05-15 2009-05-27 Endocyte, Inc. Vitamin-mitomycin conjugates
CA2512867C (en) 2003-01-27 2014-08-26 Endocyte, Inc. Vitamin receptor binding drug delivery conjugates
US8288557B2 (en) 2004-07-23 2012-10-16 Endocyte, Inc. Bivalent linkers and conjugates thereof
EP1863816B1 (en) * 2005-03-16 2014-06-25 Endocyte, Inc. Synthesis and purification of pteroic acid and conjugates thereof
ES2468240T3 (es) 2005-08-19 2014-06-16 Endocyte, Inc. Conjugados de ligando de múltiples fármacos
EP1948240A2 (en) 2005-08-19 2008-07-30 Endocyte, Inc. Ligand conjugates of vinca alkaloids, analogs and derivatives
WO2008100591A2 (en) * 2007-02-14 2008-08-21 The General Hospital Corporation Modulation of nitric oxide signaling to normalize tumor vasculature
WO2008101231A2 (en) 2007-02-16 2008-08-21 Endocyte, Inc. Methods and compositions for treating and diagnosing kidney disease
US9555139B2 (en) * 2007-03-14 2017-01-31 Endocyte, Inc. Binding ligand linked drug delivery conjugates of tubulysins
US9877965B2 (en) 2007-06-25 2018-01-30 Endocyte, Inc. Vitamin receptor drug delivery conjugates for treating inflammation
AU2008268432B2 (en) 2007-06-25 2015-01-15 Endocyte, Inc. Conjugates containing hydrophilic spacer linkers
EP2209374B1 (en) 2007-10-25 2014-12-03 Endocyte, Inc. Tubulysins and processes for preparing
US9168232B2 (en) * 2009-09-07 2015-10-27 Nipro Patch Co., Ltd. Transdermally absorbable preparation
US10080805B2 (en) 2012-02-24 2018-09-25 Purdue Research Foundation Cholecystokinin B receptor targeting for imaging and therapy
US20140080175A1 (en) 2012-03-29 2014-03-20 Endocyte, Inc. Processes for preparing tubulysin derivatives and conjugates thereof
HK1212618A1 (zh) 2012-10-16 2016-06-17 恩多塞特公司 含有非天然氨基酸的藥物遞送綴合物以及其使用方法

Family Cites Families (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3097137A (en) * 1960-05-19 1963-07-09 Canadian Patents Dev Vincaleukoblastine
US3205220A (en) * 1961-10-26 1965-09-07 Lilly Co Eli Leurosidine and leurocristine and their production
US3392173A (en) * 1964-03-09 1968-07-09 Lilly Co Eli Novel acyl derivatives of desacetyl-vincaleukoblastine and processes for their preparation
US3370057A (en) * 1964-04-27 1968-02-20 Lilly Co Eli Leurosine
US3387001A (en) * 1964-10-19 1968-06-04 Lilly Co Eli Novel aminoacyl esters of desacetyl vincaleukoblastine
US3887565A (en) * 1974-05-06 1975-06-03 Lilly Co Eli Vincadioline
US3890325A (en) * 1974-05-15 1975-06-17 Lilly Co Eli Leurocolombine
US3954773A (en) * 1974-11-21 1976-05-04 Eli Lilly And Company 4-Desacetoxyvinblastine
IL48685A (en) * 1975-01-09 1980-03-31 Lilly Co Eli Amides of vincadioline and vinblastine
US3944554A (en) * 1975-01-09 1976-03-16 Eli Lilly And Company 4-Desacetoxy-3-hydroxyvinblastine
US4029663A (en) * 1975-07-10 1977-06-14 Eli Lilly And Company Dimeric anhydro-vinca derivatives
US4115388A (en) * 1977-03-30 1978-09-19 Eli Lilly And Company 3'-Oxygenated derivatives of 4'-deoxy VLB "A" and "B" and related 1-formyl compounds

Also Published As

Publication number Publication date
ES479754A1 (es) 1980-08-16
CH643269A5 (fr) 1984-05-30
CS218585B2 (en) 1983-02-25
EP0005051A1 (en) 1979-10-31
IE48213B1 (en) 1984-10-31
JPS6245873B2 (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html) 1987-09-29
FI791286A7 (fi) 1981-01-01
PL215911A1 (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html) 1980-03-24
DD143075A5 (de) 1980-07-30
AR228940A1 (es) 1983-05-13
SU1225490A3 (ru) 1986-04-15
FR2423495B1 (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html) 1983-02-11
US4166810A (en) 1979-09-04
AU527109B2 (en) 1983-02-17
DK160679A (da) 1979-10-21
ATA291279A (de) 1982-04-15
PL119416B1 (en) 1981-12-31
PH14163A (en) 1981-03-19
NZ190213A (en) 1982-12-21
ZA791856B (en) 1980-11-26
DE2964130D1 (en) 1983-01-05
HU181431B (en) 1983-07-28
EP0005051B1 (en) 1982-12-01
PL125470B1 (en) 1983-05-31
BE875652A (fr) 1979-10-18
CS218584B2 (en) 1983-02-25
RO81037A (ro) 1983-02-01
PT69496A (en) 1979-05-01
DK147484B (da) 1984-08-27
CA1097629A (en) 1981-03-17
GR69987B (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html) 1982-07-22
SU1061698A3 (ru) 1983-12-15
EG14867A (en) 1986-09-30
IE790795L (en) 1979-10-20
BG33297A3 (bg) 1983-01-14
LU81166A1 (fr) 1979-09-07
RO80084B (ro) 1983-01-30
AT369010B (de) 1982-11-25
FR2423495A1 (fr) 1979-11-16
GB2019396B (en) 1982-09-15
ES479753A1 (es) 1980-08-16
CS218583B2 (en) 1983-02-25
GB2019396A (en) 1979-10-31
SU893135A3 (ru) 1981-12-23
RO81114A (ro) 1983-02-01
AU4609779A (en) 1979-10-25
IL57168A (en) 1983-10-31
RO81037B (ro) 1983-01-30
BG33296A3 (bg) 1983-01-14
JPS54141798A (en) 1979-11-05
YU93179A (en) 1983-01-21
RO81114B (ro) 1983-01-30
IL57168A0 (en) 1979-07-25
BG33294A3 (bg) 1983-01-14
RO80084A (ro) 1983-02-01

Similar Documents

Publication Publication Date Title
DK147484C (da) Fremgangsmaade til fremstilling af derivater af 4-desacetyl-vincaleucoblastin-c-3-carboxhydrazid
DK158679C (da) Fremgangsmaade til fremstilling af ethanol
DK251079A (da) Fremgangsmaade til fremstilling af phenylpiperazinderivater
DK520679A (da) Fremgangsmaade til fremstilling af 3-quinolincarboxulsyrederivater
DK584777A (da) Fremgangsmaade til fremstilling af sterolinforbindelser
DK152752C (da) Fremgangsmaade til fremstilling af l-sulpirid
DK70979A (da) Fremgangsmaade til fremstilling af phthalocyaninpigmeneter
DK232080A (da) Fremgangsmaade til fremstilling af hydroxyaminoeburnanderivater
DK300781A (da) Fremgangsmaade til fremstilling af halogenfenylpyridyllylamin-derivater
DK226579A (da) Fremgangsmaade til fremstilling af metaboliter
DK183880A (da) Fremgangsmaade til fremstilling af hydroxyderivater af isopropyrimidin
DK160312C (da) Fremgangsmaade til fremstilling af derivater af 7-aminothiazolylacetamidocephalosporansyre
DK159153C (da) Analogifremgangsmaade til fremstilling af penicillinforbindelser
DK152579A (da) Fremgangsmaade til fremstilling af androstaner
DK36379A (da) Fremgangsmaade til fremstilling af n-ethylethylendiamin
DK172779A (da) Fremgangsmaade til fremstilling af cyklopropanderivater
DK208677A (da) Fremgangsmade til fremstilling af maphthylforbindelser
DK143107C (da) Fremgangsmaade til fremstilling af 2-isopropylaminopyrimidin
DK178279A (da) Fremgangsmaade til fremstilling af tetrapeptidhydrazidderivater
DK147420C (da) Fremgangsmaade til fremstilling af acylcyanider
DK149853C (da) Fremgangsmaade til fremstilling af s-alkyl-sulfonimidoylxanthonderivater
DK195979A (da) Fremgangsmaade til fremstilling af d-homosteroider
DK335479A (da) Fremgangsmaade til fremstilling af oligomere af pyridocarbazoler
DK545280A (da) Fremgangsmaade til fremstilling af nitrothiazolinforbindelser
DK304479A (da) Fremgangsmaade til fremstilling af 20-methyl13,14-didehydro-pg12-derivater

Legal Events

Date Code Title Description
PBP Patent lapsed