WO2023055155A1 - 혈액 뇌장벽 투과용 펩타이드 및 이의 용도 - Google Patents

혈액 뇌장벽 투과용 펩타이드 및 이의 용도 Download PDF

Info

Publication number
WO2023055155A1
WO2023055155A1 PCT/KR2022/014716 KR2022014716W WO2023055155A1 WO 2023055155 A1 WO2023055155 A1 WO 2023055155A1 KR 2022014716 W KR2022014716 W KR 2022014716W WO 2023055155 A1 WO2023055155 A1 WO 2023055155A1
Authority
WO
WIPO (PCT)
Prior art keywords
peptide
blood
penetrating
brain barrier
seq
Prior art date
Application number
PCT/KR2022/014716
Other languages
English (en)
French (fr)
Inventor
박윤정
정종평
이주연
이동우
Original Assignee
서울대학교산학협력단
주식회사 나이벡
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 서울대학교산학협력단, 주식회사 나이벡 filed Critical 서울대학교산학협력단
Priority to EP22876927.9A priority Critical patent/EP4410821A1/en
Priority to CN202280076796.1A priority patent/CN118556069A/zh
Priority to JP2024519855A priority patent/JP2024536278A/ja
Publication of WO2023055155A1 publication Critical patent/WO2023055155A1/ko

Links

Images

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
    • A61K47/645—Polycationic or polyanionic oligopeptides, polypeptides or polyamino acids, e.g. polylysine, polyarginine, polyglutamic acid or peptide TAT
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
    • A61K47/645—Polycationic or polyanionic oligopeptides, polypeptides or polyamino acids, e.g. polylysine, polyarginine, polyglutamic acid or peptide TAT
    • A61K47/6455—Polycationic oligopeptides, polypeptides or polyamino acids, e.g. for complexing nucleic acids
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00—Drugs for disorders of the nervous system
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/001—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof by chemical synthesis
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K19/00—Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
    • C07K7/04—Linear peptides containing only normal peptide links
    • C07K7/06—Linear peptides containing only normal peptide links having 5 to 11 amino acids
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
    • C07K7/04—Linear peptides containing only normal peptide links
    • C07K7/08—Linear peptides containing only normal peptide links having 12 to 20 amino acids

Definitions

  • the present invention relates to a peptide for penetrating the blood-brain barrier and its use, and more particularly, to a peptide for penetrating the blood-brain barrier and a complex in which an antibody, protein or drug of therapeutic nucleic acid is bound to the peptide, and a brain disease or brain tumor thereof It relates to therapeutic or prophylactic use of.
  • the blood-brain barrier is the strongest biological barrier and is a defense system that helps maintain the complex physiology of the brain by selectively passing only blood substances essential for maintaining brain function.
  • the BBB consists of capillaries formed from brain endothelial cells, astrocytes and pericytes surrounding them, and each cell contributes to strengthening the BBB's unique biological barrier.
  • cerebrovascular endothelial cells have developed tight junctions, which strongly inhibit the intercellular passage of hydrophilic substances of 300 Da or more, which is called a physical barrier function.
  • polarized endothelial cells have developed various types of multi-drug efflux pumps, such as P-glycoprotein, MRP1, MRP4, and BCRP, which combine with hydrophobic drugs to hinder the penetration of drugs into the brain tissue, which acts as a metabolic barrier. called a function.
  • Astrocytic cells extend protrusions toward the formed brain capillaries to form astrocytic endfeets that cover most of the surface of blood vessels, and recently these endfeets protect against harmful factors applied to the BBB and form a biological barrier. It is known to play a pivotal role in maintaining
  • drugs for neurological diseases such as high-molecular-weight drugs or low-molecular-weight drugs that must act inside the brain, cannot penetrate the blood-brain barrier (BBB).
  • BBB blood-brain barrier
  • cerebrovascular endothelial cells also have low density lipoprotein receptor (LDLR)-related proteins (LRPs) receptors.
  • LRPs low density lipoprotein receptor-related proteins
  • LRPs receptors endocytose LDL particles to permeabilize the BBB.
  • the present inventors prepared a blood-brain barrier (BBB) penetrating peptide by connecting a cell-permeable peptide to a transferrin receptor-binding peptide or a low-density lipoprotein receptor-related protein receptor-binding peptide, and the prepared peptide was endo It is confirmed that it can directly pass through the cell membrane of brain endothelial cells without relying on cytosis, and the blood-brain barrier in which drugs such as antibodies, proteins or therapeutic nucleic acids are bound to peptides for penetrating the blood-brain barrier
  • the present invention was completed after confirming that the penetrating peptide-drug conjugate was effectively delivered to the brain parenchyma and was effective in treating brain tumors.
  • An object of the present invention is to provide a peptide for penetrating the blood-brain barrier (BBB) to effectively deliver a drug for treating brain disease or brain tumor to the brain parenchyma.
  • BBB blood-brain barrier
  • Another object of the present invention is to provide a blood-brain barrier-penetrating peptide-drug conjugate in which a drug is bound to the blood-brain barrier-penetrating peptide.
  • Another object of the present invention is to provide a pharmaceutical composition for treating or preventing brain diseases or brain tumors containing the peptide-drug complex for penetrating the blood-brain barrier.
  • Another object of the present invention is a method for preventing or treating brain diseases or brain tumors comprising administering the complex, the use of the complex for preventing or treating brain diseases or brain tumors, and the preparation of drugs for preventing or treating brain diseases or brain tumors. It is to provide the use of the complex for.
  • the present invention provides a blood-brain barrier (BBB) penetration peptide in which a cerebrovascular endothelial cell surface protein-binding peptide and a cell-penetrating peptide are linked.
  • BBB blood-brain barrier
  • the present invention also provides a blood-brain barrier-penetrating peptide-drug conjugate in which a drug is bound to the blood-brain barrier-penetrating peptide.
  • the present invention also provides a nucleic acid encoding the complex.
  • the present invention also provides a recombinant vector into which the nucleic acid is introduced.
  • the present invention also provides a recombinant cell into which the nucleic acid or the recombinant vector is introduced.
  • the present invention also includes (a) culturing the recombinant cells to express the blood-brain barrier-penetrating peptide-drug complex; and (b) recovering the expressed blood-brain barrier-penetrating peptide-drug conjugate.
  • the present invention also provides a pharmaceutical composition for treating or preventing brain diseases or brain tumors comprising the peptide-drug complex for penetrating the blood-brain barrier.
  • the present invention also relates to a method for preventing or treating brain diseases or brain tumors comprising administering the complex, a use of the complex for preventing or treating brain diseases or brain tumors, and a method for preparing a drug for preventing or treating brain diseases or brain tumors.
  • the use of the complex is provided.
  • FIG. 1 is a schematic diagram of an antibody and a peptide complex for penetrating the blood-brain barrier.
  • FIG. 2 is a schematic diagram of a siRNA and a peptide complex for penetrating the blood-brain barrier.
  • Figure 3 shows the results of SDS-PAGE and western blot of peptides and antibodies for penetrating the blood-brain barrier purified from pcDNA3.4-TOPO.
  • Figure 4a is a result of IVIS observation of a complex of a peptide for penetrating the blood-brain barrier and an antibody distributed in brain, liver, lung, spleen, kidney, and heart.
  • Figure 4b is a result of three-dimensional observation of the complex of the peptide and antibody for penetrating the blood-brain barrier distributed inside the brain.
  • 5 is a concentration of a complex of a peptide for penetrating the blood-brain barrier and an antibody present in blood and brain.
  • Figure 6a is an image of measuring bioluminescence of U87MG-Luc cells on day 16.
  • Figure 6b is the result of measuring the bioluminescence of U87MG-Luc cells for 16 days.
  • Figure 6c is the result of observing the distribution of the complex of the peptide and antibody for penetrating the blood-brain barrier at the brain tumor site.
  • 11 is a result of measuring the mRNA level of beta catenin decreased in the cerebral cortex, cerebellum, and mid brain by qRT-PCR by a blood-brain barrier-penetrating peptide and siRNA complex.
  • a peptide capable of binding to the transferrin receptor was devised using phage display technology instead of an antibody to prevent the transfer of substances penetrated into cerebrovascular endothelial cells from endosomes to lysosomes.
  • This transferrin receptor-binding peptide is characterized in that transferrin binds to a region different from the region where transferrin binds to the transferrin receptor.
  • LDLR low density lipoprotein receptor
  • LRPs low density lipoprotein receptor
  • a blood-brain barrier capable of directly passing through the cell membrane of cerebrovascular endothelial cells without relying on endocytosis has been developed.
  • Brain barrier, BBB Brain barrier, BBB penetrating peptide was developed, and it was named NIPEP-TPP-BBB shuttle (NIBEC Peptide-Target Tissue Penetrating Property-BBB shuttle).
  • a drug such as an antibody, protein or therapeutic nucleic acid is bound to the N-terminus of a peptide for penetrating the blood brain barrier by a gene expression method or a chemical bonding method and intravenously injected into a mouse, it is delivered to the brain parenchyma, and glioblastoma When administered to induced animals, it was confirmed that the number of tumor cells decreased.
  • the present invention relates to a blood-brain barrier (BBB) penetration peptide in which a cerebrovascular endothelial cell surface protein-binding peptide and a cell-penetrating peptide are linked.
  • BBB blood-brain barrier
  • the cerebrovascular endothelial cell surface protein may be a transferrin receptor or a low-density lipoprotein receptor-related protein (LRP) receptor. Therefore, the peptide for penetrating the blood-brain barrier may be characterized in that a peptide capable of binding to a transferrin receptor or a peptide capable of binding to a low-density lipoprotein receptor-related protein (LRP) receptor is linked to a cell-penetrating peptide.
  • LRP low-density lipoprotein receptor-related protein
  • the transferrin receptor-binding peptide may be characterized in that it is represented by any one amino acid sequence of SEQ ID NO: 1 to SEQ ID NO: 4.
  • SEQ ID NO: 2 LRRERQSRLRRERQSR
  • transferrin receptor refers to a specific receptor in transferrin to allow iron to enter cells, and is composed of a homodimer of a polypeptide chain with a molecular weight of 95,000 Da, One molecule of transferrin, which has two iron ions bound to each chain, is bound.
  • transferrin is a kind of glycoprotein, in which ⁇ -globulin is bound to two molecules of trivalent iron ions absorbed into the serum, and mediates the transferrin receptor for iron necessary for cell proliferation or hemoglobin production. It means an iron transport protein that is supplied into cells by means of , and more than 99% of iron in serum binds to transferrin.
  • the low-density lipoprotein receptor-related protein receptor-binding peptide may be characterized in that represented by the amino acid sequence of SEQ ID NO: 5 or SEQ ID NO: 6.
  • SEQ ID NO: 5 YHFNGCEDPLCR
  • SEQ ID NO: 6 HPWCCGRLLDLR
  • LRP receptor low-density lipoprotein receptor-related protein receptor
  • LRPs low density lipoprotein receptor-related proteins
  • the cell-penetrating peptide may be characterized in that it is represented by any one amino acid sequence of SEQ ID NO: 7 to SEQ ID NO: 10.
  • SEQ ID NO: 9 VSRRRRRRGGRRRR
  • SEQ ID NO: 10 GKCSTRGRKCCRRKK
  • the cell-penetrating peptide is characterized in that it is directly linked to the N-terminus, C-terminus, or both the N-terminus and C-terminus of the transferrin receptor-binding peptide or low-density lipoprotein receptor-related protein receptor-binding peptide. It may be, but is not limited thereto.
  • the peptide for penetrating the blood-brain barrier may be characterized in that it is represented by any one amino acid sequence of SEQ ID NO: 11 to SEQ ID NO: 58 (Table 1).
  • the cerebrovascular endothelial cell surface protein-binding peptide and the cell-penetrating peptide may be characterized in that they are connected through a spacer composed of 2 to 10 amino acids G and 1 to 5 amino acids S.
  • the present invention relates to a blood-brain barrier-penetrating peptide-drug conjugate in which a drug is bound to the blood-brain barrier-penetrating peptide.
  • the peptide for penetrating the blood-brain barrier and the drug may be characterized in that they are linked by a linker, but are not limited thereto.
  • the drug may be an antibody, protein or therapeutic nucleic acid
  • the antibody may be an antibody that inhibits a protein that causes brain disease
  • the protein may be a growth factor associated with nerve cells. It may be, but is not limited thereto.
  • the protein is brain-derived neurotrophic factor (BDNF), nerve growth factor (NGF), neurotrophin-4/5, fibroblast growth factor (FGF)-2 and other FGFs, neurotrophins ( NT)-3, erythropoietin (EPO), epidermal growth factor (EGF), transforming growth factor (TGF)-alpha, TGF-beta, vascular endothelial growth factor (VEGF), glial cell-derived neurotrophic factor (GDNF), neurturin, platelet-derived growth factor (PDGF), heregulin, neuregulin, artemin, persepin, interleukin, glial cell line-derived neurotrophic factor (GFR), granulocyte-colony stimulating factor (CSF), granulocyte It may be characterized in that it is selected from the group consisting of -macrophage-CSF and stem cell factor (SCF).
  • BDNF brain-derived neurotrophic factor
  • NGF nerve growth factor
  • FGF fibroblast growth
  • the antibody may be characterized in that it is represented by the amino acid sequence of SEQ ID NO: 59, and has a therapeutic effect on glioblastoma.
  • the blood-brain barrier-penetrating peptide-drug conjugate in which an antibody is bound to the blood-brain barrier-penetrating peptide can be prepared by a gene expression method or a chemical conjugation method, but the manufacturing method is not limited thereto .
  • a vector that expresses (i) an antibody capable of inhibiting glioblastoma (ii) a peptide for blood-brain barrier penetration can be used.
  • a pET vector was used for expression in E. coli, and pcDNA3.1-TOPO and pcDNA3.4-TOPO vectors were used for expression in mammalian cells.
  • a linker sequence may be additionally included between the antibody and the peptide for penetrating the blood-brain barrier so as to be expressed.
  • the linker may be CGGGG, but is not limited thereto.
  • the present invention after expressing and purifying a therapeutic antibody from a gene, it can be combined with a peptide for penetrating the blood-brain barrier by a chemical bonding method.
  • the blood-brain barrier-penetrating peptide-drug complex of the therapeutic antibody and the blood-brain barrier-penetrating peptide is any one transferrin receptor-binding peptide selected from the group consisting of SEQ ID NO: 1 to SEQ ID NO: 4 or SEQ ID NO: 5
  • a low-density lipoprotein receptor-related protein receptor-binding peptide of SEQ ID NO: 6 and any one cell-permeable peptide selected from the group consisting of SEQ ID NO: 7 to SEQ ID NO: 10 is a cysteine or Fc region at the C-terminus of the antibody of SEQ ID NO: 59 It can be characterized in that it is linked to the sugar in the chemical bond method. This is shown in the schematic diagram of the complex of the antibody and the peptide for penetrating the blood-brain barrier in FIG.
  • a peptide for penetrating the blood-brain barrier may be chemically linked to the antibody by a linker and a crosslinker.
  • Any linker may be used as long as it can provide space to form a functional structure.
  • the linker may be a peptidic linker of natural and/or synthetic origin.
  • Peptidic linkers of natural and/or synthetic origin may consist of amino acid chains of 1 to 50 amino acids, and may include repetitive amino acid sequences of naturally occurring polypeptides, such as polypeptides having a hinge function.
  • the peptidic linker amino acid sequence can be a synthetic linker amino acid sequence designed to be enriched in glycine, glutamine, and/or serine residues.
  • residues may be arranged in small repeating units of, for example, 5 amino acids or less, and the small repeating units may be arranged repeatedly to form multimer units.
  • the amino- and/or carboxy-terminus of the multimer unit up to six additional optional naturally occurring amino acids may be added.
  • Other synthetic peptidic linkers may be of a single amino acid composition repeated 10 to 20 times, and may be any naturally occurring amino acid with up to 6 additional amino- and/or carboxy-terminus.
  • the linker may be in the form of a chemically modified amino acid, for example, it may be used in the form of Fmoc-6-aminohexanoic acid to which Fmoc-(9-Fluorenylmethoxycarbonyl) is bound as a blocking group, but is limited to this it is not going to be
  • the sulfhydryl group of cysteine located at the N-terminus of the peptide for penetrating the blood-brain barrier may be linked to the amine group of lysine exposed in the three-dimensional structure of SEQ ID NO: 59.
  • usable crosslinkers include 1,4-bis-maleimidobutane (BMB), 1,11-bis-maleimidotetraethylene glycol (BM[ PEO]4), 1-ethyl-3-[3-dimethyl aminopropyl] carbodiimide hydrochloride (EDC), succinimidyl-4-[N -Maleimidomethylcyclohexane-1-carboxy-[6-amidocaproate]] (succinimidyl-4-[N-maleimidomethylcyclohexane-1-carboxy-[6-amidocaproate]], SMCC) and its sulfonated salts (sulfo- SMCC), succimidyl 6-[3-(2-pyridyldithio)-ropionamido] hexanoate (SPDP) and its sulfones Flame (sulfo-SPDP), m-maleimidobenzoyl-N-hydroxy
  • the method for preparing a peptide-drug conjugate for penetrating the blood-brain barrier using the chemical bonding method includes the following steps:
  • the therapeutic nucleic acid may be selected from the group consisting of DNA, siRNA, miRNA, and mRNA, and preferably, the therapeutic nucleic acid inhibits or increases the expression of a target gene.
  • the siRNA may have a nucleotide sequence complementary to a nucleotide sequence encoding a tumor-inducing protein or a brain disease-inducing protein.
  • mutant KRAS was inhibited using siRNA against mutant KRAS, and the siRNAs may be characterized in that they are represented by SEQ ID NO: 60 and SEQ ID NO: 61.
  • Anti-sense-UACUGGUCCCUCAUUGCAC (SEQ ID NO: 61)
  • the siRNA may be a natural form or a chemically modified form of siRNA.
  • the first complex is prepared by reacting the therapeutic nucleic acid with a cationic peptide, cationic polymer or RNA-binding peptide, and then the first complex is mixed with an anionic amino acid or an anionic polymer; And it may be characterized by forming nanoparticles by reacting with the peptide for penetrating the blood-brain barrier to which the spacer is connected.
  • the cationic peptide is represented by the amino acid sequence of SEQ ID NO: 9, the cationic polymer is poly-L-lysine, polyethylene imine or chitosan, and the RNA
  • the binding peptide is represented by any one amino acid sequence of SEQ ID NO: 62 to SEQ ID NO: 67, the anionic amino acid is glutamic acid or aspartic acid, and the anionic polymer is heparin or hyaluronic acid It may be hyaluronic acid, and the spacer may be 5 to 10 glycine, but is not limited thereto.
  • an RNA-binding peptide may be introduced in addition to the blood-brain barrier-penetrating peptide, and the RNA-binding peptide is represented by any one amino acid sequence of SEQ ID NO: 62 to SEQ ID NO: 67 can be characterized.
  • SEQ ID NO: 62 CPISQVHEIGIKRNMTVHFKVLREEGPAHMKNF
  • SEQ ID NO: 63 CPISQVHEIGIKR
  • SEQ ID NO: 64 CNMTVHFKVLREEG
  • SEQ ID NO: 65 CPAHMKNFITA
  • SEQ ID NO: 66 CIVTEGEGNGKKVSKKRAAEKMLVEL
  • the peptides of SEQ ID NO: 62 to SEQ ID NO: 67 may be connected to the N-terminus of the complex of SEQ ID NO: 11 to SEQ ID NO: 58, but are not limited thereto.
  • the complex of the siRNA and the peptide for penetrating the blood brain barrier is any one transferrin receptor-binding peptide selected from the group consisting of SEQ ID NO: 1 to SEQ ID NO: 4 or low-density lipoprotein receptor-related SEQ ID NO: 5 or SEQ ID NO: 6 protein receptor binding peptides; Any one cell penetrating peptide selected from the group consisting of SEQ ID NO: 7 to SEQ ID NO: 10; and the RNA-binding peptides of SEQ ID NOs: 62 to 67 and siRNAs of SEQ ID NOs: 60 and 61 may form a complex through self-assembly.
  • This composite forms nano-sized particles and may be characterized in that the size is 10-200 nm.
  • the complex of siRNA and peptide for penetrating the blood-brain barrier can be prepared in two steps. 1) siRNA is first reacted with a cationic peptide or cationic polymer.
  • the cationic peptide may be the peptide of SEQ ID NO: 9, and the cationic polymer may be poly-L-lysine, polyethylene imine, or chitosan. 2) In the next step, it can be combined with a peptide for penetrating the blood-brain barrier linked to an anionic amino acid or an anionic polymer.
  • the complex of the peptide for penetrating the blood-brain barrier, the spacer, and the anionic amino acid may be characterized in that it is represented by any one amino acid sequence of SEQ ID NO: 68 to SEQ ID NO: 85.
  • FIG. 2 is a schematic diagram of a complex of siRNA and a peptide for penetrating the blood-brain barrier.
  • Figure 2 is a diagram showing the case where the therapeutic nucleic acid is siRNA.
  • the siRNA is DNA, miRNA or mRNA, it can be reacted with a DNA, miRNA or mRNA-binding peptide to prepare a primary complex.
  • the peptide for penetrating the blood-brain barrier-Therapeutic nucleic acid complex is selected from the group consisting of an anionic amino acid composed of 5 to 10 glutamic acid or aspartic acid, a spacer composed of 5 to 10 glycine, and SEQ ID NO: 7 to SEQ ID NO: 10 It may be characterized by comprising a peptide linked to any one cell-penetrating functional peptide and any one brain vascular endothelial cell surface protein binding peptide selected from the group consisting of SEQ ID NOs: 1 to 6.
  • SEQ ID NO: 68 EEEGEEEGE-GGGGG-HRRCNKNNKKR-VPALR
  • SEQ ID NO: 69 EEEGEEEGE-GGGGG-HRRCNPNNKKR-GGGGG-VPALR
  • SEQ ID NO: 70 EEEGEEEGE-GGGGG-VSRRRRRRGGRRRR-GGGGG-VPALR
  • SEQ ID NO: 71 EEEGEEEGE-GGGGG-GKCSTRGRKCCRRKK-GGGGG-VPALR
  • SEQ ID NO: 72 EEEGEEEGE-GGGGG-HRRCNKNNKKR-LRRERQSRLRRERQSR
  • SEQ ID NO: 73 EEEGEEEGE-GGGGG-HRRCNPNNKKR-LRRERQSRLRRERQSR
  • SEQ ID NO: 74 EEEGEEEGE-GGGGG-VSRRRRRRGGRRRR-GGGGG-LRRERQSRLRRERQSR
  • SEQ ID NO: 75 EEEGEEEGE-GGGGG-GKCSTRGRKCCRRKK-LRRERQSRLRRERQSR
  • SEQ ID NO: 76 EEEGEEEGE-GGGGG-HRRCNKNNKKR-VPALRRERQSRLRRERQSR
  • SEQ ID NO: 77 EEEGEEEGE-GGGGG-HRRCNPNNKKR-VPALRRERQSRLRRERQSR
  • SEQ ID NO: 78 EEEGEEEGE-GGGGG-VSRRRRRRGGRRRR-VPALRRERQSRLRRERQSR
  • SEQ ID NO: 79 EEEGEEEGE-GGGGG-GKCSTRGRKCCRRKK-VPALRRERQSRLRRERQSR
  • SEQ ID NO: 80 EEEGEEEGE-GGGGG-HRRCNKNNKKR-HAIYPRH
  • SEQ ID NO: 81 EEEGEEEGE-GGGGG-HRRCNPNNKKR-HAIYPRH
  • SEQ ID NO: 82 EEEGEEEGE-GGGGG-VSRRRRRRGRRRR-HAIYPRH
  • SEQ ID NO: 83 EEEGEEEGE-GGGGG-GKCSTRGRKCCRRKK-HAIYPRH
  • SEQ ID NO: 84 EEEGEEEGE-GGGGG-VSRRRRRRGGRRRR-GGGGG-YHFNGCEDPLCR
  • SEQ ID NO: 85 EEEGEEEGE-GGGGG-VSRRRRRRGGRRRR-GGGGG-HPWCCGRLLDLR
  • heparin or hyaluronic acid an anionic polymer
  • glutamic acid or aspartic acid an anionic amino acid
  • the siRNA and the peptide of SEQ ID NO: 9 After first reacting with the siRNA and the peptide of SEQ ID NO: 9 by self-assembly, it can be combined with the peptide for penetrating the blood-brain barrier, and this complex forms nano-sized particles, characterized in that the size is 10-200 nm can be done with
  • the method of forming a complex by the self-assembly of therapeutic nucleic acids including siRNA includes the following steps:
  • the present invention relates to a nucleic acid encoding the peptide-drug complex for penetrating the blood-brain barrier.
  • the present invention relates to a recombinant vector into which the nucleic acid is introduced.
  • the vector may be a pET vector, pcDNA 3.4, pcDNA3.1, pcDNA3.1-TOPO, pcDNA3.4-TOPO, or pSecTag vector, but is not limited thereto, and preferably the vector is a pET vector or pcDNA3 .1-TOPO, pcDNA3.4-TOPO vector.
  • the present invention relates to a recombinant cell into which the nucleic acid or the recombinant vector is introduced.
  • the recombinant cells may be E. coli or mammalian cells, but are not limited thereto.
  • the mammalian cell line may be Chinese hamsterovarian cell (CHO) or human embryonic kidney cells (HEK293), but is not limited thereto.
  • the present invention relates to a method for preparing the peptide-drug conjugate for penetrating the blood-brain barrier comprising the following steps:
  • the brain transfer effect or tumor growth inhibitory effect of an antibody or siRNA bound to a peptide for penetrating the blood-brain barrier was confirmed, the tumor cells in question were tested in both in vitro and animal experiments. It was confirmed that there is an effect of significantly inhibiting proliferation.
  • the present invention relates to a pharmaceutical composition for treating or preventing brain diseases or brain tumors comprising the peptide-drug complex for penetrating the blood-brain barrier.
  • the present invention relates to a method for preventing or treating brain diseases or brain tumors, comprising administering the peptide-drug complex for penetrating the blood-brain barrier.
  • the present invention relates to the use of the peptide-drug conjugate for penetrating the blood-brain barrier for the prevention or treatment of brain diseases or brain tumors.
  • the present invention relates to the use of the peptide-drug conjugate for penetrating the blood-brain barrier for the preparation of a drug for preventing or treating brain disease or brain tumor.
  • an antibody or therapeutic nucleic acid material that can be used as a treatment for other brain diseases in addition to suppressing brain tumors can be used in combination with a peptide for penetrating the blood-brain barrier.
  • the brain disease is encephalitis, Parkinson's disease, epilepsy, Huntington's disease, Alzheimer's dementia, Lou Gehrig's disease, Pick's disease, epilepsy, Creutzfeldt-Jakob disease, progressive supranuclear palsy, spinocerebellar degeneration, cerebellar atrophy, multiple sclerosis, neuronal disease It may be characterized in that it is selected from the group consisting of senile dementia caused by loss, stroke, amnesia, depression and post-traumatic stress disorder.
  • the brain tumor is glioma, glioblastoma multiforme, meningioma, astrocytoma, acoustic neuroma, chondroma, oligodendroglioma, medulloblastoma, ganglion glioma, schwannoma, neurofibroma, neuroblastoma and epidural, intramedullary Or it may be characterized in that it is selected from the group consisting of intrathecal tumors.
  • a single dose of the peptide-drug conjugate for penetrating the blood-brain barrier may be 1 ⁇ g/kg to 100 mg/kg, preferably 5 ⁇ g/kg to 50 mg/kg, once daily or It may be characterized by administration 1-3 times a week, but the dosage and administration interval are not limited thereto.
  • the pharmaceutical composition is any one selected from the group consisting of injections, preparations for oral administration, liquid preparations such as aqueous solutions, suspensions, and emulsions (for example, for injection), capsules, granules, tablets, and preparations for mucosal administration. It may be characterized in that it is formulated into a formulation of, but is not limited thereto. These preparations may be prepared by a conventional method used for formulation in the art or a method disclosed in Remington's Pharmaceutical Science (recent edition), Mack Publishing Company, Easton PA, and formulated into various preparations according to each disease or component It can be.
  • the pharmaceutical composition of the present invention may further include one or more pharmaceutically acceptable carriers in addition to the antibody or siRNA complex bound to the blood-brain barrier-penetrating peptide.
  • the pharmaceutically acceptable carrier may be at least one selected from the group consisting of saline, sterile water, Ringer's solution, buffered saline, dextrose solution, maltodextrin solution, glycerol and ethanol, but is not limited thereto.
  • the pharmaceutical composition of the present invention may further contain a pharmaceutically acceptable adjuvant, if necessary.
  • the adjuvant may be one or more selected from the group consisting of excipients, diluents, dispersants, buffers, antibacterial preservatives, bacteriostats, surfactants, binders, lubricants, antioxidants, thickeners and viscosity modifiers, but is not limited thereto.
  • the pharmaceutical composition according to the present invention may be administered orally or parenterally (for example, intravenously, subcutaneously, intraperitoneally or topically applied) according to the desired method, and the dosage is determined by the patient's body weight, age, gender, Depending on health status, diet, administration time, administration method, excretion rate, severity of disease, etc., the range may be varied and used according to the opinions of experts.
  • Example 1 Synthesis of peptides for penetrating the blood-brain barrier
  • Amino acids and reagents required for synthesis were purchased from GL biochem and Sigma-Aldirich.
  • Peptides were synthesized by the F-moc solid-state chemical synthesis method from the C-terminus using a peptide synthesizer. That is, it was synthesized using a link resin (0.075mmol/g, 100 ⁇ 200 mesh, 1% DVB crosslinking) to which Fmoc-(9-Fluorenylmethoxycarbonyl) was bound as a blocking group, and 50mg After inserting the link resin, the resin was swelled with DMF, and then a 20% piperidine/DMF solution was used to remove the Fmoc-group.
  • a link resin 0.075mmol/g, 100 ⁇ 200 mesh, 1% DVB crosslinking
  • 0.5M amino acid solution (solvent: dimethylformamide, DMF), 1.0M DIPEA (solvent: dimethylformamide & enemethylpyrrolidone, DMF&NMP), 0.5M HBTU (solvent: dimethylformamide, DMF) in sequence from the C-terminus 5, 10, and 5 equivalents of each were added and reacted for 1 to 2 hours under a nitrogen stream. After each of the deprotection and coupling steps, washing was performed twice with DMF and isopropanol. After coupling the last amino acid, deprotection was performed to remove the Fmoc-group.
  • synthesis was performed by adding DIPEA (10 equivalents), HBTU (5 equivalents), and palmitic acid (5 equivalents) in the presence of DMF.
  • the reaction time was carried out using Kaiser test solution until a negative result was obtained, and after the reaction was completed, the resin was washed with DMF and MeOH and dried in a vacuum oven.
  • a trifluoroacetic acid (TFA) cleavage cocktail was added at a rate of 20 ml per 1 g of resin, shaken for 3 hours, and a cocktail in which resin and peptides were dissolved was separated through filtering.
  • Example 2 Preparation of peptide and antibody complex for penetrating the blood-brain barrier
  • a linker CGGGG was introduced to the N-terminus of the peptide for penetrating the blood-brain barrier (SEQ ID NO: 41) prepared by the method of Example 1, and the antibody of SEQ ID NO: 59 was chemically coupled.
  • 1.02mg antibody of SEQ ID NO: 59 was dissolved in 1mL PBS buffer (pH 8.3).
  • 2.12mg SPDP succinimidyl 3-(2-pyridyldithio)propionate, ThermoFisher, 21857
  • the pcDNA3.4-TOPO vector was synthesized with gene sequences in which the blood-brain barrier penetration peptides of SEQ ID NOs: 15 to 18 were linked to the C term of the antibody of SEQ ID NO: 59.
  • pcDNA3.1-TOPO or pcDNA3.4-TOPO was digested with EcoR I and BamH I, and a KRAS mutant scFv gene fragment of 900-960 bp was recovered by agarose electro elution.
  • the genes were amplified by PCR, and at the same time BamH I and EcoRI restriction enzyme sites were synthesized.
  • Each digested vector and insert were mixed at a ratio of 4 ⁇ l to 4 ⁇ l, using T4 DNA ligase in a ligation buffer solution composed of Tris-HCl 500 mM, MgCl 2 100 mM, DTT 200 mM, and ATP 10 mM. and reacted at 4°C for 16-18 hours.
  • the prepared vector was transformed into the Chinese hamster ovary cell line Expi-CHO-S.
  • Chinese hamster ovary cell line ExpiCHO-S was provided by Thermo Fisher Scientific (USA) and cultured in ExpiCHO Expression medium (GIBCO, USA).
  • the ExpiCHO-S cell line (3 X 10 8 cells) was plated in 50 mL of culture medium in a 250 mL disposable Erlenmeyer flask.
  • the column was separated and purified using nickel chromatography (HisTrapTM excel, GE healthcare), and the nickel column was pre-wetted with a buffer under the conditions of [20mM sodium phosphate, 0.5M NaCl, pH 7.4] to equalize, and then a medium was applied. After washing was performed using the above buffer containing 25 mM imidazole, the imidazole was increased to 125 mM to separate proteins. The separated proteins were collected, imidazole was removed through desalting, and stored.
  • nickel chromatography HisTrapTM excel, GE healthcare
  • Figure 3 shows the results of SDS-PAGE and western blot of peptides and antibodies for penetrating the blood-brain barrier purified from pcDNA3.4-TOPO. Arrows indicate expressed complexes.
  • Hairless mouse (SKH-1, female, 6 weeks old, Orient Bio), SEQ ID NO: 17 labeled with Cy5.5, peptide for penetrating the blood-brain barrier, antibody with SEQ ID NO: 59 labeled with Cy5.5, labeled with Cy5.5
  • a complex of SEQ ID NO: 17 peptide for penetrating the blood-brain barrier and SEQ ID NO: 59 antibody was injected intravenously at 4 mg/kg each, and fluorescence was measured in each organ (brain, liver, lung, spleen, kidney, heart) by IVIS (Perkin Elmer).
  • a control cell-penetrating peptide (TAT) and antibody of SEQ ID NO: 59 were prepared in the same manner as in Example 2, and cy5.5 was labeled. Cy5.5 was labeled on the complex of the peptide for penetrating the blood-brain barrier of SEQ ID NO: 41 and the antibody of SEQ ID NO: 59 into which CGGGG was introduced in the N term prepared in Example 2.
  • the antibody of SEQ ID NO: 59 was labeled with Cy5.5, and intravenously injected at 10 mg/kg each into a hairless mouse (SKH-1, female, 6 weeks old, Orient Bio). Until day 24, brain and blood concentrations were measured using IVIS (Perkin Elmer) at excitation: 685 nm and emission: 706 nm, and the results are shown in FIG. 5.
  • U87MG-Luc 2 (ATCC, HTB-14-LUC2TM) cells, a U87MG glioblastoma expressing luciferase were cultured in DMEM medium supplemented with 10% FBS and 1% antibiotics.
  • 5- to 7-week-old nude mice (Orient Bio) were anesthetized with isofran and fixed using an ear bar in a stereotaxic instrument.
  • a hole was made using a sterile drill at 2 mm to the right of bregma and 2 mm downward. Thereafter, 1.0 ⁇ 10 5 /10 ⁇ L U87MG-Luc-2 cells were injected with a 26G Hamilton syringe (1 ⁇ l/min) through the hole, and after injection, the hole was closed with bone wax and sutured to close the scalp. Proliferation of the transplanted glioblastoma was confirmed by injecting 150 mg/kg of D-luciferin potassium (15 mg/mL dissolved in PBS, sigma), a substrate for luciferase, into mice, sacrificed after 10 minutes, and bioluminescence using IVIS (Perkin Elmer). It was measured using and the results are shown in FIG. 6 .
  • 6 is a result of observing that a complex of a peptide for penetrating the blood-brain barrier and an antibody penetrates the brain to suppress brain tumor and is distributed in the brain parenchyma in a brain tumor animal model.
  • 6(a) is a photograph of IVIS observation of bioluminescence of U87MG-Luc cells on day 16.
  • 6(b) is the result of measuring the bioluminescence of U87MG-Luc cells by IVIS for 4, 10, and 16 days. As a result of observing bioluminescence for 16 days, bioluminescence continued to increase in the group without treatment after transplanting glioblastoma. This means that many of the transplanted brain tumor cells are still alive. Even when only the antibody was administered, many brain tumor cells survived, but bioluminescence by brain tumor cells was reduced when the complex of CGGGG-SEQ ID NO: 41 for penetrating the blood-brain barrier and SEQ ID NO: 59 antibody was injected.
  • Example 3 Preparation of peptides for penetrating the blood-brain barrier and complexes of RNA-binding peptides and siRNAs
  • siRNAs of SEQ ID NOs: 60 and 61, the RNA-binding peptide of SEQ ID NO: 62, and the peptide for penetrating the blood brain barrier of SEQ ID NO: 40 were mixed at a constant ratio to prepare nanoparticles by self-assembly.
  • the RNA-binding peptide and the peptide for penetrating the blood-brain barrier were dissolved in RNase, DNase Free & PCR certified water (Tech&Innovation, BWA-8000) at a concentration of 5 ⁇ g/ ⁇ L.
  • siRNA was dissolved in RNase, DNase Free & PCR certified water (Tech&Innovation, BWA-8000) at a concentration of 1 ⁇ g/ ⁇ L.
  • the mixing ratio of the siRNA solution and the peptide for penetrating the blood-brain barrier was 1:10 to 1:20, and 10 ⁇ L of the siRNA was mixed with 12 ⁇ L (1:10) of the peptide solution for penetrating the blood-brain barrier by 2 ⁇ L each, and left for 30 minutes or longer.
  • a complex was formed with siRNAs of SEQ ID NO: 60 and SEQ ID NO: 61.
  • Example 4 Preparation of peptides for penetrating the blood-brain barrier and complexes of cationic peptides and siRNAs
  • Example 4-1 Preparation of complex between blood-brain barrier penetrating peptide including transferrin receptor-binding peptide and KRAS siRNA
  • the cationic peptide of SEQ ID NO: 9 was dissolved in RNase, DNase Free & PCR certified water (Tech & Innovation, BWA-8000) at a concentration of 5 ⁇ g/ ⁇ L.
  • siRNAs of SEQ ID NOs: 60 and 61 were dissolved in RNase, DNase Free & PCR certified water (Tech&Innovation, BWA-8000) at a concentration of 1 ⁇ g/ ⁇ L.
  • the mixing ratio of the siRNA solution and the peptide of SEQ ID NO: 9 was 1:10, and 10 ⁇ L of the siRNA was mixed with 12 ⁇ L (1:10) of the peptide solution of SEQ ID NO: 9 by 2 ⁇ L each, and the mixture was allowed to stand for 30 minutes or longer.
  • the peptide for penetrating the blood-brain barrier of SEQ ID NO: 70 was dissolved in RNase, DNase Free & PCR certified water (Tech & Innovation, BWA-8000) at a concentration of 1 ⁇ g/ ⁇ L. 12 ⁇ L of the peptide solution for penetrating the blood-brain barrier of SEQ ID NO: 70 was divided into 2 ⁇ L each and mixed with the mixture of siRNA and the peptide of SEQ ID NO: 9, and left for 30 minutes or more. The formed complex was confirmed using a transmission electron microscope (TEM, JEOL, JEM 1010) (FIG. 8(a)).
  • TEM, JEOL, JEM 1010 transmission electron microscope
  • Example 4-2 Preparation of a complex between a peptide for penetrating the blood-brain barrier including a transferrin receptor-binding peptide and beta catenin siRNA
  • RNA-binding peptide of SEQ ID NO: 64 was dissolved in RNase, DNase Free & PCR certified water (Tech & Innovation, BWA-8000) at a concentration of 5 ⁇ g/ ⁇ L.
  • Beta catenin siRNA (Dhamacon, #J-040628-05) was dissolved in RNase, DNase Free & PCR certified water (Tech&Innovation, BWA-8000) at a concentration of 1 ⁇ g/ ⁇ L.
  • the mixing ratio of the siRNA solution and the RNA-binding peptide was set to 1:10, and 10 ⁇ L of the siRNA was mixed with 12 ⁇ L (1:10) of the RNA-binding peptide solution by 1 ⁇ L, and the mixture was allowed to stand for 30 minutes or more.
  • the peptide for penetrating the blood-brain barrier of SEQ ID NO: 70 was dissolved in RNase, DNase Free & PCR certified water (Tech & Innovation, BWA-8000) at a concentration of 1 ⁇ g/ ⁇ L. 12 ⁇ L of the peptide solution for penetrating the blood-brain barrier of SEQ ID NO: 70 was divided into 1 ⁇ L of the mixed solution of beta catenin siRNA and the RNA-binding peptide of SEQ ID NO: 64, mixed, and allowed to stand for 30 minutes or longer. The formed complex was confirmed using a transmission electron microscope (TEM, JEOL, JEM 1010) (FIG. 8(b)).
  • Example 4-3 Preparation of a complex of peptides for penetrating the blood-brain barrier including beta catenin siRNA and LRP-binding peptide
  • the peptide of SEQ ID NO: 64 was dissolved in RNase, DNase Free & PCR certified water (Tech & Innovation, BWA-8000) at a concentration of 5 ⁇ g/ ⁇ L.
  • siRNAs of SEQ ID NOs: 60 and 61 were dissolved in RNase, DNase Free & PCR certified water (Tech&Innovation, BWA-8000) at a concentration of 1 ⁇ g/ ⁇ L.
  • the mixing ratio of the siRNA solution and the peptide transporter was set to 1:10, and 10 ⁇ L of the siRNA was mixed with 12 ⁇ L (1:10) of the peptide solution of SEQ ID NO: 64 divided by 1 ⁇ L, and left for 30 minutes or longer.
  • the peptide for penetrating the blood-brain barrier of SEQ ID NO: 84 was dissolved in RNase, DNase Free & PCR certified water (Tech & Innovation, BWA-8000) at a concentration of 1 ⁇ g/ ⁇ L. 12 ⁇ L of the peptide solution for penetrating the blood-brain barrier of SEQ ID NO: 84 was divided into 2 ⁇ L each and mixed with the mixture of siRNA and the peptide of SEQ ID NO: 64, and left for 30 minutes or more. The formed complex was confirmed using a transmission electron microscope (TEM, JEOL, JEM 1010) (FIG. 8(c)).
  • TEM, JEOL, JEM 1010 transmission electron microscope
  • siRNAs of SEQ ID NO: 60 and SEQ ID NO: 61 labeled with Alexa FluorTM 488 a complex with the peptide for penetrating the blood-brain barrier was prepared in the same manner as in Example 4-1, and the in vitro BBB model was Permeability was evaluated using As a control, LipofectamineTM 2000 (Invitrogen) was reacted with siRNAs of SEQ ID NO: 60 and SEQ ID NO: 61 labeled with Alexa FluorTM 488 (Invitrogen) according to the manufacturer's method.
  • Immortalized mouse brain endothelial cells (bEnd.3, CRL-2299, ATCC) were seeded at 5 ⁇ 10 4 /well in the upper chamber of culture inserts (corning) and placed in 24 wells. 800 ⁇ L Dulbecco's modified Eagle's medium (DMEM) was added to the lower chamber. Medium was changed every 2 days. The density of the cell layer was monitored using a trans-endothelial electrical resistance (TEER) instrument (World Precision Instruments, Inc., Sarasota), and the experiment was performed when the TEER value was 200 ⁇ cm 2 or more.
  • TEER trans-endothelial electrical resistance
  • the medium was replaced with DMEM without FBS, and the complex of the peptide for penetrating the blood-brain barrier of SEQ ID NO: 70 labeled with Cy5.5 and the siRNA of SEQ ID NOs: 60 and 61, LipofectamineTM 2000 and SEQ ID NO: 60 and sequence
  • the siRNA complex of No. 61 was added to the upper chamber at a concentration of 200 nM, respectively.
  • the assembled transwell was left at 37°C and 50 rpm for 1, 4, and 8 hours in a shaking incubator. 500 ⁇ L was taken from the lower chamber (basolateral compartment) and refilled with the same volume of fresh medium. At the end of the experiment, the TEER value was checked again.
  • Example 4-2 and Example 4-3 also measured permeability in the in vitro BBB model in the same manner as above.
  • FIG. 9 is a result of permeability of a peptide for penetrating the blood-brain barrier and a siRNA complex permeated in an in vitro BBB model.
  • the degree of permeation of the composite of Example 4-1 increased with increasing time (FIG. 9(a)).
  • the permeation rate was 6 times higher than that of the complex of lipofectamine and siRNA of SEQ ID NO: 60 and SEQ ID NO: 61 8 hours after the cell treatment.
  • the complexes of Examples 4-2 and 4-3 were also measured for up to 4 hours, it was found that the degree of permeation was 8-10 times higher than that of LipofectamineTM (FIGS. 9(b) and 9(c)).
  • siRNAs of SEQ ID NO: 60 and SEQ ID NO: 61 labeled with Alexa FluorTM 680 Alexa FluorTM 680 (Invitrogen)
  • complexes with peptides for penetrating the blood-brain barrier were prepared in the same manner as in Example 4-1.
  • Hairless mouse (SKH-1, female, 6 weeks old, Orient Bio) was intravenously injected with the complex of Example 4-1 and siRNA of SEQ ID NO: 60 and SEQ ID NO: 61 at 150 ⁇ g/kg, respectively, and after 5 hours, the brain was extracted. and fluorescence was observed by confocal microscopy (Carl Zeiss LSM700).
  • Hairless mouse (SKH-1, female, 6 weeks old, Orient Bio) was injected intravenously with the complex of Examples 4-2 and 4-3 and beta catenin siRNA at 1 mg/kg each, and after 1 hour, the brain was extracted and fluorescence were observed by confocal microscopy (Carl Zeiss LSM700).
  • Example 10 is a result of observing a peptide and siRNA complex for penetrating the blood-brain barrier into the brain parenchyma. It was found that the complex of Example 4-1 effectively delivered the siRNAs of SEQ ID NO: 60 and SEQ ID NO: 61 into the brain (FIG. 10(a)). In addition, it was found that the complexes of Examples 4-2 and 4-3 also effectively delivered beta catenin siRNA into the brain (FIG. 10(b)).
  • beta catenin siRNA delivered to brain tissue effectively reduced beta catenin mRNA.
  • Example 4-2 and Example 4-3 An 8-week-old mouse (C57BL/6, Orient Bio) was purchased, and a complex was prepared in the same manner as in Example 4-2 and Example 4-3, at doses of 2.5 mg/kg and 10 mg/kg (based on siRNA). intravenous injection. 24 hours and 96 hours after the injection, perfusion was performed three times with 20 ml of PBS, and blood was removed from the brain tissue.
  • the cerebral cortex (cerebral cortex), cerebellum (cerebellum) and mid brain (midbrain) were isolated, and beta catenin mRNA in brain tissue was measured by qRT-PCR (Thermo Fisher - QuantStudio 3). PCT conditions and primer sequences used are shown in Table 2 and Table 3, respectively.
  • FIG. 11 is a result of measuring beta catenin mRNA in each brain region.
  • Beta catenin mRNA decreased more at 96 hours than at 24 hours after injection, and as the dose increased, beta catenin mRNA level decreased.
  • the blood-brain barrier-penetrating peptide of the present invention in which a cell-permeable peptide is linked to a cerebrovascular endothelial cell surface protein-binding peptide, passes through the cell membrane of cerebrovascular endothelial cells with excellent efficiency, and the blood-brain barrier-penetrating peptide is an antibody, protein or therapeutic
  • a peptide-drug complex in which a drug such as a nucleic acid for nucleic acid is coupled has the advantage of effectively delivering the drug to the brain parenchyma and maximizing the therapeutic effect of brain diseases and brain tumors.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Epidemiology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Neurology (AREA)
  • Biomedical Technology (AREA)
  • Neurosurgery (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicinal Preparation (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)

Abstract

본 발명은 혈액 뇌장벽 투과용 펩타이드 및 이의 용도에 관한 것으로, 더 상세하게는 혈액 뇌장벽 투과용 펩타이드 및 상기 펩타이드에 항체, 단백질 또는 치료용 핵산의 약물이 결합되어 있는 복합체 및 이의 뇌질환 또는 뇌종양의 치료 또는 예방 용도에 관한 것이다. 본 발명의 혈액 뇌장벽 투과용 펩타이드는 뇌혈관 내피세포의 세포막을 우수한 효율로 통과하며, 상기 혈액 뇌장벽 투과용 펩타이드에 항체, 단백질 또는 치료용 핵산 등의 약물이 결합된 펩타이드-약물 복합체는 약물을 뇌실질로 효과적으로 전달하고, 뇌질환 및 뇌종양의 치료 효과를 극대화할 수 있는 장점이 있다.

Description

혈액 뇌장벽 투과용 펩타이드 및 이의 용도
본 발명은 혈액 뇌장벽 투과용 펩타이드 및 이의 용도에 관한 것으로, 더 상세하게는 혈액 뇌장벽 투과용 펩타이드 및 상기 펩타이드에 항체, 단백질 또는 치료용 핵산의 약물이 결합되어 있는 복합체 및 이의 뇌질환 또는 뇌종양의 치료 또는 예방 용도에 관한 것이다.
혈액 뇌장벽(Blood-brain barrier, BBB)은 가장 강력한 생체장벽으로서 뇌 기능 유지에 필수적인 혈중 물질만 선택적으로 통과하게 함으로써 뇌의 복잡한 생리를 유지할 수 있도록 돕는 방어 시스템이다. BBB는 뇌혈관 내피세포(brain endothelial cell)로부터 형성된 모세혈관과 이를 둘러싼 성상교세포(astrocyte) 및 혈관주위세포(pericyte)로 이루어져 있으며 각 세포들은 BBB 특유의 생체장벽을 견고하게 하는 데 기여한다. 뇌혈관 내피세포는 타 장기의 내피세포와 다르게 폐쇄연접(tight junction)이 발달되어 있어 300 Da 이상의 친수성 물질의 세포간 통과를 강력히 저해하고 있으며 이를 물리적 장벽기능이라고 한다. 또한 극성화된 내피세포에는 P-glycoprotein, MRP1, MRP4, BCRP 등 다양한 종류의 다제 내출 펌프(efflux pump)가 발달되어 있어 소수성의 약물과 결합함으로써 약물의 뇌조직 투과를 방해하며, 이를 대사적 장벽기능이라고 일컫는다. 성상교세포는 형성된 뇌 모세혈관을 향해 돌기를 뻗어 혈관의 대부분의 표면을 감싼 성상교세포 말단(astrocytic endfeet)을 형성하며, 최근에는 이러한 말단(endfeet)이 BBB에 가해지는 위해 요인을 방어하여 생체장벽을 유지하는 데 있어 중추역할을 하는 것으로 알려지고 있다.
따라서, 뇌 안쪽에서 작용해야 되는 분자량이 큰 약물 또는 낮은 뇌 투과율을 갖는 저분자 약물과 같은 신경 질환 약물들은 혈액 뇌장벽(blood-brain barrier, BBB)을 투과할 수 없다.
한편, 기존 기술들은 혈액 뇌장벽을 통과시키기 위하여, 뇌 모세혈관 내피 상에서 발현된 내인성 수용체에 의해 매개된 트랜스시토시스(transcytosis) 경로를 이용하였다. 뇌혈관 내피세포의 표면에 트랜스페린 수용체가 다수 존재한다는 점에 착안하여 트랜스페린 수용체에 대한 항체 또는 펩타이드를 고안한 것인데, 트랜스페린 수용체와 결합한 항체는 직접 세포막을 통과할 수 없고, 엔도사이토시스(endocytosis)에 의해 뇌혈관 내피세포 안으로 들어갈 수 있다. 이렇게 엔도사이토시스로 뇌혈관 세포안에 들어가게 되면 엔도좀(endosome)을 형성하고, 엔도좀에서 탈출하지 못하면, 리소좀(lysosome)으로 이행되어 분해된다는 한계점이 있다.
한편, 뇌혈관 내피세포에는 트랜스페린 이외에 저밀도 지단백질 수용체-관련 단백질(low density lipoprotein receptor(LDLR)-related proteins(LRPs)) 수용체도 존재한다. 저밀도 지단백질 수용체-관련 단백질 수용체는 LDL 입자를 엔도사이토시스하여 BBB를 투과시킨다. 이 LRPs 수용체는 리소좀으로 이동하여 분해되는 것을 거치지 않으며, 퇴행성 신경질환 치료에 사용되는 약물을 전달하기에 유리한 수용체이다.
이전의 연구들은 혈류 중에 주입된 IgG는 매우 낮은 비율(약 0.1%)로 CNS 구획 내로 투과하므로[Felgenhauer, Klin. Wschr. 52: 1158-1164 (1974)], CNS 내에서 매우 제한적인 약동학적 효과를 나타낸다는 한계점이 있다. 따라서, BBB를 횡단하여 약물을 뇌로 효과적으로 운반하기 위한 신경 질환 약물의 전달 시스템이 요구되는 실정이다.
이에, 본 발명자들은 트랜스페린 수용체 결합 펩타이드 또는 저밀도 지단백질 수용체-관련 단백질 수용체 결합 펩타이드에 세포 투과성 펩타이드를 연결한 혈액 뇌장벽(Blood-brain barrier, BBB) 투과용 펩타이드를 제조하고, 상기 제조된 펩타이드가 엔도사이토시스에 의존하지 않고 직접 뇌혈관 내피세포(brain endothelial cell)의 세포막을 통과할 수 있음을 확인하고, 혈액 뇌장벽 투과용 펩타이드에 항체, 단백질 또는 치료용 핵산 등의 약물이 결합된 혈액 뇌장벽 투과용 펩타이드-약물 복합체는 뇌실질(brain parenchyma)로 효과적으로 전달되며, 뇌종양 치료 효과가 있음을 확인하고 본 발명을 완성하였다.
본 배경기술 부분에 기재된 상기 정보는 오직 본 발명의 배경에 대한 이해를 향상시키기 위한 것이며, 이에 본 발명이 속하는 기술분야에서 통상의 지식을 가지는 자에게 있어 이미 알려진 선행기술을 형성하는 정보를 포함하지 않을 수 있다.
발명의 요약
본 발명의 목적은 뇌질환 또는 뇌종양 치료용 약물을 뇌실질로 효과적으로 전달하기 위한 혈액 뇌장벽(Blood-brain barrier, BBB) 투과용 펩타이드를 제공하는 데 있다.
본 발명의 다른 목적은 상기 혈액 뇌장벽 투과용 펩타이드에 약물이 결합되어 있는 혈액 뇌장벽 투과용 펩타이드-약물 복합체를 제공하는 데 있다.
본 발명의 또 다른 목적은 상기 혈액 뇌장벽 투과용 펩타이드-약물 복합체를 포함하는 뇌질환 또는 뇌종양 치료 또는 예방용 약학 조성물을 제공하는 데 있다.
본 발명의 또 다른 목적은 상기 복합체를 투여하는 단계를 포함하는 뇌질환 또는 뇌종양의 예방 또는 치료방법, 뇌질환 또는 뇌종양 예방 또는 치료를 위한 상기 복합체의 용도 및 뇌질환 또는 뇌종양 예방 또는 치료용 약제 제조를 위한 상기 복합체의 사용을 제공하는 데 있다.
상기 목적을 달성하기 위하여, 본 발명은 뇌혈관 내피세포 표면 단백질 결합 펩타이드 및 세포 투과성 펩타이드가 연결되어 있는 혈액 뇌장벽(Blood-brain barrier, BBB) 투과용 펩타이드를 제공한다.
본 발명은 또한, 상기 혈액 뇌장벽 투과용 펩타이드에 약물이 결합되어 있는 혈액 뇌장벽 투과용 펩타이드-약물 복합체를 제공한다.
본 발명은 또한, 상기 복합체를 코딩하는 핵산을 제공한다.
본 발명은 또한, 상기 핵산이 도입되어 있는 재조합 벡터를 제공한다.
본 발명은 또한, 상기 핵산 또는 상기 재조합 벡터가 도입되어 있는 재조합 세포를 제공한다.
본 발명은 또한, (a) 상기 재조합 세포를 배양하여 상기 혈액 뇌장벽 투과용 펩타이드-약물 복합체를 발현시키는 단계; 및 (b) 상기 발현된 혈액 뇌장벽 투과용 펩타이드-약물 복합체를 회수하는 단계;를 포함하는 상기 혈액 뇌장벽 투과용 펩타이드-약물 복합체를 제조하는 방법을 제공한다.
본 발명은 또한, 상기 혈액 뇌장벽 투과용 펩타이드-약물 복합체를 포함하는 뇌질환 또는 뇌종양 치료 또는 예방용 약학 조성물을 제공한다.
본 발명은 또한, 상기 복합체를 투여하는 단계를 포함하는 뇌질환 또는 뇌종양의 예방 또는 치료방법, 뇌질환 또는 뇌종양 예방 또는 치료를 위한 상기 복합체의 용도 및 뇌질환 또는 뇌종양 예방 또는 치료용 약제 제조를 위한 상기 복합체의 사용을 제공한다.
도 1은 항체와 혈액 뇌장벽 투과용 펩타이드 복합체의 모식도이다.
도 2는 siRNA와 혈액 뇌장벽 투과용 펩타이드 복합체의 모식도이다.
도 3은 pcDNA3.4-TOPO에서 발현되어 정제된 혈액 뇌장벽 투과용 펩타이드와 항체의 SDS-PAGE와 western blot 결과이다.
도 4a는 brain, liver, lung, spleen, kidney, heart에 분포한 혈액 뇌장벽 투과용 펩타이드와 항체의 복합체를 IVIS 관찰한 결과이다. 도 4b는 brain 내부에 분포한 혈액 뇌장벽 투과용 펩타이드와 항체의 복합체를 3차원으로 관찰한 결과이다.
도 5는 혈액과 뇌에 존재하는 혈액 뇌장벽 투과용 펩타이드와 항체의 복합체의 농도이다.
도 6a는 16일 째 U87MG-Luc 세포의 bioluminescence를 측정한 이미지이다. 도 6b는 16일 동안 U87MG-Luc 세포의 bioluminescence를 측정한 결과이다. 도 6c는 뇌종양 부위에서 혈액 뇌장벽 투과용 펩타이드와 항체의 복합체의 분포를 관찰한 결과이다.
도 7은 혈액 뇌장벽 투과용 펩타이드와 siRNA의 복합체를 전기영동으로 확인한 결과이다.
도 8은 투과전자현미경으로 혈액 뇌장벽 투과용 펩타이드와 siRNA의 복합체를 확인한 결과이다.
도 9는 in vitro BBB 모델에서 투과된 혈액 뇌장벽 투과용 펩타이드와 siRNA 복합체의 투과도 결과이다.
도 10은 뇌실질로 투과된 혈액 뇌장벽 투과용 펩타이드와 siRNA 복합체를 관찰한 결과이다.
도 11은 혈액 뇌장벽 투과용 펩타이드와 siRNA 복합체에 의해 대뇌피질(cerebral cortex), 소뇌(cerebellum), 중뇌(mid brain)에서 감소한 beta catenin의 mRNA 레벨을 qRT-PCR로 측정한 결과이다.
발명의 상세한 설명 및 바람직한 구현예
다른 식으로 정의되지 않는 한, 본 명세서에서 사용된 모든 기술적 및 과학적 용어들은 본 발명이 속하는 기술분야에서 숙련된 전문가에 의해서 통상적으로 이해되는 것과 동일한 의미를 갖는다. 일반적으로, 본 명세서에서 사용된 명명법 및 이하에 기술하는 실험 방법은 본 기술분야에서 잘 알려져 있고 통상적으로 사용되는 것이다.
본 발명에서는 뇌혈관 내피세포로 투과된 물질이 엔도좀에서 리소좀으로 이행되는 것을 막기 위해, 항체 대신 파지디스플레이 기법을 이용해 트랜스페린 수용체에 결합할 수 있는 펩타이드를 고안하였다. 이 트랜스페린 수용체 결합 펩타이드는 트랜스페린이 트랜스페린 수용체에 결합하는 부분과 다른 부분에 결합하는 것을 특징으로 한다. 추가로, 저밀도 지단백질 수용체-관련 단백질(low density lipoprotein receptor(LDLR)-related proteins(LRPs)) 수용체 결합 펩타이드를 고안하였다.
트랜스페린 수용체 결합 펩타이드 또는 저밀도 지단백질 수용체-관련 단백질 수용체 결합 펩타이드와 세포투과 기능을 가진 펩타이드를 연결함으로써, 엔도사이토시스에 의존하지 않고 직접 뇌혈관 내피세포의 세포막을 통과할 수 있는 혈액 뇌장벽(Blood-brain barrier, BBB) 투과용 펩타이드를 개발하고, 이를 NIPEP-TPP-BBB shuttle(NIBEC Peptide-Target Tissue Penetrating Property-BBB shuttle) 이라고 명명하였다.
또한, 혈액 뇌장벽 투과용 펩타이드의 N 말단에 유전자 발현법 또는 화학적 결합법으로 항체, 단백질 또는 치료용 핵산 등의 약물을 결합하여 마우스에 정맥주사하였을 때 뇌실질로 전달되고, 교모세포종(glioblastoma)을 유발한 동물에 투여했을 때 종양 세포가 감소하는 것을 확인하였다.
따라서, 본 발명은 일 관점에서, 뇌혈관 내피세포 표면 단백질 결합 펩타이드 및 세포 투과성 펩타이드가 연결되어 있는 혈액 뇌장벽(Blood-brain barrier, BBB) 투과용 펩타이드에 관한 것이다.
본 발명에 있어서, 상기 뇌혈관 내피세포 표면 단백질은 트랜스페린(transferrin) 수용체 또는 저밀도 지단백질 수용체-관련 단백질(LRP) 수용체인 것을 특징으로 할 수 있다. 따라서, 상기 혈액 뇌장벽 투과용 펩타이드는 트랜스페린 수용체에 결합능이 있는 펩타이드 또는 저밀도 지단백질 수용체-관련 단백질(LRP) 수용체에 결합능이 있는 펩타이드와 세포 투과성 펩타이드가 연결되어 있는 것을 특징으로 할 수 있다.
본 발명에 있어서, 상기 트랜스페린 수용체 결합 펩타이드는 서열번호 1 내지 서열번호 4 중 어느 하나의 아미노산 서열로 표시되는 것을 특징으로 할 수 있다.
서열번호 1: VPALR
서열번호 2: LRRERQSRLRRERQSR
서열번호 3: VPALRRERQSRLRRERQSR
서열번호 4: HAIYPRH
본 발명에 있어서, 용어 "트랜스페린 수용체(transferrin receptor)"는 세포 내에 철이 끼여 들어가게 하기 위해 트랜스페린에 있는 특이적 수용체를 의미하며, 분자량 95,000 Da의 폴리펩티드 사슬의 동종이량체(homodimer)로 구성되고, 그 각각의 사슬에 철이온 2개를 결합한 트랜스페린이 1분자씩 결합한다.
본 발명에 있어서, 용어 "트랜스페린(transferrin)"은 당단백질의 일종으로, β-글로불린이 혈청 속에 흡수된 2분자의 3가철이온과 결합한 상태로 세포증식이나 헤모글로빈 생산에 필요한 철을 트랜스페린 수용체를 매개로 하여 세포 내로 공급하는 철운반 단백질을 의미하며, 혈청 속의 철 99% 이상은 트랜스페린과 결합한다.
본 발명에 있어서, 상기 저밀도 지단백질 수용체-관련 단백질 수용체 결합 펩타이드는 서열번호 5 또는 서열번호 6의 아미노산 서열로 표시되는 것을 특징으로 할 수 있다.
서열번호 5: YHFNGCEDPLCR
서열번호 6: HPWCCGLRLDLR
본 발명에 있어서, 용어 "저밀도 지단백질 수용체-관련 단백질 수용체(LRP receptor)"는 뇌혈관 내피세포, 소장 상피 등에 다수 발현되어 있는 것으로 알려진 세포막 단백질을 의미하며, LDL 입자를 엔도사이토시스(endocytosis)하여 BBB를 투과시키는 기능을 한다.
본 발명에 있어서, 용어 "저밀도 지단백질 수용체-관련 단백질(low density lipoprotein receptor(LDLR)-related proteins(LRPs))"은 LDL receptor gene family에 속하는 600 kDa의 당단백질로, 간세포, 지방세포, 섬유아세포, 대식세포와 중추신경계의 신경세포 등 여러 조직에서 발현되며(Herz J., et al., EMBO Journal, 20, 4119-27 (1988)), 주로 간과 뇌에 많이 분포해 있는 단백질을 의미한다. 중추신경계에서의 LRP의 기능은 소뇌, 대뇌피질, 해마, 뇌간에서 특히 중요시되고 있다(Qian Z., et al., Nature, 361, 453-457 (1993)).
본 발명에 있어서, 상기 세포 투과성 펩타이드는 서열번호 7 내지 서열번호 10 중 어느 하나의 아미노산 서열로 표시되는 것을 특징으로 할 수 있다.
서열번호 7: HRRCNKNNKKR
서열번호 8: HRRCNPNNKKR
서열번호 9: VSRRRRRRGGRRRR
서열번호 10: GKCSTRGRKCCRRKK
본 발명에 있어서, 상기 세포 투과성 펩타이드는 상기 트랜스페린 수용체 결합 펩타이드 또는 저밀도 지단백질 수용체-관련 단백질 수용체 결합 펩타이드의 N-말단, C-말단, 또는 N-말단과 C-말단 양쪽에 직접 연결된 것을 특징으로 할 수 있으나, 이에 제한되는 것은 아니다.
본 발명에 있어서, 상기 혈액 뇌장벽 투과용 펩타이드는 서열번호 11 내지 서열번호 58 중 어느 하나의 아미노산 서열로 표시되는 것을 특징으로 할 수 있다(표 1).
Figure PCTKR2022014716-appb-img-000001
Figure PCTKR2022014716-appb-img-000002
Figure PCTKR2022014716-appb-img-000003
본 발명에 있어서, 상기 뇌혈관 내피세포 표면 단백질 결합 펩타이드 및 세포 투과성 펩타이드는 2개 내지 10개의 아미노산 G 및 1개 내지 5개의 아미노산 S로 구성된 스페이서를 통해 연결된 것을 특징으로 할 수 있다.
본 발명은 다른 관점에서, 상기 혈액 뇌장벽 투과용 펩타이드에 약물이 결합되어 있는 혈액 뇌장벽 투과용 펩타이드-약물 복합체에 관한 것이다.
본 발명에 있어서, 상기 혈액 뇌장벽 투과용 펩타이드와 약물은 링커에 의해 연결된 것을 특징으로 할 수 있으나, 이에 제한되는 것은 아니다.
본 발명에 있어서, 상기 약물은 항체, 단백질 또는 치료용 핵산인 것을 특징으로 할 수 있으며, 상기 항체는 뇌질환을 유발하는 단백질을 억제하는 항체일 수 있고, 상기 단백질은 신경세포와 관련된 성장인자일 수 있으나, 이에 제한되는 것은 아니다.
본 발명에 있어서, 상기 단백질은 뇌-유도 신경영양 인자(BDNF), 신경 성장 인자(NGF), 뉴로트로핀-4/5, 섬유모세포 성장 인자(FGF)-2 및 다른 FGF, 뉴로트로핀(NT)-3, 에리쓰로포이에틴(EPO), 표피 성장 인자(EGF), 형질전환 성장 인자(TGF)-알파, TGF-베타, 혈관 내피 성장 인자(VEGF), 아교세포-유도 신경영양 인자(GDNF), 뉴르투린, 혈소판-유래 성장 인자(PDGF), 헤레굴린, 뉴레굴린, 아르테민, 페르세핀, 인터류킨, 아교 세포주 유도 신경영양 인자(GFR), 과립구-콜로니 자극 인자(CSF), 과립구-대식세포-CSF 및 줄기 세포 인자(SCF)로 구성된 군에서 선택되는 것을 특징으로 할 수 있다.
본 발명에 있어서, 상기 항체는 서열번호 59의 아미노산 서열로 표시되는 것을 특징으로 할 수 있으며, 교모세포종(glioblastoma) 치료 효능이 있다.
Figure PCTKR2022014716-appb-img-000004
본 발명에 있어서, 상기 혈액 뇌장벽 투과용 펩타이드에 항체가 결합되어 있는 혈액 뇌장벽 투과용 펩타이드-약물 복합체는 유전자 발현법 또는 화학적 결합법으로 제조할 수 있으나, 그 제조방법이 이에 한정되는 것은 아니다.
유전자 발현법으로 혈액 뇌장벽 투과용 펩타이드-약물 복합체를 제조하는 경우, (i) 교모세포종(glioblastoma)을 억제할 수 있는 항체 (ii) 혈액 뇌장벽 투과용 펩타이드가 함께 발현되는 벡터를 이용할 수 있다. 본 발명에서는 대장균에서의 발현을 위해 pET 벡터를, 포유동물 세포에서의 발현을 위해 pcDNA3.1-TOPO, pcDNA3.4-TOPO 벡터를 사용하였다.
이 경우, 상기 항체와 상기 혈액 뇌장벽 투과용 펩타이드 사이에 링커 서열을 추가로 포함하여 발현되도록 할 수 있으며, 바람직하게는 링커는 CGGGG일 수 있으나, 이에 제한되는 것은 아니다.
본 발명에 있어서, 치료용 항체를 유전자에서 발현시켜 정제한 후, 이를 혈액 뇌장벽 투과용 펩타이드에 화학적 결합법으로 결합할 수 있다.
본 발명에 있어서, 치료용 항체와 혈액 뇌장벽 투과용 펩타이드의 혈액 뇌장벽 투과용 펩타이드-약물 복합체는 서열번호 1 내지 서열번호 4로 구성된 군에서 선택되는 어느 하나의 트랜스페린 수용체 결합 펩타이드 또는 서열번호 5 또는 서열번호 6의 저밀도 지단백질 수용체-관련 단백질 수용체 결합 펩타이드와 서열번호 7 내지 서열번호 10으로 구성된 군에서 선택되는 어느 하나의 세포 투과성 펩타이드가 서열번호 59의 항체의 C-말단에 있는 시스테인 또는 Fc 영역에 있는 당과 화학적 결합법으로 연결되는 것을 특징으로 할 수 있다. 이는 도 1의 항체와 혈액 뇌장벽 투과용 펩타이드의 복합체 모식도에 나타냈다.
혈액 뇌장벽 투과용 펩타이드는 링커와 crosslinker에 의해 상기 항체와 화학적으로 연결될 수 있다. 링커는 기능적 구조를 형성할 수 있도록 공간을 부여할 수 있는 것이라면 어떠한 것이라도 사용할 수 있을 것이다. 예를 들어, 상기 링커는 천연 및/또는 합성 기원의 펩타이드성 링커일 수 있다. 천연 및/또는 합성 기원의 펩타이드성 링커는 1 내지 50개의 아미노산으로 이루어진 아미노산 사슬로 이루어질 수 있고, 경첩 기능을 갖는 폴리펩타이드와 같이 천연 발생 폴리펩타이드의 반복적인 아미노산 서열을 포함할 수 있다. 또 다른 양태로서, 상기 펩타이드성 링커 아미노산 서열은 글리신, 글루타민, 및/또는 세린 잔기가 풍부하도록 지정된 합성 링커 아미노산 서열일 수 있다. 이들 잔기는 예를 들어 5개 이하의 아미노산의 작은 반복 단위로 배열될 수 있고 상기 작은 반복 단위는 멀티머 단위를 형성하도록 반복되어 배열될 수 있다. 멀티머 단위의 아미노- 및/또는 카르복시-말단에서, 6개 이하의 추가의 임의의 천연 발생 아미노산이 첨가될 수 있다. 기타 합성 펩타이드성 링커는 10 내지 20회 반복되는 단일 아미노산 구성일 수 있고, 아미노- 및/또는 카르복시-말단에 6개 이하의 추가 임의의 천연 발생 아미노산일 수 있다. 한편, 상기 링커는 아미노산이 화학적으로 변형된 형태일 수 있으며, 예컨데, 블로킹 그룹(Blocking group)으로 Fmoc-(9-Fluorenylmethoxycarbonyl)이 결합된 Fmoc-6-aminohexanoic acid의 형태로 사용될 수 있으나, 이에 한정되는 것은 아니다.
본 발명에 따른 일부 양태로서, 혈액 뇌장벽 투과용 펩타이드의 N 말단에 위치한 cysteine의 sulfhydryl기는 서열번호 59의 입체 구조에서 노출된 부분에 있는 lysine의 아민기에 연결될 수 있다.
이 경우, 사용가능한 crosslinker는 1,4-비스-말레이미도부탄(1,4-bis-maleimidobutane, BMB), 1,11-비스-말레이미도테트라에틸렌글리콜(1,11-bis-maleimidotetraethyleneglycol, BM[PEO]4), 1-에틸-3-[3-디메틸 아미노프로필] 카보디이미드 하이드로클로라이드(1-ethyl-3-[3-dimethyl aminopropyl] carbodiimide hydrochloride, EDC), 숙시니미딜-4-[N-말레이미도메틸시클로헥산-1-카복시-[6-아미도카프로에이트]](succinimidyl-4-[N-maleimidomethylcyclohexane-1-carboxy-[6-amidocaproate]], SMCC) 및 그의 설폰화염(sulfo-SMCC), 숙시미딜 6-[3-(2-피리딜디티오)-로피오나미도] 헥사노에이트](succimidyl 6-[3-(2-pyridyldithio)-ropionamido] hexanoate, SPDP) 및 그의 설폰화염(sulfo-SPDP), m-말레이미도벤조일-N-하이드로시숙시니미드 에스터(m-maleimidobenzoyl-N-hydroxysuccinimide ester, MBS) 및 그의 설폰화염(sulfo-MBS), 숙시미딜[4-(p-말레이미도페닐) 부틸레이트](succimidyl[4-(p-maleimidophenyl) butyrate], SMPB) 및 그의 설폰화염(sulfo-SMPB)등이 있으나, 이에 한정되는 것은 아니다.
본 발명에 있어서, 상기 화학적 결합법을 이용하여 혈액 뇌장벽 투과용 펩타이드-약물 복합체를 제조하는 방법은 하기 단계를 포함한다:
(a) 치료용 항체의 C 말단에 있는 시스테인 또는 노출된 부분에 존재하는 라이신의 아민기를 crosslinker로 활성화 하는 단계;
(b) 혈액 뇌장벽 투과용 펩타이드를 crosslinker로 활성화된 상기 항체에 연결하는 단계; 및
(c) 상기 항체와 혈액 뇌장벽 투과용 펩타이드가 결합되어 있는 혈액 뇌장벽 투과용 펩타이드-약물 복합체를 정제하는 단계.
본 발명에 있어서, 상기 치료용 핵산은 DNA, siRNA, miRNA 및 mRNA로 구성된 군에서 선택되는 것을 특징으로 할 수 있으며, 바람직하게는 상기 치료용 핵산은 타겟 유전자의 발현을 억제시키거나 증가시키는 기능을 가진다. 상기 siRNA는 종양유발 단백질, 뇌질환을 유발하는 단백질을 코딩하는 염기서열에 대한 상보적인 염기서열을 가질 수 있다.
본 발명의 일 양태에서, 돌연변이 KRAS에 대한 siRNA를 사용하여 돌연변이 KRAS의 발현을 억제하였고, 상기 siRNA는 서열번호 60 및 서열번호 61로 표시되는 것을 특징으로 할 수 있다.
KRAS siRNA 서열:
Sense-GUGCAAUGAAGGGACCAGUA (서열번호 60);
Anti-sense-UACUGGUCCCUCAUUGCAC (서열번호 61)
본 발명에 있어서, 상기 siRNA는 천연 형태 또는 화학적으로 변형된 형태의 siRNA일 수 있다.
본 발명에 있어서, 상기 치료용 핵산을 양이온성 펩타이드, 양이온성 고분자 또는 RNA 결합 펩타이드와 반응시켜 1차 콤플렉스를 제조한 다음, 상기 1차 콤플렉스를 음이온성 아미노산 또는 음이온성 고분자; 및 스페이서가 연결되어 있는 상기 혈액 뇌장벽 투과용 펩타이드와 반응시켜 나노입자를 형성하는 것을 특징으로 할 수 있다.
본 발명에 있어서, 상기 양이온성 펩타이드는 서열번호 9의 아미노산 서열로 표시되고, 상기 양이온성 고분자는 폴리-L-라이신(poly-L-lysine), 폴리에틸렌 이민(polyethylene imine) 또는 키토산이며, 상기 RNA 결합 펩타이드는 서열번호 62 내지 서열번호 67 중 어느 하나의 아미노산 서열로 표시되고, 상기 음이온성 아미노산은 글루탐산(glutamic acid) 또는 아스파르트산(aspartic acid)이며, 상기 음이온성 고분자는 헤파린(heparin) 또는 히알루론산(hyaluronic acid)이고, 상기 스페이서는 5개 내지 10개의 글리신(glycine)인 것을 특징으로 할 수 있으나, 이에 제한되는 것은 아니다.
치료용 핵산을 혈액 뇌장벽을 투과시키기 위해서 혈액 뇌장벽 투과용 펩타이드에 추가로 RNA 결합 펩타이드를 도입할 수 있으며, RNA 결합 펩타이드는 서열번호 62 내지 서열번호 67 중 어느 하나의 아미노산 서열로 표시되는 것을 특징으로 할 수 있다.
서열번호 62: CPISQVHEIGIKRNMTVHFKVLREEGPAHMKNF
서열번호 63: CPISQVHEIGIKR
서열번호 64: CNMTVHFKVLREEG
서열번호 65: CPAHMKNFITA
서열번호 66: CIVTEGEGNGKKVSKKRAAEKMLVEL
서열번호 67: CEGNGKKVSKKRAA
서열번호 62 내지 서열번호 67의 펩타이드는 서열번호 11 내지 서열번호 58의 복합체의 N-말단에 연결하여 사용할 수 있으나, 이에 한정되는 것은 아니다.
본 발명에 있어서, siRNA와 혈액 뇌장벽 투과용 펩타이드의 복합체는 서열번호 1 내지 서열번호 4로 구성된 군에서 선택되는 어느 하나의 트랜스페린 수용체 결합 펩타이드 또는 서열번호 5 또는 서열번호 6의 저밀도 지단백질 수용체-관련 단백질 수용체 결합 펩타이드; 서열번호 7 내지 서열번호 10으로 구성된 군에서 선택되는 어느 하나의 세포 투과성 펩타이드; 및 서열번호 62 내지 서열번호 67로 구성된 RNA 결합 펩타이드와 서열번호 60 및 서열번호 61의 siRNA가 자기조립에 의한 복합체를 형성하는 것을 특징으로 할 수 있다. 이 복합체는 나노 사이즈의 입자를 형성하는 것으로 크기는 10-200nm의 크기인 것을 특징으로 할 수 있다.
본 발명에 있어서, siRNA와 혈액 뇌장벽 투과용 펩타이드의 복합체는 2단계로 제조할 수 있다. 1) siRNA를 양이온성 펩타이드 또는 양이온성 고분자와 먼저 반응시킨다. 양이온성 펩타이드는 서열번호 9의 펩타이드일 수 있고, 양이온성 고분자는 poly-L-lysine, polyethylene imine 또는 키토산일 수 있다. 2) 그 다음 단계로 음이온성 아미노산 또는 음이온성 고분자에 연결된 혈액 뇌장벽 투과용 펩타이드와 결합시킬 수 있다. 이 때 혈액 뇌장벽 투과용 펩타이드, 스페이서 및 음이온성 아미노산의 복합체는 서열번호 68 내지 서열번호 85 중 어느 하나의 아미노산 서열로 표시되는 것을 특징으로 할 수 있다.
도 2는 siRNA와 혈액 뇌장벽 투과용 펩타이드의 복합체 모식도이다. 도 2는 치료용 핵산이 siRNA인 경우를 예시적으로 나타낸 도면으로, siRNA가 DNA, miRNA 또는 mRNA인 경우 DNA, miRNA 또는 mRNA 결합 펩타이드와 반응시켜 1차 콤플렉스를 제조할 수 있다. 혈액 뇌장벽 투과용 펩타이드-치료용 핵산 복합체는 5개에서 10개의 glutamic acid 또는 aspartic acid으로 구성된 음이온성 아미노산, 5개에서 10개의 glycine으로 구성된 스페이서, 서열번호 7 내지 서열번호 10으로 구성된 군에서 선택되는 어느 하나의 세포투과 기능성 펩타이드 및 서열번호 1 내지 6으로 구성된 군에서 선택되는 어느 하나의 뇌혈관 내피세포 표면 단백질 결합 펩타이드가 연결된 펩타이드를 포함하는 것을 특징으로 할 수 있다.
서열번호 68: EEEGEEEGE-GGGGG-HRRCNKNNKKR-VPALR
서열번호 69: EEEGEEEGE-GGGGG-HRRCNPNNKKR-GGGGG-VPALR
서열번호 70: EEEGEEEGE-GGGGG-VSRRRRRRGGRRRR-GGGGG-VPALR
서열번호 71: EEEGEEEGE-GGGGG-GKCSTRGRKCCRRKK-GGGGG-VPALR
서열번호 72: EEEGEEEGE-GGGGG-HRRCNKNNKKR-LRRERQSRLRRERQSR
서열번호 73: EEEGEEEGE-GGGGG-HRRCNPNNKKR-LRRERQSRLRRERQSR
서열번호 74: EEEGEEEGE-GGGGG-VSRRRRRRGGRRRR-GGGGG-LRRERQSRLRRERQSR
서열번호 75: EEEGEEEGE-GGGGG-GKCSTRGRKCCRRKK-LRRERQSRLRRERQSR
서열번호 76: EEEGEEEGE-GGGGG-HRRCNKNNKKR-VPALRRERQSRLRRERQSR
서열번호 77: EEEGEEEGE-GGGGG-HRRCNPNNKKR-VPALRRERQSRLRRERQSR
서열번호 78: EEEGEEEGE-GGGGG-VSRRRRRRGGRRRR-VPALRRERQSRLRRERQSR
서열번호 79: EEEGEEEGE-GGGGG-GKCSTRGRKCCRRKK-VPALRRERQSRLRRERQSR
서열번호 80: EEEGEEEGE-GGGGG-HRRCNKNNKKR-HAIYPRH
서열번호 81: EEEGEEEGE-GGGGG-HRRCNPNNKKR-HAIYPRH
서열번호 82: EEEGEEEGE-GGGGG-VSRRRRRRGGRRRR-HAIYPRH
서열번호 83: EEEGEEEGE-GGGGG-GKCSTRGRKCCRRKK-HAIYPRH
서열번호 84: EEEGEEEGE-GGGGG-VSRRRRRRGGRRRR-GGGGG-YHFNGCEDPLCR
서열번호 85: EEEGEEEGE-GGGGG-VSRRRRRRGGRRRR-GGGGG-HPWCCGLRLDLR
또한, 음이온성 아미노산인 glutamic acid 또는 aspartic acid 대신 음이온성 고분자인 heparin 또는 hyaluronic acid를 사용할 수 있다.
자기조립에 의해 siRNA와 서열번호 9의 펩타이드와 먼저 반응시킨 후, 혈액 뇌장벽 투과용 펩타이드와 결합시킬 수 있고, 이 복합체는 나노 사이즈의 입자를 형성하며, 크기는 10-200nm의 크기인 것을 특징으로 할 수 있다.
본 발명에 있어서, siRNA를 포함한 치료용 핵산을 상기 자기조립에 의해 복합체를 형성하는 방법은 하기 단계를 포함한다:
(a) 양이온성 펩타이드, 양이온성 고분자, 또는 RNA 결합 펩타이드와 치료용 핵산을 먼저 반응시키는 단계;
(b) 음이온성 펩타이드가 도입된 혈액 뇌장벽 투과용 펩타이드와 반응시키는 단계;
(c) 자기조립에 의한 나노입자 형성 단계.
본 발명은 또 다른 관점에서, 상기 혈액 뇌장벽 투과용 펩타이드-약물 복합체를 코딩하는 핵산에 관한 것이다.
본 발명은 또 다른 관점에서, 상기 핵산이 도입되어 있는 재조합 벡터에 관한 것이다.
본 발명에 있어서, 벡터는 pET 벡터, pcDNA 3.4, pcDNA3.1, pcDNA3.1-TOPO, pcDNA3.4-TOPO, pSecTag 벡터일 수 있으나, 이에 한정되지는 않으며, 바람직하게는 벡터는 pET 벡터 또는 pcDNA3.1-TOPO, pcDNA3.4-TOPO 벡터이다.
본 발명은 또 다른 관점에서, 상기 핵산 또는 상기 재조합 벡터가 도입되어 있는 재조합 세포에 관한 것이다.
본 발명에 있어서, 상기 재조합 세포는 대장균 또는 포유동물 세포인 것을 특징으로 할 수 있으나, 이에 한정되지는 않는다.
본 발명에 있어서, 포유동물 세포주는 중국햄스터난소세포주(CHO: Chinese hamsterovarian cell), 인간 태아 신장세포주(HEK293: human embryonic kidney cells)일 수 있으나, 이에 한정되지는 않는다.
본 발명은 또 다른 관점에서, 다음 단계를 포함하는 상기 혈액 뇌장벽 투과용 펩타이드-약물 복합체를 제조하는 방법에 관한 것이다:
(a) 상기 재조합 세포를 배양하여 상기 혈액 뇌장벽 투과용 펩타이드-약물 복합체를 발현시키는 단계; 및
(b) 상기 발현된 혈액 뇌장벽 투과용 펩타이드-약물 복합체를 회수하는 단계.
뇌질환을 억제하는 항체 중 대표적인 교모세포종(glioblastoma)을 억제하는 항체 또는 KRAS 돌연변이를 억제하는 siRNA는 혈액 뇌장벽을 투과할 수 없기 때문에 치료 효과가 크지 않다. 반면에, 본 발명의 다른 실시예에서는, 혈액 뇌장벽 투과용 펩타이드와 결합된 항체 또는 siRNA의 뇌 전달 효과 또는 종양 증식 억제 효과를 확인하였을 때, 시험관 내 실험 및 동물 실험 결과 모두에서 해당 종양 세포의 증식을 현저히 억제하는 효과가 있음을 확인하였다.
따라서, 본 발명은 또 다른 관점에서, 상기 혈액 뇌장벽 투과용 펩타이드-약물 복합체를 포함하는 뇌질환 또는 뇌종양 치료 또는 예방용 약학 조성물에 관한 것이다.
본 발명은 또 다른 관점에서, 상기 혈액 뇌장벽 투과용 펩타이드-약물 복합체를 투여하는 단계를 포함하는 뇌질환 또는 뇌종양의 예방 또는 치료방법에 관한 것이다.
본 발명은 또 다른 관점에서, 뇌질환 또는 뇌종양 예방 또는 치료를 위한 상기 혈액 뇌장벽 투과용 펩타이드-약물 복합체의 용도에 관한 것이다.
본 발명은 또 다른 관점에서, 뇌질환 또는 뇌종양 예방 또는 치료용 약제 제조를 위한 상기 혈액 뇌장벽 투과용 펩타이드-약물 복합체의 사용에 관한 것이다.
본 발명에 있어서, 뇌종양 억제 이외에 다른 뇌질환 치료제로 사용할 수 있는 항체 또는 치료용 핵산 물질을 혈액 뇌장벽 투과용 펩타이드와 결합하여 사용할 수 있다.
본 발명에 있어서, 상기 뇌질환은 뇌염, 파킨슨병, 간질, 헌팅턴병, 알츠하이머 치매, 루게릭병, 픽크병, 간질, 크로이츠펠트 야콥병, 진행성 핵상마비, 척수소뇌 변성증, 소뇌 위축증, 다발성경화증, 신경세포의 소실에 의해 발생하는 노인성 치매, 뇌졸중, 기억상실증, 우울증 및 외상 후 스트레스 장애로 구성된 군에서 선택되는 것을 특징으로 할 수 있다.
본 발명에 있어서, 상기 뇌종양은 신경아교종, 다형성 교모세포종, 수막종, 성상세포종, 청신경종, 연골종, 희소돌기아교세포종, 수모세포종, 신경절 신경아교종, 신경초종, 신경섬유종, 신경모세포종 및 경막외, 골수내 또는 경막내 종양으로 구성된 군에서 선택되는 것을 특징으로 할 수 있다.
본 발명에 있어서, 상기 혈액 뇌장벽 투과용 펩타이드-약물 복합체의 1회 투여량은 1μg/kg 내지 100㎎/㎏일 수 있으며, 바람직하게는 5μg/kg 내지 50㎎/㎏이고, 일일 1회 또는 주 1-3회 투여하는 것을 특징으로 할 수 있으나, 투여량과 투여간격이 이에 한정되는 것은 아니다.
본 발명에 있어서, 상기 약학 조성물은 주사제, 경구투여용 제제, 수용액, 현탁액, 유탁액 등과 같은 액제(예를 들어, 주사용), 캡슐, 과립, 정제, 점막투여제제 구성된 군에서 선택되는 어느 하나의 제형으로 제제화되는 것을 특징으로 할 수 있으나, 이에 한정되는 것은 아니다. 이들 제제는 당분야에서 제제화에 사용되는 통상의 방법 또는 Remington's Pharmaceutical Science(최근판), Mack Publishing Company, Easton PA에 개시되어 있는 방법으로 제조될 수 있으며 각 질환에 따라 또는 성분에 따라 다양한 제제로 제제화될 수 있다.
본 발명에 있어서, 본 발명의 약학 조성물은 혈액 뇌장벽 투과용 펩타이드와 결합된 항체 또는 siRNA의 복합체 이외에 약제학적으로 허용가능한 담체를 1 종 이상 더 포함할 수 있다. 약제학적으로 허용 가능한 담체는 식염수, 멸균수, 링거액, 완충 식염수, 덱스트로즈 용액, 말토 덱스트린 용액, 글리세롤 및 에탄올로 구성된 군에서 선택되는 하나 이상 일 수 있으나, 이에 한정되는 것은 아니다.
본 발명의 약학 조성물은 필요에 따라 약제학적으로 허용가능한 보조제를 추가로 함유하는 것을 특징으로 할 수 있다. 상기 보조제는 부형제, 희석제, 분산제, 완충제, 항균성 보존제, 정균제, 계면활성제, 결합제, 윤활제, 산화방지제, 증점제 및 점도개질제로 구성된 군에서 선택되는 하나 이상일 수 있으나, 이에 한정되는 것은 아니다.
본 발명에 따른 약학 조성물은 목적하는 방법에 따라 경구 투여하거나 비경구 투여(예를 들어, 정맥 내, 피하, 복강 내 또는 국소에 적용)할 수 있으며, 투여량은 환자의 체중, 연령, 성별, 건강상태, 식이, 투여시간, 투여방법, 배설율 및 질환의 중증도 등에 따라 그 범위가 전문가의 소견에 따라 다양하게 변경되어 사용될 수 있다.
이하, 실시예를 통하여 본 발명을 더욱 상세히 설명하고자 한다. 이들 실시예는 오로지 본 발명을 예시하기 위한 것으로서, 본 발명의 범위가 이들 실시예에 의해 제한되는 것으로 해석되지는 않는 것은 당업계에서 통상의 지식을 가진 자에게 있어서 자명할 것이다.
실시예 1: 혈액 뇌장벽 투과용 펩타이드의 합성
아미노산 및 합성에 필요한 시약은 GL biochem과 Sigma-Aldirich에서 구입하였다. 펩타이드 합성장치를 이용하여 C 말단으로부터 F-moc 고체상 화학합성방법으로 펩타이드를 합성하였다. 즉, 블로킹 그룹(Blocking group)으로 Fmoc-(9-Fluorenylmethoxycarbonyl)이 결합된 링크 레진(Rink resin) (0.075mmol/g, 100 ~ 200 mesh, 1% DVB crosslinking)을 사용하여 합성하였으며, 합성기에 50mg의 링크 레진을 넣은 뒤 DMF로 레진을 스웰링(swelling) 시킨 후 Fmoc-group의 제거를 위해 20% piperidine/DMF 용액을 사용하였다. C 말단부터 서열대로 0.5M 아미노산 용액(용매: 디메틸포름아마이드, DMF), 1.0M DIPEA(용매: 디메틸포름아마이드&엔메틸피롤리돈, DMF&NMP), 0.5M HBTU(용매: 디메틸포름아마이드, DMF)를 각각 5, 10, 5 당량씩 넣어 질소 기류하에서 1~2시간 동안 반응시켰다. 상기 디프로텍션(deprotection)과 커플링(coupling) 단계가 끝날 때마다 DMF와 이소프로판올(Isopropanol)로 두 번씩 세척하는 과정을 거쳤다. 마지막 아미노산을 커플링(coupling) 시킨 후에도 디프로텍션(deprotection)을 해주어 Fmoc-group을 제거하였다. N 말단의 마지막 아미노산의 F-moc 보호기를 제거한 후, DMF 존재하에 DIPEA(10 당량), HBTU(5 당량), 그리고 palmitic acid(5 당량)를 첨가하여 합성을 진행 하였다. 반응시간은 Kaiser test solution을 사용 하여 음성의 결과가 나올 때까지 반응을 진행 하였으며, 반응 종결후 DMF 및 MeOH로 resin을 세척하고 진공 오븐에 건조 하였다. 트리플루오로아세트산(TFA) 절단 칵테일(cleavage cocktail)을 레진 1g 당 20ml의 비율로 넣어 3시간 혼합(shaking) 시킨 후 필터링을 통해 레진과 펩타이드가 녹아 있는 칵테일을 분리하였다. 필터로 걸러진 용액을 진공증발농축기(rotary evaporator)를 이용하여 제거한 후 콜드 에테르(cold ether)를 넣어주거나 펩타이드가 녹아있는 TFA 칵테일 용액에 직접 콜드 에테르를 과량 넣어주어 펩타이드를 고체상으로 결정화시키고 이를 원심분리하여 분리해 내었다. 이때 에테르로 여러 번 세척과 원심분리 과정을 거쳐 TFA 칵테일을 완전히 제거하였다. 이렇게 해서 얻어진 펩타이드는 증류수에 녹여 동결건조하였다. 동결건조 완료 후, 고성능 액체크로마토그래피(Shimadzu, Japan)에 의해 분리, 정제하였다. 직경 4.6mm의 C18 컬럼을 이용하여 유속 1ml/min으로 0.1% TFA/H2O와 0.092% TFA/아세토나이트릴(acetonitrile)을 0~60%의 변화를 주면서 30분간 흘려주는 방법으로 분석하였으며, 이때 자외선 검출기의 파장은 220nm로 하였다. 정제는 직경 2.2cm의 컬럼을 이용하여 유속 20ml/min으로 용매와 검출파장을 같은 조건으로 실시하였다. 정제된 펩타이드의 분자량을 질량분석법(Mass spectrometry)을 통해 확인하였다.
Alexa Fluor™ 680 NHS Ester(=Cy5.5-NHS ester, Invitrogen, A37567) 1mg과 합성된 펩타이드 2mg을 0.1ml DMF에 녹였다. 0.05ml pyridine을 첨가한 후, 50℃ heat block에 15분간 반응시켰다. Ethyl acetate 0.7ml을 넣어 침전을 형성시킨 후, 10,000rpm에서 2분간 원심분리하였다. 상층액을 제거한 후, Ethyl acetate 0.7ml을 넣어 같은 방법으로 2회 wash 하고, 공기중에서 건조하였다.
실시예 2: 혈액 뇌장벽 투과용 펩타이드와 항체 복합체의 제조
실시예 1의 방법을 이용해서 제조된 혈액 뇌장벽 투과용 펩타이드(서열번호 41)의 N-말단에 링커 CGGGG를 도입시키고, 서열번호 59의 항체를 화학적 방법으로 결합시켰다. 서열번호 59의 1.02mg 항체를 1mL PBS buffer(pH 8.3)에 용해하였다. 2.12mg SPDP(succinimidyl 3-(2-pyridyldithio)propionate, ThermoFisher, 21857)을 120μL DMSO(Dimethyl sulfoxide)에 용해하였다. 여기에 40μL SMCC 용액을 첨가하고, 1시간 동안 차광시켜 반응하는 것을 3회 반복하였다. 반응이 종결되면 PD-10 Desalting Column(GE healthcare)을 사용하여 Desalting을 진행하고, 3.5mL의 pyridyldithiol activated 항체를 수득하였다. 여기에 3차 정제수 300μL에 2.5mg 서열번호 42 용액을 각각 혼합하고, 1M tris buffer(pH=9)를 사용하여 pH 8.3으로 조정하였다. 차광 후 4℃에서 혼합하면서 overnight 반응시켰다. FPLC(Akta Pure, GE healthcare)로 heparin column(HiTrap, GE Healthcare)을 사용하여 혈액 뇌장벽 투과용 펩타이드가 결합된 항체를 정제하였다.
동물세포 발현을 위해 pcDNA3.4-TOPO 벡터에 서열번호 59의 항체의 C term에 서열번호 15 내지 서열번호 18의 혈액 뇌장벽 투과용 펩타이드가 연결된 유전자 서열을 합성하였다.
Figure PCTKR2022014716-appb-img-000005
Figure PCTKR2022014716-appb-img-000006
Figure PCTKR2022014716-appb-img-000007
Figure PCTKR2022014716-appb-img-000008
pcDNA3.1-TOPO 또는 pcDNA3.4-TOPO를 EcoR I과 BamH I으로 절단하여, 900-960 bp의 KRAS mutant scFv 유전자 단편을 아가로스 전기 용출(agarose electro elution) 방법으로 회수하였다. 이를 pcDNA3.1-TOPO 및 pcDNA3.4-TOPO 벡터에 삽입하기 위하여 PCR을 통해 유전자를 증폭시켰으며, 동시에 BamH I과 EcoR I 제한효소 사이트를 합성하였다. 각각의 절단된 벡터와 인서트를 4 μl와 4 μl의 비율로 혼합하였고, Tris-HCl 500 mM, MgCl2 100 mM, DTT 200 mM, ATP 10 mM 조성의 라이게이션 완충 용액에서 T4 DNA 리가아제를 사용하여, 4℃에서 16-18시간 동안 반응시켰다.
제조된 벡터를 중국 햄스터 난소 세포주 Expi-CHO-S에 형질전환시켰다. 중국 햄스터 난소 세포주 ExpiCHO-S는 Thermo Fisher Scientific(USA)에서 제공받았고, ExpiCHO Expression medium(GIBCO, USA) 배지에서 배양하였다. 이후 ExpiCHO-S 세포주(3 X 108 cells)를 250 mL disposable Erlenmeyer flask에 50 mL의 배양액에 깔아주었다. 50 μg의 플라스미드가 들어있는 2 mL의 Opti-MEM에 1.84 mL의 Opti-MEM에 희석한 ExpiFectamine CHO Reagent(Gibco, Cat # A20130) 160 μL를 혼합하여 상온에서 5분간 정지 반응시킨 후, 준비된 중국 햄스터 난소 세포에 골고루 점적하고, 18시간 동안 37℃, 8% CO2 항온기에서 배양한 후, ExpiCHO enhancer 300 μL와 ExpiCHO Feed 12 mL을 추가하여 5일동안 배양하였다. 형질도입(transfection) 이후 6일 후, 배양 배지를 수집하여, 제균 후 FPLC를 사용하여 정제를 하였다. 컬럼은 니켈 크로마토그래피(HisTrapTM excel, GE healthcare)를 사용하여 분리 정제되었으며 [20mM sodium phosphate, 0.5M NaCl, pH 7.4] 조건의 버퍼로 니켈 컬럼을 미리 적셔 균등하게 해준 후 배지를 적용시켰다. 25mM의 이미다졸(imidazole)이 포함되어 있는 위 버퍼를 이용하여 세척을 진행한 후 이미다졸을 125mM로 증가시켜 단백질을 분리하였다. 분리된 단백질을 모아서 desalting을 통해 이미다졸을 제거하여 보관하였다.
도 3은 pcDNA3.4-TOPO에서 발현되어 정제된 혈액 뇌장벽 투과용 펩타이드와 항체의 SDS-PAGE와 western blot 결과이다. 화살표 부분이 발현된 복합체를 나타내는 것이다.
실험예 1: 정상 동물에서 혈액 뇌장벽 투과용 펩타이드와 항체 복합체의 뇌전달 효과 확인
Hairless mouse(SKH-1, female, 6주령, 오리엔트바이오)에 Cy5.5가 표지된 서열번호 17 혈액 뇌장벽 투과용 펩타이드, Cy5.5가 표지된 서열번호 59의 항체, Cy5.5가 표지된 서열번호 17 혈액 뇌장벽 투과용 펩타이드와 서열번호 59 항체의 복합체를 각각 4mg/kg로 정맥주사하고, 각 장기(brain, liver, lung, spleen, kidney, heart)에서 형광을 IVIS(Perkin Elmer)를 사용하여 Excitation: 685 nm, emission: 706 nm에서 측정하였다. 또한, brain만 따로 Optix MX3(ART Advanced Research Technologies Inc.)를 사용하여 3차원 이미지를 측정하였다. 도 4는 혈액 뇌장벽 투과용 펩타이드와 항체의 복합체의 동물에서 brain delivery를 관찰한 결과이다.
도 4(a)에서 볼 수 있듯이, Cy5.5가 표지된 서열번호 17 혈액 뇌장벽 투과용 펩타이드와 Cy5.5가 표지된 서열번호 17 혈액 뇌장벽 투과용 펩타이드 및 서열번호 59 항체 복합체를 주사하였을 경우, brain에서 형광을 관찰할 수 있었다. 그러나, Cy5.5가 표지된 서열번호 59의 항체는 brain에서 형광을 관찰할 수 없었다. 또한 도 4(b)의 3차원 이미지에서 볼 수 있듯이, Cy5.5가 표지된 서열번호 17 혈액 뇌장벽 투과용 펩타이드와 Cy5.5가 표지된 서열번호 17 혈액 뇌장벽 투과용 펩타이드 및 서열번호 59 항체 복합체를 주사하였을 경우, brain 내부까지 투과된 정도가 컸다. 그러나, 서열번호 59의 항체는 뇌의 내부에서 관찰되는 정도가 낮았다.
실험예 2: 정상 동물에서 혈액 뇌장벽 투과용 펩타이드와 항체 복합체의 혈액 및 뇌조직에서 농도 확인
대조 세포 투과성 펩타이드(TAT)와 서열번호 59의 항체를 실시예 2의 발현법과 동일한 방법으로 제조하고, cy5.5를 표지하였다. 실시예 2에서 제조한 N term에 CGGGG가 도입된 서열번호 41의 혈액 뇌장벽 투과용 펩타이드 및 서열번호 59의 항체의 복합체에 Cy5.5를 표지하였다. 서열번호 59의 항체에 Cy5.5를 표지하고, hairless mouse(SKH-1, female, 6주령, 오리엔트바이오)에 각각 10mg/kg로 정맥주사하였다. 24일 까지 brain과 혈액의 농도를 IVIS(Perkin Elmer)를 사용하여 Excitation: 685 nm, emission: 706 nm에서 측정하였고, 그 결과를 도 5에 나타냈다.
항체 단독 투여시, 12일 안에 혈액에서 모두 소실되었다. TAT와 연결된 항체 및 서열번호 41의 혈액 뇌장벽 투과용 펩타이드와 연결된 항체 모두 24일까지 유지되었다. 그러나, 서열번호 41의 혈액 뇌장벽 투과용 펩타이드 및 항체 복합체의 혈중 농도가 더 높았다.
또한, 항체 단독 투여시, 뇌조직에서 형광이 측정되지 않았다. TAT가 연결된 항체는 정맥주사 4일 후, 뇌조직에서 초기 용량의 2.4%의 형광이 측정되었다. 서열번호 41의 혈액 뇌장벽 투과용 펩타이드 및 서열번호 59의 항체 복합체는 정맥주사 4일 후, 뇌조직에서 초기 용량의 약 7%가 측정되었다. 이는 서열번호 41의 혈액 뇌장벽 투과용 펩타이드와 서열번호 59 항체 복합체가 뇌전달 효율이 더 높은 것을 증명하는 결과이다.
실험예 3: 뇌종양 동물모델을 이용한 뇌종양 치료 효과 확인
뇌종양 동물모델을 이용하여, 혈액 뇌장벽 투과용 펩타이드와 항체의 복합체가 뇌에 투과하여 뇌종양을 억제하는 것과 뇌실질에 분포하는 것을 측정하였다. 구체적으로, 10% FBS 및 1% antibiotics가 첨가된 DMEM 배지에서 luciferase를 발현하는 U87MG glioblastoma인 U87MG-Luc 2(ATCC, HTB-14-LUC2™) 세포를 배양하였다. 5 내지 7주령의 누드 마우스(오리엔트 바이오)를 아이소프란으로 마취시키고, stereotaxic instrument 안의 ear bar를 이용하여 고정시켰다. 수술 부위의 두피를 절개한 후, 브레그마(bregma)의 우측 2mm, 아래방향 2mm에 sterile drill을 이용하여 구멍을 만들었다. 이후, 상기 구멍을 통해 1.0×105/10μL U87MG-Luc-2 세포를 26G Hamilton syringe로 주입하였으며(1μl/min), 주입 후 구멍을 bone wax로 막고 봉합하여 두피를 닫았다. 이식된 glioblastoma의 증식은 luciferase의 기질인 D-luciferin potassium(15 mg/mL dissolved in PBS, sigma)을 150 mg/kg으로 쥐에 주사하고, 10분 후에 희생하고, bioluminescence를 IVIS(Perkin Elmer)를 사용하여 측정하고, 도 6에 결과를 나타냈다.
Glioblastoma를 이식한 지 4일 후부터 1 mg/kg의 CGGGG-서열번호 41의 혈액 뇌장벽 투과용 펩타이드와 서열번호 59 항체의 복합체, 1 mg/kg 서열번호 59의 항체를 각각 정맥주사 하였다. 투여간격은 3일마다 총 4회로 16일까지 관찰하였다. 도 6은 뇌종양 동물모델에서 혈액 뇌장벽 투과용 펩타이드와 항체의 복합체가 뇌에 투과하여 뇌종양을 억제하는 것과 뇌실질에 분포하는 것을 관찰한 결과이다. 도 6(a)는 16일째 U87MG-Luc 세포의 bioluminescence를 IVIS 관찰한 사진이다. 도 6(b)는 4, 10, 16일 동안 IVIS 로 U87MG-Luc 세포의 bioluminescence를 측정한 결과이다. 16일 동안 bioluminescence를 관찰한 결과, glioblastoma를 이식하고 치료를 하지 않은 군은 bioluminescence가 계속 증가하였다. 이는 이식한 뇌종양 세포가 많이 생존해 있다는 뜻이다. 항체만 투여했을 때에도 뇌종양 세포가 많이 생존했으나, CGGGG-서열번호 41의 혈액 뇌장벽 투과용 펩타이드와 서열번호 59 항체의 복합체를 주사하였을 때는 뇌종양 세포에 의한 bioluminescence가 감소하였다.
동일한 동물모델에 cy5.5로 표지된 CGGGG-서열번호 41의 혈액 뇌장벽 투과용 펩타이드와 서열번호 59 항체의 복합체를 희생하기 8시간 전에 주사하고, 뇌를 적출하였다. Frozen section한 후, confocal microscopy로 형광의 분포를 관찰하였다. 도 6(c)에서 cy5.5로 표지된 CGGGG-서열번호 41의 혈액 뇌장벽 투과용 펩타이드와 서열번호 59 항체의 복합체는 뇌종양이 발생한 부분에 분포하고 있는 것을 확인하였다.
실시예 3: 혈액 뇌장벽 투과용 펩타이드 및 RNA 결합 펩타이드와 siRNA의 복합체 제조
서열번호 60 및 서열번호 61의 siRNA와 서열번호 62의 RNA 결합 펩타이드 및 서열번호 40의 혈액 뇌장벽 투과용 펩타이드를 일정 비율로 혼합하여 자기조립에 의하여 나노입자를 제조하였다. RNA 결합 펩타이드와 혈액 뇌장벽 투과용 펩타이드를 5μg/μL의 농도로 RNase, DNase Free & PCR certified Water(Tech&Innovation, BWA-8000)에 용해하였다. siRNA를 1μg/μL의 농도로 RNase, DNase Free & PCR certified Water(Tech&Innovation, BWA-8000)에 용해하였다. siRNA 용액과 혈액 뇌장벽 투과용 펩타이드의 혼합 비율은 1:10 내지 1:20으로 siRNA 10μL에 혈액 뇌장벽 투과용 펩타이드 용액을 12μL(1:10)을 2μL씩 나누어 혼합하고, 30분 이상 방치하였다. 서열번호 63-서열번호 40, 서열번호 64-서열번호 40, 서열번호 65-서열번호 40, 서열번호 66-서열번호 40, 서열번호 67-서열번호 40의 혈액 뇌장벽 투과용 펩타이드도 위와 같은 방법으로 서열번호 60 및 서열번호 61의 siRNA와 복합체를 형성하였다.
도 7은 혈액 뇌장벽 투과용 펩타이드와 siRNA의 복합체를 전기영동으로 확인한 결과이다. siRNA 단독은 밑으로 이동하지만, 복합체는 내려오지 않는 것을 확인하였다.
실시예 4: 혈액 뇌장벽 투과용 펩타이드 및 양이온성 펩타이드와 siRNA의 복합체 제조
실시예 4-1: 트랜스페린 수용체 결합 펩타이드를 포함하는 혈액 뇌장벽 투과용 펩타이드 및 KRAS siRNA의 복합체 제조
서열번호 9의 양이온성 펩타이드를 5μg/μL의 농도로 RNase, DNase Free & PCR certified Water(Tech&Innovation, BWA-8000)에 용해하였다. 서열번호 60 및 서열번호 61의 siRNA를 1μg/μL의 농도로 RNase, DNase Free & PCR certified Water(Tech&Innovation, BWA-8000)에 용해하였다. siRNA 용액과 서열번호 9의 펩타이드의 혼합 비율을 1:10으로 하고, siRNA 10μL에 서열번호 9의 펩타이드 용액을 12μL(1:10)을 2μL씩 나누어 혼합하고, 30분 이상 방치하였다.
서열번호 70의 혈액 뇌장벽 투과용 펩타이드를 1μg/μL의 농도로 RNase, DNase Free & PCR certified Water(Tech&Innovation, BWA-8000)에 용해하였다. siRNA와 서열번호 9의 펩타이드 혼합액에 서열번호 70의 혈액 뇌장벽 투과용 펩타이드 용액 12μL를 2μL씩 나누어 혼합하고, 30분 이상 방치하였다. 투과전자현미경(TEM, JEOL, JEM 1010)을 이용하여 형성된 복합체를 확인하였다(도 8(a)).
실시예 4-2: 트랜스페린 수용체 결합 펩타이드를 포함하는 혈액 뇌장벽 투과용 펩타이드 및 Beta catenin siRNA의 복합체 제조
서열번호 64의 RNA 결합 펩타이드를 5μg/μL의 농도로 RNase, DNase Free & PCR certified Water(Tech&Innovation, BWA-8000)에 용해하였다. Beta catenin siRNA(Dhamacon, #J-040628-05)를 1μg/μL의 농도로 RNase, DNase Free & PCR certified Water(Tech&Innovation, BWA-8000)에 용해하였다. siRNA 용액과 RNA 결합 펩타이드의 혼합 비율을 1:10으로 하고, siRNA 10μL에 RNA 결합 펩타이드 용액을 12μL(1:10)을 1μL씩 나누어 혼합하고, 30분 이상 방치하였다.
서열번호 70의 혈액 뇌장벽 투과용 펩타이드를 1μg/μL의 농도로 RNase, DNase Free & PCR certified Water(Tech&Innovation, BWA-8000)에 용해하였다. Beta catenin siRNA와 서열번호 64의 RNA 결합 펩타이드 혼합액에 서열번호 70의 혈액 뇌장벽 투과용 펩타이드 용액 12μL를 1μL씩 나누어 혼합하고, 30분 이상 방치하였다. 투과전자현미경(TEM, JEOL, JEM 1010)을 이용하여 형성된 복합체를 확인하였다(도 8(b)).
실시예 4-3: Beta catenin siRNA 및 LRP 결합 펩타이드를 포함하는 혈액 뇌장벽 투과용 펩타이드의 복합체 제조
서열번호 64의 펩타이드를 5μg/μL의 농도로 RNase, DNase Free & PCR certified Water(Tech&Innovation, BWA-8000)에 용해하였다. 서열번호 60 및 서열번호 61의 siRNA를 1μg/μL의 농도로 RNase, DNase Free & PCR certified Water(Tech&Innovation, BWA-8000)에 용해하였다. siRNA 용액과 펩타이드 전달체의 혼합 비율을 1:10으로 하고, siRNA 10μL에 서열번호 64의 펩타이드 용액을 12μL(1:10)을 1μL씩 나누어 혼합하고, 30분 이상 방치하였다. 서열번호 84의 혈액 뇌장벽 투과용 펩타이드를 1μg/μL의 농도로 RNase, DNase Free & PCR certified Water(Tech&Innovation, BWA-8000)에 용해하였다. siRNA와 서열번호 64의 펩타이드 혼합액에 서열번호 84의 혈액 뇌장벽 투과용 펩타이드 용액 12μL를 2μL씩 나누어 혼합하고, 30분 이상 방치하였다. 투과전자현미경(TEM, JEOL, JEM 1010)을 이용하여 형성된 복합체를 확인하였다(도 8(c)).
도 8은 투과전자현미경으로 혈액 뇌장벽 투과용 펩타이드와 siRNA의 복합체를 확인한 결과로, 각각의 제조된 복합체는 사이즈 100nm의 입자를 형성하는 것을 확인하였다.
실험예 4: in vitro BBB 모델에서 투과능 확인
Alexa Fluor™ 488(Invitrogen)로 표지되어 있는 서열번호 60 및 서열번호 61의 siRNA를 사용하여 실시예 4-1과 동일한 방법으로 혈액 뇌장벽 투과용 펩타이드와의 복합체를 제조하고, in vitro BBB 모델을 사용하여 투과능을 평가하였다. 대조군으로 Lipofectamine™ 2000(Invitrogen)을 제조사의 방법에 따라 Alexa Fluor™ 488(Invitrogen)로 표지되어 있는 서열번호 60 및 서열번호 61의 siRNA와 반응시켰다. upper chamber of culture inserts(corning)에 불멸화된 mouse brain endothelial cells(bEnd.3, CRL-2299, ATCC)을 5×104/well을 시딩하고, 24 웰에 넣었다. Lower chamber에 800 μL Dulbecco's modified Eagle's medium(DMEM)을 넣었다. 배지는 2일마다 교체하였다. Trans-endothelial electrical resistance(TEER) instrument(World Precision Instruments, Inc., Sarasota)를 사용하여 세포층의 치밀성을 모니터하였고, TEER 값이 200 Ω cm2 이상일 때 실험을 하였다. FBS가 포함되지 않은 DMEM으로 배지를 교체하고, Cy5.5로 표지된 서열번호 70의 혈액 뇌장벽 투과용 펩타이드와 서열번호 60 및 서열번호 61의 siRNA의 복합체, Lipofectamine™ 2000과 서열번호 60 및 서열번호 61의 siRNA 복합체를 각각 200nM 농도로 upper chamber에 가하였다. 조립한 트랜스웰을 쉐이킹 인큐베이터에서 37℃, 50 rpm으로 1, 4, 8시간 방치하였다. Lower chamber(basolateral compartment)에서 500 μL를 취하고, 같은 볼륨의 새로운 배지로 다시 채웠다. 실험 종료시에 TEER 값을 다시 확인하였다. 투과된 복합체의 비율(transport ratio,%)은 fluorescence spectrophotometer(Thermo Scientific, USA)를 사용하여 형광감도를 측정하였다. 실시예 4-2와 실시예 4-3도 위와 동일한 방법으로 in vitro BBB 모델에서 투과능을 측정하였다.
도 9는 in vitro BBB 모델에서 투과된 혈액 뇌장벽 투과용 펩타이드와 siRNA 복합체의 투과도 결과이다. 실시예 4-1의 복합체는 시간이 증가할수록 그 투과 정도가 증가하였다(도 9(a)). 또한, 세포에 처리한 지 8시간 후 lipofectamine과 서열번호 60 및 서열번호 61의 siRNA의 복합체 보다 투과 정도가 6배가 높았다. 실시예 4-2와 4-3의 복합체도 4시간까지 측정하였을 때, Lipofectamine™ 보다 투과 정도가 8-10배 높은 것을 알 수 있었다(도 9(b) 및 도 9(c)).
이는 실시예 4의 복합체들이 siRNA를 효과적으로 BBB를 투과시킨다는 것을 의미한다.
실험예 5: 정상 동물에서 혈액 뇌장벽 투과용 펩타이드와 siRNA 복합체의 뇌전달 효과 확인
Alexa Fluor™ 680(Invitrogen)으로 표지되어 있는 서열번호 60 및 서열번호 61의 siRNA를 사용하여 실시예 4-1과 동일한 방법으로 혈액 뇌장벽 투과용 펩타이드와 복합체를 제조하였다.
Hairless mouse(SKH-1, female, 6주령, 오리엔트바이오)에 실시예 4-1의 복합체와 서열번호 60 및 서열번호 61의 siRNA를 각각 150 μg/kg로 정맥주사하고, 5시간 후 brain을 적출하여 형광을 confocal microscopy(Carl Zeiss LSM700)로 관찰하였다.
Alexa Fluor™ 488(Invitrogen)으로 표지되어 있는 beta catenin siRNA를 사용하여 실시예 4-2, 4-3과 동일한 방법으로 혈액 뇌장벽 투과용 펩타이드와 복합체를 제조하였다.
Hairless mouse(SKH-1, female, 6주령, 오리엔트바이오)에 실시예 4-2와 4-3의 복합체와 beta catenin siRNA를 각각 1 mg/kg로 정맥주사하고, 1시간 후 brain을 적출하여 형광을 confocal microscopy(Carl Zeiss LSM700)로 관찰하였다.
도 10은 뇌실질로 투과된 혈액 뇌장벽 투과용 펩타이드와 siRNA 복합체를 관찰한 결과이다. 실시예 4-1의 복합체가 서열번호 60 및 서열번호 61의 siRNA를 효과적으로 뇌의 내부로 전달하는 것을 알 수 있었다(도 10(a)). 또한, 실시예 4-2, 4-3의 복합체도 beta catenin siRNA를 효과적으로 뇌의 내부에 전달하는 것을 알 수 있었다(도 10(b)).
실험예 6: 정상 동물에서 혈액 뇌장벽 투과용 펩타이드와 beta catenin siRNA 복합체에 의한 뇌 조직에서 beta catenin 유전자 억제 확인
뇌조직에 전달된 beta catenin siRNA가 효과적으로 beta catenin mRNA를 효과적으로 감소시키는지 관찰하였다.
8주령의 mouse(C57BL/6, 오리엔트바이오)를 구입하여, 실시예 4-2와 실시예 4-3과 동일한 방법으로 복합체를 제조하고, 2.5mg/kg and 10mg/kg (siRNA 기반) 용량으로 정맥주사하였다. 주사 24시간, 96시간 후, PBS로 20ml씩 3번 perfusion을 실시하여, 뇌조직에서 혈액을 제거하였다. cerebral cortex(대뇌피질), cerebellum(소뇌)와 mid brain(중뇌)를 분리하여, 뇌조직에 있는 beta catenin mRNA를 qRT-PCR(Thermo Fisher - QuantStudio 3)로 측정하였다. PCT 조건 및 사용된 프라이머 서열을 각각 표 2 및 표 3에 나타내었다.
Figure PCTKR2022014716-appb-img-000009
Figure PCTKR2022014716-appb-img-000010
도 11은 각각의 뇌영역에서 beta catenin mRNA를 측정한 결과이다. 실시예 4-2(도 11(a)), 4-3(도 11(b))의 복합체 모두 beta catenin mRNA를 효과적으로 감소시켰다. 주사 후 24시간 보다 96시간 때, beta catenin mRNA이 더 감소하였고, 투여 용량이 증가할수록 beta catenin mRNA 수치가 감소했다. 또한, 뇌의 영역별로 비슷하게 beta catenin mRNA 수치가 감소된 것을 볼 때, 복합체가 각 뇌 영역으로 전달된 것을 확인할 수 있다.
본 발명의 뇌혈관 내피세포 표면 단백질 결합 펩타이드에 세포 투과성 펩타이드가 연결된 혈액 뇌장벽 투과용 펩타이드는 뇌혈관 내피세포의 세포막을 우수한 효율로 통과하며, 상기 혈액 뇌장벽 투과용 펩타이드에 항체, 단백질 또는 치료용 핵산 등의 약물이 결합된 펩타이드-약물 복합체는 약물을 뇌실질로 효과적으로 전달하고, 뇌질환 및 뇌종양의 치료 효과를 극대화할 수 있는 장점이 있다.
이상으로 본 발명 내용의 특정한 부분을 상세히 기술하였는 바, 당업계의 통상의 지식을 가진 자에게 있어서, 이러한 구체적 기술은 단지 바람직한 실시양태일 뿐이며, 이에 의해 본 발명의 범위가 제한되는 것이 아닌 점은 명백할 것이다. 따라서 본 발명의 실질적인 범위는 첨부된 청구항들과 그것들의 등가물에 의하여 정의된다고 할 것이다.
전자파일 첨부하였음.

Claims (25)

  1. 뇌혈관 내피세포 표면 단백질 결합 펩타이드 및 세포 투과성 펩타이드가 연결되어 있는 혈액 뇌장벽(Blood-brain barrier, BBB) 투과용 펩타이드.
  2. 제1항에 있어서, 상기 뇌혈관 내피세포 표면 단백질은 트랜스페린(transferrin) 수용체 또는 저밀도 지단백질 수용체-관련 단백질(LRP) 수용체인 것을 특징으로 하는 혈액 뇌장벽 투과용 펩타이드.
  3. 제2항에 있어서, 상기 트랜스페린 수용체 결합 펩타이드는 서열번호 1 내지 서열번호 4 중 어느 하나의 아미노산 서열로 표시되는 것을 특징으로 하는 혈액 뇌장벽 투과용 펩타이드.
  4. 제2항에 있어서, 상기 저밀도 지단백질 수용체-관련 단백질 수용체 결합 펩타이드는 서열번호 5 또는 서열번호 6의 아미노산 서열로 표시되는 것을 특징으로 하는 혈액 뇌장벽 투과용 펩타이드.
  5. 제1항에 있어서, 상기 세포 투과성 펩타이드는 서열번호 7 내지 서열번호 10 중 어느 하나의 아미노산 서열로 표시되는 것을 특징으로 하는 혈액 뇌장벽 투과용 펩타이드.
  6. 제1항에 있어서, 상기 혈액 뇌장벽 투과용 펩타이드는 서열번호 11 내지 서열번호 58 중 어느 하나의 아미노산 서열로 표시되는 것을 특징으로 하는 혈액 뇌장벽 투과용 펩타이드.
  7. 제1항에 있어서, 상기 뇌혈관 내피세포 표면 단백질 결합 펩타이드 및 세포 투과성 펩타이드는 2개 내지 10개의 아미노산 G 및 1개 내지 5개의 아미노산 S로 구성된 스페이서를 통해 연결된 것을 특징으로 하는 혈액 뇌장벽 투과용 펩타이드.
  8. 제1항 내지 제7항 중 어느 한 항의 혈액 뇌장벽 투과용 펩타이드에 약물이 결합되어 있는 혈액 뇌장벽 투과용 펩타이드-약물 복합체.
  9. 제8항에 있어서, 상기 약물은 항체, 단백질 또는 치료용 핵산인 것을 특징으로 하는 혈액 뇌장벽 투과용 펩타이드-약물 복합체.
  10. 제8항에 있어서, 상기 혈액 뇌장벽 투과용 펩타이드와 약물은 링커에 의해 연결된 것을 특징으로 하는 혈액 뇌장벽 투과용 펩타이드-약물 복합체.
  11. 제10항에 있어서, 상기 약물이 항체인 경우, 상기 링커는 CGGGG인 것을 특징으로 하는 혈액 뇌장벽 투과용 펩타이드-약물 복합체.
  12. 제9항에 있어서, 상기 항체는 서열번호 59의 아미노산 서열로 표시되는 것을 특징으로 하는 혈액 뇌장벽 투과용 펩타이드-약물 복합체.
  13. 제9항에 있어서, 상기 단백질은 뇌-유도 신경영양 인자(BDNF), 신경 성장 인자(NGF), 뉴로트로핀-4/5, 섬유모세포 성장 인자(FGF)-2 및 다른 FGF, 뉴로트로핀(NT)-3, 에리쓰로포이에틴(EPO), 표피 성장 인자(EGF), 형질전환 성장 인자(TGF)-알파, TGF-베타, 혈관 내피 성장 인자(VEGF), 아교세포-유도 신경영양 인자(GDNF), 뉴르투린, 혈소판-유래 성장 인자(PDGF), 헤레굴린, 뉴레굴린, 아르테민, 페르세핀, 인터류킨, 아교 세포주 유도 신경영양 인자(GFR), 과립구-콜로니 자극 인자(CSF), 과립구-대식세포-CSF 및 줄기 세포 인자(SCF)로 구성된 군에서 선택되는 것을 특징으로 하는 혈액 뇌장벽 투과용 펩타이드-약물 복합체.
  14. 제9항에 있어서, 상기 치료용 핵산은 DNA, siRNA, miRNA 및 mRNA로 구성된 군에서 선택되는 것을 특징으로 하는 혈액 뇌장벽 투과용 펩타이드-약물 복합체.
  15. 제14항에 있어서, 상기 siRNA는 서열번호 60 및 서열번호 61로 표시되는 것을 특징으로 하는 혈액 뇌장벽 투과용 펩타이드-약물 복합체.
  16. 제9항에 있어서, 상기 치료용 핵산을 양이온성 펩타이드, 양이온성 고분자 또는 RNA 결합 펩타이드와 반응시켜 1차 콤플렉스를 제조한 다음, 상기 1차 콤플렉스를 음이온성 아미노산 또는 음이온성 고분자; 및 스페이서;가 연결되어 있는 제1항의 혈액 뇌장벽 투과용 펩타이드와 반응시켜 나노입자를 형성하는 것을 특징으로 하는 혈액 뇌장벽 투과용 펩타이드-약물 복합체.
  17. 제16항에 있어서, 상기 양이온성 펩타이드는 서열번호 9의 아미노산 서열로 표시되고, 상기 양이온성 고분자는 폴리-L-라이신(poly-L-lysine), 폴리에틸렌 이민(polyethylene imine) 또는 키토산이며, 상기 RNA 결합 펩타이드는 서열번호 62 내지 서열번호 67 중 어느 하나의 아미노산 서열로 표시되고, 상기 음이온성 아미노산은 글루탐산(glutamic acid) 또는 아스파르트산(aspartic acid)이며, 상기 음이온성 고분자는 헤파린(heparin) 또는 히알루론산(hyaluronic acid)이고, 상기 스페이서는 5개 내지 10개의 글리신(glycine)인 것을 특징으로 하는 혈액 뇌장벽 투과용 펩타이드-약물 복합체.
  18. 제8항의 혈액 뇌장벽 투과용 펩타이드-약물 복합체를 코딩하는 핵산.
  19. 제18항의 핵산이 도입되어 있는 재조합 벡터.
  20. 제18항의 핵산 또는 제19항의 재조합 벡터가 도입되어 있는 재조합 세포.
  21. 다음 단계를 포함하는 제8항의 혈액 뇌장벽 투과용 펩타이드-약물 복합체를 제조하는 방법:
    (a) 제20항의 재조합 세포를 배양하여 제8항의 혈액 뇌장벽 투과용 펩타이드-약물 복합체를 발현시키는 단계; 및
    (b) 상기 발현된 혈액 뇌장벽 투과용 펩타이드-약물 복합체를 회수하는 단계.
  22. 제8항의 혈액 뇌장벽 투과용 펩타이드-약물 복합체를 포함하는 뇌질환 또는 뇌종양 치료 또는 예방용 약학 조성물.
  23. 제22항에 있어서, 상기 뇌질환은 뇌염, 파킨슨병, 간질, 헌팅턴병, 알츠하이머 치매, 루게릭병, 픽크병, 간질, 크로이츠펠트 야콥병, 진행성 핵상마비, 척수소뇌 변성증, 소뇌 위축증, 다발성경화증, 신경세포의 소실에 의해 발생하는 노인성 치매, 뇌졸중, 기억상실증, 우울증 및 외상 후 스트레스 장애로 구성된 군에서 선택되는 것을 특징으로 하는 약학 조성물.
  24. 제22항에 있어서, 상기 뇌종양은 신경아교종, 다형성 교모세포종, 수막종, 성상세포종, 청신경종, 연골종, 희소돌기아교세포종, 수모세포종, 신경절 신경아교종, 신경초종, 신경섬유종, 신경모세포종 및 경막외, 골수내 또는 경막내 종양으로 구성된 군에서 선택되는 것을 특징으로 하는 약학 조성물.
  25. 제22항에 있어서, 상기 혈액 뇌장벽 투과용 펩타이드-약물 복합체의 1회 투여량은 1μg/kg 내지 100㎎/㎏인 것을 특징으로 하는 약학 조성물.
PCT/KR2022/014716 2021-10-01 2022-09-30 혈액 뇌장벽 투과용 펩타이드 및 이의 용도 WO2023055155A1 (ko)

Priority Applications (3)

Application Number Priority Date Filing Date Title
EP22876927.9A EP4410821A1 (en) 2021-10-01 2022-09-30 Peptide for penetrating blood-brain barrier and use thereof
CN202280076796.1A CN118556069A (zh) 2021-10-01 2022-09-30 用于穿透血脑屏障的肽及其用途
JP2024519855A JP2024536278A (ja) 2021-10-01 2022-09-30 血液脳関門透過用ペプチド及びこの用途

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR20210130554 2021-10-01
KR10-2021-0130554 2021-10-01

Publications (1)

Publication Number Publication Date
WO2023055155A1 true WO2023055155A1 (ko) 2023-04-06

Family

ID=85783255

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2022/014716 WO2023055155A1 (ko) 2021-10-01 2022-09-30 혈액 뇌장벽 투과용 펩타이드 및 이의 용도

Country Status (5)

Country Link
EP (1) EP4410821A1 (ko)
JP (1) JP2024536278A (ko)
KR (1) KR20230048240A (ko)
CN (1) CN118556069A (ko)
WO (1) WO2023055155A1 (ko)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN116808231A (zh) * 2023-07-07 2023-09-29 中国药科大学 一种细胞穿膜肽偶联舒必利前药体系以及制备方法和应用

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20170041289A (ko) * 2012-08-29 2017-04-14 에프. 호프만-라 로슈 아게 혈액 뇌 장벽 셔틀
KR20200026121A (ko) * 2018-08-31 2020-03-10 주식회사 나이벡 염증 및 대사성 질환의 바이오마커에 대한 결합능이 있는 신규한 펩타이드 및 이의 용도
WO2020124032A1 (en) * 2018-12-14 2020-06-18 Fred Hutchinson Cancer Research Center Transferrin receptor targeting peptides

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20170041289A (ko) * 2012-08-29 2017-04-14 에프. 호프만-라 로슈 아게 혈액 뇌 장벽 셔틀
KR20200026121A (ko) * 2018-08-31 2020-03-10 주식회사 나이벡 염증 및 대사성 질환의 바이오마커에 대한 결합능이 있는 신규한 펩타이드 및 이의 용도
WO2020124032A1 (en) * 2018-12-14 2020-06-18 Fred Hutchinson Cancer Research Center Transferrin receptor targeting peptides

Non-Patent Citations (6)

* Cited by examiner, † Cited by third party
Title
"Remington's Pharmaceutical Science", MACK PUBLISHING COMPANY
FELGENHAUER, KLIN. WSCHR, vol. 52, 1974, pages 1158 - 1164
HERZ J. ET AL., EMBO JOURNAL, vol. 20, 1988, pages 4119 - 27
LI YUTAO, AN CHIYING, HAN DANAN, DANG YANXIN, LIU XIN, ZHANG FENGMING, XU YUAN, ZHONG HAIJING, SUN XIAOJUN: "Neutrophil affinity for PGP and HAIYPRH (T7) peptide dual-ligand functionalized nanoformulation enhances the brain delivery of tanshinone IIA and exerts neuroprotective effects against ischemic stroke by inhibiting proinflammatory signaling pathways", NEW JOURNAL OF CHEMISTRY, vol. 42, no. 23, 19 November 2018 (2018-11-19), GB , pages 19043 - 19061, XP093053330, ISSN: 1144-0546, DOI: 10.1039/C8NJ04819C *
QIAN Z. ET AL., NATURE, vol. 361, 1993, pages 453 - 457
SEVERINE ANDRE, LARBANOIX LIONEL, VERTENEUIL SEBASTIEN, STANICKI DIMITRI, NONCLERCQ DENIS, VANDER ELST LUCE, LAURENT SOPHIE, MULLE: "Development of an LDL Receptor-Targeted Peptide Susceptible to Facilitate the Brain Access of Diagnostic or Therapeutic Agents", BIOLOGY, vol. 9, no. 7, 11 July 2020 (2020-07-11), CH , pages 161, XP055768184, ISSN: 2079-7737, DOI: 10.3390/biology9070161 *

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN116808231A (zh) * 2023-07-07 2023-09-29 中国药科大学 一种细胞穿膜肽偶联舒必利前药体系以及制备方法和应用
CN116808231B (zh) * 2023-07-07 2024-03-26 中国药科大学 一种细胞穿膜肽偶联舒必利前药体系以及制备方法和应用

Also Published As

Publication number Publication date
JP2024536278A (ja) 2024-10-04
EP4410821A1 (en) 2024-08-07
KR20230048240A (ko) 2023-04-11
CN118556069A (zh) 2024-08-27

Similar Documents

Publication Publication Date Title
AU2016346864B2 (en) Long-acting FGF21 fusion proteins and pharmaceutical composition comprising same
WO2017034330A1 (en) Cell-permeable bone morphogenetic protein (cp-bmp) recombinant protein and use thereof
WO2016028036A1 (en) Advanced macromolecule transduction domain (amtd) sequences for improvement of cell-permeability, polynucleotides encoding the same, method to identify the unique features of amtds comprising the same, method to develop the amtd sequences comprising the same
WO2023055155A1 (ko) 혈액 뇌장벽 투과용 펩타이드 및 이의 용도
WO2014035179A1 (ko) 미토콘드리아 타겟팅 펩타이드
WO2019107812A1 (ko) 세포의 세포질에 침투하여 세포내 활성화된 ras를 억제하는 항체 및 이의 용도
WO2017026779A1 (en) Improved cell-permeable cre (icp-cre) recombinant protein and use thereof
WO2013077680A1 (ko) 세포 투과능을 개선한 개량형 신규 거대 분자 전달 도메인 개발 및 이의 이용방법
WO2015005723A1 (ko) 세포 투과성 펩티드 및 이를 포함하는 컨쥬게이트
WO2017030323A1 (en) Cell-permeable (cp)-δsocs3 recombinant protein and uses thereof
WO2020050626A1 (ko) O-글리코실화 가능한 폴리펩타이드 영역을 포함하는 융합 폴리펩타이드
WO2023214833A1 (ko) Glp-1, 면역글로불린 fc, 및 igf-1을 포함하는 융합단백질 및 이의 용도
WO2022235140A1 (ko) 단일사슬항체조각 및 페리틴의 융합단백질을 포함하는 나노입자 및 이의 용도
WO2022164288A1 (ko) 비염증성 식세포작용 유도 활성을 갖는 융합분자
WO2019132579A2 (ko) 세포질 침투 항체에 융합된 rna 분해효소를 포함하는 면역독소
WO2022010273A1 (ko) 보체 경로 억제제를 포함하는 융합단백질 및 이의 용도
WO2022035262A1 (ko) 세포내 종양 유발 단백질을 타겟하는 항체 또는 이의 단일가닥 가변 단편과 암세포 투과성 펩타이드의 융합 단백질 및 이의 용도
WO2018021778A1 (ko) Lrg1 당단백질을 포함하는 융합 단백질을 함유하는 발기부전, 허혈성 질환 또는 말초 신경질환의 예방 또는 치료용 조성물
WO2014010985A1 (ko) 세포내 단백질의 고효율 도입 및 유지용 펩타이드
WO2017026776A1 (en) Improved cell-permeable reprogramming factor (icp-rf) recombinant protein and use thereof
WO2023017976A1 (ko) 양이온성 세포 투과성 펩타이드 및 이의 용도
WO2022050781A1 (en) Development of cell-permeable truncated socs3 sh2 domain (cp-sd) recombinant protein for anti-obesity agent
WO2023277575A1 (ko) 신규한 세포 투과성 펩타이드 및 이의 용도
WO2023191209A1 (ko) 친수성 펩타이드를 포함하는 마이셀 및 이의 용도
WO2023177261A1 (ko) 세포 투과성이 향상된 신규 세포 투과성 펩타이드 및 이의 용도

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22876927

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2024519855

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2022876927

Country of ref document: EP

Effective date: 20240502