DK172779A - Fremgangsmaade til fremstilling af cyklopropanderivater - Google Patents

Fremgangsmaade til fremstilling af cyklopropanderivater

Info

Publication number
DK172779A
DK172779A DK172779A DK172779A DK172779A DK 172779 A DK172779 A DK 172779A DK 172779 A DK172779 A DK 172779A DK 172779 A DK172779 A DK 172779A DK 172779 A DK172779 A DK 172779A
Authority
DK
Denmark
Prior art keywords
cyclopropane derivatives
preparing cyclopropane
preparing
derivatives
cyclopropane
Prior art date
Application number
DK172779A
Other languages
English (en)
Inventor
A E Kaye
A C Tucker
Original Assignee
Ici Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Ici Ltd filed Critical Ici Ltd
Publication of DK172779A publication Critical patent/DK172779A/da

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
    • C07C255/00—Carboxylic acid nitriles
    • C07C255/45—Carboxylic acid nitriles having cyano groups bound to carbon atoms of rings other than six-membered aromatic rings

Landscapes

  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Organic Low-Molecular-Weight Compounds And Preparation Thereof (AREA)
DK172779A 1978-04-28 1979-04-26 Fremgangsmaade til fremstilling af cyklopropanderivater DK172779A (da)

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
GB1694378 1978-04-28
GB1694478 1978-04-28
GB1694578 1978-04-28

Publications (1)

Publication Number Publication Date
DK172779A true DK172779A (da) 1979-10-29

Family

ID=27257434

Family Applications (1)

Application Number Title Priority Date Filing Date
DK172779A DK172779A (da) 1978-04-28 1979-04-26 Fremgangsmaade til fremstilling af cyklopropanderivater

Country Status (7)

Country Link
US (1) US4284582A (da)
EP (1) EP0007154B1 (da)
JP (1) JPS54144342A (da)
AU (1) AU526551B2 (da)
DE (1) DE2961651D1 (da)
DK (1) DK172779A (da)
NZ (1) NZ190168A (da)

Families Citing this family (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
FR2485004A1 (fr) * 1980-06-20 1981-12-24 Roussel Uclaf Derives cyclopropane-1-carboxyliques et leurs sels, leur preparation et leur application a la synthese d'intermediaires de composes pyrethrinoides de configuration cis
CA1175065A (en) * 1981-07-22 1984-09-25 Kingsley Salisbury Photoisomerisation of trans-cyclopropane-nitriles
GB2127012A (en) * 1982-09-22 1984-04-04 Shell Int Research Process for the preparation of cyclopropane compounds
US4567265A (en) * 1984-01-16 1986-01-28 Loyola University Of Chicago Cyclopropanoid cyanoesters and method of making same
DE19507822B4 (de) * 1995-02-21 2006-07-20 Schering Ag Substituierte DTPA-Monoamide der zentralen Carbonsäure und deren Metallkomplexe, diese Komplexe enthaltende pharmazeutische Mittel, deren Verwendung in der Diagnostik und Therapie sowie Verfahren zur Herstellung der Komplexe und Mittel

Family Cites Families (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3391205A (en) * 1960-12-09 1968-07-02 Pittsburgh Plate Glass Co Process of chemical manufacture
FR1356949A (fr) * 1962-12-13 1964-04-03 Rhone Poulenc Sa Procédé de préparation de dérivés de l'acide cyclopropanecarboxylique
US3239553A (en) * 1963-08-12 1966-03-08 Shell Oil Co Process for the production of gammahalonitriles by the 1, 2-addition of alpha-halonitriles to olefines
US3454657A (en) * 1967-08-24 1969-07-08 Dow Chemical Co Catalytic synthesis of organic halogen compounds
US4000180A (en) * 1974-08-14 1976-12-28 Imperial Chemical Industries Limited Process for preparing 2-dihalovinyl-3,3-dimethyl cyclo propane derivatives
US3974199A (en) * 1975-06-16 1976-08-10 The Dow Chemical Company Process for production of cyclopropylcyanide
US4083863A (en) * 1976-06-01 1978-04-11 American Cyanamid Corporation Process for the preparation of cyclopropane carboxylic acids and esters
GB1578139A (en) * 1976-07-07 1980-11-05 Ici Ltd Preparation of alicyclic compounds
GB1581340A (en) * 1976-07-26 1980-12-10 Shell Int Research Preparation of esters
US4154952A (en) * 1977-01-31 1979-05-15 Schultz Harry W Process for the production of substituted cyclopropane derivatives
US4174348A (en) * 1978-05-30 1979-11-13 Shell Internationale Research Maatschappij B. V. Preparation of cyclopropanecarbonitriles

Also Published As

Publication number Publication date
NZ190168A (en) 1981-01-23
JPS54144342A (en) 1979-11-10
AU526551B2 (en) 1983-01-20
AU4602879A (en) 1979-11-01
DE2961651D1 (en) 1982-02-18
EP0007154B1 (en) 1981-12-30
US4284582A (en) 1981-08-18
EP0007154A1 (en) 1980-01-23

Similar Documents

Publication Publication Date Title
DK377079A (da) Fremgangsmaade til fremstilling af 4-anilinoquinazolinderivater
DK281079A (da) Fremgangsmaade til fremstilling af 4,5-diaryl-2-nitroimidazoler
DK160679A (da) Fremgangsmaade til fremstilling af derivater af 4-desacetyl-vincaleucoblastin-c-3-carboxhydrazid
DK251079A (da) Fremgangsmaade til fremstilling af phenylpiperazinderivater
DK140480A (da) Fremgangsmaade til fremstilling af mercaptoacyldipeptider
DK229980A (da) Fremgangsmaade til fremstilling af n-heterocyclyl-thienamyciner
DK156253C (da) Fremgangsmaade til fremstilling af pyruvatoxidase
DK520679A (da) Fremgangsmaade til fremstilling af 3-quinolincarboxulsyrederivater
DK70979A (da) Fremgangsmaade til fremstilling af phthalocyaninpigmeneter
DK232080A (da) Fremgangsmaade til fremstilling af hydroxyaminoeburnanderivater
DK152752C (da) Fremgangsmaade til fremstilling af l-sulpirid
DK344679A (da) Fremgangsmaade til fremstilling af arylglyoxylsyrer
DK87079A (da) Fremgangsmaade til fremstilling af dialkylphospohorchloridothioter
DK226579A (da) Fremgangsmaade til fremstilling af metaboliter
DK300781A (da) Fremgangsmaade til fremstilling af halogenfenylpyridyllylamin-derivater
DK229479A (da) Fremgangsmaade til fremstilling af forbindelser af muramylpeptidtypen
DK172779A (da) Fremgangsmaade til fremstilling af cyklopropanderivater
DK152579A (da) Fremgangsmaade til fremstilling af androstaner
DK36379A (da) Fremgangsmaade til fremstilling af n-ethylethylendiamin
DK143107C (da) Fremgangsmaade til fremstilling af 2-isopropylaminopyrimidin
DK147420C (da) Fremgangsmaade til fremstilling af acylcyanider
DK195979A (da) Fremgangsmaade til fremstilling af d-homosteroider
DK144280A (da) Fremgangsmaade til fremstilling af 2-aminopyraziner
DK341980A (da) Fremgangsmaade til fremstilling af 2-isopropylaminopyrimidin
DK150822C (da) Framgangsmaade til fremstilling af cis-2-phenyl-bicyclooctylaminer

Legal Events

Date Code Title Description
AHB Application shelved due to non-payment
B1 Patent granted (law 1993)
B1 Patent granted (law 1993)