WO2023191209A1 - 친수성 펩타이드를 포함하는 마이셀 및 이의 용도 - Google Patents

친수성 펩타이드를 포함하는 마이셀 및 이의 용도 Download PDF

Info

Publication number
WO2023191209A1
WO2023191209A1 PCT/KR2022/015283 KR2022015283W WO2023191209A1 WO 2023191209 A1 WO2023191209 A1 WO 2023191209A1 KR 2022015283 W KR2022015283 W KR 2022015283W WO 2023191209 A1 WO2023191209 A1 WO 2023191209A1
Authority
WO
WIPO (PCT)
Prior art keywords
cpt
gsh
gst
micelles
egfr
Prior art date
Application number
PCT/KR2022/015283
Other languages
English (en)
French (fr)
Inventor
김채규
유자형
진성언
Original Assignee
주식회사 퓨전바이오텍
울산과학기술원
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 주식회사 퓨전바이오텍, 울산과학기술원 filed Critical 주식회사 퓨전바이오텍
Publication of WO2023191209A1 publication Critical patent/WO2023191209A1/ko

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/69—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the conjugate being characterised by physical or galenical forms, e.g. emulsion, particle, inclusion complex, stent or kit
    • A61K47/6905—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the conjugate being characterised by physical or galenical forms, e.g. emulsion, particle, inclusion complex, stent or kit the form being a colloid or an emulsion
    • A61K47/6907—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the conjugate being characterised by physical or galenical forms, e.g. emulsion, particle, inclusion complex, stent or kit the form being a colloid or an emulsion the form being a microemulsion, nanoemulsion or micelle
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/69—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the conjugate being characterised by physical or galenical forms, e.g. emulsion, particle, inclusion complex, stent or kit
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents

Definitions

  • chemotherapy uses poorly soluble drugs such as irinotecan, topotecan, doxorubicin, cisplatin, taxol, and 5-fluorouracil. Therapeutics are widely used.
  • poorly soluble drugs contain hydrophobic regions in the structure of the compound, so their practicality is often limited because they do not dissolve well in water.
  • more than 41% of drugs being developed as new drugs are abandoned due to poor solubility, and more than one-third of drugs listed in the US Pharmacopeia are classified as poorly soluble drugs.
  • Anticancer drugs act not only on cancer cells but also on normal cells, preventing them from inducing selective death of cancer cells. As a result, the growth of normal cells is suppressed or necrosis is induced, causing the patient to feel severe pain.
  • cremorphor EL is a mixture of polyoxyethylated castor oil and absolute ethanol.
  • Cremorphor EL is a mixture of polyoxyethylated castor oil and absolute ethanol.
  • the present inventors linked glutathione (GSH), a hydrophilic peptide, to a hydrophobic anticancer agent by a linker to make the entire precursor drug have amphiphilic properties and form an interface.
  • GSH glutathione
  • the present invention was completed by manufacturing nanoparticle micelles in an aqueous solution without using an activator and confirming that the solubility of existing anticancer drugs can be dramatically improved.
  • One aspect is to provide micelles containing a hydrophilic peptide, a drug, and a linker represented by the following formula (1) connecting the hydrophilic peptide and the drug:
  • Another aspect is to provide a pharmaceutical composition for preventing or treating cancer containing the micelles as an active ingredient.
  • Another aspect is to provide a method for preventing or treating cancer, which includes administering to a subject a composition containing the micelles as an active ingredient.
  • Another aspect is to provide the micelles for use in the manufacture of therapeutic agents for use in the prevention or treatment of cancer.
  • One aspect provides a micelle comprising a hydrophilic peptide, a drug, and a linker represented by the following formula (1) connecting the hydrophilic peptide and the drug:
  • R 1 may be O, N, or S, and x may be 1 to 6.
  • peptide is used in its usual sense in the art, and refers to a polymer in which a plurality of amino acids are linked by a peptide bond and a compound that is its modifier.
  • hydrophilicity refers to the degree of affinity of a substance with water. Hydrophilic substances have a strong affinity for water and tend to dissolve or mix in water. Accordingly, the “hydrophilic peptide” refers to a peptide that has a strong affinity for water.
  • the hydrophilic peptide may be composed of 2 to 10 amino acids. For example, it may be composed of 3 to 9 or 3 to 5 amino acids.
  • the hydrophilic peptide may include one or more peptides selected from the group consisting of the amino acid sequences of SEQ ID NOs: 1 to 31, but is not limited thereto.
  • the micelles include glutathione-S-transferase (GST); And it may be surface-modified with a fusion protein containing a protein having the ability to bind to target cells or target proteins.
  • GST glutathione-S-transferase
  • a fusion protein containing glutathione-S-transferase and a protein having the ability to bind to a target cell or target protein may be bound to the hydrophilic peptide.
  • the micelles surface-modified with the fusion protein may be a mixture of hydrophilic peptide and fusion protein at a ratio of at least 10:1.
  • 10 to 10,0000:1 for example from 15 to 10,0000:1, from 20 to 10,0000:1, from 30 to 10,0000:1, from 40 to 10,0000:1, from 50 to 50.
  • the fusion protein may further include a linker connecting glutathione-S-transferase and a protein having the ability to bind to a target cell or target protein.
  • protein with target cell or target protein binding ability refers to a protein that specifically binds to a cell's receptor or target protein. It may refer to a protein that recognizes an enemy or binds specifically to a cell receptor or target protein.
  • the protein that specifically binds to the cell receptor or target protein is any one selected from the group consisting of antibodies, antigen-binding fragments, affibodies, diabodies, and aptamers. It may be.
  • the term “affibody molecule” may refer to an antibody mimetic that can bind to a specific target protein (receptor).
  • an affibody molecule consists of 20 to 150 amino acid residues and may be composed of 2 to 10 alpha helices. More specifically, the affibody molecule may include an anti-ErbB affibody molecule (ab31889), a HER2-specific affibody molecule (ZHER2:342), an anti-EFFR affibody molecule (ZEGFR:2377), etc.
  • it is not limited thereto, and includes all affibody molecules capable of recognizing specific receptors or target proteins in cells.
  • target receptors or target proteins examples include amyloid beta peptide, synuclein (e.g., alpha-synuclein), apolipoprotein (e.g., apolipoprotein A1), and complement.
  • Complement factor e.g. C5
  • carbonic anhydrase e.g. CAIX
  • IL2RA interleukin-2 receptor alpha chain
  • cell surface CD antigen e.g.
  • the protein having the ability to bind to the target cell or target protein may specifically bind to receptor tyrosine kinases (RTKs). More specifically, the receptor tyrosine kinases include epidermal growth factor receptor (EGFR), insulin receptor, platelet-derived growth factor receptor, vascular endothelial growth factor receptor, fibroblast growth factor receptor, and cholecystokinin (CCK) receptor. , Neurotrophic factor (NGF) receptor, Hepatocyte growth factor (HGF) receptor, Ephrin (Eph) receptor, angiopoietin receptor, and RYK (related to receptor tyrosine kinase) receptor. It may be any one selected from the group.
  • EGFR epidermal growth factor receptor
  • insulin receptor insulin receptor
  • platelet-derived growth factor receptor vascular endothelial growth factor receptor
  • fibroblast growth factor receptor cholecystokinin
  • CCK cholecystokinin
  • NGF Neurotrophic factor
  • the protein having the ability to bind to the target cell or target protein may be an antibody, antigen-binding fragment, affibody, diabody, or aptamer that specifically binds to a receptor tyrosine kinase.
  • the GST and a protein having the ability to bind to a target cell or target protein may be connected through a linker.
  • the linker may be a polypeptide consisting of 1 to 400 amino acids, 1 to 200 amino acids, or 2 to 200 amino acids.
  • the peptide linker may include Gly, Asn, and Ser residues, and may also include neutral amino acids such as Thr and Ala. Suitable amino acid sequences for peptide linkers are known in the art. Copy number “n” can also be adjusted to achieve appropriate separation between functional moieties or to take into account optimization of the linker to maintain essential inter-moiety interactions.
  • the linker may be a flexible linker containing G, S, and/or T residues.
  • linkers include (GGGGS) n (SEQ ID NO: 32), (SGGGG) n (SEQ ID NO: 33), (SRSSG) n (SEQ ID NO: 34), (SGSSC) n (SEQ ID NO: 35), (GKSSGSGSESKS) n (SEQ ID NO: 36), (RPPPPC) n (SEQ ID NO: 37), (SSPPPPC) n (SEQ ID NO: 38), (GSTSGSGKSSEGKG) n (SEQ ID NO: 39), (GSTSGSGKSSEGSGSTKG) n (SEQ ID NO: 40), (GSTSGSGKPGSGEGSTKG) n (SEQ ID NO: 41), or (EGKSSGSGSESKEF) n (SEQ ID NO: 42), where n may be an integer of 1 to 20, or 1 to 10.
  • the drug may be selected from the group consisting of anticancer agents, therapeutic antibodies, antibiotics, antibacterial agents, antiviral agents, anti-inflammatory agents, contrast agents, protein drugs, growth factors, cytokines, peptide drugs, hair growth agents, anesthetics, and combinations thereof. It is not limited to this.
  • the drug may be an anticancer agent
  • the anticancer agent may be a hydrophobic anticancer agent
  • the anticancer drugs include docetaxel, camptothecin, paclitaxel, floxuridine, leuprolide, zoledronate, doxorubicin, and cisplatin. , verapamil, fluorouracil, oxaliplatin, daunorubicin, carboplatin, methotrexalte, vincristine, gemcitabine , streptozocin, topotecan, irinotecan, vinorelbine, hydroxyurea, valrubicin, doxifluridine, vinblastine ( vinblastin, prednisone, testosterone, mitoxantrone, salicylates, dexamethasone, prednisolone, cortisone, nutlin derivatives, SN -38 (7-ethyl-10hydroxycamptothecin), belotecan, exatecan, lurtotecan, rubitecan, 9-amino Selected from the group consisting of 9-a
  • the cancer may be lung cancer, pancreatic cancer, stomach cancer, liver cancer, colon cancer, brain cancer, breast cancer, thyroid cancer, bladder cancer, esophageal cancer, prostate cancer, or uterine cancer, but is not limited thereto.
  • the term “micelle” refers to an aggregate of amphipathic molecules having an inner core and an outer surface in an aqueous medium, wherein most of the amphiphilic molecules have their hydrophobic portion forming the core and the hydrophilic portion forming the core. It is oriented to form an outer surface.
  • the micelle according to the present invention is oriented so that the drug forms the hydrophobic part to form the core, and the hydrophilic peptide forms the hydrophilic part to form the outer surface.
  • the micelles can be prepared in an aqueous solution without using a surfactant.
  • the micelle is prepared by (a) binding a linker represented by the following formula (1) to a drug, (b) binding a hydrophilic peptide to the other end of the linker bound to the drug to form a drug-linker-hydrophilic structure. It can be prepared through the steps of forming a peptide complex, and (c) dissolving the drug-linker-hydrophilic peptide complex in an organic solvent to prepare micelles:
  • R 1 may be O, N, or S, and x may be 1 to 6.
  • hydrophilic peptide and drug are as described above.
  • the linker and the anticancer agent in step (a), can be combined by reacting for 5 to 20 hours, for example, 10 to 20 hours, 15 to 20 hours, 15 to 19 hours, or 15 to 18 hours. there is.
  • the reaction can be performed at room temperature, and those skilled in the art can appropriately change the reaction time depending on the temperature.
  • the bases used in step (a) are NaH, lithium diisopropylamide (LDA), 4-dimethylaminopyridine (DMAP), triethylamine (TEA), pyridine, ammonia, Methylamine, ethylamine, propylamine, isopropylamine, dimethylamine, diethylamine, dipropylamine, diisopropylamine, trimethylamine, tripropylamine, triisopropylamine, aniline, methylaniline, dimethylaniline, pyridine , azazulolidine, benzylamine, methylbenzylamine, dimethylbenzylamine, 2,6-lutidine, morpholine, piperidine, piperazine, proton-sponge, ammonium hydroxide, triethanolamine, ethanolamine, or trizylamine. may, but is not limited to this.
  • the solvents used in step (a) include dimethylacetamide (DMAc), dichloromethane (DCM), tetrahydrofuran (THF), dimethylformamide (DMF), and acetonitrile: ACN), DMAP, water, acetic acid, acetone, dioxane, benzene, 1-butanol, 2-butanol, tert-butyl alcohol, carbon tetrachloride, chloroform, cyclohexane, hexane, diethyl ether, dimethyl sulfoxide (DMSO) ), ethanol, ethyl acetate, ethylene glycol, glycerin, heptane, pentane, pyridine, toluene, hydrochloric acid, and triethyl amine, but is not limited thereto.
  • DMAc dimethylacetamide
  • DCM dichloromethane
  • THF tetrahydrofuran
  • DMF
  • step (b) the linker bound to the anticancer agent and the hydrophilic peptide are reacted for 10 to 36 hours, for example, 10 to 36 hours, 15 to 36 hours, or 20 to 26 hours to form the other side of the linker bound to the anticancer agent.
  • a hydrophilic peptide can be bound to the end.
  • the reaction can be performed at room temperature, and those skilled in the art can appropriately change the reaction time depending on the temperature.
  • the solvent used in step (b) is water, chloroform, methylene chloride, carbon tetrachloride, 1,2-dichloroethane, dichloroethylene, trichloroethylene, perchloroethylene, dichloropropane, amyl chloride, 1,2-dichloroethylene, Bromoethane, acetone, methyl isobutyl ketone, cyclohexanone, benzene, toluene, xylene, N,N-dimethylformamide, N,N-dibutylformamide, N,N-dimethylacetamide, N-methylp.
  • Tris-buffered saline Lolidone, methanol, ethanol, propanol, butanol, phosphate-buffered saline (PBS), simulated body fluid (SBF), borate-buffered saline (BBS), or Tris-buffered saline. It may be, but is not limited to, physiological saline (tris-buffered saline: TBS).
  • step (c) is performed by dissolving the drug-linker-hydrophilic peptide complex in an organic solvent and then dissolving it at 10°C to 30°C, for example, 15°C to 30°C, 15°C to 25°C, or at room temperature.
  • the micelles may be produced by artificial dialysis.
  • the artificial dialysis may be performed for 1 to 5 days, for example, 1 to 4 days or 2 to 3 days.
  • the organic solvent used in step (c) may be fluorinated alcohol, dimethylformamide, dimethyl sulfoxide, chlorinated hydrocarbon, hydrocarbon, and alkyl alcohol, but is not limited thereto.
  • the size of the micelles may be 50 nm to 200 nm.
  • it may be 50 nm to 200 nm, 50 nm to 150 nm, or 50 nm to 100 nm.
  • the zeta potential of the micelle may be -2 mV to -40 mV.
  • it may be -2 mV to -30 mV, -2 mV to -20 mV, -2mV to -10mV, and -3mV to -10 mV.
  • Another aspect provides a pharmaceutical composition for preventing or treating cancer containing the micelles as an active ingredient.
  • the pharmaceutical composition for preventing or treating cancer may additionally contain a pharmaceutically effective amount of a bioactive ingredient or may contain one or more pharmaceutically acceptable carriers, excipients, or diluents.
  • the pharmaceutically effective amount refers to an amount sufficient to exhibit the desired physiological or pharmacological activity when the bioactive ingredient is administered to animals or humans.
  • the pharmaceutically effective amount may vary appropriately depending on the age, weight, health status, gender, administration route, and treatment period of the administration subject.
  • the "biologically active ingredient” is a substance that can induce a desired biological or pharmacological effect by promoting or suppressing physiological functions in the body of animals or humans, and is a chemical or biological substance or compound suitable for administration to animals or humans. It means (1) has a preventive effect on organic matter by preventing unwanted biological effects, such as preventing infection, and (2) alleviates conditions caused by disease, for example, alleviating pain or infection as a result of disease. , (3) can play a role in alleviating, reducing or completely eliminating disease from organic matter. Additionally, “the bioactive ingredient” may also be used interchangeably with the term “therapeutic agent.”
  • the bioactive ingredient may be selected from the group consisting of proteins, anticancer agents, anti-inflammatory painkillers, antibiotics, antibacterial agents, hormones, genes, and vaccines, but is not limited thereto.
  • the term "pharmaceutically acceptable” means that it is physiologically acceptable and does not usually cause gastrointestinal disorders, allergic reactions such as dizziness, or similar reactions when administered to humans.
  • the carriers, excipients and diluents include lactose, dextrose, sucrose, sorbitol, mannitol, xylitol, erythritol, maltitol, starch, gum acacia, alginate, gelatin, calcium phosphate, calcium silicate, cellulose, methyl cellulose, Examples include polyvinylpyrrolidone, water, methylhydroxybenzoate, propylhydroxybenzoate, talc, magnesium stearate, and mineral oil.
  • fillers, anti-coagulants, lubricants, wetting agents, fragrances, emulsifiers and preservatives may be additionally included.
  • the pharmaceutical composition may be formulated using diluents or excipients such as fillers, extenders, binders, wetting agents, disintegrants, and surfactants by methods known in the art, and such formulations may be oral or parenteral administration formulations.
  • diluents or excipients such as fillers, extenders, binders, wetting agents, disintegrants, and surfactants by methods known in the art, and such formulations may be oral or parenteral administration formulations.
  • the oral dosage form may be granules, powder, solution, tablet, capsule, dry syrup, or a combination thereof, and the parenteral dosage form may be an injection, but is not limited thereto.
  • the administration may be performed by methods known in the art. Administration may be administered directly to the subject by any means, such as, for example, intravenous, intramuscular, oral, transdermal, mucosal, intranasal, intratracheal or subcutaneous administration. You can. The administration may be administered systemically or locally.
  • the subject may include, but is not limited to, mammals, such as humans, cattle, horses, pigs, dogs, sheep, goats, or cats.
  • the subject may be an individual in need of an improvement in a condition related to cancer.
  • the therapeutically effective dosage of the pharmaceutical composition is 0.01 to 1000 mg per kg of body weight per day, for example, 0.1 to 500 mg or 0.1 to 300 mg, and can be administered in one to several divided doses.
  • the therapeutically effective dosage or therapeutically effective amount may vary depending on the formulation method, administration method, administration time, and/or administration route of the pharmaceutical composition.
  • the type and degree of reaction to be achieved by administration of the composition, type of subject to be administered, age, weight, general health condition, symptoms or degree of disease, gender, diet, excretion, simultaneous or different effects on the subject It may vary depending on various factors including drugs and other composition components used together, and similar factors well known in the pharmaceutical field, and a person skilled in the art can easily determine the effective dosage for the desired treatment. and can be prescribed.
  • Another aspect provides a method for preventing or treating cancer, comprising administering to a subject a composition containing the micelles as an active ingredient.
  • Another aspect is to provide the micelles for use in the manufacture of therapeutic agents for use in the prevention or treatment of cancer.
  • the solubility of existing drugs is improved without the use of additives such as surfactants, and the drugs can be usefully used to prevent, improve, or treat diseases.
  • the micelles when using the micelles, there is an effect of improving drug-induced side effects by improving the selectivity of the drug for cells or tissues that require drug treatment.
  • Figure 1 is a schematic diagram of a method for producing the CPT-GSH@GST-EGFR.
  • Figure 2 is a schematic diagram of GSH-CPT micelles.
  • Figure 3 is a graph and TEM image showing the DLS results of GSH-CPT micelles:
  • Figure 3a is a graph showing the DLS results of GSH-CPT micelles; and Figure 3b is a TEM image of GSH-CPT micelles.
  • Figure 4 is an image showing the zeta potential of GSH-CPT micelles, GST-EGFR, and micelles whose surfaces were modified with GST-EGFR.
  • Figure 5 is a graph showing steady state fluorescence excitation spectra at various concentrations of GSH-CPT.
  • Figure 6 is a graph showing the results of examining the critical aggregation concentration (CAC) by comparing the I 344 /I 339 intensity values at each concentration of GSH-CPT.
  • CAC critical aggregation concentration
  • Figure 7 is a graph showing the DLS results of GSH-CPT micelles over time.
  • Figure 8 is a TEM image of GSH-CPT micelles after 30 days.
  • Figure 9 is a graph showing the binding affinity between CPT-GSH and GST-EGFR.
  • Figure 10 is a DLS graph measuring the size of micelles whose surface containing CPT-GSH was modified by varying the concentration of GST-EGFR.
  • Figure 11 is a DLS graph measuring the size of micelles in CPT-GSH@GST-EGFR when the concentration of CPT-GSH is 15 ⁇ M or 150 ⁇ M.
  • Figure 12 is a graph showing the FRET intensity of CPT-GSH micelles and CPT-GSH@GST-EGFR.
  • Figure 13 is a graph showing the cytotoxicity of CPT, CPT-GSH, and CPT-GSH@GST-EGFR against MDA-MB-231 cells and NIH-3T3 cells.
  • Figure 14 is an image measuring cellular internalization of CPT-GSH@GST-EGFR in MDA-MB-231 cells, NIH-3T3 cells, and 55% serum.
  • Figure 15 is an image measuring IR780 intensity in mice administered CPT-GSH, CPT-GSH@GST, and CPT-GSH@GST-EGFR.
  • Figure 16 is an image and graph confirming the tumor growth inhibition effect after administering CPT, CPT-GSH, and CPT-GSH@GST-EGFR to the MDA-MB-231 mouse model:
  • Figure 16a is an image showing the change in tumor size according to the administration of CPT, CPT-GSH, and CPT-GSH@GST-EGFR
  • Figure 16b is an image showing the change in tumor size according to the administration of CPT, CPT-GSH, and CPT-GSH@GST-EGFR. It is a graph showing the change in volume and weight over time
  • Figure 16c is an H&E stained image of tumor cells administered with CPT, CPT-GSH and CPT-GSH@GST-EGFR
  • Figure 16d is an image of CPT, CPT- This is a TUNEL analysis image observing the degree of apoptosis in tumor cells following administration of GSH and CPT-GSH@GST-EGFR.
  • Camptothecin (CPT, 200 mg, 0.574 mmol) was reacted with 4-nitrophenyl (2-(pyridinyl-2) represented by the following formula (2) in the presence of DMAP (294.5 mg, 2.41 mmol)/DCM solution at room temperature for 16 hours.
  • CPT-PDS was prepared after reaction with 4-nitrophenyl (2-(pyridinly-2-disulfanyl)ethyl) carbonate: PDS_NO 2 ) (329.7 mg, 0.9 mmol).
  • the CPT-PDS was separated and purified through silica column chromatography.
  • the CPT-PDS (10 mg, 0.0178 mmol) was reacted with GSH (5.47 mg, 0.0178 mmol) in the presence of pH 7.4 PBS solution for 24 hours at room temperature. After filtering the precipitate, GSH-CPT was separated through silica column chromatography.
  • SN38-PDS was prepared after reacting SN38 (200 mg, 0.52 mmol) with PDS_NO 2 (329.7 mg, 0.9 mmol) in the presence of DMAP (294.5 mg, 2.41 mmol)/DCM solution for 16 hours at room temperature.
  • the SN38-PDS was separated through silica column chromatography.
  • the SN38-PDS (10 mg, 0.0162 mmol) was reacted with GSH (5.32 mg, 0.0177 mmol) in the presence of pH 7.4 PBS solution for 24 hours at room temperature. After filtering the precipitate, GSH-SN38 was isolated through silica column chromatography.
  • IRINO-PDS Irinotecan (IRINO, 200 mg, 0.48 mmol) was reacted with PDS_NO 2 (329.7 mg, 0.9 mmol) in the presence of DMAP (294.5 mg, 2.41 mmol)/DCM solution for 16 hours at room temperature to prepare IRINO-PDS. .
  • the IRINO-PDS was separated through silica column chromatography.
  • the IRINO-PDS (10 mg, 0.0162 mmol) was reacted with GSH (5.32 mg, 0.0177 mmol) in the presence of pH 7.4 PBS solution for 24 hours at room temperature. After filtering the precipitate, GSH-IRINO was separated through silica column chromatography.
  • Topotecan 200 mg, 0.52 mmol was reacted with PDS_NO 2 (329.7 mg, 0.9 mmol) in the presence of DMAP (294.5 mg, 2.41 mmol)/DCM solution at room temperature for 16 hours to prepare TOPOT-PDS. did.
  • the TOPOT-PDS was separated through a silica column chromatography process.
  • the TOPOT-PDS (10 mg, 0.0175 mmol) was reacted with GSH (5.43 mg, 0.019 mmol) in the presence of pH 7.4 PBS solution for 24 hours at room temperature. After filtering the precipitate, GSH-TOPOT was separated through silica column chromatography.
  • N201-PDS was prepared after reacting the nutlin derivative (N201, 200 mg, 0.42 mmol) with PDS_NO 2 (313.2 mg, 0.87 mmol) in the presence of DMAP (281.2 mg, 2.21 mmol)/DCM solution for 16 hours at room temperature. .
  • the N201-PDS was separated through a silica column chromatography process.
  • N201-PDS (10 mg, 0.0157 mmol) was reacted with GSH (5.43 mg, 0.019 mmol) in the presence of pH 7.4 PBS solution for 24 hours at room temperature. After filtering the precipitate, GSH-N201 was isolated through silica column chromatography.
  • CPT-GSH prepared in Example 1 10 mg was dissolved in 0.1 ml of dimethyl sulfoxide (DMSO), mixed in 10 ml of PBS, and stirred at room temperature for 1 hour. The mixed solution was subjected to artificial dialysis in PBS for 2 days to prepare CPT-GSH micelles.
  • DMSO dimethyl sulfoxide
  • Example 7 Glutathione-S-transferase (GST); and manufacturing micelles with a surface modified with a fusion protein (GST-EGFR) containing the epibody of epidermal growth factor receptor (EGFR).
  • GST Glutathione-S-transferase
  • GST-EGFR fusion protein containing the epibody of epidermal growth factor receptor
  • the surface of the micelle prepared in Example 6 was modified with GST-EGFR to prepare micelles surface-modified with GST-EGFR (hereinafter, CPT-GSH@GST-EGFR).
  • a linker domain (SGGGSGGGSGGGSGGGSGGGSGGGSGGG; SEQ ID NO: 44) at the end of the gene encoding an affibody (VDNKFNKEMWAAWEEIRNLPNLNGWQMTAFIASLVDDPSQSANLLAEAKKLNDAQAPK; SEQ ID NO: 43) that specifically binds to human epidermal growth factor receptor 2 (EGFR2).
  • EGFR2 human epidermal growth factor receptor 2
  • a GST encoding gene designed to be linked to the N-terminus of GST with a 6 ⁇ His tag was inserted into the pBT7-N-His plasmid to produce a fusion protein (GST-EGFR) in which the affibody and GST were linked by a linker.
  • GST-EGFR fusion protein
  • the constructed plasmid was inserted into E. coli BL21(DE3)RIL strain and cultured. Afterwards, overexpression of GST-EGFR was induced by treating with IPTG and culturing at 30°C for 16 hours. The overexpression-induced E. coli cells were centrifuged at 5000 ⁇ g at 4°C for 10 minutes to obtain precipitated cells, and the cells were suspended in phosphate buffer solution (50 mM sodium phosphate and 100 mM sodium chloride, pH 6.5).
  • phosphate buffer solution 50 mM sodium phosphate and 100 mM sodium chloride, pH 6.5
  • the cell suspension was treated with lysozyme and incubated at room temperature for 20 minutes, then sonicated for 30 seconds and at 1-minute intervals for a total of 10 minutes. After crushing, centrifugation was performed at 12000 ⁇ g at 4°C for 1 hour to obtain the supernatant as a fraction containing GST-EGFR. The obtained supernatant was purified by immobilized metal affinity chromatography using FPLC (1mL HisTrap FF column, GE HealthCare) to isolate GST-EGFR.
  • the isolated GST-EGFR was concentrated by dialyzing in PBS (pH 7.4) overnight, and the concentrated GST-EGFR was separated through SDS-PAGE analysis and ESI-TOF MS (electro spray ionization time-of-light mass spectrometry) analysis. The purity and molecular weight of one protein were analyzed. As a result, it was confirmed that it had a purity of over 99.0% and a molecular weight of approximately 36.14 kDa.
  • a protein solution was prepared by dissolving 50 uM of the purified GST-EGFR in 1 mL of PBS (pH 7.4), and 500 uM of the nanoparticle micelle CPT-GSH prepared in the above example was dissolved in 1 mL of PBS at 4° C. for 6 days.
  • CPT-GSH@GST-EGFR was prepared by slowly adding and mixing while stirring for some time, and the CPT-GSH@GST-EGFR was stored at 4°C.
  • the shape and size of the precursor drug nanoparticle micelles prepared in Example 6 were observed using Transmission Electron Microscopy (TEM) and Dynamic Light Scattering (DLS) using a BioTEM system (JEM 1400). As a result, it was confirmed that the average particle size of GSH-CPT micelles was 30 to 60 nm when observed by TEM, and the average particle size of GSH-CPT micelles was confirmed to be about 160 nm when measured by DLS. The results are shown in Figures 2 and 3.
  • Figure 2 is a schematic diagram of GSH-CPT micelles.
  • Figure 3 is a graph and TEM image showing the DLS results of GSH-CPT micelles:
  • Figure 3a is a graph showing the DLS results of GSH-CPT micelles; and Figure 3b is a TEM image of GSH-CPT micelles.
  • GSH-CPT nanoparticles formed micelle structures with a size of 50 to 200 nm.
  • GSH-CPT micelles showed a surface charge of about -7.74 mV
  • GST-EGFR showed a surface charge of about -3.43 mV
  • the ratio of GSH-CPT and GST-EGFR was high.
  • CPT-GSH@GST-EGFR whose surface was modified with GST-EGFR to have a ratio of 20:1, was confirmed to have a surface charge of approximately -3.52 mV. The results are shown in Figure 4.
  • Figure 4 is an image showing the zeta potential of GSH-CPT micelles, GST-EGFR, and micelles whose surfaces were modified with GST-EGFR (indicated as Complex in Figure 3).
  • the surface charge of the GSH-CPT precursor drug nanoparticle micelle was confirmed to be -7.74 mv. This means that precursor drug nanoparticle micelles with GSH located on the surface were formed in the aqueous solution.
  • the zeta potential of CPT-GSH@GST-EGFR was -3.52 mV, which was confirmed to be almost identical to that of GST-EGFR.
  • Figure 5 is a graph showing steady state fluorescence excitation spectra at various concentrations of GSH-CPT.
  • Figure 6 is a graph showing the results of examining the critical aggregation concentration (CAC) by comparing the I 344 /I 339 intensity values at each concentration of GSH-CPT.
  • CAC critical aggregation concentration
  • Figure 7 is a graph showing the DLS results of GSH-CPT micelles over time.
  • Figure 8 is a TEM image of GSH-CPT micelles after 30 days.
  • GSH-CPT nanoparticle micelles stably maintained a size of 150 to 200 nm for 30 days.
  • GSH-CPT nanoparticle micelles maintained a diameter of 20 to 30 nm even after 30 days.
  • Figure 9 is a graph showing the binding affinity between CPT-GSH and GST-EGFR.
  • the dissociation constant K d of CPT-GSH and GST-EGFR was confirmed to be 1.158 ⁇ M ⁇ 0.359 ⁇ M. This means that strong binding occurs between micelles containing CPT-GSH and GST-EGFR.
  • DLS was performed by varying the concentration of CPT-GSH (15 ⁇ M and 150 ⁇ M) in CPT-GSH@GST-EGFR, the surface of which was modified with GST-EGFR, so that the ratio of GSH-CPT and GST-EGFR was 20:1. was measured to confirm that the concentration of CPT-GSH did not affect the formation of CPT-GSH@GST-EGFR, and this is shown in Figure 11.
  • Figure 10 is a DLS graph measuring the size of micelles whose surface containing CPT-GSH was modified by varying the concentration of GST-EGFR.
  • Figure 11 is a DLS graph measuring the size of micelles in CPT-GSH@GST-EGFR when the concentration of CPT-GSH is 15 ⁇ M or 150 ⁇ M.
  • Figure 12 is a graph showing the FRET intensity of CPT-GSH micelles and CPT-GSH@GST-EGFR.
  • MDA-MB-231 cells, a TNBC cell line, and NIH-3T3 cells, a normal mouse fibroblast were purchased from ATCC, and the MDA-MB-231 cells and NIH-3T3 cells were incubated with 10% FBS and 1% penicillin/ The cells were cultured in DMEM medium containing streptomycin (Life Technologies) at 37°C and 10% CO 2 . Then, MDA-MB-231 cells and NIH-3T3 cells were treated with CPT, CPT-GSH, and CPT-GSH@GST-EGFR, respectively, and each cell was incubated for 96 hours. And the cytotoxicity of CPT, CPT-GSH, and CPT-GSH@GST-EGFR on each cell was investigated through MTT assay. And the results are shown in Figure 13.
  • Figure 13 is a graph showing the cytotoxicity of CPT, CPT-GSH, and CPT-GSH@GST-EGFR against MDA-MB-231 cells (left graph) and NIH-3T3 cells (right graph).
  • CPT-GSH and CPT-GSH@GST-EGFR showed cytotoxicity as high as CPT against MDA-MB-231 cells, a TNBC cell line.
  • CPT-GSH@GST-EGFR showed significantly improved cytotoxicity: the IC 50 of CPT was 8.9 ⁇ M, the IC 50 of CPT-GSH was 18.7 ⁇ M, and the IC 50 of CPT-GSH@GST-EGFR was 3.1. ⁇ M.
  • IC 50 of CPT-GSH@GST-EGFR was found to be over 50 ⁇ M and the IC 50 of CPT-GSH was 46.1 ⁇ M, showing significantly lower cytotoxicity than CPT. Confirmed: IC 50 of CPT is 6.0 ⁇ M.
  • CPT confocal laser scanning microscope
  • Figure 14 is an image measuring cellular internalization of CPT-GSH@GST-EGFR in MDA-MB-231 cells, NIH-3T3 cells, and 55% serum.
  • CPT-GSH and CPT-GSH@GST-EGFR do not target NIH-3T3 cells, a normal cell line, but selectively target only MDA-MB-231, a TNBC cell line, thereby demonstrating selective anticancer activity. It was confirmed that .
  • IR780 was loaded into CPT-GSH, CPT-GSH@GST, and CPT-GSH@GST-EGFR, respectively, and the IR780-loaded CPT-GSH , CPT-GSH@GST and CPT-GSH@GST-EGFR were injected into the vein of the MDA-MB-231 tumor xenograft nude mouse model: the CPT-GSH@GST was bound to the surface of CPT-GSH micelles by Affibody. These are micelles modified with untreated GST. 24 hours after injection, the intensity of IR 780 at the tumor site of the MDA-MB-231 mouse model was measured. Additionally, 72 hours after injection, the intensity of IR 780 in the organs of the MDA-MB-231 mouse model was measured. The results are shown in Figure 15.
  • Figure 15 is an image measuring IR780 intensity in mice administered CPT-GSH, CPT-GSH@GST, and CPT-GSH@GST-EGFR.
  • Figure 16 is an image and graph confirming the tumor growth inhibition effect after administering CPT, CPT-GSH, and CPT-GSH@GST-EGFR to the MDA-MB-231 mouse model:
  • Figure 16a is an image showing the change in tumor size according to the administration of CPT, CPT-GSH, and CPT-GSH@GST-EGFR
  • Figure 16b is an image showing the change in tumor size according to the administration of CPT, CPT-GSH, and CPT-GSH@GST-EGFR. It is a graph showing the change in volume and weight over time
  • Figure 16c is an H&E stained image of tumor cells administered with CPT, CPT-GSH and CPT-GSH@GST-EGFR
  • Figure 16d is an image of CPT, CPT- This is a TUNEL analysis image observing the degree of apoptosis in tumor cells following administration of GSH and CPT-GSH@GST-EGFR.
  • the tumor growth inhibition effect was confirmed in all CPT, CPT-GSH, and CPT-GSH@GST-EGFR, and no change in body weight was observed in CPT, CPT-GSH, and CPT-GSH@GST.
  • -It was confirmed that there were no side effects in all EGFR cases.
  • the tumor size was significantly reduced in CPT-GSH@GST-EGFR, and the tumor growth inhibition ability of CPT-GSH@GST-EGFR was significantly superior to that of CPT and CPT-GSH.

Abstract

친수성 펩타이드를 포함하는 마이셀 및 이의 용도에 관한 것으로서, 일 양상에 따른 마이셀 및 약학적 조성물에 의하면, 계면활성제 등의 첨가제의 사용 없이도 기존 약물의 용해도를 향상시켜, 질병 예방, 개선, 또는 치료에 약물을 유용하게 사용할 수 있는 효과가 있다. 또한, 상기 마이셀을 이용하는 경우, 약물의 치료가 필요한 세포 또는 조직에 대한 약물의 선택성을 향상시켜 약물로 인한 부작용을 개선할 수 있는 효과가 있다.

Description

친수성 펩타이드를 포함하는 마이셀 및 이의 용도
친수성 펩타이드를 포함하는 마이셀 및 이의 용도에 관한 것이다.
일반적으로 항암치료에 있어서 이리노테칸(irinotecan), 토포테칸(topotecan), 독소루비신(doxorubicin), 시스플라틴(cisplatin), 탁솔(taxol), 5-플루오로우라실(5-fluorouracil)등의 난용성 약물을 사용한 화학치료요법이 광범위하게 사용되고 있다.
그러나 난용성 약물은 화합물의 구조상 소수성 부위를 포함하고 있어, 물에 잘 녹지 않아 그 실용성이 제한되는 경우가 많다. 또한 신약으로 개발되는 약물 중 약 41% 이상이 난용성으로 인하여 중도에 포기되고 있으며, 미국 약전(US Pharmacopeia)에 등재된 약물의 약 1/3 이상이 난용성 약물로 분류되고 있다.
이러한 난용성 약물들은 치료 가능한 정도의 양만 투여해도 환자에게 심한 고통을 가져다주며, 과도한 부작용으로 인하여 다량을 투여할 수 없는 실정이다. 이러한 부작용이 나타나는 원인은 항암제의 비선택성 때문으로, 항암제가 암세포에만 작용하지 않고 일반세포에도 작용함으로써 암세포의 선택적 사멸을 유도하지 못하게 된다. 이에 따라, 정상적인 세포의 성장을 억제 또는 궤사를 유발하여 환자는 심한 고통을 느끼게 된다.
이러한 난용성 약물을 사용하기 위해서는 난용성을 해결하기 위한 부가적인 물질이 첨가되어야 하나, 부가되는 물질의 독성으로 인하여 사용이 제한되는 사례가 다수 보고되고 있다. 예들 들어, 폴리옥시에틸화 피마자유(polyoxyethylated castor oil)와 무수에탄올(absolute ethanol)의 혼합물인 크레모포 EL(cremorphor EL)이라는 용제를 사용하여 수용해도를 개선함으로써 전신투여에 이용하는 방법이 알려져 있지만, 임상적으로 이러한 용제가 과량 투여되면 심장독성, 신경독성, 신경장애 및 과민증 등의 부작용이 나타나는 것으로 보고되고 있다(Onetto, N. and Grechko J., Overview of taxol safety, J. Natl. Cancer Inst. Monogr., 1993, 15: 131; Mazzo, D. and Denis, P., Compatibility of docetaxel and paclitaxel in intravenous solutions with polyvinyl chloride infusion materials, Am. J. Health Sys. Pharm., 1997, 54: 566; Gregory R. and Delisa, A.F., Paclitaxel: a new antineoplastic agent for refractory ovarian cander, Clin. Pharm., 1993, 12: 401). 이 외에도 에멀젼, 마이크로에멀젼, 리포좀(liposome), 미셀(micelle) 또는 폐길화(PEGylation) 등의 방법이 사용되어 왔으나, 계면활성제 등의 첨가제를 필수로 사용해야하는 단점을 가지고 있다.
이에, 본 발명자들은 상기 문제점을 해결하기 위해, 친수성 펩타이드(peptide)인 글루타치온(glutathione: GSH)이 링커(linker)에 의해 소수성 항암제와 연결되어 전체 전구체 약물을 양친매성(amphiphilic)의 성질을 띄어 계면활성제의 사용 없이 수용액 상에서 나노입자 마이셀을 제조하고, 기존 항암제의 용해도를 극적으로 향상시킬 수 있음을 확인하고 본 발명을 완성하였다.
일 양상은 친수성 펩타이드(peptide), 약물 및 상기 친수성 펩타이드와 상기 약물을 연결하는 하기 화학식 1로 표시되는 링커(linker)를 포함하는 마이셀(micelle)을 제공하는 것이다:
[화학식 1]
Figure PCTKR2022015283-appb-img-000001
.
다른 양상은 상기 마이셀을 유효성분으로 포함하는 암 예방 또는 치료용 약학적 조성물을 제공하는 것이다.
또 다른 양상은 상기 마이셀을 유효성분으로 포함하는 조성물을 개체에 투여하는 단계를 포함하는 암을 예방 또는 치료하는 방법을 제공하는 것이다.
또 다른 양상은 상기 마이셀을 암 예방 또는 치료에 사용하기 위한 치료제의 제조에 사용하기 위한 용도를 제공하는 것이다.
일 양상은 친수성 펩타이드(peptide), 약물 및 상기 친수성 펩타이드와 상기 약물을 연결하는 하기 화학식 1로 표시되는 링커(linker)를 포함하는 마이셀을 제공한다:
[화학식 1]
Figure PCTKR2022015283-appb-img-000002
상기 화학식 1에서, R1은 O, N 또는 S일 수 있고, x는 1 내지 6일 수 있다.
본 명세서에서 용어, "펩타이드"는 당해 기술 분야에 있어서의 통상의 의미로 사용되며, 복수의 아미노산이 펩티드 결합에 의해 연결된 중합체 및 그 수식체인 화합물을 가리킨다.
본 명세서에서 용어 "친수성"은 물질이 가지는 물과의 친화성의 정도를 가리킨다. 친수성 물질은 물에 대해 강한 친화성을 가지며, 물에 용해 또는 혼합하는 경향이 있다. 따라서, 상기 "친수성 펩타이드"는 물에 대해 강한 친화성을 갖는 펩타이드를 지칭한다.
상기 친수성 펩타이드는 2 내지 10개의 아미노산으로 구성된 것일 수 있다. 예를 들면, 3 내지 9개 또는 3 내지 5개의 아미노산으로 구성된 것일 수 있다.
일 구체예에 있어서, 상기 친수성 펩타이드는 서열번호 1 내지 31의 아미노산 서열로 이루어진 군으로부터 선택되는 어느 하나 이상의 펩타이드를 포함하는 것일 수 있으나, 이에 제한되는 것은 아니다.
펩타이드 서열번호 펩타이드 서열번호
글루타티온(Glutathione: GSH)(Glu-Cys-Gly:ECG) 서열번호 1 GRGDSPC(Gly-Arg-Gly-Asp-Ser-Pro-Cys) 서열번호 17
RGD(Arg-Gly-Asp) 서열번호 2 RGDS(Arg-Gly-Asp-Ser) 서열번호 18
RGDK(Arg-Gly-Asp-Lys) 서열번호 3 SDGR(Ser-Asp-Gly-Arg) 서열번호 19
GRGESP(Gly-Arg-Gly-Glu-Ser-Pro) 서열번호 4 YRGDS(Tyr-Arg-Gly-Asp-Ser) 서열번호 20
RGDC(Arg-Gly-Asp-Cys) 서열번호 5 GPR(Gly-Pro-Arg) 서열번호 21
RGDV(Arg-Gly-Asp-Val) 서열번호 6 GHK(Gly-His-Lys) 서열번호 22
CRGDK(Cys-Arg-Gly-Asp-Lys) 서열번호 7 YIGSR(Tyr-Ile-Gly-Ser-Arg) 서열번호 23
CDRGDK(Cys-Asp-Arg-Gly-Asp-Lys) 서열번호 8 PDSGR(Pro-Asp-Ser-Gly-Arg) 서열번호 24
RGES(Arg-Gly-Glu-Ser) 서열번호 9 EIL(Glu-Ile-Leu) 서열번호 25
KGDS(Lys-Gly-Asp-Ser) 서열번호 10 LCFR(Leu-Cys-Phe-Arg) 서열번호 26
GRADSP(Gly-Arg-Ala-Asp-Ser-Pro) 서열번호 11 CDPGYIGSR(Cys-Asp-Pro-Gly-Tyr-Ile-Gly-Ser-Arg) 서열번호 27
GRGDS(Gly-Arg-Gly-Asp-Ser) 서열번호 12 EILDV(Glu-Ile-Leu-Asp-Val) 서열번호 28
GRGDSP(Gly-Arg-Gly-Asp-Ser-Pro) 서열번호 13 EILDVPST(Glu-Ile-Leu-Asp-Val-Pro-Ser-Thr) 서열번호 29
GRGDTP(Gly-Arg-Gly-Asp-Thr-Pro) 서열번호 14 EILEVPST(Glu-Ile-Leu-Glu-Val-Pro-Ser-Thr) 서열번호 30
GRGES(Gly-Arg-Gly-Glu-Ser) 서열번호 15 LDV(Leu-Asp-Val) 서열번호 31
LDVPS(Leu-Asp-Val-Pro-Ser) 서열번호 16
일 구체예에 있어서, 상기 마이셀은 글루타치온-S-전이효소(glutathione-S-transferase, GST); 및 표적 세포 또는 표적 단백질 결합능을 갖는 단백질을 포함하는 융합 단백질로 표면개질된 것일 수 있다. 예를 들면, 상기 친수성 펩타이드에 글루타치온-S-전이효소 및 표적 세포 또는 표적 단백질 결합능을 갖는 단백질을 포함하는 융합 단백질이 결합된 것일 수 있다.
일 구체예에 있어서, 상기 융합 단백질로 표면개질된 마이셀은 친수성 펩타이드 및 융합단백질의 비가 적어도 10 : 1로 혼합된 것일 수 있다. 예를 들어, 10 내지 10,0000 : 1, 예를 들면, 15 내지 10,0000 : 1, 20 내지 10,0000 : 1, 30 내지 10,0000 : 1, 40 내지 10,0000 : 1, 50 내지 10,0000 : 1, 100 내지 10,0000 : 1, 200 내지 10,0000 : 1, 300 내지 10,0000 : 1, 400 내지 10,0000 : 1, 500 내지 10,0000 : 1, 1000 내지 10,0000 : 1, 2000 내지 10,0000 : 1, 3000 내지 10,0000 : 1, 4000 내지 10,0000 : 1, 5000 내지 10,0000 : 1, 1,0000 내지 10,0000 : 1, 10 내지 5,0000 : 1, 15 내지 5,0000 : 1, 20 내지 5,0000 : 1, 30 내지 5,0000 : 1, 40 내지 5,0000 : 1, 50 내지 5,0000 : 1, 100 내지 5,0000 : 1, 200 내지 5,0000 : 1, 300 내지 5,0000 : 1, 400 내지 5,0000 : 1, 500 내지 5,0000 : 1, 1000 내지 5,0000 : 1, 2000 내지 5,0000 : 1, 3000 내지 5,0000 : 1, 4000 내지 5,0000 : 1, 5000 내지 5,0000 : 1, 1,0000 내지 5,0000 : 1, 10 내지 1,0000 : 1, 15 내지 1,0000 : 1, 20 내지 1,0000 : 1, 30 내지 1,0000 : 1, 40 내지 1,0000 : 1, 50 내지 1,0000 : 1, 100 내지 1,0000 : 1, 200 내지 1,0000 : 1, 300 내지 1,0000 : 1, 400 내지 1,0000 : 1, 500 내지 1,0000 : 1, 1000 내지 1,0000 : 1, 2000 내지 1,0000 : 1, 3000 내지 1,0000 : 1, 4000 내지 1,0000 : 1, 또는 5000 내지 1,0000 : 1로 혼합되는 것일 수 있다.
상기 융합 단백질은 글루타치온-S-전이효소와 표적 세포 또는 표적 단백질 결합능을 갖는 단백질을 연결하는 링커를 더 포함할 수 있다.
본 명세서에서 용어 "표적 세포 또는 표적 단백질 결합능을 갖는 단백질", "표적세포 인식능을 갖는 단백질", 또는 "표적 세포 또는 표적 단백질에 특이적으로 결합하는 단백질"은 세포의 수용체 또는 표적 단백질을 특이적으로 인식하는 또는 세포의 수용체 또는 표적 단백질에 특이적으로 결합하는 단백질을 의미할 수 있다. 구체적으로, 상기 세포의 수용체 또는 표적 단백질에 특이적으로 결합하는 단백질은 항체, 항원 결합 단편, 애피바디(affibody), 다이아바디(diabody) 및 앱타머(aptamer)로 이루어진 군으로부터 선택되는 어느 하나인 것일 수 있다.
본 명세서에서 용어 "애피바디 분자(affibody molecule)"는 특정 타겟 단백질(수용체)에 결합할 수 있는, 항체 모사체를 의미할 수 있다. 일반적으로 애피바디 분자는 20 내지 150의 아미노산 잔기로 구성되며, 2 내지 10개의 알파 헬릭스로 구성된 것일 수 있다. 더욱 상세하게는 상기 애피바디 분자는 항-ErbB 애피바디 분자(ab31889), HER2-특이적 애피바디 분자(ZHER2:342), 항-EFFR 애피바디 분자(ZEGFR:2377) 등을 포함할 수 있다. 또한, 이에 한정되지 않고, 세포의 특정 수용체 또는 표적 단백질을 인식할 수 있는 애피바디 분자를 모두 포함한다. 상기 애피바디 분자가 인식할 수 있는 표적 수용체 또는 표적 단백질의 예는, 아밀로이드 베타 펩티드, 시누클레인(예를 들면, 알파-시누클레인), 아포리포프로테인(예를 들면, 아포리포프로테인 A1), 보체 인자(Complement factor)(예를 들면, C5), 탄산무수화효소(Carbonic anhydrase)(예를 들면, CAIX), 인터루킨-2 수용체 알파 사슬(IL2RA; CD25), 세포 표면의 CD 항원(예를 들면, CD28), 또는 c-Jun, Factor VIII, 프비르노겐, GP120, H-Ras, Her2, Her3, HPV16 E7, IAPP(Human islet amyloid polypeptide), 이뮤노글로불린 A(IgA), IgE, IgM, 인터루킨(예를 들면, IL-1, IL-6, IL-8, IL-17), 인슐린, 스타필로코커스 단백질 A 도메인(Staphylococcal protein A domain), Raf-1, LOV 도메인(Light-oxygen-voltage-sensing domain), 또는 RSV G 단백질일 수 있다. 상기 애피바디에 대한 정보는 Stefan Stahl et al., Affibody Molecules in Biotechnological and Medical Applications, Trends in Biotechnology, August 2017, Vol 35, No 8에 기재되어 있으며, 상기 문헌은 그 전체가 참조로서 본 명세서에서 포함된다.
상기 표적 세포 또는 표적 단백질 결합능을 갖는 단백질은 수용체 타이로신 카이네이즈(Receptor tyrosine kinases: RTKs)에 특이적으로 결합하는 것일 수 있다. 더욱 구체적으로, 상기 수용체 타이로신 카이네이즈는 표피 성장인자 수용체(epidermal growth factor receptor: EGFR), 인슐린 수용체, 혈소판 유래 성장인자 수용체, 혈관내피 성장인자 수용체, 섬유아세포 성장인자 수용체, 콜레시스토키닌(Cholecystokinin: CCK) 수용체, 신경영양인자(Neurotrophic factor: NGF) 수용체, 간세포 성장인자 (Hepatocyte growth factor: HGF) 수용체, 에프린(Ephrin: Eph) 수용체, 안지오포이에틴 수용체, 및 RYK(related to receptor tyrosine kinase) 수용체로 이루어진 군으로부터 선택된 어느 하나일 수 있다.
일 구체예에 있어서, 상기 표적 세포 또는 표적 단백질 결합능을 갖는 단백질은 수용체 타이로신 카이네이즈에 특이적으로 결합하는 항체, 항원 결합 단편, 애피바디, 다이아바디 또는 앱타머일 수 있다.
일 구체예에 있어서, 상기 GST 및 표적 세포 또는 표적 단백질 결합능을 갖는 단백질은 링커를 통해 연결되어 있을 수 있다. 예를 들어, 상기 링커는, 1 내지 400개, 1 내지 200개, 또는 2 내지 200개의 임의의 아미노산으로 이루어진 폴리펩티드일 수 있다. 상기 펩티드 링커는 Gly, Asn 및 Ser 잔기를 포함할 수 있으며, Thr 및 Ala과 같은 중성 아미노산들도 포함될 수 있다. 펩티드 링커에 적합한 아미노산 서열은 당업계에 공지되어 있다. 또한 기능적 일부분 사이의 적절한 분리를 달성하기 위하여 또는 필수적인 내부-일부분(inter-moiety)의 상호작용을 유지하기 위한　링커의 최적화를 고려하여 카피 수 "n"을 조절할 수 있다. 해당 기술분야에서 다른 가요성　링커들이 알려져 있는데, 예를 들어 수용성을 향상시키기 위하여 극성 아미노산 잔기를 추가하는 것뿐만 아니라 유연성을 유지하기 위하여 T 및 A와 같은 아미노산 잔기를 추가한 G 및 S　링커가 있을 수 있다. 따라서 일 구체예에 있어서, 상기　링커는 G, S, 및/또는 T 잔기를 포함하는 유연성　링커일 수 있다. 상기　링커는 (GpSs)n 및 (SpGs)n으로부터 선택되는 일반식을 가질 수 있고, 이 경우, 독립적으로, p는 1 내지 10의 정수이고, s = 0 내지 10의 0 또는 정수이고, p + s는 20 이하의 정수이고, 및 n은 1 내지 20의 정수일 수 있다. 더욱 구체적으로 링커의 예는 (GGGGS)n (서열번호 32), (SGGGG)n　(서열번호 33), (SRSSG)n (서열번호 34), (SGSSC)n (서열번호 35), (GKSSGSGSESKS)n (서열번호 36), (RPPPPC)n (서열번호 37), (SSPPPPC)n (서열번호 38), (GSTSGSGKSSEGKG)n (서열번호 39), (GSTSGSGKSSEGSGSTKG)n (서열번호 40),　(GSTSGSGKPGSGEGSTKG)n　(서열번호 41), 또는 (EGKSSGSGSESKEF)n (서열번호 42)이고, 상기 n은 1 내지 20, 또는 1 내지 10의 정수일 수 있다.
상기 약물은 항암제, 치료용 항체, 항생제, 항박테리아제, 항바이러스제, 항염증제, 조영제, 단백질 의약품, 성장인자, 사이토카인, 펩타이드 약물, 발모제, 마취제 및 이의 조합으로 이루어진 군에서 선택되는 것일 수 있으나, 이에 제한되는 것은 아니다.
일 구체예에 있어서, 상기 약물은 항암제일 수 있고, 상기 항암제는 소수성 항암제일 수 있다.
상기 항암제는 도세탁셀(docetaxel), 캄토테신(camptothecin), 파클리탁셀(paclitaxel), 플록슈리딘(floxuridine), 류프로리드(leuprolide), 졸레드로네이트(zoledronate), 독소루비신(doxorubicin), 시스플라틴(cisplatin), 베라파밀(verapamil), 플루오로우라실(fluorouracil), 옥살리플라틴(oxaliplatin), 다우노루비신(daunorubicin), 카보플라틴(carboplatin), 메소트렉세이트(methotrexalte), 빈크리스틴(vincristine), 젬시타빈(gemcitabine), 스트렙토조토신(streptozocin), 토포테칸(topotecan), 이리노테칸(irinotecan), 비노렐빈(vinorelbine), 하이드록시우레아(hydroxyurea), 발루비신(valrubicin), 독시플루리딘(doxifluridine), 빈블라스틴(vinblastin), 프레드니손(prednisone), 테스토스테론(testosterone), 미토산트론(mitoxantrone), 살리실레이트(salicylates), 덱사메타손(dexamethasone), 프레드니솔론(prednisolone), 코르티손(cortisone), 뉴트린(nutlin) 유도체, SN-38(7-에틸-10-하이드록시캄토테신(7-ethyl-10hydroxycamptothecin)), 벨로테칸(belotecan), 엑사테칸(exatecan), 루르토테칸(lurtotecan), 루비테칸(rubitecan), 9-아미노캄토테신(9-aminocamptothecin), 지마테칸(gimatecan), BNP-1530, DB-67, BN-80915, BN-80927, 코르티코스테로이드(corticosteroid) 및 이의 약학적으로 허용가능한 염으로 구성된 군으로부터 선택되는 어느 하나 이상인 것일 수 있으나, 이에 제한되는 것은 아니다.
상기 암은 폐암, 췌장암, 위암, 간암, 대장암, 뇌암, 유방암, 갑상선암, 방광암, 식도암, 전립선암 또는 자궁암일 수 있으나, 이에 제한되지 않는다.
본 명세서에서 용어, "마이셀"은 수성 매질 중 내부 코어 및 외부 표면을 갖는, 양친매성 분자의 집합체(aggregate)를 지칭하며, 상기 양친매성 분자들은 대부분 그들의 소수성 부분이 코어를 형성하고, 친수성 부분이 외부 표면을 형성하도록 배향(oriented)된다. 본 발명에 따른 마이셀은 약물이 소수성 부분을 이루어 코어를 형성하고, 친수성 펩타이드가 친수성 부분을 이루어 외부 표면을 형성하도록 배향된다.
일 구체예에 따르면, 상기 마이셀은 계면활성제의 사용 없이 수용액 상에서 제조할 수 있다.
일 구체예에 따르면, 상기 마이셀은 (a) 하기 화학식 1로 표시되는 링커를 약물과 결합시키는 단계, (b) 상기 약물과 결합된 링커의 다른 쪽 말단에 친수성 펩타이드를 결합시켜 약물-링커-친수성 펩타이드의 복합체를 형성하는 단계, 및 (c) 상기 약물-링커-친수성 펩타이드의 복합체를 유기용매에 녹여 마이셀을 제조하는 단계를 통해 제조할 수 있다:
[화학식 1]
Figure PCTKR2022015283-appb-img-000003
상기 화학식 1에서, R1은 O, N 또는 S일 수 있고, x는 1 내지 6일 수 있다.
상기 친수성 펩타이드 및 약물은 상기한 바와 같다.
일 구체예에 따르면, 상기 (a) 단계에서 링커와 항암제를 5 내지 20 시간, 예를 들면, 10 내지 20 시간, 15 내지 20 시간, 15 내지 19 시간 또는 15 내지 18 시간동안 반응시켜 결합시킬 수 있다. 상기 반응은 실온에서 수행할 수 있으며, 온도에 따라 당업자는 반응시간을 적절히 변경할 수 있다.
상기 (a) 단계에서 사용된 염기는 NaH, 리튬 디아소프로필아마이드(lithium diisopropylamide: LDA), 4-디메틸아미노피리딘(4-dimethylaminopyridine: DMAP), 트리에틸아민(triethylamine: TEA), 피리딘, 암모니아, 메틸아민, 에틸아민, 프로필아민, 이소프로필아민, 디메틸아민, 디에틸아민, 디프로필아민, 디이소프로필아민, 트리메틸아민, 트리프로필아민, 트리이소프로필아민, 아닐린, 메틸아닐린, 디메틸아닐린, 피리딘, 아자줄롤리딘, 벤질아민, 메틸벤질아민, 디메틸벤질아민, 2,6-루티딘, 모르폴린, 피페리딘, 피페라진, 양성자-스폰지, 수산화암모늄, 트리에탄올아민, 에탄올아민, 또는 트리즈마일 수 있으나, 이에 제한되지 않는다.
상기 (a) 단게에서 사용된 용매는 디메틸아세트아마이드(dimethylacetamide: DMAc), 디클로로메탄(dichloromethane: DCM), 테트라하이드로푸란(tetrahydrofuran: THF), 디메틸포름아미드(dimethylformamide: DMF), 아세토니트릴(acetonitrile: ACN), DMAP, 물, 아세트산, 아세톤, 디옥산, 벤젠, 1-부탄올, 2-부탄올, tert-부틸 알콜, 사염화탄소, 클로로포름, 시클로헥산, 헥산, 디에틸 에테르, 디메틸 설폭사이드(dimethyl sulfoxide: DMSO), 에탄올, 에틸 아세테이트, 에틸렌 글리콜, 글리세린, 헵탄, 펜탄, 피리딘, 톨루엔, 염산, 및 트리에틸 아민일 수 있으나, 이에 제한되지 않는다.
상기 (b) 단계에서 항암제와 결합된 링커와 친수성 펩타이드를 10 내지 36 시간, 예를 들면, 10 내지 36 시간, 15 내지 36 시간 또는 20 내지 26 시간동안 반응시켜 상기 항암제와 결합된 링커의 다른 쪽 말단에 친수성 펩타이드를 결합시킬 수 있다. 상기 반응은 실온에서 수행할 수 있으며, 온도에 따라 당업자는 반응 시간을 적절히 변경할 수 있다.
상기 (b) 단계에서 사용된 용매는 물, 클로로포름, 염화메틸렌, 4염화탄소, 1,2-디클로로에탄, 디클로로에틸렌, 트리클로로에틸렌, 퍼클로로에틸렌, 디클로로프로판, 염화아밀, 1,2-디브로모에탄, 아세톤, 메틸이소부틸케톤, 시클로헥산온, 벤젠, 톨루엔, 크실렌, N,N-디메틸포름아미드, N,N-디부틸포름아미드, N,N-디메틸아세트아미드, N-메틸피롤리돈, 메탄올, 에탄올, 프로판올, 부탄올, 인산완충생리식염수(phosphate-buffered saline: PBS), 생체유사용액(simulated body fluid: SBF), 붕산완충생리식염수(borate-buffered saline: BBS) 또는 트리스완충생리식염수(tris-buffered saline: TBS)일 수 있으나, 이에 제한되지 않는다.
일 구체예에 따르면, 상기 (c) 단계는 약물-링커-친수성 펩타이드의 복합체를 유기용매에 녹인후, 10℃ 내지 30℃, 예를 들면 15℃ 내지 30℃, 15℃ 내지 25℃ 또는 상온에서 교반한 뒤, 인공투석(dialysis)하여 마이셀을 제조하는 것일 수 있다. 상기 인공투석은 1 내지 5일, 예를 들면 1 내지 4일 또는 2 내지 3일 동안 수행될 수 있다.
상기 (c) 단계에서 사용되는 유기용매는 불화알콜, 디메틸포름아마이드, 디메틸 설폭사이드, 염화탄화수소, 탄화수소 및 알킬알콜일 수 있으나, 이에 제한되지 않는다.
상기 마이셀의 크기는 50 nm 내지 200 nm일 수 있다. 예를 들어, 50 nm 내지 200 nm, 50 nm 내지 150 nm, 50 nm 내지 100 nm일 수 있다.
일 구체예에 따르면, 상기 마이셀의 제타 전위는 -2 mV 내지 -40 mV일 수 있다. 예를 들면, -2 mV 내지 -30 mV, -2 mV 내지 -20 mV, -2mV 내지 -10mV, -3mV 내지 -10 mV일 수 있다.
다른 양상은 상기 마이셀을 유효성분으로 포함하는 암 예방 또는 치료용 약학적 조성물을 제공한다.
상기 암 예방 또는 치료용 약학적 조성물은 약학적으로 유효한 양의 생리활성성분을 추가로 포함하거나 하나 이상의 약학적으로 허용되는 담체, 부형제 또는 희석제를 포함할 수 있다. 상기 약학적으로 유효한 양이란 상기 생리활성성분이 동물 또는 사람에게 투여되어 목적하는 생리학적 또는 약리학적 활성을 나타내기에 충분한 양을 의미한다. 상기 약학적으로 유효한 양은 투여 대상의 연령, 체중, 건강상태, 성별, 투여 경로 및 치료기간 등에 따라 적절히 변화될 수 있다.
상기 "생리활성성분"은 동물 또는 사람의 체내에서 생리적인 기능을 촉진 또는 억제하여 목적하는 생물학적 또는 약리학적 효과를 유도할 수 있는 물질로서, 동물 또는 사람에게 투여하기 적합한 화학적 또는 생물학적 물질 또는 화합물을 의미하며, (1) 감염 예방과 같은 원하지 않은 생물학적 효과를 예방하여 유기물에 대한 예방효과를 가지고, (2) 질병으로 생기는 컨디션을 경감시키며, 예를 들어 질병의 결과로 생기는 고통 또는 감염을 완화시키며, (3) 유기물로부터 질병을 완화, 감소 또는 완전히 제거할 수 있는 역할을 수행할 수 있다. 또한, "상기 생리활성성분"은 "치료제"의 용어와도 상호 교환적으로 사용될 수 있다.
상기 생리활성성분은 단백질, 항암제, 소염진통제, 항생제, 항균제, 호르몬제, 유전자 및 백신으로 이루어진 군에서 선택될 수 있으나, 이에 제한되지 않는다.
또한, 상기 "약학적으로 허용되는"이란 생리학적으로 허용되고 인간에게 투여될 때, 통상적으로 위장 장애, 현기증과 같은 알레르기 반응 또는 이와 유사한 반응을 일으키지 않는 것을 의미한다. 상기 담체, 부형제 및 희석제의 예로는, 락토즈, 덱스트로즈, 수크로즈, 솔비톨, 만니톨, 자일리톨, 에리스리톨, 말티톨, 전분, 아카시아 고무, 알지네이트, 젤라틴, 칼슘 포스페이트, 칼슘 실리케이트, 셀룰로즈, 메틸 셀룰로즈, 폴리비닐피롤리돈, 물, 메틸하이드록시벤조에이트, 프로필하이드록시벤조에이트, 탈크, 마그네슘 스테아레이트 및 광물유를 들 수 있다. 또한, 충진제, 항응집제, 윤활제, 습윤제, 향료, 유화제 및 방부제 등을 추가로 포함할 수 있다.
상기 약학적 조성물은 당업계에 공지된 방법으로 충진제, 증량제, 결합제, 습윤제, 붕해제, 계면활성제 등의 희석제 또는 부형제를 사용하여 제형화될 수 있고, 이러한 제형은 경구 또는 비경구 투여 제형일 수 있다. 경구 투여 제형은 과립제, 산제, 액제, 정제, 캅셀제, 건조시럽제, 또는 그 조합일 수 있고, 비경구 투여 제형은 주사제일 수 있으나, 이에 제한되지 않는다.
상기 투여는 당업계에 알려진 방법에 의하여 투여될 수 있다. 투여는 예를 들면, 정맥내, 근육내, 경구, 경피 (transdermal), 점막, 코안 (intranasal), 기관내 (intratracheal) 또는 피하 투여와 같은 경로로, 임의의 수단에 의하여 개체로 직접적으로 투여될 수 있다. 상기 투여는 전신적으로 또는 국부적으로 투여될 수 있다.
상기 개체는 포유동물, 예를 들면, 사람, 소, 말, 돼지, 개, 양, 염소, 또는 고양이를 포함할 수 있으나 이에 한정되지 않는다. 상기 개체는 암과 관련된 상태의 개선 효과를 필요로 하는 개체일 수 있다.
상기 약학적 조성물의 치료적 유효 투여량은 하루에 체중 1 kg당 0.01 내지 1000 mg, 예를 들면 0.1 내지 500 mg 또는 0.1 내지 300 mg의 양으로 1 내지 수회에 나누어 투여할 수 있다. 그러나 상기 치료적 유효 투여량 또는 치료적 유효량은 상기 약학적 조성물의 제제화 방법, 투여 방식, 투여 시간 및/또는 투여 경로 등에 의해 다양해질 수 있다. 또한, 상기 조성물의 투여로 달성하고자 하는 반응의 종류와 정도, 투여 대상이 되는 개체의 종류, 연령, 체중, 일반적인 건강 상태, 질병의 증세나 정도, 성별, 식이, 배설, 해당 개체에 동시 또는 이시에 함께 사용되는 약물 기타 조성물의 성분 등을 비롯한 여러 인자 및 의약 분야에서 잘 알려진 유사 인자에 따라 다양해질 수 있으며, 당해 기술 분야에서 통상의 지식을 가진 자는 목적하는 치료에 효과적인 투여량을 용이하게 결정하고 처방할 수 있다.
또 다른 양상은 상기 마이셀을 유효성분으로 포함하는 조성물을 개체에 투여하는 단계를 포함하는 암을 예방 또는 치료하는 방법을 제공한다.
또 다른 양상은 상기 마이셀을 암 예방 또는 치료에 사용하기 위한 치료제의 제조에 사용하기 위한 용도를 제공하는 것이다.
일 양상에 따른 마이셀 및 약학적 조성물에 의하면, 계면활성제 등의 첨가제의 사용 없이도 기존 약물의 용해도를 향상시켜, 질병 예방, 개선, 또는 치료에 약물을 유용하게 사용할 수 있는 효과가 있다. 또한, 상기 마이셀을 이용하는 경우, 약물의 치료가 필요한 세포 또는 조직에 대한 약물의 선택성을 향상시켜 약물로 인한 부작용을 개선할 수 있는 효과가 있다.
도 1은 상기 CPT-GSH@GST-EGFR를 제조하는 방법에 대한 모식도이다.
도 2는 GSH-CPT 마이셀의 모식도이다.
도 3은 GSH-CPT 마이셀의 DLS 결과를 나타낸 그래프 및 TEM 이미지이다:
도 3a는 GSH-CPT 마이셀의 DLS 결과를 나타낸 그래프이고; 및 도 3b는 GSH-CPT 마이셀의 TEM 이미지이다.
도 4는 GSH-CPT 마이셀, GST-EGFR 및 GST-EGFR로 표면이 개질된 마이셀의 제타 전위를 나타낸 이미지이다.
도 5는 여러가지 농도의 GSH-CPT에서 정상 상태 형광 여기 스펙트럼(steady state fluorescence excitation spectra)을 나타낸 그래프이다.
도 6은 GSH-CPT의 농도별 I344/I339 강도값을 비교하여 임계응집농도(CAC)를 조사한 결과를 나타낸 그래프이다.
도 7은 시간의 흐름에 따른 GSH-CPT 마이셀의 DLS 결과를 나타낸 그래프이다.
도 8은 30일 이후의 GSH-CPT 마이셀의 TEM 이미지이다.
도 9는 CPT-GSH와 GST-EGFR 간의 결합 친화도를 나타낸 그래프이다.
도 10은 CPT-GSH를 포함하는 마이셀의 표면을 GST-EGFR의 농도를 달리하여 개질한 마이셀의 크기를 측정한 DLS 그래프이다.
도 11은 CPT-GSH@GST-EGFR에서 CPT-GSH의 농도가 15 μM, 또는 150 μM일 때의 마이셀의 크기를 측정한 DLS 그래프이다.
도 12는 CPT-GSH 마이셀 및 CPT-GSH@GST-EGFR의 FRET 강도를 나타낸 그래프이다.
도 13은 CPT, CPT-GSH, 및 CPT-GSH@GST-EGFR의 MDA-MB-231 세포 및 NIH-3T3 세포에 대한 세포독성을 나타낸 그래프이다.
도 14는 MDA-MB-231 세포, NIH-3T3 세포, 및 55 %의 혈청에서 CPT-GSH@GST-EGFR의 세포 내제화를 측정한 이미지이다.
도 15는 CPT-GSH, CPT-GSH@GST 및 CPT-GSH@GST-EGFR가 투여된 마우스에서 IR780 강도를 측정한 이미지이다.
도 16은 MDA-MB-231 마우스 모델에 CPT, CPT-GSH 및 CPT-GSH@GST-EGFR을 투여한 후 종양 성장 억제 효과를 확인한 이미지 및 그래프이다:
도 16a는 CPT, CPT-GSH 및 CPT-GSH@GST-EGFR의 투여에 따른 종양의 크기 변화를 나타난 이미지이고, 도 16b는 CPT, CPT-GSH 및 CPT-GSH@GST-EGFR의 투여에 따른 종양의 부피 및 무게 변화를 시간의 흐름에 따라 나타낸 그래프이며, 도 16c는 CPT, CPT-GSH 및 CPT-GSH@GST-EGFR를 투여한 종양 세포를 H&E 염색한 이미지이고, 도 16d는 CPT, CPT-GSH 및 CPT-GSH@GST-EGFR의 투여에 따른 종양 세포에서의 세포사멸 정도를 관찰한 TUNEL 분석 이미지이다.
이하 실시예를 통하여 보다 상세하게 설명한다. 그러나, 이들 실시예는 하나 이상의 구체예를 예시적으로 설명하기 위한 것으로 본 발명의 범위가 이들 실시예에 한정되는 것은 아니다.
실시예 1. CPT-GSH 복합체의 제조
단계 1. CPT-PDS의 제조
캄토테신(camptothecin: CPT, 200 mg, 0.574 mmol)을 실온에서 16시간 동안 DMAP(294.5 mg, 2.41 mmol)/DCM 용액 존재 하에 하기 화학식 2로 표시되는 4-니트로페닐 (2-(피리디닐-2-디설파닐)에틸) 카보네이트(4-nitrophenyl (2-(pyridinly-2-disulfanyl)ethyl) carbonate: PDS_NO2)(329.7 mg, 0.9 mmol)와 반응시킨 후 CPT-PDS를 제조하였다. 상기 CPT-PDS를 실리카 컬럼크로마토그라피 과정을 통하여 분리 및 정제하였다.
[화학식 2]
Figure PCTKR2022015283-appb-img-000004
상기 반응을 이하의 반응식 1에 나타내었다.
[반응식 1]
Figure PCTKR2022015283-appb-img-000005
단계 2. CPT-GSH의 제조
상기 CPT-PDS(10 mg, 0.0178 mmol)를 실온에서 24시간 동안 pH 7.4 PBS 용액 존재 하에 GSH(5.47 mg, 0.0178 mmol)와 반응시켰다. 침전물을 필터링한 후 실리카 컬럼크로마토그라피 과정을 통하여 GSH-CPT를 분리하였다.
상기 반응을 이하의 반응식 2에 나타내었다.
[반응식 2]
Figure PCTKR2022015283-appb-img-000006
실시예 2. SN38-GSH 복합체의 제조
단계 1. SN38-PDS의 제조
SN38(200 mg, 0.52 mmol)을 실온에서 16시간 동안 DMAP(294.5 mg, 2.41 mmol)/DCM 용액 존재 하에 PDS_NO2(329.7 mg, 0.9 mmol)와 반응시킨 후 SN38-PDS를 제조하였다. 상기 SN38-PDS를 실리카 컬럼크로마토그라피 과정을 통하여 분리하였다.
상기 반응을 이하의 반응식 3에 나타내었다.
[반응식 3]
Figure PCTKR2022015283-appb-img-000007
단계 2. SN38-GSH의 제조
상기 SN38-PDS(10 mg, 0.0162 mmol)를 실온에서 24시간 동안 pH 7.4 PBS 용액 존재 하에 GSH(5.32 mg, 0.0177 mmol)와 반응시켰다. 침전물을 필터링한 후 실리카 컬럼크로마토그라피 과정을 통하여 GSH-SN38을 분리하였다.
상기 반응을 이하의 반응식 4에 나타내었다.
[반응식 4]
Figure PCTKR2022015283-appb-img-000008
실시예 3. IRINO-GSH 복합체의 제조
단계 1. IRINO-PDS의 제조
이리노테칸(Irinotecan: IRINO, 200 mg, 0.48 mmol)을 실온에서 16시간 동안 DMAP(294.5 mg, 2.41 mmol)/DCM 용액 존재 하에 PDS_NO2(329.7 mg, 0.9 mmol)와 반응시킨 후 IRINO-PDS를 제조하였다. 상기 IRINO-PDS를 실리카 컬럼크로마토그라피 과정을 통하여 분리하였다.
상기 반응을 이하의 반응식 5에 나타내었다.
[반응식 5]
Figure PCTKR2022015283-appb-img-000009
단계 2. IRINO-GSH의 제조
상기 IRINO-PDS(10 mg, 0.0162 mmol)를 실온에서 24시간 동안 pH 7.4 PBS 용액 존재 하에 GSH(5.32 mg, 0.0177 mmol)와 반응시켰다. 침전물을 필터링한 후 실리카 컬럼크로마토그라피 과정을 통하여 GSH-IRINO를 분리하였다.
상기 반응을 이하의 반응식 6에 나타내었다.
[반응식 6]
Figure PCTKR2022015283-appb-img-000010
실시예 4. TOPOT-GSH 복합체의 제조
단계 1. TOPOT-PDS의 제조
토포테칸(Topotecan: TOPOT, 200 mg, 0.52 mmol)을 실온에서 16시간 동안 DMAP(294.5 mg, 2.41 mmol)/DCM 용액 존재 하에 PDS_NO2(329.7 mg, 0.9 mmol)와 반응시킨 후 TOPOT-PDS를 제조하였다. 상기 TOPOT-PDS를 실리카 컬럼크로마토그라피 과정을 통하여 분리하였다.
상기 반응을 이하의 반응식 7에 나타내었다.
[반응식 7]
Figure PCTKR2022015283-appb-img-000011
단계 2. TOPOT-GSH의 제조
상기 TOPOT-PDS(10 mg, 0.0175 mmol)를 실온에서 24시간 동안 pH 7.4 PBS 용액 존재 하에 GSH(5.43 mg, 0.019 mmol)와 반응시켰다. 침전물을 필터링한 후 실리카 컬럼크로마토그라피 과정을 통하여 GSH-TOPOT를 분리하였다.
상기 반응을 이하의 반응식 8에 나타내었다.
[반응식 8]
Figure PCTKR2022015283-appb-img-000012
실시예 5. N201-GSH 복합체의 제조
단계 1. N201-PDS의 제조
뉴트린 유도체(N201, 200 mg, 0.42 mmol)를 실온에서 16시간 동안 DMAP(281.2 mg, 2.21 mmol)/DCM 용액 존재 하에 PDS_NO2(313.2 mg, 0.87 mmol)와 반응시킨 후 N201-PDS를 제조하였다. 상기 N201-PDS를 실리카 컬럼크로마토그라피 과정을 통하여 분리하였다.
상기 반응을 이하의 반응식 9에 나타내었다.
[반응식 9]
Figure PCTKR2022015283-appb-img-000013
단계 2. N201-GSH의 제조
상기 N201-PDS(10 mg, 0.0157 mmol)를 실온에서 24시간 동안 pH 7.4 PBS 용액 존재 하에 GSH(5.43 mg, 0.019 mmol)와 반응시켰다. 침전물을 필터링한 후 실리카 컬럼크로마토그라피 과정을 통하여 GSH-N201을 분리하였다.
상기 반응을 이하의 반응식 10에 나타내었다.
[반응식 10]
Figure PCTKR2022015283-appb-img-000014
실시예 6. 전구체 약물 나노입자 마이셀 제조
상기 실시예 1.에서 제조된 CPT-GSH 10 mg을 디메틸 설폭사이드(dimethyl sulfocide: DMSO) 0.1 ml에 녹인후, PBS 10 ml에 혼합한 후 상온에서 1시간동안 교반시켰다. 혼합된 용액을 2일간 PBS에서 인공투석(dialysis)하여, CPT-GSH 마이셀을 제조하였다.
실시예 7. 글루타치온-S-전이효소(glutathione-S-transferase, GST); 및 표피 성장인자 수용체(epidermal growth factor receptor: EGFR)의 애피바디를 포함하는 융합 단백질(GST-EGFR)로 표면이 개질된 마이셀 제조
상기 실시예 6에서 제조한 마이셀을 GST-EGFR로 표면을 개질하여, GST-EGFR로 표면 개질된 마이셀(이하, CPT-GSH@GST-EGFR)을 제조하였다.
보다 구체적으로, 인간 표피 성장인자 수용체 2(epidermal growth factor receptor 2: EGFR2)에 특이적으로 결합하는 애피바디(VDNKFNKEMWAAWEEIRNLPNLNGWQMTAFIASLVDDPSQSANLLAEAKKLNDAQAPK; 서열번호 43)를 암호화하는 유전자의 말단에 링커 도메인(SGGGSGGGSGGGSGGGSGGGSGGG; 서열번호 44)을 암호화하는 유전자를 결합시킨 다음, pBT7 플라스미드에 삽입하였다. 또한, GST 과발현을 위해, GST의 N-말단에 6ХHis 태그가 연결되도록 디자인한 GST 암호화 유전자를 상기 pBT7-N-His 플라스미드에 삽입하여, 상기 애피바디와 GST가 링커로 연결된 융합 단백질(GST-EGFR)의 과발현을 위한 플라스미드를 구축하였다.
구축된 플라스미드에서 PCR 및 DNA 서열분석을 통해 GST-EGFR 암호화 서열이 정상적으로 삽입되었는지 확인한 후, 구축된 플라스미드를 E. coli BL21(DE3)RIL 균주에 삽입하여 배양하였다. 그 후, IPTG를 처리하고 30 ℃에서 16 시간 동안 배양하여 GST-EGFR의 과발현을 유도하였다. 과발현 유도된 E. coli 세포를 5000Хg로 4 ℃에서 10 분간 원심분리하여 침전된 세포를 수득하고, 인산염 완충용액(50 mM 인산 나트륨 및 100 mM 염화 나트륨, pH 6.5)에서 상기 세포를 현탁하였다. 세포 현탁액에 리소자임(lysozyme)을 처리하고 20 분간 실온에서 배양한 다음, 30 초 파쇄 및 1 분 간격으로 총 10 분간 초음파 파쇄하였다. 파쇄 후, 12000Хg로 4 ℃에서 1 시간 동안 원심분리하여 상층액을 GST-EGFR 포함 분획으로서 수득하였다. 수득한 상층액을 FPLC를 이용한 금속이온 친화 크로마토그래피(immobilized metal affinity chromatography; 1mL HisTrap FF 컬럼, GE HealthCare)로 정제하여 GST-EGFR을 분리하였다. 분리한 GST-EGFR를 PBS(pH 7.4)에서 밤새도록 투석하여 농축하고, 농축한 GST-EGFR를 SDS-PAGE 분석 및 ESI-TOF MS(electro spray ionization time-of-light mass spectrometry) 분석을 통해 분리한 단백질의 순도 및 분자량을 분석하였다. 그 결과, 99.0% 이상의 순도와 약 36.14 kDa의 분자량을 가짐을 확인하였다.
상기 정제하여 수득한 GST-EGFR를 50uM, 1 ㎖ PBS(pH 7.4)에 용해한 단백질 용액을 준비하여, 상기 실시예에서 제조한 나노입자 마이셀 CPT-GSH의 500 uM, 1 ㎖ PBS에 4 ℃에서 6 시간 동안 교반하면서, 천천히 가하여 혼합되도록 하여 CPT-GSH@GST-EGFR를 제조하고, 상기 CPT-GSH@GST-EGFR를 4 ℃에서 보관하였다.
실험예 1. 나노입자 마이셀의 특성 분석
상기 실시예 6에서 제조된 전구체 약물 나노입자 마이셀을 BioTEM 시스템(JEM 1400)의 투과전자현미경(Transmission Electron Microscopy: TEM) 및 동적 광 산란(Dynamic Light Scattering: DLS)으로 모양 및 크기를 관찰하였다. 그 결과 GSH-CPT 마이셀의 평균 입자 크기는 TEM으로 관찰하였을 때 30 내지 60 nm임을 확인하였고, DLS로 측정하였을 때 GSH-CPT 마이셀의 평균 크기는 약 160 nm임을 확인하였다. 그 결과를 도 2 및 도 3에 나타내었다.
도 2는 GSH-CPT 마이셀의 모식도이다.
도 3은 GSH-CPT 마이셀의 DLS 결과를 나타낸 그래프 및 TEM 이미지이다:
도 3a는 GSH-CPT 마이셀의 DLS 결과를 나타낸 그래프이고; 및 도 3b는 GSH-CPT 마이셀의 TEM 이미지이다.
도 2에 나타낸 바와 같이, GSH-CPT 나노입자는 50 내지 200 nm 크기의 마이셀 구조를 형성함을 확인하였다.
도 3a에 나타낸 바와 같이, GSH-CPT 마이셀을 DLS로 관찰하였을 때, GSH-CPT 마이셀의 평균 크기는 약 160 nm임을 확인하였다.
도 3b에 나타낸 바와 같이, GSH-CPT 마이셀을 TEM으로 관찰하였을 때, 30 내지 60 nm의 입자 크기를 갖는 GSH-CPT 마이셀 응집체를 형성함을 확인하였다.
또한, 제타 전위(Zeta potential) 측정에서 GSH-CPT 마이셀은 약 -7.74 mV의 표면 전하를 보였고, GST-EGFR은 약 -3.43 mV의 표면 전하를 보였으며, GSH-CPT 및 GST-EGFR의 비율이 20 : 1이 되도록 GST-EGFR로 표면이 개질된 CPT-GSH@GST-EGFR은 약 -3.52 mV의 표면 전하를 보임을 확인하였다. 그 결과를 도 4에 나타내었다.
도 4는 GSH-CPT 마이셀, GST-EGFR 및 GST-EGFR로 표면이 개질된 마이셀(도 3에서 Complex로 표시됨)의 제타 전위를 나타낸 이미지이다.
도 4에 나타낸 바와 같이, GSH-CPT 전구체 약물 나노입자 마이셀의 표면전하는 -7.74 mv이임을 확인하였다. 이는 수용액상에서 GSH가 표면에 위치한 전구체약물 나노입자 마이셀이 형성되었음을 의미한다. 또한, CPT-GSH@GST-EGFR의 제타 전위는 -3.52 mV로 GST-EGFR의 제타전위와 거의 동일함을 확인하였다.
실험예 2. 임계응집농도(critical aggregation concentration: CAC) 분석
상기 실시예 6.에서 제조된 전구체 약물 나노 입자 마이셀의 임계응집농도(CAC) 결정을 위한 형광 측정을 10 mM PBS 중에서 분광형광계로 판독하였다. 형광탐색자(fluorescence probe)로서 피렌(pyrene)을 사용하였고, 실온조건에서 PBS 중에서 GSH-CPT의 농도를 다양하게 하여 376 nm에서 GSH-CPT의 정상 상태 형광 여기 스펙트럼(steady state fluorescence excitation spectra)을 확인하였다. 그 결과를 도 5에 나타내었다.
도 5는 여러가지 농도의 GSH-CPT에서 정상 상태 형광 여기 스펙트럼(steady state fluorescence excitation spectra)을 나타낸 그래프이다.
또한, PBS 중에서 피렌 여기(pyrene excitation)의 I344/I339 비율의 플롯(plot)을 로그 값으로 나타내었다. 그 결과 GSH-CPT의 CAC 값은 3.7 uM임을 확인하고, 그 결과를 도 6에 나타내었다.
도 6은 GSH-CPT의 농도별 I344/I339 강도값을 비교하여 임계응집농도(CAC)를 조사한 결과를 나타낸 그래프이다.
실험예 3. 수용액상에서의 안정성 실험
상기 실시예 6.에서 제조된 전구체약물 나노 입자 마이셀의 수용액상에서의 안정성을 확인하기 위해 GSH-CPT 나노 입자 마이셀 100 μM을 PBS상에서 DLS로 30일동안 측정하였다. 그리고 30일 이후의 GSH-CPT 나노 입자 마이셀을 TEM으로 관찰하였다. 그 결과 DLS로 측정하였을 때 GSH-CPT 나노 입자 마이셀은 30일동안 150 내지 200 nm의 크기를 안정하게 유지함을 확인하였다. 그 결과를 도 7에 나타내었다.
또한, TEM으로 측정하였을 때 GSH-CPT 나노 입자 마이셀은 30 일 이후에도 30 내지 60 nm의 크기를 유지함을 확인하였다. 그 결과를 도 8에 나타내었다.
도 7은 시간의 흐름에 따른 GSH-CPT 마이셀의 DLS 결과를 나타낸 그래프이다.
도 8은 30일 이후의 GSH-CPT 마이셀의 TEM 이미지이다.
도 7에 나타낸 바와 같이, GSH-CPT 나노 입자 마이셀은 30 일동안 150 내지 200 nm의 크기를 안정하게 유지함을 확인하였다.
도 8에 나타낸 바와 같이, GSH-CPT 나노 입자 마이셀은 30 일 이후에도 20 내지 30 nm의 직경을 유지함을 확인하였다.
실험예 4. GST-EGFR로 표면이 개질된 마이셀의 특성 및 안정성 분석
4.1 GST-EGFR로 표면이 개질된 마이셀의 특성 분석
CPT-GSH@GST-EGFR에서 CPT-GSH와 GST-EGFR 간의 결합 친화도를 확인하기 위해, 등온 적정 열랑계(Isothermal titration calorimetry: ITC)를 통해 측정하고, 이를 도 9에 나타내었다.
보다 구체적으로, CPT-GSH 마이셀의 CAC 이상의 농도를 유지하기 위해 50 μM PBS 용액을 UV 마이크로 큐벳에 넣고, PBS 버퍼 중 GST-EGFR 500 μM을 세포에 적가하여 반응열을 측정하였다.
도 9는 CPT-GSH와 GST-EGFR 간의 결합 친화도를 나타낸 그래프이다.
도 9에 나타낸 바와 같이, CPT-GSH와 GST-EGFR의 해리 상수 Kd는 1.158 μM± 0.359 μM임을 확인하였다. 이는 CPT-GSH를 포함하는 마이셀과 GST-EGFR간의 강한 결합이 발생함을 의미한다.
4.2 CPT-GSH@GST-EGFR의 안정성 분석
GST-EGFR로 표면을 개질한 CPT-GSH@GST-EGFR의 구조적 안정성을 확인하기 위해, CPT-GSH를 포함하는 마이셀의 농도를 고정하고, GST-EGFR의 농도를 증가시키면서 복합체를 형성하였다. 그리고 상기 복합체의 구조를 DLS를 통해 측정하고 이를 도 10에 나타내었다.
추가로, GSH-CPT 및 GST-EGFR의 비율이 20 : 1이 되도록 GST-EGFR로 표면이 개질된 CPT-GSH@GST-EGFR에서 CPT-GSH의 농도(15 μM 및 150 μM)를 달리하여 DLS를 측정하여 CPT-GSH의 농도가 CPT-GSH@GST-EGFR의 형성에 영향을 미치지 않음을 확인하였고, 이를 도 11에 나타내었다.
도 10은 CPT-GSH를 포함하는 마이셀의 표면을 GST-EGFR의 농도를 달리하여 개질한 마이셀의 크기를 측정한 DLS 그래프이다.
도 10에 나타낸 바와 같이, CPT-GSH 및 GST-EGFR의 비율이 20 내지 10000 : 1인 경우, 마이셀 피크가 200 nm에서 관측되어, 모든 마이셀이 안정함을 확인하였다. 반면, CPT-GSH 및 GST-EGFR의 비율이 5 내지 10 : 1인 경우, 마이셀 피크가 10 nm 및 200 nm 모두에서 관측되어, 일부 마이셀에서 분해가 발생함을 확인하였다. 이는, CPT-GSH@GST-EGFR에서, CPT-GSH 및 GST-EGFR의 비율을 적어도 10 : 1로 하는 경우, 마이셀이 안정하게 형성됨을 의미한다.
도 11은 CPT-GSH@GST-EGFR에서 CPT-GSH의 농도가 15 μM, 또는 150 μM일 때의 마이셀의 크기를 측정한 DLS 그래프이다.
도 11에 나타낸 바와 같이, 이는 CPT-GSH의 농도가 15 μM인 경우와 150 μM인 경우 모두 동일한 위치에서 마이셀 피크가 관측됨을 확인하였다. 이와 같은 결과는 CPT-GSH의 농도가 GST-EGFR로 표면이 개질된 마이셀의 안정성에 영향을 미치지 않음을 의미한다.
이에 더하여, CPT-GSH@GST-EGFR의 안정성을 측정하기 위해, DiO-DiI 염료의 형광 공명 에너지 전달(fluorescence resonance energy transfer: FRET)을 이용한 실험을 수행하였다.
보다 구체적으로, CPT-GSH를 포함하는 마이셀에 DiO-DiI 염료를 로딩한 후 GST-EGFR 단백질의 유무에 따른 FRET 강도를 측정하고, 그 결과를 도 12에 나타내었다.
도 12는 CPT-GSH 마이셀 및 CPT-GSH@GST-EGFR의 FRET 강도를 나타낸 그래프이다.
도 12에 나타낸 바와 같이, CPT-GSH@GST-EGFR과 CPT-GSH 마이셀은 FRET 강도에서 차이가 없음을 확인하였다. 이는 GST-EGFR로 표면이 개질된 마이셀이 안정함을 의미한다.
실험예 5. 삼중음성유방암(triple negative breast cancer: TNBC) 세포에 대한 선택적 항암 활성 확인
상기 실시예 6.에서 제조된 전구체약물 나노 입자 마이셀 및 이를 GST-EGFR로 표면 개질한 CPT-GSH@GST-EGFR의 선택적 항암 활성을 확인하였다.
보다 구체적으로, TNBC 세포주인 MDA-MB-231 세포 및 정상 마우스 섬유아세포인 NIH-3T3 세포를 ATCC에서 구입하고, 상기 MDA-MB-231 세포 및 NIH-3T3 세포를 10 % FBS 및 1 % 페니실린/스트렙토마이신(Life Technologies)을 포함하는 DMEM 배지에서 37 ℃ 및 10 %의 CO2의 조건 하에 배양하였다. 그리고 MDA-MB-231 세포 및 NIH-3T3 세포 각각에 CPT, CPT-GSH, 및 CPT-GSH@GST-EGFR을 처리하고, 96 시간 동안 각 세포를 인큐베이팅하였다. 그리고 MTT 어세이(MTT assay)를 통해 각 세포에 대한 CPT, CPT-GSH, 및 CPT-GSH@GST-EGFR의 세포독성을 조사하였다. 그리고 그 결과를 도 13에 나타내었다.
도 13은 CPT, CPT-GSH, 및 CPT-GSH@GST-EGFR의 MDA-MB-231 세포(왼쪽 그래프) 및 NIH-3T3 세포(오른쪽 그래프)에 대한 세포독성을 나타낸 그래프이다.
도 13에 나타낸 바와 같이, TNBC 세포주인 MDA-MB-231 세포에 대해 CPT-GSH 및 CPT-GSH@GST-EGFR 모두 CPT 만큼 높은 세포독성을 보임을 확인하였다. 특히, CPT-GSH@GST-EGFR에서 현저히 향상된 세포독성을 보임을 확인하였다: CPT의 IC50은 8.9 μM, CPT-GSH의 IC50은 18.7 μM, CPT-GSH@GST-EGFR의 IC50은 3.1 μM.
반면에, 정상 마우스 섬유아세포인 NIH-3T3 세포에서는 CPT-GSH@GST-EGFR의 IC50은 50 μM 초과, CPT-GSH의 IC50은 46.1 μM로 확인되어, CPT 보다 현저히 낮은 세포독성을 보임을 확인하였다: CPT의 IC50은 6.0 μM.
이러한 결과는, CPT-GSH 및 CPT-GSH@GST-EGFR를 이용하는 경우, 암세포만을 선택적으로 타겟할 수 있어, 약물만을 투여한 경우 대비 약물로 인한 부작용을 현저히 감소시킬 수 있음을 의미한다.
추가로, 공초점레이저 주사 현미경(confocal laser scanning microscope: CLSM)을 이용하여 CPT, CPT-GSH, 및 CPT-GSH@GST-EGFR의 세포 내제화(intracellular internalization) 정도를 측정하였다. 상기 공초점 레이저 스캐닝 현미경 이미지는 LSM780으로 촬영하였다.
보다 구체적으로, 30 μM의 CPT, 30 μM의 CPT-GSH, 및 30 μM의 CPT-GSH@GST-EGFR 각각을 MDA-MB-231 세포 및 NIH-3T3 세포에 6 시간 동안 처리한 후, 상기 세포에 Lysotracker Red DND-99를 처리하여 세포내이입(endocytosis)된 정도를 측정하였다. 그 결과, MDA-MB-231 세포의 경우, CPT-GSH@GST-EGFR에서 CPT 및 CPT-GSH보다 현저히 높은 녹색 강도(green intensity)가 측정되었다. 또한, CPT-GSH@GST-EGFR에서 Lysotracker와의 Pearson 계수(Pearson's coefficient)는 0.8로 높은 주업도를 보임을 확인하였다. 반면, NIH-3T3 세포의 경우, CPT, CPT-GSH 및 CPT-GSH@GST-EGFR 모두에서 녹생 강도가 관측되지 않음을 확인하였다. 또한, MDA-MB-231에 대한 타겟팅이 생체 내에서 많은 종류의 단백질이 존재하는 경우에도 효과적으로 유지되는지 확인하기 위해, 상기와 같이 혈청 조건에서 공초점레이저 주사 현미경을 이용하여 세포 내제화 정도를 측정하였다. 그 결과, 모든 실험 조건(bare, 10 %, 55 %)에서 높은 녹색 강도가 관찰되었다. 그리고 그 결과를 도 14에 나타내었다.
도 14는 MDA-MB-231 세포, NIH-3T3 세포, 및 55 %의 혈청에서 CPT-GSH@GST-EGFR의 세포 내제화를 측정한 이미지이다.
도 14에 나타낸 바와 같이, CPT-GSH, 및 CPT-GSH@GST-EGFR는 정상 세포주인 NIH-3T3 세포를 타겟팅하지 않으며, TNBC 세포주인 MDA-MB-231만을 선택적으로 타겟팅함으로써, 선택적인 항암활성을 보임을 확인하였다.
실험예 5. 종양(tumor) 표적화능 및 종양 성장 억제 확인
CPT-GSH@GST-EGFR의 종양에 대한 표적화능을 조사하기 위해, IR780을 CPT-GSH, CPT-GSH@GST 및 CPT-GSH@GST-EGFR에 각각 로딩하고, 상기 IR780이 로딩된 CPT-GSH, CPT-GSH@GST 및 CPT-GSH@GST-EGFR을 MDA-MB-231 종양 이종이식 누드 마우스 모델의 정맥에 주사하였다: 상기 CPT-GSH@GST는 CPT-GSH 마이셀의 표면을 애피바디가 결합되지 않은 GST로 개질한 마이셀이다. 주사 후 24 시간이 경과한 때, MDA-MB-231 마우스 모델의 종양 부위에서의 IR 780의 강도를 측정하였다. 또한, 주사 후 72 시간이 경과한 때, MDA-MB-231 마우스 모델의 기관(organ)에서의 IR 780의 강도를 측정하였다. 그 결과를 도 15에 나타내었다.
도 15는 CPT-GSH, CPT-GSH@GST 및 CPT-GSH@GST-EGFR가 투여된 마우스에서 IR780 강도를 측정한 이미지이다.
도 15에 나타낸 바와 같이, CPT-GSH, CPT-GSH@GST 및 CPT-GSH@GST-EGFR 모두에서 마우스의 다른 기관보다 종양 부위에서 마이셀이 많이 축적됨을 확인하였다. 특히, CPT-GSH@GST-EGFR가 CPT-GSH, CPT-GSH@GST 대비 마우스의 종양 부위에서 현저하게 많이 축적됨을 확인할 수 있었다.
또한, MDA-MB-231 마우스 모델에게 2 mg/kg의 CPT, 2 mg/kg의 CPT-GSH 및 2 mg/kg의 CPT-GSH@GST-EGFR을 각각 3일 간격으로 정맥주사로 투여한 후, CPT, CPT-GSH 및 CPT-GSH@GST-EGFR의 종양 성장 억제 효과를 측정하였다. 그리고, 투여 28 일이 경과한 때 각 마우스에서 종양세포를 절제한 후, 헤마톡실린 및 에오신(hematoxylin and eosin: H&E) 염색을 통해 종양세포의 양상을 조사하였다. 또한, 종양에 대한 TUNEL 분석(TUNEL assay kit)을 통해 종양 세포에서의 세포사멸 정도를 조사하였다. 그리고 그 결과를 도 16에 나타내었다.
도 16은 MDA-MB-231 마우스 모델에 CPT, CPT-GSH 및 CPT-GSH@GST-EGFR을 투여한 후 종양 성장 억제 효과를 확인한 이미지 및 그래프이다:
도 16a는 CPT, CPT-GSH 및 CPT-GSH@GST-EGFR의 투여에 따른 종양의 크기 변화를 나타난 이미지이고, 도 16b는 CPT, CPT-GSH 및 CPT-GSH@GST-EGFR의 투여에 따른 종양의 부피 및 무게 변화를 시간의 흐름에 따라 나타낸 그래프이며, 도 16c는 CPT, CPT-GSH 및 CPT-GSH@GST-EGFR를 투여한 종양 세포를 H&E 염색한 이미지이고, 도 16d는 CPT, CPT-GSH 및 CPT-GSH@GST-EGFR의 투여에 따른 종양 세포에서의 세포사멸 정도를 관찰한 TUNEL 분석 이미지이다.
도 16a 내지 도 16d에 나타낸 바와 같이, CPT, CPT-GSH 및 CPT-GSH@GST-EGFR 모두에서 종양 성장 억제 효과를 확인하였으며, 체중의 변화가 나타나지 않아 CPT, CPT-GSH 및 CPT-GSH@GST-EGFR 모두에서 부작용이 없음을 확인하였다. 특히, CPT-GSH@GST-EGFR에서 종양의 크기가 현저히 감소함을 확인하여, CPT-GSH@GST-EGFR의 종양 성장 억제능이 CPT, 및 CPT-GSH 대비 현저히 뛰어남을 확인하였다.
또한, H&E 염색을 통해 CPT-GSH@GST-EGFR을 처리한 종양 세포에서만 병리학적 손상이 관찰됨을 확인하였고, TUNEL 분석을 통해 CPT-GSH@GST-EGFR을 처리한 경우에만 TUNEL 양성 세포인 녹색 형광이 관찰됨을 확인하였다. 이는 CPT-GSH@GST-EGFR가 종양 선택적으로 아폽토시스(apoptosis)를 유도하여 선택적 항종양 효과를 나타냄을 의미한다.

Claims (18)

  1. 친수성 펩타이드(peptide);
    약물; 및
    상기 친수성 펩타이드와 상기 약물을 연결하는 하기 화학식 1로 표시되는 링커(linker)를 포함하는 마이셀(micelle):
    [화학식 1]
    Figure PCTKR2022015283-appb-img-000015
    상기 화학식 1에서, R1은 O, N 또는 S이고, x는 1 내지 10이다.
  2. 청구항 1에 있어서,
    상기 친수성 펩타이드는 2 내지 10개의 아미노산으로 구성된, 마이셀.
  3. 청구항 1에 있어서,
    상기 친수성 펩타이드는 서열번호 1 내지 31의 아미노산 서열로 이루어진 군으로부터 선택되는 어느 하나 이상의 펩타이드를 포함하는 것인, 마이셀.
  4. 청구항 1에 있어서,
    상기 약물은 항암제인, 마이셀.
  5. 청구항 4에 있어서,
    상기 항암제는 도세탁셀(docetaxel), 캄토테신(camptothecin), 파클리탁셀(paclitaxel), 플록슈리딘(floxuridine), 류프로리드(leuprolide), 졸레드로네이트(zoledronate), 독소루비신(doxorubicin), 시스플라틴(cisplatin), 베라파밀(verapamil), 플루오로우라실(fluorouracil), 옥살리플라틴(oxaliplatin), 다우노루비신(daunorubicin), 카보플라틴(carboplatin), 메소트렉세이트(methotrexalte), 빈크리스틴(vincristine), 젬시타빈(gemcitabine), 스트렙토조토신(streptozocin), 토포테칸(topotecan), 이리노테칸(irinotecan), 비노렐빈(vinorelbine), 하이드록시우레아(hydroxyurea), 발루비신(valrubicin), 독시플루리딘(doxifluridine), 빈블라스틴(vinblastin), 프레드니손(prednisone), 테스토스테론(testosterone), 미토산트론(mitoxantrone), 살리실레이트(salicylates), 덱사메타손(dexamethasone), 프레드니솔론(prednisolone), 코르티손(cortisone), 뉴트린(nutlin) 유도체, SN-38(7-에틸-10-하이드록시캄토테신(7-ethyl-10hydroxycamptothecin)), 벨로테칸(belotecan), 엑사테칸(exatecan), 루르토테칸(lurtotecan), 루비테칸(rubitecan), 9-아미노캄토테신(9-aminocamptothecin), 지마테칸(gimatecan), BNP-1530, DB-67, BN-80915, BN-80927, 코르티코스테로이드(corticosteroid) 및 이의 약학적으로 허용가능한 염으로 구성된 군으로부터 선택되는 어느 하나 이상인 것인, 마이셀.
  6. 청구항 1에 있어서,
    상기 마이셀의 크기는 50 내지 200 nm인, 마이셀.
  7. 청구항 1에 있어서,
    상기 마이셀은 글루타치온-S-전이효소(glutathione-S-transferase, GST); 및
    표적 세포 또는 표적 단백질 결합능을 갖는 단백질을 포함하는 융합 단백질로 표면개질된 것인, 마이셀.
  8. 청구항 7에 있어서,
    상기 융합 단백질로 표면개질된 마이셀은 친수성 펩타이드 및 융합단백질의 비가 적어도 10 : 1로 혼합된 것인, 마이셀.
  9. 청구항 7에 있어서,
    상기 표적 세포 또는 표적 단백질 결합능을 갖는 단백질은 수용체 타이로신 카이네이즈(Receptor tyrosine kinases: RTKs)에 특이적으로 결합하는 항체, 항원 결합 단편, 애피바디(affibody), 다이아바디(diabody) 또는 앱타머(aptamer)인 것인, 마이셀.
  10. 친수성 펩타이드(peptide);
    약물; 및
    상기 친수성 펩타이드와 상기 약물을 연결하는 하기 화학식 1로 표시되는 링커(linker)를 포함하는 마이셀(micelle)을 유효성분으로 포함하는, 암 예방 또는 치료용 약학적 조성물:
    [화학식 1]
    Figure PCTKR2022015283-appb-img-000016
    상기 화학식 1에서, R1은 O, N 또는 S이고, x는 1 내지 10이다.
  11. 청구항 10에 있어서,
    상기 친수성 펩타이드는 2 내지 10개의 아미노산으로 구성된, 암 예방 또는 치료용 약학적 조성물.
  12. 청구항 10에 있어서,
    상기 약물은 항암제인, 암 예방 또는 치료용 약학적 조성물.
  13. 청구항 10에 있어서,
    상기 마이셀의 크기는 50 내지 200 nm인, 암 예방 또는 치료용 약학적 조성물.
  14. 청구항 10에 있어서,
    상기 마이셀은 글루타치온-S-전이효소(glutathione-S-transferase, GST); 및
    표적 세포 또는 표적 단백질 결합능을 갖는 단백질을 포함하는 융합 단백질로 표면개질된 것인, 암 예방 또는 치료용 약학적 조성물.
  15. 청구항 14에 있어서,
    상기 융합 단백질로 표면개질된 마이셀은 친수성 펩타이드 및 융합단백질의 비가 적어도 10 : 1로 혼합된 것인, 암 예방 또는 치료용 약학적 조성물.
  16. 청구항 14에 있어서,
    상기 표적 세포 또는 표적 단백질 결합능을 갖는 단백질은 수용체 타이로신 카이네이즈(Receptor tyrosine kinases: RTKs)에 특이적으로 결합하는 항체, 항원 결합 단편, 애피바디(affibody), 다이아바디(diabody) 또는 앱타머(aptamer)인 것인, 암 예방 또는 치료용 약학적 조성물.
  17. 친수성 펩타이드(peptide);
    약물; 및
    상기 친수성 펩타이드와 상기 약물을 연결하는 하기 화학식 1로 표시되는 링커(linker)를 포함하는 마이셀(micelle)을 유효성분으로 포함하는 조성물을 개체에 투여하는 단계를 포함하는 암을 예방 또는 치료하는 방법:
    [화학식 1]
    Figure PCTKR2022015283-appb-img-000017
    상기 화학식 1에서, R1은 O, N 또는 S이고, x는 1 내지 10이다.
  18. 친수성 펩타이드(peptide);
    약물; 및
    상기 친수성 펩타이드와 상기 약물을 연결하는 하기 화학식 1로 표시되는 링커(linker)를 포함하는 마이셀(micelle)을 암 예방 또는 치료에 사용하기 위한 치료제의 제조에 사용하기 위한 용도:
    [화학식 1]
    Figure PCTKR2022015283-appb-img-000018
    상기 화학식 1에서, R1은 O, N 또는 S이고, x는 1 내지 10이다.
PCT/KR2022/015283 2022-03-29 2022-10-11 친수성 펩타이드를 포함하는 마이셀 및 이의 용도 WO2023191209A1 (ko)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR20220039190 2022-03-29
KR10-2022-0039190 2022-03-29

Publications (1)

Publication Number Publication Date
WO2023191209A1 true WO2023191209A1 (ko) 2023-10-05

Family

ID=88203004

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2022/015283 WO2023191209A1 (ko) 2022-03-29 2022-10-11 친수성 펩타이드를 포함하는 마이셀 및 이의 용도

Country Status (2)

Country Link
KR (1) KR20230141412A (ko)
WO (1) WO2023191209A1 (ko)

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2019107896A1 (ko) * 2017-11-28 2019-06-06 울산과학기술원 글루타치온-ｓ-전이효소 및 표적 세포 또는 표적 단백질 결합능을 갖는 단백질을 포함하는 융합 단백질 및 이의 용도
CN110314237A (zh) * 2018-03-30 2019-10-11 烟台药物研究所 一种还原响应型肿瘤靶向多肽药物偶联物及其制备方法和应用
WO2020219498A1 (en) * 2019-04-22 2020-10-29 The Johns Hopkins University Tubular supramolecular polymers
WO2021007435A1 (en) * 2019-07-10 2021-01-14 Cybrexa 2, Inc. Peptide conjugates of cytotoxins as therapeutics
WO2021158780A1 (en) * 2020-02-04 2021-08-12 The Johns Hopkins University Self-assembling prodrugs as immune boosters for cancer immunotherapy

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2019107896A1 (ko) * 2017-11-28 2019-06-06 울산과학기술원 글루타치온-ｓ-전이효소 및 표적 세포 또는 표적 단백질 결합능을 갖는 단백질을 포함하는 융합 단백질 및 이의 용도
CN110314237A (zh) * 2018-03-30 2019-10-11 烟台药物研究所 一种还原响应型肿瘤靶向多肽药物偶联物及其制备方法和应用
WO2020219498A1 (en) * 2019-04-22 2020-10-29 The Johns Hopkins University Tubular supramolecular polymers
WO2021007435A1 (en) * 2019-07-10 2021-01-14 Cybrexa 2, Inc. Peptide conjugates of cytotoxins as therapeutics
WO2021158780A1 (en) * 2020-02-04 2021-08-12 The Johns Hopkins University Self-assembling prodrugs as immune boosters for cancer immunotherapy

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
JINQIANG WANG, SHIQI HU, WEIWEI MAO, JIAJIA XIANG, ZHUXIAN ZHOU, XIANGRUI LIU, JIANBIN TANG, YOUQING SHEN: "Assemblies of Peptide-Cytotoxin Conjugates for Tumor-Homing Chemotherapy", ADVANCED FUNCTIONAL MATERIALS, WILEY - V C H VERLAG GMBH & CO. KGAA, DE, vol. 29, no. 7, 1 February 2019 (2019-02-01), DE , pages 1807446, XP055727021, ISSN: 1616-301X, DOI: 10.1002/adfm.201807446 *

Also Published As

Publication number Publication date
KR20230141412A (ko) 2023-10-10

Similar Documents

Publication Publication Date Title
CN111065621B (zh) 制备抗体-药物缀合物的新方法
WO2019107896A1 (ko) 글루타치온-ｓ-전이효소 및 표적 세포 또는 표적 단백질 결합능을 갖는 단백질을 포함하는 융합 단백질 및 이의 용도
KR20180110645A (ko) 피롤로벤조디아제핀 이량체 전구체 및 이의 리간드-링커 접합체 화합물
TWI814699B (zh) 四級胺化妥布賴森(tubulysin)化合物之結合物
WO2017188731A1 (ko) 경구 투여용 유전자 전달을 위한 나노입자 및 이를 포함하는 약학 조성물
KR20200084802A (ko) 안전성이 향상된 피롤로벤조디아제핀 이량체 화합물 및 이의 용도
WO2019078611A1 (ko) Cas9 단백질, SRD5A2 유전자의 발현을 억제하는 가이드 RNA 및 양이온성 폴리머의 복합체가 봉입된 나노 리포좀-마이크로버블 결합체 및 이를 함유하는 탈모 개선 또는 치료용 조성물
WO2023191209A1 (ko) 친수성 펩타이드를 포함하는 마이셀 및 이의 용도
JP2023542382A (ja) がんの処置に有用なｓｎ３８のペプチド性コンジュゲート
WO2023055155A1 (ko) 혈액 뇌장벽 투과용 펩타이드 및 이의 용도
WO2003097635A1 (en) Processes for preparing 3-substituted 1-(chloromethyl)-1,2-dihydro-3h-[ring fused indol-5-yl(amine-derived)] compounds and analogues thereof, and to products obtained therefrom
WO2023048453A1 (ko) 약물 이합체를 포함하는 나노입자 및 이의 용도
WO2016068617A1 (ko) 폴리올계 삼투압적 폴리디자일리톨 폴리머 유전자 전달체 및 이의 용도
WO2022260480A1 (ko) 타겟 세포 내로 올리고뉴클레오티드를 전달하기 위한 펩타이드-지질의 결합체를 포함하는 나노입자 및 이를 포함하는 약학적 조성물
WO2019216744A2 (ko) 클릭화학 반응을 통해 필러 또는 약물전달체로 사용하기 위한 주사제형 조성물
WO2022005179A1 (ko) 혈액-뇌 장벽 침투 압타머 및 이의 이용
WO2022139071A1 (ko) 신규한 세포 투과성 펩타이드 및 이의 용도
WO2021167308A2 (ko) 항암제 프로드러그 컨쥬게이트의 새로운 용도
WO2018212540A2 (ko) 세포투과능이 향상된 리피바디-항암 단백질 약물 복합체, 그 제조방법 및 용도
WO2024054062A1 (ko) 세포 내 형질주입을 위한 신규한 폴리펩타이드 조성물
WO2017188653A1 (en) Fusion protein comprising ccl3 variant and use thereof cross-reference to related applications
WO2023277575A1 (ko) 신규한 세포 투과성 펩타이드 및 이의 용도
WO2021049920A1 (ko) 표면개질된 세포외 소포체 및 이를 포함하는 조성물
WO2021020945A1 (ko) 항암제 및 다공성 실리카 입자의 제조방법
WO2024019441A1 (ko) 세포 유래 베지클 및 리포좀 융합 하이브리드 나노입자 및 이의 용도

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22935883

Country of ref document: EP

Kind code of ref document: A1