DK159153C - Analogifremgangsmaade til fremstilling af penicillinforbindelser - Google Patents
Analogifremgangsmaade til fremstilling af penicillinforbindelserInfo
- Publication number
- DK159153C DK159153C DK412980A DK412980A DK159153C DK 159153 C DK159153 C DK 159153C DK 412980 A DK412980 A DK 412980A DK 412980 A DK412980 A DK 412980A DK 159153 C DK159153 C DK 159153C
- Authority
- DK
- Denmark
- Prior art keywords
- penicillal
- analogue
- preparing
- compounds
- preparing penicillal
- Prior art date
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D499/00—Heterocyclic compounds containing 4-thia-1-azabicyclo [3.2.0] heptane ring systems, i.e. compounds containing a ring system of the formula:, e.g. penicillins, penems; Such ring systems being further condensed, e.g. 2,3-condensed with an oxygen-, nitrogen- or sulfur-containing hetero ring
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
Landscapes
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Health & Medical Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Communicable Diseases (AREA)
- Pharmacology & Pharmacy (AREA)
- Oncology (AREA)
- Animal Behavior & Ethology (AREA)
- General Health & Medical Sciences (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Cephalosporin Compounds (AREA)
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP12641079A JPS5651488A (en) | 1979-10-02 | 1979-10-02 | Penicillin derivative and its preparation |
| JP12641079 | 1979-10-02 |
Publications (3)
| Publication Number | Publication Date |
|---|---|
| DK412980A DK412980A (da) | 1981-04-03 |
| DK159153B DK159153B (da) | 1990-09-10 |
| DK159153C true DK159153C (da) | 1991-03-11 |
Family
ID=14934463
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| DK412980A DK159153C (da) | 1979-10-02 | 1980-09-30 | Analogifremgangsmaade til fremstilling af penicillinforbindelser |
Country Status (20)
| Country | Link |
|---|---|
| US (1) | US4331597A (da) |
| JP (1) | JPS5651488A (da) |
| AR (1) | AR228437A1 (da) |
| AU (1) | AU520127B2 (da) |
| BE (1) | BE885484A (da) |
| BR (1) | BR8006252A (da) |
| CA (1) | CA1149799A (da) |
| CH (1) | CH645903A5 (da) |
| DE (1) | DE3037284C2 (da) |
| DK (1) | DK159153C (da) |
| ES (1) | ES495519A0 (da) |
| FR (1) | FR2466466A1 (da) |
| GB (1) | GB2061270B (da) |
| GR (1) | GR70030B (da) |
| IT (1) | IT1143099B (da) |
| NL (1) | NL8005461A (da) |
| NZ (1) | NZ195115A (da) |
| PH (1) | PH17165A (da) |
| SE (1) | SE450123B (da) |
| ZA (1) | ZA805787B (da) |
Families Citing this family (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JPS5978621U (ja) * | 1982-11-19 | 1984-05-28 | 東芝テック株式会社 | 電磁装置 |
| EP0550576A1 (en) * | 1990-09-28 | 1993-07-14 | Smith Kline & French Laboratories Limited | Phenylpyridinol derivatives as medicaments |
| DE19500760A1 (de) * | 1995-01-13 | 1996-07-18 | Basf Ag | Substituierte 2-Phenylpyridine |
| WO2001019971A1 (en) * | 1999-09-17 | 2001-03-22 | Smithkline Beecham Corporation | Novel imp-1 metallo beta-lactamase enzyme |
| DK1474395T3 (da) | 2002-02-12 | 2008-02-11 | Smithkline Beecham Corp | Nicotinamidderivater, der er nyttige som p38-inhibitorer |
| EP2750504A4 (en) | 2011-08-29 | 2015-03-11 | Ptc Therapeutics Inc | ANTIBACTERIAL COMPOUNDS AND METHODS OF USE |
| KR20140085437A (ko) * | 2011-08-29 | 2014-07-07 | 피티씨 테라퓨틱스, 인크. | 항균 화합물 및 이의 사용 방법 |
Family Cites Families (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| AR204813A1 (es) * | 1972-05-08 | 1976-03-05 | Yamanouchi Pharma Co Ltd | Proceso para la preparacion de derivados de ampilicina |
| US3873523A (en) * | 1972-12-15 | 1975-03-25 | Parke Davis & Co | Derivatives of ampicillin |
| JPS5751837B2 (da) * | 1973-04-05 | 1982-11-04 | ||
| US3954734A (en) * | 1974-01-21 | 1976-05-04 | Parke, Davis & Company | Novel antibacterial amide compounds and process means for producing the same |
| ZA7546B (en) * | 1974-01-21 | 1976-08-25 | Parke Davis & Co | New antibacterial amide compounds and methods for their production |
| US4053470A (en) * | 1974-12-23 | 1977-10-11 | Parke, Davis & Company | Substituted-1,2-dihydro-2-oxonicotinyl-cephalosporins |
| US4101661A (en) * | 1977-06-03 | 1978-07-18 | Warner-Lambert | Novel antibacterial amide compounds and process means for producing the same |
-
1979
- 1979-10-02 JP JP12641079A patent/JPS5651488A/ja active Pending
-
1980
- 1980-09-18 ZA ZA00805787A patent/ZA805787B/xx unknown
- 1980-09-26 PH PH24640A patent/PH17165A/en unknown
- 1980-09-30 GR GR63000A patent/GR70030B/el unknown
- 1980-09-30 IT IT49770/80A patent/IT1143099B/it active
- 1980-09-30 ES ES495519A patent/ES495519A0/es active Granted
- 1980-09-30 GB GB8031559A patent/GB2061270B/en not_active Expired
- 1980-09-30 DK DK412980A patent/DK159153C/da not_active IP Right Cessation
- 1980-09-30 AR AR282708A patent/AR228437A1/es active
- 1980-09-30 BR BR8006252A patent/BR8006252A/pt unknown
- 1980-10-01 CA CA000361916A patent/CA1149799A/en not_active Expired
- 1980-10-01 BE BE0/202296A patent/BE885484A/fr not_active IP Right Cessation
- 1980-10-01 CH CH732380A patent/CH645903A5/fr not_active IP Right Cessation
- 1980-10-01 SE SE8006862A patent/SE450123B/sv not_active IP Right Cessation
- 1980-10-01 NZ NZ195115A patent/NZ195115A/xx unknown
- 1980-10-02 NL NL8005461A patent/NL8005461A/nl not_active Application Discontinuation
- 1980-10-02 AU AU62906/80A patent/AU520127B2/en not_active Ceased
- 1980-10-02 FR FR8021157A patent/FR2466466A1/fr active Granted
- 1980-10-02 US US06/193,317 patent/US4331597A/en not_active Expired - Lifetime
- 1980-10-02 DE DE3037284A patent/DE3037284C2/de not_active Expired
Also Published As
| Publication number | Publication date |
|---|---|
| NZ195115A (en) | 1982-05-31 |
| CA1149799A (en) | 1983-07-12 |
| BR8006252A (pt) | 1981-04-07 |
| AR228437A1 (es) | 1983-03-15 |
| NL8005461A (nl) | 1981-04-06 |
| GR70030B (da) | 1982-07-23 |
| AU520127B2 (en) | 1982-01-14 |
| SE450123B (sv) | 1987-06-09 |
| GB2061270A (en) | 1981-05-13 |
| JPS5651488A (en) | 1981-05-09 |
| SE8006862L (sv) | 1981-04-03 |
| ZA805787B (en) | 1981-08-26 |
| PH17165A (en) | 1984-06-13 |
| ES8200688A1 (es) | 1981-11-16 |
| DE3037284A1 (de) | 1981-04-09 |
| FR2466466A1 (fr) | 1981-04-10 |
| DK159153B (da) | 1990-09-10 |
| BE885484A (fr) | 1981-02-02 |
| IT1143099B (it) | 1986-10-22 |
| IT8049770A0 (it) | 1980-09-30 |
| AU6290680A (en) | 1981-04-09 |
| US4331597A (en) | 1982-05-25 |
| GB2061270B (en) | 1983-11-16 |
| DK412980A (da) | 1981-04-03 |
| ES495519A0 (es) | 1981-11-16 |
| CH645903A5 (fr) | 1984-10-31 |
| FR2466466B1 (da) | 1984-06-08 |
| DE3037284C2 (de) | 1984-04-12 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| DK155048C (da) | Analogifremgangsmaade til fremstilling af 1,8-naphthyridinforbindelser | |
| DK148141C (da) | Analogifremgangsmaade til fremstilling af phosphonylacetylproliner | |
| DK160866C (da) | Analogifremgangsmaade til fremstilling af phenoletherforbindelser | |
| DK154940C (da) | Analogifremgangsmaade til fremstilling af tetra- eller pentapeptider | |
| DK229980A (da) | Fremgangsmaade til fremstilling af n-heterocyclyl-thienamyciner | |
| DK140480A (da) | Fremgangsmaade til fremstilling af mercaptoacyldipeptider | |
| DK447380A (da) | Fremgangsmaade til fremstilling af d3-vitaminforbindelser | |
| DK158460C (da) | Analogifremgangsmaade til fremstilling af substituerede oxocarboxylsyrer | |
| DK232080A (da) | Fremgangsmaade til fremstilling af hydroxyaminoeburnanderivater | |
| DK159153C (da) | Analogifremgangsmaade til fremstilling af penicillinforbindelser | |
| DK300781A (da) | Fremgangsmaade til fremstilling af halogenfenylpyridyllylamin-derivater | |
| DK149026C (da) | Analogifremgangsmaade til fremstilling af adeninnucleosidderivater | |
| DK183880A (da) | Fremgangsmaade til fremstilling af hydroxyderivater af isopropyrimidin | |
| DK333579A (da) | Analogifremgangsmaade til fremstilling af thiophencarboxamidoalkylmercaptaner | |
| DK153469C (da) | Fremgangsmaade til fremstilling af fluorerede alkenylaminer | |
| DK41480A (da) | Fremgangsmaade til fremstilling af beta-lactamforbindelser | |
| DK149472C (da) | Fremgangsmaade til fremstilling af phosphorchloridthiolater | |
| DK238081A (da) | Fremgangsmaade til fremstilling af tetramisolanaloge | |
| DK144280A (da) | Fremgangsmaade til fremstilling af 2-aminopyraziner | |
| DK341980A (da) | Fremgangsmaade til fremstilling af 2-isopropylaminopyrimidin | |
| DK545280A (da) | Fremgangsmaade til fremstilling af nitrothiazolinforbindelser | |
| DK160294C (da) | Fremgangsmaade til fremstilling af 3-oxycyclopentener | |
| DK335479A (da) | Fremgangsmaade til fremstilling af oligomere af pyridocarbazoler | |
| DK145544C (da) | Analogifremgangsmaade til fremstilling af cephalosporinforbindelser | |
| DK146533C (da) | Fremgangsmaade til fremstilling af 4-nitrothioanisol |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PBP | Patent lapsed |