WO2022235140A1 - 단일사슬항체조각 및 페리틴의 융합단백질을 포함하는 나노입자 및 이의 용도 - Google Patents

단일사슬항체조각 및 페리틴의 융합단백질을 포함하는 나노입자 및 이의 용도 Download PDF

Info

Publication number
WO2022235140A1
WO2022235140A1 PCT/KR2022/006597 KR2022006597W WO2022235140A1 WO 2022235140 A1 WO2022235140 A1 WO 2022235140A1 KR 2022006597 W KR2022006597 W KR 2022006597W WO 2022235140 A1 WO2022235140 A1 WO 2022235140A1
Authority
WO
WIPO (PCT)
Prior art keywords
ferritin
fusion protein
protein
nanoparticles
hrid
Prior art date
Application number
PCT/KR2022/006597
Other languages
English (en)
French (fr)
Inventor
성백린
정상전
김민진
강효진
김가현
김영석
이제호
Original Assignee
연세대학교 산학협력단
성균관대학교 산학협력단
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 연세대학교 산학협력단, 성균관대학교 산학협력단 filed Critical 연세대학교 산학협력단
Priority to KR1020237042487A priority Critical patent/KR20240008333A/ko
Publication of WO2022235140A1 publication Critical patent/WO2022235140A1/ko

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/22—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against growth factors ; against growth regulators
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/32—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products of oncogenes
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/70—Vectors or expression systems specially adapted for E. coli
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/93—Ligases (6)
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622—Single chain antibody (scFv)
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/70—Fusion polypeptide containing domain for protein-protein interaction
    • C07K2319/735—Fusion polypeptide containing domain for protein-protein interaction containing a domain for self-assembly, e.g. a viral coat protein (includes phage display)
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/85—Fusion polypeptide containing an RNA binding domain

Definitions

  • the present invention relates to an N-terminal domain RID (RNA-interaction domain) of ferritin, a single-chain antibody fragment linked to the N-terminus of ferritin, and a human-derived lysyl tRNA synthetase coupled to the N-terminus of the single-chain antibody fragment. It relates to a fusion protein comprising a fusion protein, self-assembled nanoparticles of the fusion protein, an expression vector containing a nucleotide encoding the fusion protein, and novel uses thereof.
  • the fusion protein and nanoparticles of the present invention have the advantage of greatly enhancing water solubility by using RID, and by varying the origin of single-chain antibody fragments, a pharmaceutical composition for treating a desired disease can be prepared.
  • Viruses are largely divided into two types: enveloped viruses and non-enveloped viruses.
  • the viral epidermis consists only of capsid proteins, and thus self-assembly into VLPs is possible only with capsid proteins.
  • enveloped viruses essentially require a membrane component to form a virus. Therefore, for self-assembly into virus-like particles (VLPs), membrane components are required in addition to surface antigens. That is, in the envelope-virus-like particle (VLP) self-assembly process, not only the folding of the monomeric antigen protein but also its lipid membrane is essential.
  • the lipid membrane is structurally non-uniform and difficult to characterize, so the formation of VLPs could only be generated in higher cells (animal cells, insect cells, human-derived cells, yeast, etc.). Therefore, there is a need for a method for commonly constructing various antigenic proteins by recombination and expression of a self-assembling protein as a scaffold instead of a membrane component.
  • Ferritin is present in most biological species and has the characteristic of self-assembling to form nanoparticles.
  • viral nanoparticles were formed in eukaryotic cells (insects and animal cells) using human-derived ferritin or Helicobacter pylori ferritin (L. He, N. de Val et al.: Presenting nativelike trimeric HIV).
  • -1 antigens with self-assembling nanoparticles Nat Commun, 7, 12041 (2016) doi:10.1038/ncomms12041, H. M. Yassine et al.: Hemagglutinin-stem nanoparticles generate heterosubtypic influenza protection. Nature medicine, 21(9), 1065-1070 (2015)).
  • the eukaryotic cell production system has problems such as high cost, low productivity, and difficult mass production process.
  • the present inventors intend to solve the above problem and use the nanoparticles prepared through this as a disease-specific therapeutic agent.
  • An object of the present invention to solve the problems of the prior art is to produce a single-chain variable fragment, which is difficult to express in water-soluble in E. coli, in a water-soluble manner, and to self-assemble to form a stable nanoparticle.
  • Another object of the present invention is to provide a method for preparing a water-soluble fusion protein and nanoparticles using the recombinant expression vector and host cell.
  • Another object of the present invention is to provide a pharmaceutical composition for the prevention, improvement or treatment of diseases comprising the nanoparticles prepared by the above manufacturing method.
  • the present inventors used RID (RNA-interaction domain) among human-derived lysyl tRNA synthetase at the N-terminus of a single-chain variable fragment as a novel fusion partner, and at the N-terminus of ferritin, the single A fusion protein to which a chain antibody fragment is bound, a nanoparticle in which the fusion protein is self-assembled, and an expression vector thereof were prepared, and using this, an insoluble single-chain variable fragment, which was difficult to produce in the prior art, can be refolded without refolding. It was produced with water solubility.
  • RID RNA-interaction domain
  • ferritin (ferritin) protein a single-chain variable fragment binding to the N-terminus of the ferritin; and an N-terminal domain (hLysRS Nterminal appended RNA interacting domain; hRID) separated from a human-derived lysyl tRNA synthetase, bound to the N-terminus of the single-chain antibody fragment, the nanoparticles are provided.
  • a recombinant expression vector comprising a polynucleotide encoding is provided.
  • the type of the single-chain antibody fragment of the present invention is not limited, but most preferably from any one antibody selected from the group consisting of Trastuzumab, Bevacizumab and Pertuzumab. it is derived
  • the hRID may be represented by the amino acid sequence of SEQ ID NO: 1
  • the ferritin protein may be represented by the amino acid sequence of SEQ ID NO: 4.
  • the vector may include a linker between the polynucleotide encoding the single-chain antibody fragment (scFv) and the polynucleotide encoding the ferritin.
  • the linker may be represented by an amino acid sequence represented by any one of the nucleotide sequences of SEQ ID NOs: 8 to 10.
  • the present invention also provides a host cell transformed with the expression vector.
  • the host cell may be used without limitation any host cell readily available to those skilled in the art to which the present invention belongs, but preferably, the host cell is Escherichia bacterium, Bacillus genus bacteria, It may be selected from the group consisting of Pseudomonas genus bacteria, lactic acid bacteria, yeast, animal cells and insect cells, and most preferably Escherichia coli.
  • ferritin (ferritin) protein a single-chain variable fragment bound to the N-terminus of the ferritin protein; and an N-terminal domain (hLysRS N-terminal appended RNA interacting domain; hRID) isolated from human lysyl tRNA synthetase, bound to the N-terminus of the single-chain antibody fragment; expression comprising a polynucleotide encoding preparing a vector; (b) introducing the expression vector into a host cell to prepare a transformant; (c) inducing expression of a single chain antibody fragment (scFv)-ferritin fusion protein by culturing the transformant; and (d) purifying nanoparticles formed by self-assembly of the expressed single-chain antibody fragment-ferritin fusion protein;
  • the present invention also provides a pharmaceutical composition for improving or treating a disease comprising the nanoparticles.
  • the disease may be specified differently depending on the type of the single-chain antibody fragment, and when the single-chain variable fragment is derived from Bevacizumab, cancer (especially colon cancer, lung cancer, Glioblastoma, renal cell carcinoma) or eye disease (eg, macular degeneration) may be the target disease to be treated (target disease).
  • cancer especially, breast cancer or metastatic gastric cancer
  • target disease target disease
  • the target disease may include, but is not limited to, cancers such as breast cancer, ovarian cancer, and ovarian cancer.
  • the present invention provides a method for preventing or treating a target disease comprising administering the self-assembled nanoparticles.
  • the therapeutically effective amount is the type and extent of the response to be achieved, the specific composition including whether other agents are used if necessary, the individual's age, weight, general health status, sex and diet, administration time, administration route, and composition It is preferable to apply differently depending on various factors including the secretion rate, treatment period, and drugs used or concurrently with a specific composition and similar factors well known in the pharmaceutical field. Therefore, it is preferable to determine the effective amount of the composition suitable for the purpose of the present invention in consideration of the foregoing.
  • the subject is applicable to any mammal, and the mammal includes not only humans and primates, but also domestic animals such as cattle, pigs, sheep, horses, dogs and cats.
  • the vector for preparing self-assembled nanoparticles or fusion proteins according to the present invention can significantly enhance the water-soluble expression of single-chain variable fragment-ferritin fusion proteins and self-assembled nanoparticles in host cells, and the production efficiency can be increased.
  • the fusion protein expressed according to the vector of the present invention forms nanoparticles through self-assembly, and the formed nanoparticles present a single-chain variable fragment on the surface (surface expression), It is highly chemical and thus increases the efficiency of various immune responses, and thus can be used as a vaccine and therapeutic agent.
  • FIG. 1 is a schematic diagram of a vector encoding a fusion protein according to the present invention.
  • FIG. 1A shows a case in which scfv is derived from Bevacizumab
  • FIG. 1B is a case in which scfv is derived from Trastuzumab
  • FIG. 2B shows a case in which scfv is derived from Pertuzumab.
  • FIG. 2 shows the structure of the linker according to the type of scfv and the three-dimensional structure when the linker is combined with scfv according to an embodiment of the present invention.
  • FIG. 3 is an image confirming the solubility of RID and scfv fusion proteins.
  • Figure 3a shows the water solubility of the hRID-Bevacizumab scfv-ferritin fusion protein
  • Figure 3b shows the water solubility of the hRID-Trastuzumab scfv- ferritin fusion protein
  • Figure 3c shows the water solubility of the hRID-pertuzumab scfv- ferritin fusion protein.
  • FIG. 4 is an image confirming the separation of hRID-Bevacizumab scfv-ferritin fusion protein.
  • Figure 4a the chromatogram results when the hRID-Bevacizumab scfv- ferritin fusion protein eluted by nickel affinity chromatography was purified by ion resin exchange chromatography was confirmed, and
  • Figure 4b shows the results of size exclusion chromatography.
  • 5 is an image confirming the separation of hRID-Trastuzumab scfv- ferritin fusion protein.
  • 5a shows the chromatogram results when the hRID-Trastuzumab scfv-ferritin fusion protein eluted by nickel affinity chromatography was purified through ion resin exchange chromatography
  • FIG. 5b shows the size exclusion chromatography results.
  • 6 is an image confirming the isolation of hRID-pertuzumab scfv-ferritin fusion protein.
  • 6a shows the chromatogram results when the hRID-pertuzumab scfv-ferritin fusion protein eluted by nickel affinity chromatography was purified through ion resin exchange chromatography, and
  • FIG. 6b shows the size exclusion chromatography results.
  • FIG. 7 is a transmission electron microscope image of nanoparticles formed by self-assembly of hRID-Bevacizumab scfv-ferritin fusion protein, hRID-Trastuzumab scfv-ferritin fusion protein, and hRID-pertuzumab scfv-ferritin fusion protein.
  • 9 is a graph comparing the binding affinity of hRID-Bevacizumab scfv-ferritin (HFH; Human Ferritin heavy chain) fusion protein by ELISA analysis. 9 shows the folding and binding affinities of hRID(W)-Bevacizumab scfv-ferritin (HFH) fusion protein nanoparticles, hRID(9M)-Bevacizumab scfv-ferritin (HFH) fusion protein nanoparticles, and Bevacizumab scfv according to antibody concentration. indicates.
  • HH Human Ferritin heavy chain
  • FIG. 10 is a graph comparing the binding affinity of hRID-pertuzumab scfv-ferritin fusion protein nanoparticles to a target by SPR analysis.
  • VEGF vascular endothelial growth factor
  • FIG. 12 shows the choroidal flat-mount immunofluorescence image obtained 14 days after intravitreal injection of a drug into the eye of a mouse with laser-induced choroidal neovascularization and the average area of the measured choroidal neovascularization.
  • 13 is a saline, 120nM ScFv, 600nM ScFv, 120nM ScFv-Ferritin, 600nM ScFv-Ferritin fusion protein nanoparticles into the eyes of mice, respectively, and the distribution of scFv in the retina on day 1 and day 7 using a confocal microscope. observed image.
  • FIG. 14 shows the stability of fusion protein nanoparticles according to hRID.
  • 14a shows the hRID-dependent stability of the hRID-Bevacizumab scfv-ferritin fusion protein nanoparticles
  • FIG. 14b shows the hRID-dependent stability of the hRID-Trastuzumab scfv-ferritin fusion protein nanoparticles
  • FIG. 14c shows the hRID-pertuzumab scfv-ferritin fusion
  • the stability of protein nanoparticles according to hRID is compared.
  • 15 is an image of purified fusion protein nanoparticles including hRID.
  • 15A is an image showing the purification results of hRID-Bevacizumab scfv-ferritin fusion protein nanoparticles in the case of wild-type (w) and mutant hRID (9m), respectively, and
  • FIG. 15B shows the results of size exclusion chromatography.
  • 16 is an image showing the purification results of each hRID- Trastuzumab scfv-ferritin fusion protein nanoparticles in the case where hRID is wild-type (w) and mutant hRID (9m) in the protein.
  • FIG. 17 shows TEM images of hRID-Bevacizumab scfv-ferritin fusion protein nanoparticles formed when hRID is wild-type (w) and mutant hRID (9m).
  • FIG. 18 is a graph comparing the binding affinity of hRID-Bevacizumab scfv-ferritin (HFL; Human Ferritin light chain) fusion protein by indirect ELISA analysis.
  • Figure 18 shows the folding of hRID(W)-Bevacizumab scfv-ferritin (HFL) fusion protein nanoparticles, hRID(9M)-Bevacizumab scfv-ferritin (HFL) fusion protein nanoparticles and Bevacizumab scfv according to the antibody concentration and binding to the target. indicates affinity.
  • FIG. 19 shows the target binding affinity of hRID-scFv-G3SG3TG3SG3-ferritin (scFv-HFL) nanoparticles, hRID-scFv (scFv) and hRID-HFL (HFL) according to an embodiment of the present invention; It is a graph analyzed by sandwich ELISA. The results were obtained by repeating the ELISA three times.
  • FIG. 20 is a schematic diagram showing a structure in which the fusion protein prepared according to an embodiment of the present invention forms nanoparticles by self-assembly.
  • blue represents an antibody heavy chain variable fragment of scfv
  • red represents an antibody light chain variable fragment.
  • the present invention provides a polynucleotide encoding a single-chain variable fragment; peptides for enhancing the expression efficiency of single-chain variable fragments; and ferritin bound to the 3'-end of the polynucleotide encoding a single-chain variable fragment; provides an expression vector for preparing self-assembled nanoparticles comprising.
  • FIGS. 1A to 1C are structures of an expression vector according to the present invention ( FIGS. 1A to 1C ), wherein hRID is cleaved after promoting solubility and folding of a single-chain variable fragment-ferritin fusion protein monomer. Thereafter, the monomer may be appropriately folded to form a trimer structure, and eight trimers may be assembled to form nanoparticles. That is, according to the present invention, the nanoparticles of the present invention may contain one or more and 24 or less single-chain variable fragment-ferritin fusion protein monomers, and preferably, the fusion protein monomer is a trimer. , nanoparticles including the 8 trimers (including a total of 24 fusion protein fragments) can be prepared. On the surface of the nanoparticles, 24 single-chain variable fragment-ferritin fusion proteins can be expressed on the surface.
  • antibody includes immunoglobulin molecules having antigen-binding ability with reactivity with a specific antigen, and includes both polyclonal and monoclonal antibodies.
  • the term also includes forms produced by genetic engineering such as chimeric antibodies (eg, humanized murine antibodies) and heterologous antibodies (eg, bispecific antibodies).
  • Antibodies are structurally composed of heavy and light chains, each of which includes a constant region and a variable region.
  • the variable regions of the heavy and light chains include three variable regions called “complementarity determining regions (CDRs)” and four “framework regions”.
  • single chain variable fragment is not a general fragment formed from an antibody, but a fragment including the variable region of the heavy chain constituting the antibody and the variable region of the light chain. It is a fusion protein constructed by artificially fusing fragments containing
  • the type of the single-chain antibody fragment is not limited as long as the nucleic acid or amino acid sequence is known.
  • they are single-chain antibody fragments of Trastuzumab, Bevacizumab and Pertuzumab.
  • the "single-chain variable fragment” of the present invention is a protein that those skilled in the art want to produce in large quantities, and inserts a polynucleotide encoding the protein into a recombinant expression vector to produce all proteins that can be expressed in a host cell. it means.
  • "single-chain variable fragment” is expressed in a fusion form with ferritin in a host cell and may be located on the surface of nanoparticles self-assembled by ferritin.
  • the "peptide for enhancing the expression efficiency of single-chain variable fragment" of the present invention can express a fusion protein of single-chain variable fragment and ferritin in a water-soluble form
  • a fusion protein of single-chain variable fragment and ferritin in a water-soluble form
  • Glutathione S transferase GST
  • maltose binding protein ubiquitin
  • taoredoxin etc.
  • fusion proteins such as rRID, mRID, hRID, LysRS, and most preferably
  • rRID mRID
  • hRID hRID
  • LysRS a fusion protein
  • it may be configured to include the amino acid sequence of an N-terminal domain (hLysRS N-terminal appended RNA interacting domain; hRID) isolated from a human-derived lysyl tRNA synthetase.
  • RID RNA interaction domain
  • tag-RID represented by SEQ ID NO: 1 in which a tag sequence is bound to RID was used as a binding partner for soluble expression of single-chain antibody fragments (scFv) in bacteria.
  • a doublemutant hRID mutated (K19A, K23A) for K19 and K23 sites among 9 hRID domains and nine mutant hRIDs mutated with K19A, K23A, R24A, K27A, K30A, K31A, K35A, K38A, and K40A were created.
  • ferritin may be used without limitation as long as each of these proteins has an activity capable of forming a cage-type complex protein as a unit.
  • the ferritin protein or fragment is not limited as long as the activity capable of forming a cage-type complex protein is maintained, and HFL (human ferritin light chain) or HFH (human ferritin heavy chain) may be used.
  • the ferritin protein or fragment thereof of the present invention may be a protein or fragment formed by partially adding, deleting, or substituted amino acid residues in the amino acid sequence of SEQ ID NO: 2.
  • expression vector is a linear or circular DNA molecule consisting of fragments encoding a polypeptide of interest operably linked to additional fragments that serve for transcription of the expression vector. Such additional fragments include promoter and terminator sequences.
  • the expression vector also comprises one or more origins of replication, one or more selectable markers, polyadenylation signals, and the like. Expression vectors are generally derived from plasmid or viral DNA, or contain elements of both.
  • operably linked refers to the arrangement of fragments in a promoter to act to initiate transcription and progress through the coding sequence to the termination code.
  • the expression vector may be a plasmid, a viral vector, a phage particle or a genome insert. After the expression vector is transformed into a host cell, it can be cloned independently of the genome of the host cell or integrated into the genome of the host cell.
  • the vector may be constructed by further including a linker between the polynucleotide encoding a single-chain variable fragment and ferritin.
  • the linker is for attaching the single-chain antibody fragment (scFv) to a specific site at the C-terminus or N-terminus of the ferritin monomer fragment, and may consist of one to several amino acids.
  • the linker is introduced between the single-chain variable fragment and ferritin to minimize steric hindrance between the two domains, thereby improving the formation of trimeric and nanoparticle structures.
  • the nanoparticles are formed by the precise self-assembly of low-molecular-weight monoliths (monomers) and refer to cage-type particles made of proteins having a space therein.
  • the nanoparticles of the present invention are characterized in that they contain the single-chain antibody fragment (scFv)-ferritin fusion protein of the present invention as a unit constituting the cage.
  • self-assembly refers to the property of certain molecules to form specific nanostructures on their own without a special external stimulus or artificial induction.
  • the eight trimers are regularly arranged three-dimensionally, This may be formed by gathering 24 monomers.
  • a nucleic acid encoding a single-chain variable fragment-ferritin fusion protein or a recombinant vector containing the nucleic acid can transform or transfect a host cell.
  • nucleic acid or “polynucleotide” refers to deoxyribonucleotides or ribonucleotides in single or double-stranded form. Unless otherwise limited, known analogs of natural nucleotides that hybridize to nucleic acids in a manner analogous to naturally occurring nucleotides are also included.
  • the term "recombinant protein” or “fusion protein” refers to a single-chain antibody fragment (scFv) sequence in which another protein is linked to the N-terminus or C-terminus or has a different amino acid sequence.
  • the added protein preferably a monomeric protein (scFv-ferritin monomer) in which a single-chain antibody fragment (scFv) is bound to the N-terminus of the ferritin protein, or a single-chain antibody fragment ( scFv) and hRID to single-chain antibody fragment (hRID-scFv-ferritin monomer).
  • protein is used interchangeably with “peptide” or “polypeptide”, eg, refers to a polymer of amino acid residues as commonly found in naturally occurring proteins.
  • the recombinant vector of the present invention can be obtained by linking (inserting) the nucleic acid of the present invention to an appropriate vector.
  • the vector into which the nucleic acid of the present invention is inserted is not particularly limited as long as it can be replicated in a host.
  • plasmid DNA, phage DNA, and the like can be used.
  • Specific examples of the plasmid DNA include commercial plasmids such as pCDNA31+ (Invitrogen).
  • Other examples of plasmids that can be used in the present invention include E.
  • coli-derived plasmids pYG601BR322, pBR325, pUC118 and pUC119
  • Bacillus subtilis-derived plasmids pUB110 and pTP5
  • yeast-derived plasmids YEp13, YEp24 and YCp50.
  • phage DNA include ⁇ -phages (Charon4A, Charon21A, EMBL3, EMBL4, ⁇ gt10, ⁇ gt11 and ⁇ ZAP).
  • retroviruses animal viruses such as adenoviruses or vaccinia viruses, insect viruses such as baculoviruses can also be used.
  • a method of cutting the purified DNA with an appropriate restriction enzyme and inserting it into an appropriate restriction site or cloning site of the vector DNA may be used.
  • the nucleic acid of the present invention is preferably operably linked to a vector.
  • the vector of the present invention includes a cis element such as an enhancer, a splicing signal, a poly A addition signal, and a selection marker. ), and may further include a ribosome binding sequence (SD sequence) and the like.
  • SD sequence ribosome binding sequence
  • chloramphenicol-resistant nucleic acid, ampicillin-resistant nucleic acid, dihydrofolate reductase, neomycin-resistant nucleic acid, etc. may be used, but the additional components operably linked by the above examples are limited not.
  • the present invention provides a host cell transformed with the above-described expression vector.
  • the term 'transformation' refers to introducing DNA into a host so that DNA can be replicated as a factor of chromosomes or by chromosomal integration completion. It refers to a phenomenon that causes change.
  • transformation methods include CaCl2 precipitation, the CaCl2 method using a reducing material called DMSO (dimethyl sulfoxide), the Hanahan method with increased efficiency, electroporation, calcium phosphate precipitation, protoplast fusion, silicon carbide
  • DMSO dimethyl sulfoxide
  • electroporation calcium phosphate precipitation
  • protoplast fusion silicon carbide
  • agitation method using fiber agrobacterium mediated transformation method
  • transformation method using PEG dextran sulfate
  • lipofectamine lipofectamine
  • the method for transforming the single-chain variable fragment (Single-chain variable fragment)-ferritin fusion protein-encoding nucleic acid or vector comprising the same of the present invention is not limited to the above examples, and transformation commonly used in the art Alternatively, the transfection method may be used without limitation.
  • the transformant of the present invention can be obtained by introducing a target nucleic acid, a single-chain variable fragment, a nucleic acid encoding a ferritin fusion protein or a recombinant vector containing the same into a host.
  • the host is not particularly limited as long as it allows expression of the nucleic acid of the present invention.
  • Specific examples of the host that can be used in the present invention include Escherichia bacteria such as E coli; Bacillus genus bacteria such as Bacillus subtilis; Bacteria of the genus Pseudomonas such as Pseudomonas putida; lactic acid bacteria such as Lactobacillus and Enterococcus; Yeasts such as Saccharomyces cerevisiae, Schizosaccharomyces pombe; There are prokaryotic cells, animal cells, and insect cells.
  • eukaryotic cells such as yeast, insect, and mammalian cells have been preferred over E. coli due to auxiliary folding, post-translational modification, and the possibility of generating multi-component nanoparticles.
  • a self-assembled nanoparticle structure marked with a single-chain variable fragment was produced using E. coli, which is inexpensive and easily mass-produced.
  • the host cell of the present invention is not limited thereto, but may be E. coli in terms of inexpensive and easy mass production.
  • the recombinant vector of the present invention is capable of autonomous replication in the host, and is composed of a promoter, a ribosome binding sequence, a nucleic acid of the present invention and a transcription termination sequence. have.
  • any promoter may be used as long as the nucleic acid of the present invention is expressed in a host such as E. coli.
  • E. coli or phage-derived promoters such as trp promoter, lac promoter, PL promoter or PR promoter; E. coli infected phage-derived promoters such as the T7 promoter can be used.
  • An artificially modified promoter such as the tac promoter may also be used.
  • the present invention provides (a) a polynucleotide encoding a single-chain variable fragment; preparing an expression vector comprising a peptide for enhancing the expression efficiency of the single-chain variable fragment; and a polynucleotide encoding ferritin; (b) introducing the expression vector into a host cell to prepare a transformant; (c) inducing expression of a single-chain variable fragment-ferritin fusion protein by culturing the transformant; and (d) purifying the nanoparticles formed by the self-assembly of the expressed single-chain variable fragment-ferritin fusion protein; provides a method for producing self-assembled nanoparticles comprising a.
  • the plasmid vector may further include other sequences if necessary.
  • the sequence that may be further included may be a tag sequence for protein purification, for example, glutathione S-transferase (Pharmacia, USA), MBP (maltose binding protein, USA), FLAG (IBI, USA) and hexahistidine ( hexahistidine; Quiagen, USA), and most preferably hexahistidine, but the types of sequences required for purification of single-chain variable fragments are not limited by the above examples.
  • a fusion protein expressed by a vector containing the fusion sequence it may be purified by affinity chromatography.
  • glutathione-S-transferase when glutathione-S-transferase is fused, glutathione, a substrate of this enzyme, can be used, and when MBP is used, the desired single-chain antibody fragment (scFv) can be easily recovered using an amylose column.
  • scFv single-chain antibody fragment
  • the single-chain variable fragment (Single-chain variable fragment)-ferritin fusion protein of the present invention transformed by the above method to express the host cell can be cultured by a conventional method used in the art.
  • the transformant expressing the single-chain variable fragment-ferritin fusion protein can be cultured in various media, and fed-batch culture and continuous culture can be performed.
  • the method for culturing the transformant of the present invention is not limited by the above example.
  • the carbon source that can be included in the medium for the growth of host cells can be appropriately selected by the judgment of a person skilled in the art according to the type of transformant prepared, and appropriate culture conditions can be adopted to control the culture period and amount.
  • the transformant successfully transformed with a single-chain variable fragment produces a single-chain variable fragment-ferritin fusion protein.
  • the single-chain variable fragment-ferritin fusion protein produced according to the composition of the vector and the characteristics of the host cell can be secreted into the cytoplasm of the host cell, the periplasmic space or the extracellular space.
  • Proteins expressed in or outside the host cell can be purified in a conventional manner.
  • purification methods include salting out (eg, ammonium sulfate precipitation, sodium phosphate precipitation, etc.), solvent precipitation (eg, protein fraction precipitation using acetone, ethanol, etc.), dialysis, gel filtration, ion exchange, reversed-phase column chromatography
  • the protein of the present invention can be purified by applying techniques such as chromatography and ultrafiltration alone or in combination.
  • the present invention provides nanoparticles prepared by the above manufacturing method.
  • the single-chain variable fragment-ferritin fusion protein according to the present invention can form spherical nanoparticles by self-assembly of 24 monomers.
  • the diameter of the nanoparticles may be 24 to 30 nm.
  • the present invention provides a pharmaceutical composition for preventing, improving or treating a disease comprising the nanoparticles.
  • prevention refers to any action that suppresses or delays the onset of a target disease by administration of the composition
  • treatment refers to any action in which the symptoms of the target disease are improved or beneficially changed by the composition.
  • the "disease” may be specified differently depending on the type of single-chain variable fragment used.
  • the single-chain variable fragment is derived from Bevacizumab
  • cancer especially colorectal cancer, lung cancer, glioblastoma, renal cell cancer
  • eye disease eg, macular lesions
  • the single-chain variable fragment is derived from Trastuzumab
  • cancer especially breast cancer or metastatic gastric cancer
  • the single-chain variable fragment is derived from Pertuzumab
  • cancers such as breast cancer, ovarian cancer, and ovarian cancer may be included as target diseases.
  • the pharmaceutical composition according to the present invention may contain the nanoparticles alone or may be formulated in a suitable form together with a pharmaceutically acceptable carrier, and may further contain excipients or diluents.
  • a pharmaceutically acceptable carrier may further contain excipients or diluents.
  • the term 'pharmaceutically acceptable' refers to a non-toxic composition that is physiologically acceptable and does not normally cause allergic reactions such as gastrointestinal disorders, dizziness, or similar reactions when administered to humans.
  • the pharmaceutically acceptable carrier may further include, for example, a carrier for oral administration or a carrier for parenteral administration.
  • Carriers for oral administration may include lactose, starch, cellulose derivatives, magnesium stearate, stearic acid, and the like.
  • the carrier for parenteral administration may include water, a suitable oil, saline, aqueous glucose and glycol, and the like, and may further include a stabilizer and a preservative.
  • Suitable stabilizers include antioxidants such as sodium hydrogen sulfite, sodium sulfite or ascorbic acid.
  • Suitable preservatives include benzalkonium chloride, methyl- or propyl-paraben and chlorobutanol.
  • the pharmaceutical composition of the present invention may further include a lubricant, a wetting agent, a sweetening agent, a flavoring agent, an emulsifying agent, a suspending agent, and the like, in addition to the above components.
  • a lubricant for other pharmaceutically acceptable carriers and agents, reference may be made to those described in the following literature (Remington's Pharmaceutical Sciences, 19th ed, Mack Publishing Company, Easton, PA, 1995).
  • composition of the present invention can be administered to mammals including humans by any method.
  • it may be administered orally or parenterally.
  • Parenteral administration methods include, but are not limited to, intravenous, intramuscular, intraarterial, intramedullary, intrathecal, intracardiac, transdermal, subcutaneous, intraperitoneal, intranasal, enteral, topical, sublingual or rectal administration.
  • the pharmaceutical composition of the present invention may be formulated as a formulation for oral administration or parenteral administration according to the administration route as described above.
  • the composition of the present invention may be formulated as a powder, granule, tablet, pill, dragee, capsule, liquid, gel, syrup, slurry, suspension, etc. using methods known in the art.
  • oral preparations can be obtained by mixing the active ingredient with a solid excipient, pulverizing it, adding a suitable adjuvant, and processing it into a granule mixture to obtain tablets or dragees.
  • excipients include sugars including lactose, dextrose, sucrose, sorbitol, mannitol, xylitol, erythritol and maltitol, and starches, including corn starch, wheat starch, rice starch and potato starch, cellulose, Cellulose, including methyl cellulose, sodium carboxymethylcellulose and hydroxypropylmethyl-cellulose, and the like, fillers such as gelatin, polyvinylpyrrolidone, and the like may be included.
  • cross-linked polyvinylpyrrolidone, agar, alginic acid or sodium alginate may be added as a disintegrant if necessary.
  • the pharmaceutical composition of the present invention may further include an anti-aggregating agent, a lubricant, a wetting agent, a flavoring agent, an emulsifying agent, and an antiseptic agent.
  • Formulations for parenteral administration may be formulated in the form of injections, creams, lotions, external ointments, oils, moisturizers, gels, aerosols and nasal inhalants by methods known in the art. These formulations are described in Remington's Pharmaceutical Science, 19th ed, Mack Publishing Company, Easton, PA, 1995, a recipe commonly known to all pharmaceutical chemistry.
  • the total effective amount of the composition of the present invention may be administered to a patient as a single dose, or may be administered by a fractionated treatment protocol in which multiple doses are administered for a long period of time.
  • the pharmaceutical composition of the present invention may vary the content of the active ingredient depending on the severity of the disease.
  • the preferred total dose of the pharmaceutical composition of the present invention may be about 001 ⁇ g to 10,000 mg, most preferably 0.1 mg to 500 mg per kg of body weight of the patient per day.
  • the dosage of the pharmaceutical composition is determined by considering various factors such as the formulation method, administration route and number of treatments, as well as the patient's age, weight, health status, sex, severity of disease, diet and excretion rate, etc., the effective dosage for the patient is determined.
  • the pharmaceutical composition according to the present invention is not particularly limited in its formulation, administration route and administration method as long as the effect of the present invention is exhibited.
  • hRID RNA interaction domain originated from human
  • pGE -hRID vector was digested with SalI and Hind2 restriction enzymes, and a ferritin gene derived from a microorganism or human was inserted to create a hRID-FR vector.
  • the hRID-FR vector was digested with KpnI and SalI restriction enzymes, and the amino acid SGGGGSGGGG was inserted as a linker between the ScFv sequence ferritin of bevacizumab to construct a vector composed of a TEV cleavage site and 6x-His-Bevacizumab ScFv-FR in hRID.
  • the pGE-hRID vector was digested with KpnI and EcoRV restriction enzymes, and GGGG SGGGGSGGGGSGQAGQHAAGSGSGSS was inserted as a linker between the ScFv of Trastuzumab and the human-derived ferritin gene.
  • the constructed vector was constructed.
  • the hRID-FR vector was digested with BamHI and SalI restriction enzymes, and GGGSGGGTGGGSGGG was inserted as a linker between the ScFv sequence of Pertuzumab and Ferritin to construct a vector composed of a TEV cleavage site and 6x-His-Trastuzumab ScFv-FR in hRID.
  • IPTG isopropyl ⁇ -D-1-thioglalactopyranoside
  • the wash buffer [50 mM Tris-HCl (pH 8.0), 0, 100, 200, 300 mM NaCl, 10% glycerol, 2.86 mM 2-mercaptoethanol, TWEEN-20 0.1%] was used, T (Total), the supernatant obtained by centrifugation of the lysed cells at 4 °C, 20 minutes, 12000 rpm is used as S (Soluble), and the submerged cells are used as P (Pellet). Water solubility was confirmed.
  • IPTG isopropyl ⁇ -D-1-thioglalactopyranoside
  • the wash buffer [50 mM Tris-HCl (pH 8.0), 0, 100, 200, 300 mM NaCl, 10% glycerol, 2.86 mM 2-mercaptoethanol, TWEEN-20 0.1%] was used, T (Total), the supernatant obtained by centrifugation of the lysed cells at 4 °C, 20 minutes, 12000 rpm is used as S (Soluble), and the submerged cells are used as P (Pellet). Water solubility was confirmed.
  • IPTG isopropyl ⁇ -D-1-thioglalactopyranoside
  • Nanoparticle protein (3ml) was placed in Dispo-H cell, and size was measured and analyzed (DLS) using Zeta-potential & Particle size Analyzer (ELS-2000ZS; Otsuka Electronics). The intensity distribution diameter of nanoparticles was measured twice in a water solvent at 25°C, and the sample accumulation time was measured at 200 seconds.
  • FIG. 8 is a view of thermal stability analysis of a control material and nanoparticles
  • FIG. 5 is a control material scFv, Bevacizumab, and h-scFV-HFH (of nanoparticles) using circular dichroism (CD) spectroscopy.
  • CD circular dichroism
  • Example 1-1 SPR and ELISA analysis of bevacizumab-ferritin fusion protein
  • a Biacore T100 analyzer (GE Healthcare, Uppsala, Sweden) was used.
  • a CM5 sensor chip (GE Healthcare) activated with EDC/NHS (N'-(3-dimethylaminopropyl) carbodiimide hydrochloride / N-hydroxysuccinimide) was used.
  • EDC/NHS N'-(3-dimethylaminopropyl) carbodiimide hydrochloride / N-hydroxysuccinimide
  • VEGF protein 10 ⁇ g/ml in 10 mM sodium acetate, pH 5.0
  • the activated portion remaining on the surface of the sensor chip was inactivated by adding 1.0 M ethanolamine (ethanolamine, pH 8.5).
  • bevacizumab or scFv-ferritin fusion protein was diluted in a buffer solution (1 X PBS, pH 7.4) for each concentration, and the binding and dissociation sensorgrams were checked while flowing at a flow rate of 30 ⁇ l/min.
  • a buffer solution (1 X PBS, pH 7.4) for each concentration
  • BSA bovine serum albumin
  • the Bevacizumab-ferritin fusion protein has more binding strength than the Bevacizumab-ferritin fusion protein without hRID mutation. This was done to determine whether it decreased. 2000 nM/well hVEGF protein (Abcam) was coated onto Nunc 96-well microtiter immunoplates (Thermo Fisher Scientific) overnight at 4°C. Between all procedures, the immunoplates were washed 3 times with PBST (0.05% Tween 20 added to PBS) wash buffer.
  • PBST 0.05% Tween 20 added to PBS
  • hRID(W)-scFV-HFH, hRID(9m)-scFv-HFH,scFv were serially diluted in half from 100 nM to 0.19 nM using PBST. The diluted material was applied to immunoplates and incubated for 2 hours. Then, 100 ⁇ l of 1/400 of anti-hVEGF mAb was added to each well at 37° C. and incubated for 2 hours.
  • the wells were treated with anti-mouseIgG conjugated with peroxidase diluted by 1/20000 in serum dilution buffer (PBST+0.5%BSA) and incubated for 2 hours. Finally, 100 ⁇ l/well of substrate TMB solution (BD Biosciences) was incubated in the dark at 37° C. for 30 minutes. To stop the color reaction, 50 ⁇ l of a stop solution (2NH2SO4) was added to the wells, and absorbance was measured at 450 ⁇ M using an ELISA reader FLUOstar OPTIMA (BMG LABTECH).
  • 18 is a graph comparing the binding affinity of hRID-Bevacizumab scfv-ferritin (HFL; Human Ferritin light chain) fusion protein by indirect ELISA analysis. 18 shows the folding and target binding affinity of hRID(W)-Bevacizumab scfv-ferritin (HFL) fusion protein, hRID(9M)-Bevacizumab scfv-ferritin (HFL) fusion protein, and Bevacizumab scfv according to antibody concentration. .
  • FIG. 19 is a sandwich ELISA showing the target binding affinity of hRID-scFv-G3SG3TG3SG3-ferritin (scFv-HFL), hRID-scFv (scFv) and hRID-HFL (HFL) according to an embodiment of the present invention; It is a graph analyzed by The results were obtained by repeating the ELISA three times.
  • ferritin exists in two types (HFH/HFL) according to its size.
  • FIGS. 18 and 19 it can be seen that the fusion protein prepared according to the present invention has an increased affinity for the target by self-assembly regardless of the size/type of ferritin.
  • hRID-scFv-G3SG3TG3SG3-ferritin (scFv-HFL) fusion protein nanoparticles or Bevacizumab-ferritin (HFH) fusion protein nanoparticles hRID-scFv (scFv) at a concentration of 24 times Or it can be seen that it binds to more antigens than when using hRID-HFL (HFL).
  • the fusion protein of the present invention forms nanoparticles and has a binding affinity to the target than when using a monomer structure that does not form nanoparticles (eg, hRID-scFv (scFv) or hRID-HFL (HFL)). It can be seen that is higher
  • Example 1-2 ELISAX, SPR analysis of Trastuzumab-ferritin fusion protein nanoparticles (Fig. 10)
  • the binding force between Trastuzumab, the prototype of scFv, and HER2 and the binding force between the scFv-ferritin fusion protein nanoparticles and HER2 were compared using SPR (Surface plasmon resonance) analysis.
  • a Biacore T100 analyzer (GE Healthcare, Uppsala, Sweden) was used.
  • a CM5 sensor chip (GE Healthcare) activated with EDC/NHS (N'-(3-dimethylaminopropyl) carbodiimide hydrochloride/N-hydroxysuccinimide) was used.
  • EDC/NHS N'-(3-dimethylaminopropyl) carbodiimide hydrochloride/N-hydroxysuccinimide
  • HER2 protein (10 ⁇ g/ml in 10 mM sodium acetate, pH 5.0) was flowed for 5 minutes to immobilize it.
  • the activated part remaining on the surface of the sensor chip was inactivated by adding 1.0 M ethanolamine (ethanolamine, pH 8.5).
  • the Herceptin or scFv-ferritin fusion protein nanoparticles were diluted in buffer solution (1 X PBS, pH 7.4) for each concentration, and the binding and dissociation sensorgrams were checked while flowing at a flow rate of 30 ⁇ l/min ( Fig. 9).
  • buffer solution (1 X PBS, pH 7.4
  • BSA bovine serum albumin
  • HUVECs were maintained in a serum starvation state for 6 hours, and VEGF, VEGF+Avastin, VEGF+G6 monomer, and VEGF+G6 24-mer were treated in the lower part of the transwell plate at the concentrations shown in the figure, and 1x10 5 cells were seeded in the transwell. After 5 hours, cells that had migrated to the transwell were identified through H&E staining (top of FIG. 11 ).
  • HUVECs were maintained in a serum starvation state for 6 hours, and 1.3x10 5 cells were mixed with each of VEGF, VEGF+Avastin, VEGF+G6 monomer, and VEGF+G6 24-mer treated at the concentrations shown in the figure on a matrigel-coated plate.
  • Angiogenesis was confirmed 18 hours after planting (bottom of FIG. 11).
  • the scFv monomer showed the same effect as Avastin at the same concentration on vascular endothelial cell mobility and angiogenesis, and showed a stronger effect than Avastin in the multimer (G6 24-mer).
  • the inhibitory effect of vascular endothelial cell mobility and angiogenesis to VEGF was superior to that of the VEGF-treated control group. can confirm.
  • the laser-induced CNV animal model focuses on the fundus retina and retinal pigment layer using argon green laser, an ophthalmic laser treatment equipment, on 24 8-week-old males of C57BL/6 mouse 8 weeks. At 100mW, try 4-5 laser photo coagulation. On the day of laser treatment, 4-5 animals in each group were intraocularly injected with 4 experimental groups (120nM ScFv monomer, 600nM scFv, 120nM ScFv-Ferritin, 600nM ScFv-Ferritin) and a normal control (vehicle).
  • Anti-Glial fibrillary acidic protein antibody for the purpose of confirming the distribution of astrocytes by counterstaining to confirm the structure in the retina, Lectin-PNA Alexa 488 (Molecular Probes, Eugene, After cross-fluorescence staining was performed using an antibody such as OR, USA), the distribution of scFV nanoparticles was confirmed for each group in each retinal layer by photographing under a confocal fluorescence microscope (LSM710; Carl Zeiss, Jena, Germany). (See Fig. 13). scFv was stained using His tag antibody (red color).
  • scFv-Ferritin fusion protein nanoparticles can maintain a strong and lasting therapeutic effect for a longer period of time by attaching to the inner layer surface of the retina at a high concentration and delivering scFv to the inner layer surface and the entire retinal layer for a long time compared to scFv alone administration.
  • Example 5-1 Bevacizumab fusion protein nanoparticles
  • RNA functions like molecular chaperones in E. coli, helping to improve protein solubility and folding. So, to confirm this, a point mutation (9m) was made to prevent tRNA from binding to the representative hRID of Chaperna. SDS PAGE by expressing hRID(w)-Bevacizumab-ferritin, a wild-type hRID (w) form, and hRID(9m)-Bevacizumab-ferritin, a form mutated (9m) to prevent tRNA binding to hRID. The GEL was lowered to compare the solubility of proteins.
  • Example 5-2 Trastuzumab fusion protein nanoparticles
  • Trastuzumab-ferritin a form in which hRID is not bound, hRID(WT)-Trastuzumab-ferritin, a form in which hRID is wild-type (WT), and hRID (9m), a form in which mutations (9m) are given to prevent tRNA binding to hRID (9m) -Trastuzumab-ferritin was expressed and the SDS PAGE GEL was lowered to compare the protein solubility. It was confirmed that the protein to which hRID was not bound was not expressed in E. coli, whereas the protein to which hRID was bound was expressed. In addition, it was confirmed that, even if hRID is bound to a protein, water solubility is very poor if tRNA is not bound to hRID.
  • Example 5-3 Pertuzumab fusion protein nanoparticles
  • Pertuzumab-ferritin a form in which hRID is not bound
  • hRID (WT)-Pertuzumab-ferritin a form in which hRID is wild-type (WT)
  • SDS PAGE GEL was lowered to compare protein solubility.
  • the protein to which hRID is not bound at all was expressed in E. coli, the water solubility was not increased at any NaCl concentration, but it was confirmed that the protein to which hRID was bound increased the water solubility of the protein according to the NaCl concentration.
  • Example 6-1 Bevacizumab fusion protein nanoparticles (Fig. 15 a, b)
  • hRID(w)-Bevacizumab-ferritin and the form of hRID(9m)-Bevacizumab-ferritin were expressed and purified to see what role RNA binding plays in the formation of nanoparticles. proceeded.
  • Example 6-2 Trastuzumab fusion protein nanoparticles ( FIG. 16 )
  • RNA binding in the formation of nanoparticles in the form of Trastuzumab-ferritin, hRID(w)- Trastuzumab-ferritin, and hRID(9m)- Trastuzumab-ferritin form was expressed and purified. It was confirmed that the protein not bound to hRID was not purified.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Zoology (AREA)
  • Biochemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Biophysics (AREA)
  • Wood Science & Technology (AREA)
  • Biotechnology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • General Engineering & Computer Science (AREA)
  • Biomedical Technology (AREA)
  • Immunology (AREA)
  • Microbiology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Oncology (AREA)
  • Physics & Mathematics (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Plant Pathology (AREA)
  • Epidemiology (AREA)
  • Toxicology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Peptides Or Proteins (AREA)

Abstract

본 발명은 페리틴, 상기 페리틴의 N-말단에 결합된 단일사슬항체조각 및상기 단일사슬항체조각의 N-말단에 인간유래 라이실 tRNA 합성효소 중 N-말단 도메인 RID (RNA-interaction domain)를 신규 융합파트너로 결합한 융합단백질 자가조립 나노입자 구조체를 제공하여, 수용성이 증대된 융합 단백질, 나노입자 및 이를 코딩하는 벡터, 상기 벡터로 형질 전환된 숙주세포 및 이를 이용한 질병의 치료 약학적 조성물을 제공한다.

Description

단일사슬항체조각 및 페리틴의 융합단백질을 포함하는 나노입자 및 이의 용도
본 발명은 페리틴, 상기 페리틴의 N-말단에 연결된 단일사슬항체조각 및상기 단일사슬항체조각의 N-말단에 결합된 인간유래 라이실 tRNA 합성효소 중 N-말단 도메인 RID(RNA-interaction domain)을 포함하는 융합단백질, 상기 융합단백질의 자가조립 나노입자, 상기 융합단백질을 코딩하는 뉴클레오타이드가 포함된 발현 벡터 및 이의 신규한 용도에 관한 것이다. 본 발명의 융합단백질 및 나노입자는 RID를 이용하여, 수용성이 크게 증진되는 이점이 있으며, 단일사슬항체조각의 유래를 달리하여 원하는 질병을 치료하기위한 약학적 조성물을 제조할 수 있다.
바이러스는 외피 바이러스 (enveloped virus)와 외피가 없는 바이러스(non-enveloped virus)로 크게 2종류로 구별된다. 외피가 없는 바이러스의 경우 바이러스 표피가 캡시드 단백질만으로 이루어져 있으며 따라서 캡시드 단백질만으로 VLP로의 자가조립이 가능하다. 그러나, 외피가 있는 바이러스는 바이러스 형태를 이루기 위해 막 구성요소(membrane component)가 필수적으로 요구된다. 따라서 바이러스 유사입자(VLP)로의 자가조립을 위하여는 표면 항원 이외에도 막 구성요소를 필요로 한다. 즉 envelope-바이러스유사입자(VLP) 자가조립 공정에 단량 체 항원 단백질의 폴딩뿐 아니라 이의 지질막이 필수적으로 요구된다. 그러나 지질막은 구조적으로 균일하지 않으며 특성화하기가 어려워 VLP로의 형성은 고등세포 (동물세포, 곤충세포, 인체유래세포, 또는 효모 등)에서만 생성할 수 있었다. 따라서, 막 구성요소 대신 자가조립 가능한 단백질을 스캐폴드(scaffold)로 재조합하여 발현시킴으로써 다양한 항원 단백질을 공통적으로 구축하는 방법이 필요하다.
페리틴(ferritin)은 대부분의 생물 종에 존재하며 자가 조립되어 나노입자를 형성하는 특징을 가지고 있다. 종래 연구에서 인간 유래 페리틴 또는 헬리코박터 파일로리 페리틴(Helicobacter pylori ferritin)을 이용하여 진핵세포(곤충, 동물세포)에서 바이러스 나노입자를 형성하였다(L. He, N. de Val et al.: Presenting nativelike trimeric HIV-1 antigens with self-assembling nanoparticles. Nat Commun, 7, 12041 (2016) doi:10.1038/ncomms12041, H. M. Yassine et al. : Hemagglutinin-stem nanoparticles generate heterosubtypic influenza protection. Nature medicine, 21(9), 1065-1070 (2015)). 그러나, 진핵세포 생산 시스템은 비용이 높고, 생산성이 낮으며 대량 생산공정이 어려운 문제점이 있었다.
이를 해결하기 위해서는 대장균을 사용하여 페리틴 나노입자 구조체를 생산하는 방법의 개발이 필요하다. 그러나 대장균에서 외래 단백질을 발현하는 경우 단백질의 접힘이 어려운 문제가 있어, 재접힘 공정이 추가됨에 따른 비용 및 시간이 증가되는 문제가 발생한다.
본 발명자들은 상기 문제를 해결하고 이를 통해 제조된 나노입자를 질병 특이적 치료제로 이용하고자 한다.
상기 종래기술의 문제점을 해결하기 위한 본 발명의 목적은 대장균에서 수용성 발현이 어려운 단일사슬항체조각(Single-chain variable fragment)을 수용성으로 생성하고 자가 조립하여 안정한 형태의 나노입자를 형성할 수 있는 재조합 발현 벡터, 및 상기 발현 벡터로 형질 전환된 숙주세포를 제공하는 데 있다.
본 발명의 다른 목적은 상기 재조합 발현 벡터 및 숙주세포를 이용하여 수용성 융합 단백질 및 나노입자를 제조하는 방법을 제공하는 데 있다.
본 발명의 또 다른 목적은 상기 제조방법으로 제조된 나노입자를 포함하는 질병의 예방, 개선 또는 치료용 약제학적 조성물을 제공하는 데 있다.
본 발명자들은 단일사슬항체조각(Single-chain variable fragment)의 N-말단에 인간 유래 라이실 tRNA 합성효소 중 RID (RNA-interaction domain)를 신규 융합파트너로 사용하고, 페리틴의 N-말단에 상기 단일사슬항체조각이 결합된 융합단백질, 상기 융합단백질이 자가조립된 나노입자 및 이의 발현 벡터를 제작하였고, 이를 이용하여 종래 수용성 생성이 어렵던 불용성 단일사슬항체조각(Single-chain variable fragment)을 재접힘 없이 수용성으로 생성하였다.
즉 본 발명의 일 실시예에 따르면, 페리틴(ferritin) 단백질; 상기 페리틴의 N-말단에 결합하는 단일사슬항체조각(Single-chain variable fragment); 및 상기 단일사슬항체조각의 N-말단에 결합된, 인간 유래 라이실 tRNA 합성효소로부터 분리한 N-말단 도메인(hLysRS Nterminal appended RNA interacting domain; hRID) 를 포함하는 나노입자가 제공되며, 상기 나노입자를코딩하는 폴리뉴클레오티드를 포함하는 재조합 발현 벡터가 제공된다.
본 발명의 상기 단일사슬항체조각은 그 종류가 제한되지는 않으나, 가장 바람직하게는 트라스투주맙(Trastuzumab), 베바시주맙(Bevacizumab) 및 퍼투주맙(pertuzumab)으로 이루어진 군에서 선택된 어느 하나의 항체로부터 유래된 것이다.
본 발명에 따르면 상기 hRID는 서열번호 1의 아미노산 서열로 표시될 수 있으며, 상기 페리틴 단백질은 서열번호 4의 아미노산 서열로 표시될 수 있다.
상기 벡터는 단일사슬항체조각(scFv)을 코딩하는 폴리뉴클레오티드 및 페리틴을 코딩하는 폴리뉴클레오티드 사이에 링커를 포함할 수 있다. 상기 링커는 서열번호 8 내지 10의 염기서열 중 어느 하나로 표시되는 아미노산 서열로 표시될 수 있다.
본 발명은 또한, 상기 발현 벡터로 형질 전환된 숙주세포를 제공한다. 본 발명에서 상기 숙주세포는 본 발명이 속하는 당업자가 용이하게 이용할 수 있는 숙주세포를 제한없이 사용할 수 있으나, 바람직하게 상기 숙주세포는 에스케리키아(Escherichia)속 세균, 바실러스 바실러스 (Bacillus)속 세균, 슈도모나스(Pseudomonas)속 세균, 유산균, 효모, 동물세포 및 곤충 세포로 이루어진 군에서 선택될 수 있으며, 가장 바람직하게는 대장균(Escherichia coli)이다..
본 발명의 다른 실시예에 따르면, (a) 페리틴(ferritin) 단백질; 상기 페리틴 단백질의 N-말단에 결합된 단일사슬항체조각(Single-chain variable fragment); 및 상기 단일사슬항체조각의 N-말단에 결합된, 인간 유래 라이실 tRNA 합성효소로부터 분리한 N-말단 도메인(hLysRS N-terminal appended RNA interacting domain; hRID);을 코딩하는 폴리뉴클레오티드를 포함하는 발현 벡터를 제조하는 단계; (b) 상기 발현 벡터를 숙주세포에 도입하여 형질전환체를 제조하는 단계; (c) 상기 형질전환체를 배양하여 단일사슬항체조각(scFv)-페리틴 융합단백질의 발현을 유도하는 단계; 및 (d) 상기 발현된 단일사슬항체조각-페리틴 융합단백질의 자가조립에 의해 형성된 나노입자를 정제하는 단계;를 포함하는 자가조립 나노입자의 제조방법이 제공된다.
본 발명은 또한, 상기 나노입자를 포함하는 질병의 개선 또는 치료용 약제학적 조성물을 제공한다. 상기 질병은, 상기 단일사슬항체조각의 종류에 따라 다르게 특정될 수 있으며, 단일사슬항체조각(Single-chain variable fragment)이 베바시주맙 (Bevacizumab)유래인 경우, 암(특히, 대장암, 폐암, 교모세포종, 신세포암) 또는 눈병(예를들어, 황반변성)이 치료하고자 하는 대상 질병(표적 질환)이 될 수 있다. 단일사슬항체조각(Single-chain variable fragment)이 트라스투주맙(Trastuzumab) 유래인 경우, 암(특히, 유방암 또는 전이성 위암)이 대상 질병(표적 질환)이 될 수 있다. 단일사슬항체조각(Single-chain variable fragment)이 퍼투주맙(Pertuzumab) 유래인 경우, 대상 질병(표적 질환)으로 유방암, 난소암, 전린섭암 등의 암이 포함될 수 있으나, 이에 제한되는 것은 아니다.
또한, 본 발명은 상기 자가조립 나노입자를 투여하는 단계를 포함하는 표적 질환의 예방 또는 치료 방법을 제공한다.
상기 치료적 유효량은 달성하고자 하는 반응의 종류와 정도, 경우에 따라 다른 제제가 사용되는지의 여부를 비롯한 구체적 조성물, 개체의 연령, 체중, 일반건강 상태, 성별 및 식이, 투여 시간, 투여 경로 및 조성물의 분비율, 치료기간, 구체적 조성물과 함께 사용되거나 동시 사용되는 약물을 비롯한 다양한 인자와 의약 분야에 잘 알려진 유사 인자에 따라 다르게 적용하는 것이 바람직하다. 따라서 본 발명의 목적에 적합한 조성물의 유효량은 전술한 사항을 고려하여 결정하는 것이 바람직하다.
상기 개체는 임의의 포유동물에 적용가능하며, 상기 포유동물은 인간 및 영장류뿐만 아니라, 소, 돼지, 양, 말, 개 및 고양이 등의 가축을 포함한다.
본 발명에 따른 자가조립 나노입자 또는 융합단백질 제조용 벡터는 숙주 세포에서 단일사슬항체조각(Single-chain variable fragment)-페리틴 융합단백질 및 자가조립 나노입자의 수용성 발현을 현저하게 증진시킬 수 있고, 그 생산 효율을 높일 수 있다.
또한, 본 발명의 벡터에 따라 발현된 융합단백질은 자가조립을 통해 나노입자를 형성하고, 형성된 나노입자는 표면에 단일사슬항체조각(Single-chain variable fragment)을 제시(표면 발현)하여, 표적 친화성이 높고, 이에 따라 다양한 면역 반응의 효율을 증가시키는 바, 백신 및 치료제로 활용될 수 있다.
도 1은 본 발명에 따른 융합 단백질을 코딩하는 벡터의 모식도이다. 도 1a는 scfv가 베바시주맙(Bevacizumab)유래인 경우, 도 1b는 scfv가 트라스투주맙(Trastuzumab)유래인 경우, 도 2b는 scfv가 퍼투주맙(pertuzumab)유래인 경우를 나타낸다.
도 2는 본 발명의 일 실시예에 따라 scfv 종류에 따른 링커의 구조 및 링커와 scfv의 결합 시 입체구조를 나타낸다.
도 3은 RID 및 scfv 융합 단백질의 수용성을 확인한 이미지이다. 도 3a는 hRID-Bevacizumab scfv-페리틴 융합 단백질의 수용성을, 도 3b는 hRID-Trastuzumab scfv- 페리틴 융합 단백질의 수용성을, 도 3c는 hRID- pertuzumab scfv- 페리틴 융합 단백질의 수용성을 확인한 결과이다.
도 4는 hRID-Bevacizumab scfv-페리틴 융합 단백질의 분리를 확인한 이미지이다. 도 4a에서는 니켈 친화성 크로마토그래피에서 용출된 hRID-Bevacizumab scfv- 페리틴 융합 단백질을 이온 수지 교환 크로마토그래피를 통해 정제하였을 때의 크로마토그램 결과를 확인하였으며, 도 4b는 크기배제 크로마토그래피 결과를 나타낸다.
도 5는 hRID-Trastuzumab scfv- 페리틴 융합 단백질의 분리를 확인한 이미지이다. 도 5a에서는 니켈 친화성 크로마토그래피에서 용출된 hRID-Trastuzumab scfv- 페리틴 융합 단백질을 이온 수지 교환 크로마토그래피를 통해 정제하였을 때의 크로마토그램 결과를 확인하였으며, 도 5b는 크기배제 크로마토그래피 결과를 나타낸다.
도 6은 hRID- pertuzumab scfv-페리틴 융합 단백질의 분리를 확인한 이미지이다. 도 6a에서는 니켈 친화성 크로마토그래피에서 용출된 hRID- pertuzumab scfv- 페리틴 융합 단백질을 이온 수지 교환 크로마토그래피를 통해 정제하였을 때의 크로마토그램 결과를 확인하였으며, 도 6b는 크기배제 크로마토그래피 결과를 나타낸다.
도 7은 hRID-Bevacizumab scfv-페리틴 융합 단백질, hRID-Trastuzumab scfv- 페리틴 융합 단백질 및 hRID- pertuzumab scfv- 페리틴 융합 단백질의 자가조립에 의해 형성된 나노입자를 투과전자 현미경으로 확인한 이미지이다.
도 8은 scFv의 베바시주맙, hRID-Bevacizumab scfv-페리틴 융합 단백질 나노입자 및 베바시주맙의 안정성을 비교한 결과이다.
도 9는 hRID-Bevacizumab scfv-페리틴(HFH; Human Ferritin heavy chain) 융합 단백질의 결합 친화도를 ELISA 분석으로 비교한 그래프이다. 도 9는 항체 농도에 따른 hRID(W)-Bevacizumab scfv-페리틴(HFH) 융합 단백질 나노입자, hRID(9M)- Bevacizumab scfv -페리틴(HFH) 융합 단백질 나노입자 및 Bevacizumab scfv의 접힘 및 결합 친화도를 나타낸다.
도 10은 hRID- pertuzumab scfv-페리틴 융합 단백질 나노입자의 표적에 대한 결합 친화도를 SPR 분석으로 비교한 그래프이다.
도 11은 VEGF(혈관내피성장인자)를 표적(target)으로하는 scFv의 다합체(multimer)가 혈관내피세포의 이동과 혈관형성에 미치는 영향을 확인한 결과이다.
도 12는 레이저 유도 맥락막신생혈관이 발생한 생쥐의 안구에 약물을 유리체강내 주입하고 14일 후 얻어진 맥락막 플랫마운트 면역형광 이미지와 측정한 맥락막신생혈관의 평균 면적을 나타낸다.
도 13은 생쥐의 안구에 식염수, 120nM ScFv, 600nM ScFv, 120nM ScFv-Ferritin, 600nM ScFv-Ferritin 융합단백질 나노입자를 각각 주입하고 1일째와 7일째 망막에서의 scFv의 분포를 공초점 현미경을 이용하여 관찰한 이미지이다.
도 14는 hRID에 따른 융합 단백질 나노입자의 안정성을 나타낸다. 도 14a에서는 hRID- Bevacizumab scfv-페리틴 융합 단백질 나노입자의 hRID에 따른 안정성을, 도 14b에서는 hRID- Trastuzumab scfv- 페리틴 융합 단백질 나노입자의 hRID에 따른 안정성을, 도 14c에서는 hRID-pertuzumab scfv-페리틴 융합 단백질나노입자의 hRID에 따른 안정성을 비교한다.
도 15는 hRID을 포함하는 융합 단백질 나노입자를 정제한 이미지이다. 도 15a는 hRID- Bevacizumab scfv -페리틴 융합 단백질 나노입자에서 hRID가 야생형(w)인 경우와 돌연변이 hRID(9m)인 경우 정제 결과를 각각 나타낸 이미지이며, 도 15b는 크기배제 크로마토그래피 결과를 나타낸 것이다.
도 16은 단백질에서 hRID가 야생형(w)인 경우와 돌연변이 hRID(9m)인 경우 각 hRID- Trastuzumab scfv -페리틴 융합 단백질 나노입자의 정제 결과를 나타낸 이미지이다.
도 17은 hRID가 야생형(w)인 경우와 돌연변이 hRID(9m)인 경우 각 형성된 hRID- Bevacizumab scfv- 페리틴 융합 단백질 나노입자의 TEM 이미지를 나타낸다.
도 18은 hRID-Bevacizumab scfv-페리틴(HFL; Human Ferritin light chain) 융합 단백질의 결합 친화도를 indirect ELISA 분석으로 비교한 그래프이다. 도 18는 항체 농도에 따른 hRID(W)-Bevacizumab scfv-페리틴(HFL) 융합 단백질 나노입자, hRID(9M)- Bevacizumab scfv-페리틴(HFL) 융합 단백질 나노입자 및 Bevacizumab scfv의 접힘 및 표적에 대한 결합 친화도를 나타낸다.
도 19는 본 발명의 일 실시예에 따라 hRID-scFv-G3SG3TG3SG3-페리틴(scFv-HFL) 나노입자, hRID-scFv (scFv) 및 hRID-HFL (HFL)의 표적 결합 친화도(target binding affinity)를 sandwich ELISA로 분석한 그래프이다. 해당 결과는 ELISA를 3번 반복하여 얻어졌다.
도 20은 본 발명의 일 실시예에 따라 제조된 융합단백질이 자가조립에 의해 나노입자를 형성하는 구조를 나타낸 모식도이다. 도 20에서, 파란색은 scfv의 항체 중쇄 가변 단편(antibody heavy chain variable fragment)을, 빨간색은 항체 경쇄 단편(antibody light chain variable fragment)을 나타낸다.
이하, 본 발명을 상세히 설명한다.
일 측면에서, 본 발명은 단일사슬항체조각(Single-chain variable fragment)을 코딩하는 폴리뉴클레오티드; 단일사슬항체조각(Single-chain variable fragment)의 발현 효율을 증진시키기 위한 펩타이드; 및 단일사슬항체조각(Single-chain variable fragment)을 코딩하는 폴리뉴클레오티드의 3'-말단에 결합된 페리틴;을 포함하는 자가조립 나노입자 제조용 발현 벡터를 제공한다.
하기 도 1은 본 발명에 따른 발현 벡터의 구조(도 1a 내지 도 1c)로서, hRID가 단일사슬항체조각(Single-chain variable fragment)-페리틴 융합 단백질 단량체의 수용성 및 접힘을 촉진시킨 후 절단된다. 이후, 상기 단량체는적절하게 접혀 삼량체 구조를 형성하고, 8개의 삼량체가 조립되어 나노입자를 형성할 수 있다. 즉, 본 발명에 따르면, 본 발명의 나노입자에는 단일사슬항체조각(Single-chain variable fragment)-페리틴 융합 단백질 단량체가 1개 이상 24개 이하로 포함될 수 있으며, 바람직하게는 융합 단백질 단량체가 삼량체를 이루어 상기 8개의 삼량체가 포함된(총 24개의 융합 단백질 단략체가 포함된) 나노입자가 제조될 수 있다. 나노입자 표면에는 24개의 단일사슬항체조각(Single-chain variable fragment)-페리틴 융합 단백질이 표면에 발현될 수 있다.
본 발명에서 사용되는 용어, “항체”란, 특정 항원과 반응성을 갖는 항원결합능력을 가지는 면역글로불린 분자를 포함하며, 폴리클로날(polyclonal) 항체 및 모노클로날(monoclonal) 항체를 모두 포함한다. 또한, 상기 용어는 키메라성 항체(예를 들면, 인간화 뮤린 항체) 및 이종결합항체(예를 들면, 양특이성 항체)와 같은 유전공학에 의해 생산된 형태를 포함한다. 항체는 구조적으로 중쇄 및 경쇄로 이루어지며, 각각의 중쇄 및 경쇄는 불변영역 및 가변영역을 포함한다. 상기 중쇄 및 경쇄의 가변영역은 "상보성 결정 영역(complementaritydetermining region; CDR)”이라고 불리는 3개의 다변가능한 영역 및 4개의 “구조영역(framework region)”을 포함한다.
본 발명에서 사용되는 용어, “단일사슬항체조각(single chain variable fragment; scFv)"이란, 항체로부터 형성되는 일반적인 단편이 아니라, 항체를 구성하는 중쇄의 가변영역을 포함하는 단편과 경쇄의 가변영역을 포함하는 단편을 인위적으로 융합시켜서 구성된 융합단백질이다.
본 발명에 있어서, 상기 단일사슬항체조각은 핵산 또는 아미노산 서열이 알려져 있는 경우라면 그 종류가 제한되지 않는다. 바람직하게는, 트라스투주맙(Trastuzumab), 베바시주맙(Bevacizumab) 및 퍼투주맙(pertuzumab)의 단일사슬항체조각이다.
본 발명의 "단일사슬항체조각(Single-chain variable fragment)"은 당업자가 대량으로 생산하고자 하는 단백질로서, 재조합 발현벡터에 상기 단백질을 암호화하는 폴리뉴클레오티드를 삽입하여 숙주세포에서 발현이 가능한 모든 단백질을 의미한다. 본 발명에서 "단일사슬항체조각(Single-chain variable fragment)"은 숙주세포에서 페리틴과 융합된 형태로 발현되고 페리틴에 의해 자가 조립된 나노입자의 표면에 위치할 수 있다.
본 발명의 "단일사슬항체조각(Single-chain variable fragment)의 발현 효율을 증진시키기 위한 펩타이드"는 단일사슬항체조각(Single-chain variable fragment)과 페리틴의 융합 단백질을 수용성 형태로 발현시킬 수 있다고 보고된 펩타이드로서, 예를 들어 GST(Glutathione S transferase), 말토오스 결합 단백질, 유비퀴틴, 타오레독신 등이 포함되며, 바람직하게는 rRID, mRID, hRID, LysRS와 같은 융합 단백질에서 선택될 수 있고, 가장 바람직하게는 인간 유래 라이실 tRNA 합성효소로부터 분리한 N-말단 도메인(hLysRS N-terminal appended RNA interacting domain; hRID)의 아미노산 서열을 포함하여 구성될 수 있다.
본 명세서에서 사용된 용어 "RID(RNA interaction domain)"은 RNA와 기타 단백질 간의 상호작용에 관여하는 고유한 N-말단 연장부위(70 아미노산)를 의미하며, 인간 유래 라이실 tRNA 합성 효소로부터 분리한 것이다. 본 발명의 바람직한 일 실시예에서는, RID에 태그 서열을 결합한 tag-RID(서열번호 1로 표시됨)를 박테리아에서 단일사슬항체조각(scFv)의 수용성 발현을 위한 결합 파트너로 사용하였다.
본 발명의 일 실시예에서는, 상기 RID에서 RNA 결합 여부에 따라 단백질 접힘 및 나노입자 구조형성에 영향이 있는지 비교하기 위해 hRID 도메인 9개 중에 K19 및 K23 부위에 대해 변이시킨(K19A, K23A) doublemutant hRID를 만들었고 K19A, K23A, R24A, K27A, K30A, K31A, K35A, K38A, K40A로 돌연변이된 nine mutant hRID 를 만들었다. 융합파트너로 상기 2가지 돌연변이 hRID 및 야생형 hRID(WT) 이용시 hRID에 RNA가 결합된 야생형 hRID(WT)가 융합된 경우에만 단백질 접힘이 향상되어 나노입자가 잘 형성됨을 알 수 있었다. 상기 돌연변이체의 돌연변이 부위와 아미노산 서열은 하기 [표 1]에 나타내었으며, 야생형 tag-hRID(WT)의 아미노산 서열은 서열번호 1에 나타내고, 염기서열은 서열번호 2에 나타내었다.
Tag-hRID(W) amino seq MSEQHAQAAVQAAEVKVDGSEPKLSKNELKRRLKAEKKVAEKEAKQKELSEKQLSATAAATNHTTDNGVGPEEESV
Tag-hRID(2m) amino seq(K19A/K23A) MSEQHAQAAVQAAEVKVDGSEPKLSKNEL A RRL A AEKKVAEKEAKQKELSEKQLSATAAATNHTTDNGVGPEEESV
Tag-hRID(9m) amino seq(K19A/K23A/R24A/K27A/K30A/K31A/K35A/K38A/K40A) MSEQHAQAAVQAAEVKVDGSEPKLS A NEL AA RL A AE AA VAE A EA A Q A ELSEKQLSATAAATNHTTDNGVGPEEESV
본 발명에서 페리틴(ferritin)은 이들 각각이 단위체로써 케이지(cage) 형태의 복합 단백질을 형성할 수 있는 활성이 있는 단백질이라면 제한 없이 사용될 수 있다.
본 발명에서 페리틴 단백질 또는 단편은 케이지 형태의 복합 단백질을 형성할 수 있는 활성이 유지되는 한 제한이 없으며, HFL(human ferritin light chain) 또는 HFH(human ferritin heavy chain)이 이용될 수 있다. 본 발명의 페리틴 단백질 또는 이의 단편은 서열번호 2의 아미노산 서열에서 아미노산 잔기가 일부 추가, 삭제 또는 치환되어 형성된 단백질 또는 단편일 수 있다.
본 명세서에서 사용된 용어 "발현 벡터"는 발현 벡터의 전사에 제공되는 추가단편에 작동 가능하게 연결된 관심의 폴리펩티드를 암호화하는 단편으로 구성되는 선형 또는 원형의 DNA 분자이다. 그와 같은 추가단편은 프로모터 및 종료암호 서열을 포함한다. 발현 벡터는 하나 이상의 복제 개시점, 하나 이상의 선택 마커, 폴리아데닐화 신호 등을 또한 포함한다. 발현 벡터는 일반적으로 플라스미드 또는 바이러스 DNA로부터 유도되거나, 또는 둘 다의 요소를 함유한다.
본 명세서에서 사용된 용어 "작동 가능하게 연결된"은 프로모터에서 전사가 개시하고 암호화 서열을 통해 종료 암호로 진행하는데 작용하도록 단편이 배열되는 것을 나타낸다.
본 발명에 따른 발현 벡터에 있어서, 상기 발현 벡터는 플라스미드, 바이러스 벡터, 파지 입자 또는 게놈 삽입물일 수 있다. 상기 발현 벡터는 숙주세포 내로 형질전환 된 후, 숙주세포의 게놈과 무관하게 복제되거나 숙주 세포의 게놈 내로 통합될 수 있다.
본 발명의 일 실시예에서, 상기 벡터는 단일사슬항체조각(Single-chain variable fragment)을 코딩하는 폴리뉴클레오티드 및 페리틴 사이에 링커를 더욱 포함하여 제작될 수 있다.
상기 링커는 단일사슬항체조각(scFv)을 페리틴 모노머 단편의 C-말단 또는 N-말단의 특정부위에 부착시키기 위한 것으로, 1 개 내지 수 개의 아미노산으로 이루어질 수 있다.
본 발명에서 상기 링커는 단일사슬항체조각(Single-chain variable fragment)과 페리틴 사이에 도입되어 두 도메인 사이의 입체 장애를 최소화함으로써, 삼량체 및 나노입자 구조의 형성을 향상시키는 역할을 수행할 수 있다.
본 발명에서 상기 나노입자는 저분자량의 단일체(모노머, monomer)들의 정밀한 자가조립 성질에 의하여 형성되며, 내부에 공간을 가지는 단백질로 된 케이지 형태의 입자를 의미한다. 본 발명의 나노입자는 본 발명의 단일사슬항체조각(scFv)-페리틴 융합 단백질을 상기 케이지를 구성하는 단일체로 포함하는 것을 특징으로 한다.
본 발명에서 사용되는 용어 "자가조립(self-assembly)"이란 어떤 분자들이 외부의 특별한 자극이나 인위적인 유도 없이, 스스로 알아서 특정한 나노 구조를 형성하는 성질을 의미한다.
본 발명의 나노입자는 상기 단일사슬항체조각(Single-chain variable fragment)-페리틴 융합 단백질 모노머 단편이 삼량체(trimer)를 형성한 후, 상기 삼량체 8개가 3차원적으로 규칙적으로 배열된 것으로, 이는 모노머 24개가 모여 형성된 것일 수 있다.
한편, 본 발명에 따라 단일사슬항체조각(Single-chain variable fragment)-페리틴 융합단백질을 코딩하는 핵산 또는 상기 핵산을 포함하는 재조합 벡터는 숙주 세포를 형질전환(transformation) 또는 형질감염(transfection) 시킬 수 있다.
본 명세서에서 사용된 용어 "핵산" 또는 "폴리뉴클레오티드"는 단일 또는 이중-가닥의 형태로 된 데옥시리보뉴클레오티드 또는 리보뉴클레오티드를 말한다. 다른 제한이 없는 한, 자연적으로 생성되는 뉴클레오티드와 비슷한 방법으로 핵산에 혼성화되는 자연적 뉴클레오티드의 공지된 아날로그도 포함된다.
본 명세서에서 사용된 용어 "재조합 단백질(recombinant protein)" 또는 "융합 단백질(fusion protein)"은 단일사슬항체조각(scFv) 서열의 N-말단 또는 C-말단에 다른 단백질이 연결되거나 다른 아미노산 서열이 부가된 단백질을 의미하며, 바람직하게는 페리틴 단백질의 N-말단에 단일사슬항체조각(scFv)이 결합된 단량체의 단백질(scFv-ferritin monomer), 또는 페리틴 단백질의 N-말단에 단일사슬항체조각(scFv)이 결합되고 단일사슬항체조각에 hRID가 결합된 단량체의 단백질(hRID-scFv-ferritin monomer)을 의미한다.
본 명세서에서 사용된 용어 "단백질" 은 "펩타이드(peptide)" 또는 "폴리펩타이드(polypeptide)"와 호환성 있게 사용되며, 예컨대, 자연상태의 단백질에서 일반적으로 발견되는 바와 같이 아미노산 잔기의 중합체를 말한다.
본 발명의 재조합 벡터는 본 발명의 핵산을 적당한 벡터에 연결(삽입)하여 획득할 수 있다. 본 발명의 핵산이 삽입될 벡터는 그것이 숙주 안에서 복제될 수 있는 한 특별히 제한되지는 않는다. 예를 들어, 플라스미드 DNA, 파아지 DNA 등이 사용될 수 있다. 플라스미드 DNA의 구체적인 예로는 pCDNA31+(Invitrogen) 같은 상업적인 플라스미드를 포함한다. 본 발명에 사용될 수 있는 플라스미드의 다른 예로는 대장균 유래 플라스미드(pYG601BR322, pBR325, pUC118 및 pUC119), 바실러스 서브틸리스 (Bacillus subtilis)-유래 플라스미드(pUB110 및 pTP5) 및 효모-유래 플라스미드(YEp13, YEp24 및 YCp50)가 있다. 파아지 DNA의 구체적인 예로는 λ-파아지(Charon4A, Charon21A, EMBL3, EMBL4, λgt10, λgt11 및 λZAP)가 있다. 또한, 레트로바이러스(retrovirus), 아데노바이러스(adenovirus) 또는 백시니아 바이러스(vaccinia virus)와 같은 동물 바이러스, 배큘로바이러스 (baculovirus)와 같은 곤충 바이러스가 또한 사용될 수 있다.
본 발명의 핵산을 벡터로 삽입하기 위해, 정제된 DNA를 적당한 제한효소로 절단하여 적당한 벡터 DNA의 제한 부위 또는 클로닝 부위에 삽입하는 방법이 사용될 수 있다.
본 발명의 핵산은 벡터에 작동 가능하게 연결되는 것이 바람직하다. 본 발명의 벡터는 프로모터 및 본 발명의 핵산 외에 인핸서(enhancer)와 같은 시스 요소(cis element), 스플라이싱 시그널(splicing signal), 폴리 A 추가 시그널(poly A addition signal), 선택 마커(selection marker), 라이보좀 결합 서열(ribosome binding sequence, SD sequence) 등을 추가로 포함할 수 있다. 선택 마커의 예로, 클로람페니콜 저항 핵산, 암피실린 저항 핵산, 디하이드로폴레이트 환원효소(dihydrofolate reductase), 네오마이신 저항 핵산 등이 사용될 수 있으나, 상기 예들에 의해 작동 가능하도록 연결되는 추가적 구성요소가 제한되는 것은 아니다.
다른 측면에서, 본 발명은 상술한 발현 벡터로 형질 전환된 숙주세포를 제공한다.
본 발명에서 사용되는 용어, '형질전환(transformation)'이란 DNA를 숙주로 도입하여 DNA가 염색체의 인자로서 또는 염색체 통합 완성에 의해 복제 가능하게 되는 것으로 외부의 DNA를 세포 내로 도입하여 인위적으로 유전적인 변화를 일으키는 현상을 의미한다.
본 발명의 형질전환 방법은 임의의 형질전환 방법이 사용될 수 있으며, 당업계의 통상적인 방법에 따라 용이하게 수행할 수 있다. 일반적으로 형질전환 방법에는 CaCl2 침전법, CaCl2 방법에 DMSO(dimethyl sulfoxide)라는 환원물질을 사용함으로써 효율을 높인 Hanahan 방법, 전기천공법(electroporation), 인산칼슘 침전법, 원형질융합법, 실리콘 카바이드 섬유를 이용한 교반법, 아그로박테리아 매개된 형질전환법, PEG를 이용한 형질전환법, 덱스트란 설페이트, 리포펙타민 및 건조/억제 매개된 형질전환 방법 등이 있다.
본 발명의 단일사슬항체조각(Single-chain variable fragment)-페리틴 융합단백질을 코딩하는 핵산 또는 이를 포함하는 벡터를 형질전환 시키기 위한 방법은 상기 예들에 국한되지 않으며, 당업계에서 통상적으로 사용되는 형질전환 또는 형질감염 방법이 제한 없이 사용될 수 있다.
목적 핵산인 단일사슬항체조각(Single-chain variable fragment)-페리틴 융합단백질를 코딩하는 핵산 또는 이를 포함하는 재조합 벡터를 숙주로 도입함으로써 본 발명의 형질전환체(transformant)를 획득할 수 있다.
숙주는 본 발명의 핵산을 발현하도록 하는 한 특별히 제한되지는 않는다. 본 발명에 사용될 수 있는 숙주의 특정한 예로는 대장균(E coli)과 같은 에스케리키아(Escherichia)속 세균; 바실러스 서브틸리스(Bacillus subtilis) 같은 바실러스 (Bacillus)속 세균; 슈도모나스 푸티다(Pseudomonas putida) 같은 슈도모나스 (Pseudomonas)속 세균; 락토바실러스와 엔테로코커스 등 유산균; 사카로마이세스 세레비지애(Saccharomyces cerevisiae), 스키조사카로마이세스 폼베(Schizosaccharomyces pombe) 같은 효모; 등의 원핵세포와 동물세포 및 곤충 세포가 있다.
기존 연구에서는 보조 접힘, 번역 후 변형 및 다중 성분 나노입자의 생성 가능성으로 인해 효모, 곤충 및 포유류 세포와 같은 진핵세포가 대장균 보다 선호되어 왔으나, 이러한 진핵세포 사용시 대량생산공정이 어려운 문제가 있다.
본 발명의 일 실시예에서는, 상기 문제점을 해결하기 위하여 저렴하며 용이하게 대량 생산이 가능한 대장균을 사용하여 단일사슬항체조각(Single-chain variable fragment)이 표시된 자가조립 나노입자 구조체를 생산하였다.
이에, 본 발명의 숙주세포는 이에 제한되는 것은 아니나, 저렴하고 용이하게 대량생산이 가능한 측면에서 대장균일 수 있다.
대장균과 같은 세균이 숙주로서 사용될 때, 본 발명의 재조합 벡터는 숙주 내에서 자율적인 복제를 할 수 있고, 프로모터, 라이보좀 결합서열, 본 발명의 핵산 및 전사 종료 서열(transcription termination sequence)로 구성되어 있다.
본 발명의 프로모터는, 본 발명의 핵산을 대장균과 같은 숙주에서 발현하도록 하는 한 어떠한 프로모터도 사용될 수 있다. 예를 들어, trp 프로모터, lac 프로모터, PL 프로모터 또는 PR 프로모터 같은 대장균 또는 파아지유래 프로모터; T7 프로모터 같은 대장균 감염 파아지-유래 프로모터가 사용될 수 있다. 또한 tac 프로모터 같은 인공적으로 변형된 프로모터도 사용될 수 있다.
다른 측면에서, 본 발명은 (a) 단일사슬항체조각(Single-chain variable fragment)을 코딩하는 폴리뉴클레오티드; 상기 단일사슬항체조각(Single-chain variable fragment)의 발현 효율을 증진시키기 위한 펩타이드;및 페리틴을 코딩하는 폴리뉴클레오티드를 포함하는 발현 벡터를 제조하는 단계; (b) 상기 발현 벡터를 숙주세포에 도입하여 형질전환체를 제조하는 단계; (c) 상기 형질전환체를 배양하여 단일사슬항체조각(Single-chain variable fragment)-페리틴 융합단백질의 발현을 유도하는 단계; 및 (d) 상기 발현된 단일사슬항체조각(Single-chain variable fragment)-페리틴 융합단백질의 자가조립에 의해 형성된 나노입자를 정제하는 단계;를 포함하는 자가조립 나노입자의 제조방법을 제공한다.
상기 발현 벡터, 형질전환체 및 자가조립 나노입자에 대한 구체적인 내용은 상술한 내용과 동일하다.
본 발명에서 회수되는 단일사슬항체조각(Single-chain variable fragment)의 정제를 용이하게 하기 위하여, 플라스미드 벡터는 필요에 따라 다른 서열을 추가로 포함할 수 있다. 상기 추가로 포함될 수 있는 서열은 단백질 정제용 태그 서열일 수 있으며, 예컨대, 글루타티온 S-트랜스퍼라제(Pharmacia, USA), MBP(말토스 결합 단백질, USA), FLAG(IBI, USA) 및 헥사히스티딘(hexahistidine; Quiagen, USA) 등이 있고, 가장 바람직하게는 헥사히스티딘 일 수 있으나, 상기 예들에 의하여 단일사슬항체조각(Single-chain variable fragment)의 정제를 위하여 필요한 서열의 종류가 제한되는 것은 아니다.
상기 융합 서열이 포함되어 있는 벡터에 의해 발현된 융합 단백질의 경우, 친화성 크로마토그래피에 의해 정제될 수 있다. 예컨대, 글루타티온-S-트랜스퍼라제가 융합된 경우에는 이 효소의 기질인 글루타티온을 이용할 수 있고, MBP가 이용된 경우에는 아밀로오즈 컬럼을 이용하여 원하는 단일사슬항체조각(scFv)을 용이하게 회수할 수 있다.
본 발명의 단일사슬항체조각(Single-chain variable fragment)-페리틴 융합단백질을 발현시키기 위해 상기의 방법으로 형질 전환된 숙주 세포는 당업계에서 사용되는 통상적인 방법으로 배양할 수 있다. 예를 들면, 상기 단일사슬항체조각(Single-chain variable fragment)-페리틴 융합단백질을 발현하는 형질전환체는 다양한 배지에서 배양할 수 있으며, 유가식(fed-batch) 배양 및 연속 배양 등을 수행할 수 있으나, 상기 예에 의해 본 발명의 형질전환체의 배양방법이 제한되는 것은 아니다. 또한, 숙주 세포의 생장을 위하여 배지 중에 포함될 수 있는 탄소원은 제조된 형질전환체의 종류에 따라 당업자의 판단에 의해 적절하게 선택될 수 있고, 배양 시기 및 양을 조절하기 위해 적당한 배양 조건을 채택할 수 있다.
적절한 숙주 세포를 선택하여 배지 조건을 조성하여 주면 단일사슬항체조각(Single-chain variable fragment)이 성공적으로 형질 전환된 형질전환체는 단일사슬항체조각(Single-chain variable fragment)-페리틴 융합단백질을 생산하게 되며, 벡터의 구성 및 숙주 세포의 특징에 따라 생산된 단일사슬항체조각(Single-chain variable fragment)-페리틴 융합단백질은 숙주 세포의 세포질 내, 페리플라즈믹 스페이스(periplasmic space) 또는 세포 외로 분비될 수 있다.
숙주 세포 내 또는 외에서 발현된 단백질은 통상의 방식으로 정제될 수 있다. 정제 방법의 예로는 염석(예를 들어 황산암모늄 침전, 인산 나트륨 침전 등), 용매 침전(예를 들어, 아세톤, 에탄올 등을 이용한 단백질 분획 침전 등), 투석, 겔 여과, 이온 교환, 역상 컬럼 크로마토그래피와 같은 크로마토그래피 및 한외여과 등의 기법을 단독 또는 조합으로 적용하여 본 발명의 단백질을 정제할 수 있다.
다른 측면에서, 본 발명은 상기 제조방법에 의해 제조되는 나노입자를 제공한다. 본 발명에 따른 단일사슬항체조각(Single-chain variable fragment)-페리틴 융합단백질은 단량체 24개가 자가조립에 의해 구형의 나노입자를 형성할 수 있다. 이때, 나노입자의 직경은 24 내지 30 nm 일 수 있다.
상기 나노입자에 대한 구체적인 내용은 상술한 내용과 동일하다.
다른 측면에서, 본 발명은 상기 나노입자를 포함하는 질병 예방, 개선 또는 치료용 약학 조성물을 제공한다.
본 발명에서 "예방"은 상기 조성물의 투여로 목적하는 질병의 발병을 억제 또는 지연시키는 모든 행위를 말하며, "치료"는 상기 조성물에 의해 목적하는 질병에 의한 증세가 호전되거나 이롭게 변경되는 모든 행위를 말한다.
본 발명에서 상기 "질병"은, 사용하는 단일사슬항체조각(Single-chain variable fragment)의 종류에 따라 다르게 특정될 수 있다. 예를 들어, 단일사슬항체조각(Single-chain variable fragment)이 베바시주맙 (Bevacizumab)유래인 경우, 암(특히, 대장암, 폐암, 교모세포종, 신세포암) 또는 눈병(예를들어, 황반변성)이 치료하고자 하는 대상 질병이 될 수 있다. 단일사슬항체조각(Single-chain variable fragment)이 트라스투주맙(Trastuzumab) 유래인 경우, 암(특히, 유방암 또는 전이성 위암)이 대상 질병이 될 수 있다. 단일사슬항체조각(Single-chain variable fragment)이 퍼투주맙(Pertuzumab) 유래인 경우, 대상 질병으로 유방암, 난소암, 전린섭암 등의 암이 포함될 수 있다.
본 발명에 따른 약학적 조성물은 상기 나노입자를 단독으로 함유하거나 약학적으로 허용되는 담체와 함께 적합한 형태로 제형화 될 수 있으며, 부형제 또는 희석제를 추가로 함유할 수 있다. 상기에서 '약학적으로 허용되는'이란 생리학적으로 허용되고 인간에게 투여될 때, 통상적으로 위장 장애, 현기증 등과 같은 알레르기 반응 또는 이와 유사한 반응을 일으키지 않는 비독성의 조성물을 말한다.
약학적으로 허용되는 담체로는 예컨대, 경구 투여용 담체 또는 비경구 투여용 담체를 추가로 포함할 수 있다.
경구 투여용 담체는 락토스, 전분, 셀룰로스 유도체, 마그네슘 스테아레이트, 스테아르산 등을 포함할 수 있다.
아울러, 펩티드 제제에 대한 경구투여용으로 사용되는 다양한 약물전달물질을 포함할 수 있다. 또한, 비경구 투여용 담체는 물, 적합한 오일, 식염수, 수성 글루코오스 및 글리콜 등을 포함할 수 있으며, 안정화제 및 보존제를 추가로 포함할 수 있다. 적합한 안정화제로는 아황산수소나트륨, 아황산나트륨 또는 아스코르브산과 같은 항산화제가 있다. 적합한 보존제로는 벤즈알코늄 클로라이드, 메틸-또는 프로필-파라벤 및 클로로부탄올이 있다.
본 발명의 약학적 조성물은 상기 성분들 이외에 윤활제, 습윤제, 감미제, 향미제, 유화제, 현택제 등을 추가로 포함할 수 있다. 그 밖의 약학적으로 허용되는 담체 및 제제는 다음의 문헌에 기재되어 있는 것을 참고로 할 수 있다(Remington's Pharmaceutical Sciences, 19th ed, Mack Publishing Company, Easton, PA, 1995).
본 발명의 조성물은 인간을 비롯한 포유동물에 어떠한 방법으로도 투여할 수 있다. 예를 들면, 경구 또는 비경구적으로 투여할 수 있다. 비경구적인 투여방법으로는 이에 한정되지는 않으나, 정맥내, 근육내, 동맥내, 골수 내, 경막내, 심장내, 경피, 피하, 복강내, 비강내, 장관, 국소, 설하 또는 직장내 투여일 수 있다.
본 발명의 약학적 조성물은 상술한 바와 같은 투여 경로에 따라 경구 투여용 또는 비경구 투여용 제제로 제형화할 수 있다.
경구 투여용 제제의 경우에 본 발명의 조성물은 분말, 과립, 정제, 환제, 당의정제, 캡슐제, 액제, 겔제, 시럽제, 슬러리제, 현탁액 등으로 당업계에 공지된 방법을 이용하여 제형화될 수 있다. 예를 들어, 경구용 제제는 활성성분을 고체 부형제와 배합한 다음 이를 분쇄하고 적합한 보조제를 첨가한 후 과립 혼합물로 가공함으로써 정제 또는 당의정제를 수득할 수 있다. 적합한 부형제의 예로는 락토즈, 덱스트로즈, 수크로즈, 솔비톨, 만니톨, 자일리톨, 에리스리톨 및 말티톨 등을 포함하는 당류와 옥수수 전분, 밀 전분, 쌀 전분 및 감자 전분 등을 포함하는 전분류, 셀룰로즈, 메틸 셀룰로즈, 나트륨 카르복시메틸셀룰로오즈 및 하이드록시프로필메틸-셀룰로즈 등을 포함하는 셀룰로즈류, 젤라틴, 폴리비닐피롤리돈 등과 같은 충전제가 포함될 수 있다. 또한, 경우에 따라 가교결합 폴리비닐피롤리돈, 한천, 알긴산 또는 나트륨 알기네이트 등을 붕해제로 첨가할 수 있다.
나아가, 본 발명의 약학적 조성물은 항응집제, 윤활제, 습윤제, 향료, 유화제 및 방부제 등을 추가로 포함할 수 있다. 비경구 투여용 제제의 경우에는 주사제, 크림제, 로션제, 외용연고제, 오일제, 보습제, 겔제, 에어로졸 및 비강흡입제의 형태로 당업계에 공지된 방법으로 제형화할 수 있다. 이들 제형은 모든 제약 화학에 일반적으로 공지된 처방서인 문헌(Remington's Pharmaceutical Science, 19th ed, Mack Publishing Company, Easton, PA, 1995)에 기재되어 있다.
본 발명의 조성물의 총 유효량은 단일 투여량(single dose)으로 환자에게 투여될 수 있으며, 다중 투여량(multiple dose)으로 장기간 투여되는 분할 치료 방법(fractionated treatment protocol)에 의해 투여될 수 있다. 본 발명의 약학적 조성물은 질환의 정도에 따라 유효성분의 함량을 달리할 수 있다. 바람직하게 본 발명의 약학적 조성물의 바람직한 전체 용량은 1일당 환자 체중 1㎏ 당 약 001㎍ 내지 10,000mg, 가장 바람직하게는 0.1 mg 내지 500 mg일 수 있다. 그러나 상기 약학적 조성물의 용량은 제제화 방법, 투여 경로 및 치료 횟수뿐만 아니라 환자의 연령, 체중, 건강 상태, 성별, 질환의 중증도, 식이 및 배설율등 다양한 요인들을 고려하여 환자에 대한 유효 투여량이 결정되는 것이므로, 이러한 점을 고려할 때 당 분야의 통상적인 지식을 가진 자라면 본 발명의 조성물의 적절한 유효 투여량을 결정할 수 있을 것이다. 본 발명에 따른 약학적 조성물은 본 발명의 효과를 보이는 한 그 제형, 투여 경로 및 투여 방법에 특별히 제한되지 아니한다.
이하, 발명의 이해를 돕기 위해 다양한 실시예를 제시한다. 하기 실시예는 발명을 보다 쉽게 이해하기 위하여 제공되는 것일 뿐 발명의 보호범위가 하기 실시예에 한정되는 것은 아니다.
[실험 방법]
1. 단백질 발현 벡터의 제작
1-1. Bevacizumab 유래 단일사슬항체조각(Single-chain variable fragment)을 이용한 융합단백질 벡터의 제작 (도 1a)
pGE-LysRS 벡터에서 LysRS 유전자를 nde1과 kpn1으로 효소적으로 절단 후 human LysRS의 N-말단의 1-69 아미노산인 hRID (RNA interaction domain originated from human)의 PCR 생성물을 동일한 제한 효소를 사용하여 잘라내어 pGE-hRID 벡터를 만들었다. 그런 다음, pGE-hRID 벡터를 SalI 및 Hind²제한효소로 절단하고, 미생물 혹은 사람 유래의 페리틴 유전자를 삽입하여 hRID-FR 벡터를 만들었다. hRID-FR 벡터를 KpnI 및 SalI 제한효소로 절단하고, Bevacizumab의 ScFv 서열 ferritin사이에 아미노산 SGGGGSGGGG가 링커로 오도록 삽입하여 hRID에 TEV cleavage site및 6x-His-Bevacizumab ScFv-FR로 구성된 벡터를 제작하였다.
1-2. Trastuzumab 유래 단일사슬항체조각(Single-chain variable fragment)을 이용한 융합단백질 벡터의 제작 (도 1b)
pGE-hRID 벡터를 KpnI 및 EcoRV 제한효소로 절단하고, Trastuzumab의 ScFv와 사람 유래의 페리틴 유전자사이에 GGGG SGGGGSGGGGSGQAGQHAAGSGSGSS가 링커로 오도록 삽입하여 삽입하여 hRID에 TEV cleavage site및 6x-His-Trastuzumab ScFv-FR로 구성된 벡터를 제작하였다.
1-3. Pertuzumab 유래 단일사슬항체조각(Single-chain variable fragment)을 이용한 융합단백질 벡터의 제작 (도 1c)
hRID-FR 벡터를 BamHI 및 SalI 제한효소로 절단하고, Pertuzumab의 ScFv 서열과 Ferritin사이에 GGGSGGGTGGGSGGG가 링커로 오도록 삽입하여 hRID에 TEV cleavage site및 6x-His-Trastuzumab ScFv-FR로 구성된 벡터를 제작하였다.
2. 수용성 증진의 확인
2-1. Bevacizumab- 페리틴 융합단백질 나노입자 (도 3a)
모든 플라스미드는 SHuffle® T7 Competent E. coli에 형질전환 시켰다. 3ml의 LB배지에 암피실린을 50ug/ml로 처리 후 30℃에서 밤새 배양하였다. 각각의 형질전환체를 암피실린을 포함하는 LB배지 15ml에 스캐일업하여 18℃ O.D=0,6~0.8에서 1 mM IPTG(isopropyl β-D-1-thioglalactopyranoside)를 induction 한 후 밤새 단백질을 발현 시킨다. 대장균을 원심 분리하여 세포를 가라앉히고, 세포는 wash buffer에서 초음파를 이용하여 파쇄하였다. 이때 wash buffer는 [50 mM Tris-HCl (pH 8.0), 0, 100, 200, 300 mM NaCl, 10% glycerol, 2.86mM 2-mercaptoethanol, TWEEN-20 0.1%]를 사용하였으며, 파쇄된 세포 전체를 T(Total), 파쇄된 세포를 4℃, 20분, 12000rpm으로 원심분리한 상층액을 S(Soluble), 가라앉은 세포를 P(Pellet)으로 하여 SDS PAGE GEL에 내려 파쇄된 세포에서 얻은 단백질의 수용성을 확인하였다.
2-2. Trastuzumab- 페리틴 융합단백질 나노입자 (도 3b)
모든 플라스미드는 SHuffle® T7 Competent E. coli에 형질전환 시켰다. 3ml의 LB배지에 암피실린을 50ug/ml로 처리 후 30℃에서 밤새 배양하였다. 각각의 형질전환체를 암피실린을 포함하는 LB배지 15ml에 스캐일업하여 20℃ O.D=0,6~0.8에서 1 mM IPTG(isopropyl β-D-1-thioglalactopyranoside)를 induction 한 후 8시간 동안 단백질을 발현 시킨다. 대장균을 원심 분리하여 세포를 가라앉히고, 세포는 wash buffer에서 초음파를 이용하여 파쇄하였다. 이때 wash buffer는 [50 mM Tris-HCl (pH 8.0), 0, 100, 200, 300 mM NaCl, 10% glycerol, 2.86mM 2-mercaptoethanol, TWEEN-20 0.1%]를 사용하였으며, 파쇄된 세포 전체를 T(Total), 파쇄된 세포를 4℃, 20분, 12000rpm으로 원심분리한 상층액을 S(Soluble), 가라앉은 세포를 P(Pellet)으로 하여 SDS PAGE GEL에 내려 파쇄된 세포에서 얻은 단백질의 수용성을 확인하였다.
2-3. Pertuzumab- 페리틴 융합단백질 나노입자 (도 3c)
모든 플라스미드는 SHuffle® T7 Competent E. coli에 형질전환 시켰다. 3ml의 LB배지에 암피실린을 50ug/ml로 처리 후 30℃에서 밤새 배양하였다. 각각의 형질전환체를 암피실린을 포함하는 LB배지 15ml에 스캐일업하여 16℃ O.D=0,6~0.8에서 1 mM IPTG(isopropyl β-D-1-thioglalactopyranoside)를 induction 한 후 22.5시간 동안 단백질을 발현 시킨다. 대장균을 원심 분리하여 세포를 가라앉히고, 세포는 wash buffer에서 초음파를 이용하여 파쇄하였다. 이때 wash buffer는 [50 mM Tris-HCl (pH 8.0), 0, 100, 200, 300 mM NaCl, 10% glycerol, 2mM 2-mercaptoethanol, TWEEN-20 0.1%]를 사용하였으며, 파쇄된 세포 전체를 T(Total), 파쇄된 세포를 4℃, 20분, 12000rpm으로 원심분리한 상층액을 S(Soluble), 가라앉은 세포를 P(Pellet)으로 하여 SDS PAGE GEL에 내려 파쇄된 세포에서 얻은 단백질의 수용성을 확인하였다.
3. 단백질의 발현 및 정제(Purification: Ni(affinity chromatography) and SEC)
3-1. Bevacizumab-페리틴 융합 단백질 나노입자의 정제 (도 4a, b)
모든 플라스미드는 SHuffle® T7 Competent E. coli에 형질전환 시켰다. 50ml의 LB 배지에 암피실린을 50ug/ml로 처리 후 30℃에서 밤새 배양하였다. 각각의 형질전환체를 암피실린을 포함하는 LB 배지 500ml 에 18℃로 대용량 배양하여 O.D=0,6~0.8에서 1 mM IPTG(isopropyl β-D-1-thioglalactopyranoside)를 induction 한 후 밤새 단백질을 발현 시킨다. 대장균을 원심 분리하여 세포를 가라앉히고, 세포는 wash buffer (0mM NaCl)에서 초음파를 이용하여 파쇄하였다. 단백질 정제시 Histrap HP column (GE healthcare, 17-5248-02)을 이용하였고 이때 wash buffer는 [50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol, 2.86mM 2-mercaptoethanol, TWEEN-20 0.1%, and 20mM imidazole]를 사용하였으며, elution buffer는 [50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol, 2.86mM 2-mercaptoethanol, 0.1% TWEEN-20, and 300mM imidazole]로 단백질을 정제 분리(Affinity Chromatography)하였다. 그 후 centrifugal filters (Centriprep, Merck Millipore Ltd)로 농축한 후 Superose 6 10/300 column (GE Healthcare)을 이용하여 나노입자를 정제(SEC)하였다.
3-2. Trastuzumab- 페리틴 융합 단백질 나노입자의 정제 (도 5a, b)
모든 플라스미드는 SHuffle® T7 Competent E. coli에 형질전환 시켰다. 50ml의 LB 배지에 암피실린을 50ug/ml로 처리 후 30℃에서 밤새 배양하였다. 각각의 형질전환체를 암피실린을 포함하는 LB 배지 500ml 에 20℃로 대용량 배양하여 O.D=0,6~0.8에서 1 mM IPTG(isopropyl β-D-1-thioglalactopyranoside)를 induction 한 후 8시간동안 단백질을 발현 시킨다. 대장균을 원심 분리하여 세포를 가라앉히고, 세포는 wash buffer (0mM NaCl)에서 초음파를 이용하여 파쇄하였다. 단백질 정제시 Histrap HP column (GE healthcare, 17-5248-02)을 이용하였고 이때 wash buffer는 [50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol, 2.86mM 2-mercaptoethanol, TWEEN-20 0.1%, and 20mM imidazole]를 사용하였으며, elution buffer는 [50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol, 2.86mM 2-mercaptoethanol, 0.1% TWEEN-20, and 300mM imidazole]로 단백질을 정제 분리(Affinity Chromatography)하였다. 그 후 centrifugal filters (Centriprep, Merck Millipore Ltd)로 농축한 후 Superose 6 10/300 column (GE Healthcare)을 이용하여 나노입자를 정제(SEC)하였다.
3-3. Pertuzumab- 페리틴 융합 단백질 나노입자의 정제 (도 6a, b)
모든 플라스미드는 SHuffle® T7 Competent E. coli에 형질전환 시켰다. 50ml의 LB 배지에 암피실린을 50ug/ml로 처리 후 30℃에서 밤새 배양하였다. 각각의 형질전환체를 암피실린을 포함하는 LB 배지 500ml 에 16℃로 대용량 배양하여 O.D=0,6~0.8에서 1 mM IPTG(isopropyl β-D-1-thioglalactopyranoside)를 induction 한 후 8시간동안 단백질을 발현 시킨다. 대장균을 원심 분리하여 세포를 가라앉히고, 세포는 wash buffer (0mM NaCl)에서 초음파를 이용하여 파쇄하였다. 단백질 정제시 Histrap HP column (GE healthcare, 17-5248-02)을 이용하였고 이때 wash buffer는 [50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol, 2mM 2-mercaptoethanol,TWEEN-20 0.1%, and 20mM imidazole]를 사용 하였으며, elution buffer는 [50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol, 2.86mM 2-mercaptoethanol, 0.1% TWEEN-20, and 300mM imidazole]로 단백질을 정제 분리(Affinity Chromatography)하였다. 그 후 centrifugal filters (Centriprep, Merck Millipore Ltd)로 농축한 후 Superose 6 10/300 column (GE Healthcare)을 이용하여 나노입자를 정제(SEC)하였다.
4. 나노입자 형성의 확인(Assembly of nanoparticle)
KOREA BASIC SCIENCE INSTITUTE CHUNCHEON CENTER에 의뢰하여 bio-TEM을 통해 나노입자의 형성을 확인하였다. 결과는 도 7과 같다.
나노입자 단백질 (3ml)을 Dispo-H cell에 넣고 Zeta-potential & Particle size Analyzer (ELS-2000ZS; Otsuka Electronics)를 이용하여 size를 측정 및 분석(DLS)하였다. 나노입자의 intensity distribution diameter은 물 용매에 25°C 조건에서 2번 측정되었고, 이떄 sample accumulation time은 200초 조건으로 측정하였다.
5. 나노입자의 안정성 분석 (Stability of nanoparticle)
도 8은 대조물질과 나노입자의 열 안정성 분석 (Thermal stability analysis)한 도면으로, 도 5는 circular dichroism (CD) spectroscopy를 사용하여 대조물질인 scFv와 Bevacizumab과 h-scFV-HFH (나노입자의)의 19.68 ~ 98.18℃로 온도를 높이면서 216 nm 파장의 signal을 측정한 결과이다. 이때 h-scFV-HFH (나노입자) Bevacizumab(대조 항체)는 Tm=61.81℃의 온도 이하에서는 눈에 띄는 구조의 변화가 관찰되지 않았지만, scFv는 45.71℃에서 구조의 변화가 관찰되었다. 이 결과는 우리의 h-scFV-HFH (나노입자)가 단일클론 항체(대조물질)와 유사한 열 안전성을 갖고 scFv 보다는 우수한 열 안정성이 있음을 보여주는 결과이다.
[실시예]
실시예 1. SPR 및 ELISA 분석
실시예 1-1. Bevacizumab-페리틴 융합 단백질의 SPR, ELISA 분석
- SPR 분석
베바시주맙 SPR 분석
Antigen Antibody Ka (1/Ms) Kd (1/s) KD (M)
Human VEGF Bevacizumab 1.786E+5 4.021E-6 2.251E-11
scFv monomer 4.574E+4 5.682E-4 1.242E-8
h(3)-scFv-HFH 4.655E+5 4.424E-5 9.503E-11
h(3)-scFv-HFH
+chaperone		 3.813E+4 2.577E-6 1.241E-11
Mouse VEGF Bevacizumab ND ND ND
scFv monomer 4.859E+4 8.971E-4 1.846E-8
h(3)-scFv-HFH 7.441E+4 3.686E-6 4.953E-11
h(3)-scFv-HFH
+chaperone		 9.727E+4 1.248E-6 1.283E-11
scFv의 원형인 Bevacizumab과 VEGF간의 결합력 및 상기 scFv-페리틴 융합단백질 나노입자와 VEGF간의 결합력을 SPR(Surface plasmon resonance) 분석법을 이용하여 비교하였다.
구체적으로, Biacore T100 분석기 (GE Healthcare, Uppsala, Sweden)를 사용하였는데, 바이오센서 분석에서는 EDC/NHS(N'-(3-dimethylaminopropyl) carbodiimide hydrochloride / N-hydroxysuccinimide)로 활성화한 CM5 센서 칩(GE Healthcare, Uppsala, Sweden)에 10 ㎕/min의 유속으로 VEGF 단백질(10 μg/㎖ in 10 mM Sodium acetate, pH 5.0)을 5 분간 흘려주어 고정화시켰다. 센서 칩 표면에 남아있는 활성화 부분은 1.0 M 에탄올아민 (ethanolamine, pH 8.5)을 첨가하여 비활성화시켰다. 이상태에서 Bevacizumab 또는 scFv-페리틴 융합단백질을 각 농도별로 완충용액(1 X PBS, pH 7.4)에 희석한 후, 30 ㎕/min의 유속으로 흘러주면서 결합 센서그램과 해리 센서그램을 확인하였다. 이때, 센서 칩과의 비특이적 결합에 의해 발생하는 센서그램을 보정하기 위해서BSA(bovine serum albumin)로만 완전히 비활성화된 셀을 사용하였고 VEGF의 센서그램에서 BSA의 센서그램을 빼줌으로써 비특이성 결합을 보정하였다. 센서 칩의 표면은 재생(regeneration) 완충용액(20 mM NaOH)을 흘려줌으로써 재생하였다.
- ELISA 분석
hRID가 융합 파트너로써 RNA 매개 접힘 및 안정성을 확인하기 위해서 hRID의 RNA 결합부위가 돌연변이 되어 RNA가 결합하지 못하는 hRID(9m)인 Bevacizumab-페리틴 융합 단백질은 hRID가 변이가 없는 Bevacizumab-페리틴 융합 단백질 보다 결합력이 감소하는지 여부를 확인하기 위해 수행되었다. 2000nM/웰 hVEGF 단백질 (Abcam)을 Nunc 96-웰 microtiter immunoplates(Thermo Fisher Scientific)에 밤새 4℃ 에서 코팅하였다. 모든 과정 사이에 immunoplates를 3번 PBST (PBS에 0.05% Tween 20 첨가) Wash buffer로 세척하였다. 그리고 블로킹 완충액 (PBST에 5 % skim milk 첨가)으로 37℃ 에서 1 시간동안 반응시켰다. hRID(W)-scFV-HFH, hRID(9m)-scFv-HFH,scFv를 PBST를 이용하여 100nM에서 0.19nM로 1/2로 연속 희석시켰다. 희석 물질을 immunoplates에 처리하여 2 시간 동안 배양하였다. 그 후 anti-hVEGF mAb를 1/400의 100μl를 37℃ 에서 각 웰에 첨가하고 2 시간 동안 배양하였다. 그리고 serum dilution buffer(PBST+0.5%BSA)에 1/20000로 희석한 peroxidase가 접합된 anti-mouseIgG를 웰에 처리하여 2 시간 동안 배양하였다. 마지막으로 100 ㎕/웰의 기질 TMB 용액 (BD Biosciences)을 어두운 곳에서 37℃에서 30 분 동안 배양하였다. 색 반응을 멈추기 위해 50μl의 정지 용액 (2NH2SO4)을 웰에 첨가 후, ELISA reader FLUOstar OPTIMA (BMG LABTECH)를 사용하여 450μM에서 흡광도를 측정하였다.
도 9는 RNA가 단백질의 접힘에 미치는 효과를 hRID 돌연 변이를 통해 확인한 결과로서, hRID 9개 돌연변이되어 RNA가 결합하지 못하는 Bevacizumab-페리틴(HFH) 융합 단백질은 hRID가 변이가 없는 Bevacizumab-페리틴 융합 단백질(HFH) 보다 결합력이 감소함을 확인한 결과이다. 또한 scFv만 있을 때 보다 Bevacizumab-페리틴(HFH) 융합 단백질의 형성 시 hVEGF와 결합력이 향상됨을 확인한 결과이다. 이 결과는 hRID(W)에 RNA가 결합한 경우에 단백질 접힘이 향상되고 Bevacizumab-페리틴 융합 단백질 형성 시 hVEGF에 결합력이 증가함을 보여주는 결과이다.
도 18은 hRID-Bevacizumab scfv-페리틴(HFL; Human Ferritin light chain) 융합 단백질의 결합 친화도를 indirect ELISA 분석으로 비교한 그래프이다. 도 18는 항체 농도에 따른 hRID(W)-Bevacizumab scfv-페리틴(HFL) 융합 단백질, hRID(9M)- Bevacizumab scfv-페리틴(HFL) 융합 단백질 및 Bevacizumab scfv의 접힘 및 표적과의 결합 친화도를 나타낸다. 도 19는 본 발명의 일 실시예에 따라 hRID-scFv-G3SG3TG3SG3-페리틴(scFv-HFL), hRID-scFv (scFv) 및 hRID-HFL (HFL)의 표적 결합 친화도(target binding affinity)를 sandwich ELISA로 분석한 그래프이다. 해당 결과는 ELISA를 3번 반복하여 얻어졌다.
인간의 경우 페리틴(ferritin)이 크기에 따라서 두 종류(HFH/HFL)로 존재한다. 도 9 도 18 및 도 19를 참조하면 본원 발명에 따라 제조된 융합 단백질은 페리틴의 크기/종류에 관계없이 자가조립(assembly)에 의해 표적에 대한 친화성(affinity)이 증가함을 알 수 있다. 또한, 본 실시예에 따르면, hRID-scFv-G3SG3TG3SG3-페리틴(scFv-HFL) 융합단백질 나노입자 또는 Bevacizumab-페리틴(HFH) 융합 단백질 나노입자의 형태일 때, 24배 농도의 hRID-scFv (scFv) 또는 hRID-HFL (HFL)를 이용하였을 때 보다 더 많은 항원에 결합함을 알 수 있다. 따라서, 본원 발명의 융합단백질은 나노입자를 형성하여, 나노입자를 형성하지 못한 단량체 구조 (예컨대, hRID-scFv (scFv) 또는 hRID-HFL (HFL))를 이용하였을 때 보다 표적에 대한 결합 친화도가 더 높음을 알 수 있다.
실시예 1-2. Trastuzumab-페리틴 융합 단백질 나노입자의 ELISAX, SPR 분석 (도 10)
scFv의 원형인 Trastuzumab과 HER2간의 결합력 및 상기 scFv-페리틴 융합단백질 나노입자와 HER2간의 결합력을 SPR(Surface plasmon resonance) 분석법을 이용하여 비교하였다.
구체적으로, Biacore T100 분석기 (GE Healthcare, Uppsala, Sweden)를 사용하였는데, 바이오센서 분석에서는 EDC/NHS(N'-(3-dimethylaminopropyl) carbodiimide hydrochloride/N-hydroxysuccinimide)로 활성화한 CM5 센서 칩(GE Healthcare, Uppsala, Sweden)에 10 ㎕/min의 유속으로 HER2 단백질(10 μg/㎖ in 10 mM Sodium acetate, pH 5.0)을 5 분간 흘려주어 고정화시켰다. 센서 칩 표면에 남아있는 활성화 부분은 1.0 M 에탄올아민 (ethanolamine, pH 8.5)을 첨가하여 비활성화시켰다. 이상태에서 허셉틴 또는 scFv-페리틴 융합단백질 나노입자를 각 농도별로 완충용액(1 X PBS, pH 7.4)에 희석한 후, 30 ㎕/min의 유속으로 흘러주면서 결합 센서그램과 해리 센서그램을 확인하였다(도 9). 이때, 센서 칩과의 비특이적 결합에 의해 발생하는 센서그램을 보정하기 위해서BSA(bovine serum albumin)로만 완전히 비활성화된 셀을 사용하였고 HER2의 센서그램에서 BSA의 센서그램을 빼줌으로써 비특이성 결합을 보정하였다. 센서 칩의 표면은 재생(regeneration) 완충용액(20 mM NaOH)을 흘려줌으로써 재생하였다.
실시예 2. 이동성 시험(Migration test)
HUVECs을 6시간 동안 혈청 기아 상태로 유지하였으며, transwell plate의 아랫부분에 VEGF, VEGF+Avastin, VEGF+G6 monomer, VEGF+G6 24-mer를 그림의 농도로 처리하고 transwell에 1x105 세포들을 심은 뒤 5시간 후에 H&E 염색을 통해 transwell을 이동한 세포들을 확인하였다 (도 11 상단). 마찬가지로 HUVECs을 6시간 동안 혈청 기아 상태로 유지하였으며 matrigel이 코팅된 plate에 그림의 농도로 처리된 VEGF, VEGF+Avastin, VEGF+G6 monomer, VEGF+G6 24-mer 각각에 1.3x105 세포들을 혼합하여 심고 18시간 후에 혈관형성을 확인하였다 (도 11 하단). scFv monomer는 혈관내피세포의 이동성과 혈관형성에서 같은 농도의 Avastin과 동일한 효과를 보이며 multimer(G6 24-mer)에서는 Avastin보다 더욱 강한 효과를 보였다. 따라서, 본 발명에 따른 나노입자(본 실시예에서, multimer(G6 24-mer))를 처리하였을 때, VEGF 처리 대조군과 비교하여 VEGF에 대한 혈관내피세포의 이동성과 혈관형성의 억제효과가 더 뛰어남을 확인할 수 있다.
실시예 3. 유도된 CNV 병소의 치료효과 확인
Laser 유도 CNV 동물모델은 C57BL/6 mouse 8 주령 수컷 24마리에 안과용 레이저 치료 장비인 argon green laser를 사용하여 안저 망막 및 망막색소층을 초점화하여 laser burn sopt의 크기는 지름 100μm, laser의 power는 100mW으로 하여 4~5개의 laser photo coagulation를 시도한다. laser 처치한 당일, 4개의 실험군 (120nM ScFv monomer, 600nM scFv, 120nM ScFv-Ferritin, 600nM ScFv-Ferritin) 과 정상 대조군 (vehicle)으로 각 군 당 4~5마리를 안구 내 약물 주입 (Intravitreous injection) 한 14일이 지난 후에 fluorescein-dextran을 이용한 angiography를 진행한 후 동물을 희생하여 안구를 적출하여 choroid flatmount를 진행한 후 공촛점 현미경으로 CNV 관찰하고 각 group 별로 CNV 사이즈의 감소로 치료효과를 분석하였다. 맥락막신생혈관의 평균 면적은 대조군(식염수), 120nM scFv, 600nM scFv, 120nM scFv-Ferritin의 순으로 크기가 감소하여서 scFv-Ferritin군에서 가장 작은 평균 크기의 맥락막신생혈관이 관찰되었다. 이는 120nM scFv-ferritin 나노입자가 120 또는 600nM농도의 scFv보다 더 강한 망막맥락막 혈관억제 효과가 있음을 나타낸다 (도 12 참조).
실시예 4. 나노입자가 주입된 망막의 공초점 현미경 변화 확인
동물모델 C57BL/6 mouse 8 주령 수컷 10 마리를 마취한 후, 마취한 쥐의 우안에 4개의 실험군 (120nM ScFv monomer, 600nM scFv, 120nM ScFv-Ferritin, 600nM ScFv-Ferritin) 과 정상 대조군 (vehicle) 약물을 각 Hamilton 32G needle microsyringe을 이용하여 1ul 용량씩 안저 내(Intravitreous) 주입하였다. 이후 1일차, 7일차에 각 group 별로 1마리씩 마취 희생하여 안구 적출하여 10um 두께로 동결절편 한 후, 다음과 같이 망막내 ScFv의 분포를 확인할 수 있는 polyclonal His-Tag antibody (Cell Signaling Technology)과 함께 망막내 구조를 확인하기 위한 대조염색으로 astrocyte의 분포를 확인하는 목적의 anti-Glial fibrillary acidic protein antibody (Millipore), photoreceptor layer와 Outer plexiform layer에 주로 감별되는 Lectin-PNA Alexa 488 (Molecular Probes, Eugene, OR, USA)등의 항체를 이용하여 교차 형광염색을 시행한 후, 공초점 형광 현미경 (LSM710; Carl Zeiss, Jena, Germany)에서 촬영하여 각 군 별로 망막내 층위별로 scFV 나노입자의 분포를 확인하였다(도 13 참조). scFv는 His tag 항체(붉은 색)를 이용하여 염색하였다. 1일째 이미지에서 120nM scFv와 600nM scFv는 망막에서 관찰되지 않지만 120nM, 600nM scFv-Ferritin은 망막의 내층 표면에 다량 분포하였고 scFv-Ferritin 융합단백질 나노입자에서 유리된 scFv가 망막내로 침투하여 분포함을 확인하였다(화살촉). 7일째 이미지에서 120nM scFv와 600nM scFv는 망막내에서 확인되지 않는 반면 120nM, 600nM scFv-Ferritin은 망막내층 표면에서 뚜렷이 관찰되며 600nM scFv-Ferritin 군은 망막내 scFv가 관찰된다. 이는 scFv 단독 투여 대비 scFv-Ferritin 융합단백질 나노입자가 망막의 내층 표면에 높은 농도로 부착하고 장시간 망막의 내층 표면 및 망막 전층에 scFv를 전달하여 더 오랜 시간 강하고 지속적인 치료 효과를 유지할 수 있음을 나타낸다.
실시예 5. hRDI에 따른 나노입자의 수용성 분석 (solubility of nanoparticle)
실시예 5-1. Bevacizumab 융합 단백질 나노입자
대장균에서 RNA가 분자 샤페론처럼 기능하여 단백질의 수용성향상과 접힘에 도움을 준다고 알려져있다. 그래서 이를 확인하기 위해 샤페르나의 대표적인 hRID에 tRNA가 결합하지 못하도록 점 돌연변이(9m)를 만들었다. hRID가 야생형(w)인 형태인 hRID(w)-Bevacizumab-ferritin의 형태와, hRID에 tRNA가 결합하지 못하도록 돌연변이(9m)를 준 형태인 hRID(9m)-Bevacizumab-ferritin형태를 발현하여 SDS PAGE GEL을 내려 단백질의 수용성을 비교하였다.
실시예 5-2. Trastuzumab 융합 단백질 나노입자
hRID가 결합되지 않은 형태인 Trastuzumab-ferritin, hRID가 야생형(WT)인 형태인 hRID(WT)-Trastuzumab-ferritin의 형태와 hRID에 tRNA가 결합하지 못하도록 돌연변이(9m)를 준 형태인 hRID(9m)-Trastuzumab-ferritin의 형태를 발현하여 SDS PAGE GEL을 내려 단백질의 수용성을 비교하였다. hRID가 아예 결합되지 않은 단백질은 대장균에서 발현이 되지 않은 반면, hRID가 결합된 단백질은 발현이 되는 것을 확인하였다. 또한, hRID가 단백질에 결합이 되어 있더라도, hRID에 tRNA가 결합하지 않으면 수용성이 매우 떨어지는 것을 확인하였다.
실시예 5-3. Pertuzumab 융합 단백질 나노입자
hRID가 결합되지 않은 형태인 Pertuzumab-ferritin, hRID가 야생형(WT)인 형태인 hRID(WT)-Pertuzumab-ferritin의 형태를 발현하여 SDS PAGE GEL을 내려 단백질의 수용성을 비교하였다. hRID가 아예 결합되지 않은 단백질은 대장균에서 발현이 되기는 하나, 수용성이 어느 NaCl농도에서도 증가되지 않았으나, hRID가 결합된 단백질은 NaCl농도에 따라 단백질의 수용성이 증가하는 것을 확인하였다.
실시예 6. hRID 결합여부에 따른 단백질의 발현 및 정제(Purification: Ni(affinity chromatography) and SEC)
실시예 6-1. Bevacizumab 융합 단백질 나노입자 (도 15 a, b)
페리틴 나노입자 형성시에 RNA의존성을 확인하기 위해, RNA결합이 나노입자의 형성에 어떤 역할을 하는지 hRID(w)-Bevacizumab-ferritin의 형태와, hRID(9m)-Bevacizumab-ferritin형태를 발현하여 정제를 진행하였다.
실시예 6-2. Trastuzumab 융합 단백질 나노입자 (도 16)
페리틴 나노입자 형성시에 RNA의존성을 확인하기 위해, RNA결합이 나노입자의 형성에 어떤 역할을 하는지 Trastuzumab-ferritin, hRID(w)- Trastuzumab -ferritin의 형태와, hRID(9m)- Trastuzumab -ferritin형태를 발현하여 정제를 진행하였다. hRID가 결합되지 않은 단백질은 정제가 되지 않음을 확인하였다.
실시예 7. hRID에 따른 나노입자의 형성 확인(Assembly of nanoparticle according to mutation of hRID)
Bevacizumab의 경우 Trastuzumab에 비해 hRID의 돌연변이 유무에 있어서, 발현 및 정제과정에서는 큰 차이가 없었으나, TEM으로 구조형성여부를 확인하였을 때, hRID(w)-Bevacizumab-ferritin는 적절한 구조를 형성하였지만, hRID(9m)-Bevacizumab-ferritin는 구조가 망가지는 것을 확인하였다 (도 17 참조). 종합하면, RNA결합은 불규칙한 형태로의 응집을 방지하고, 나노입자 조립에 있어서 중요한 역할을 한다.
서열번호 1
hRID(WT) Protein seq
MSEQHAQAAVQAAEVKVDGSEPKLSKNELKRRLKAEKKVAEKEAKQKELSEKQLSQATAAATNHTTDNGVGPEEESV
서열번호 2
hRID(WT) DNA seq
atgtctgaacaacacgcacaggcggccgtgcaggcggccgaggtgaaagtggatggcagcgagccgaaactgagcaagaatgagctgaagagacgcctgaaagctgagaagaaagtagcagagaaggaggccaaacagaaagagctcagtgagaaacagctaagccaagccactgctgctgccaccaaccacaccactgataatggtgtgggtcctgaggaagagagcgtg
서열번호 3
hRID(9m) DNA seq
atgtctgaacaacacgcacaggcggccgtgcaggcggccgaggtgaaagtggatggcagcgagccgaaactgagcgcgaatgagctggcggcgcgcctggcggctgaggcggcggtagcagaggcggaggccgcgcaggcggagctcagtgagaaacagctaagccaagccactgctgctgccaccaaccacaccactgataatggtgtgggtcctgaggaagagagcgtg
서열번호 4
Bacterioferritin Protein Seq
Met Lys Gly Asp Thr Lys Val Ile Asn Tyr Leu Asn Lys Leu Leu Gly Asn Glu Leu Val Ala Ile Asn Gln Tyr Phe Leu His Ala Arg Met Phe Lys Asn Trp Gly Leu Lys Arg Leu Asn Asp Val Glu Tyr His Glu Ser Ile Asp Glu Met Lys His Ala Asp Arg Tyr Ile Glu Arg Ile Leu Phe Leu Glu Gly Leu Pro Asn Leu Gln Asp Leu Gly Lys Leu Asn Ile Gly Glu Asp Val Glu Glu Met Leu Arg Ser Asp Leu Ala Leu Glu Leu Asp Gly Ala Lys Asn Leu Arg Glu Ala Ile Gly Tyr Ala Asp Ser Val His Asp Tyr Val Ser Arg Asp Met Met Ile Glu Ile Leu Arg Asp Glu Glu Gly His Ile Asp Trp Leu Glu Thr Glu Leu Asp Leu Ile Gln Lys Met Gly Leu Gln Asn Tyr Leu Gln Ala Gln Ile Arg Glu Glu Gly
서열번호 5
scfv of Trastuzumab protein seq
M T V A Q A A E V Q L V E S G G G L V Q P G G S L R L S C A A S G F N I K D T Y I H W V R Q A P G K G L E W V A R I Y P T N G Y T R Y A D S V K G R F T I S A D T S K N T A Y L Q　M　N S L R A E D T A V Y Y C S R W G G D G F Y A　M　D Y W G Q G T L V T V S G G G G S G G G G S G G G G S D I Q　M　T Q S P S S L S A S V G D R V T I T C R A S Q D V N T A V A W Y Q Q K P G K A P K L L I Y S A S F L Y S G V P S R F S G S R S G T D F T L T I S S L Q P E D F A T Y Y C Q Q H Y T T P P T F G Q G T K V E I K　
scfv of Trastuzumab DNA seq
atgaccgtggcccaggcggccgaagtgcagttagtcgaatccggtggaggcttagttcagcctggtggcagccttcgtctgtcatgcgctgcttctggttttaacatcaaagatacttatatccactgggtacggcaggccccaggaaaaggtctggaatgggtggcccgtatttatcccactaatggatatacccgttatgccgactcagtaaaaggtcgtttcactatttcggcagatactagtaaaaatacagcttatctgcaaatgaactctctcagagcagaggataccgcggtttattattgttctcgctggggtggtgatggtttctatgctatggattattggggtcaaggtactttggttacggtgtctggtggtggtggttcaggcggaggtggtagtggtggtggaggtagcgacattcagatgacgcaatctcctagcagtctttcagcgagtgtcggtgatcgtgtcaccattacatgtcgtgcatcacaagatgttaataccgcagtggcgtggtatcagcagaagccgggtaaagcaccgaaattgctgatatattccgcctcattcttatatagcggtgttccttctcgctttagcggatcgcgaagcggaacagactttaccctgacaatatcgtctctgcagccggaggattttgcaacgtattattgccaacagcattatacaaccccaccgacctttggtcagggtacgaaagtagaaattaag
서열번호 6
Scfv of Bevacizumab protein seq
MEvqlvesggglvqpggslrlscaasgftisdywihwvrqapgkglewvagitpaggytyyadsvkgrftisadtskntaylqmnslraedtavyycarfvfflpyamdywgqgtlvtvssggggsggggsggggsdiqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliysasflysgvpsrfsgsgsgtdftltisslqpedfatyycqqsyttpptfgqgtkveikrtv
Scfv of Bevacizumab DNA seq
ATG GAA GTC CAG TTG GTG GAG TCC GGT GGT GGC CTG GTC CAA CCG GGT GGG AGT CTC AGG CTC TCC TGC GCC GCT TCA GGG TTC ACA ATC TCT GAC TAT TGG ATT CAC TGG GTG CGC CAG GCG CCA GGC AAG GGG CTG GAG TGG GTC GCG GGC ATT ACC CCG GCG GGC GGC TAC ACC TAT TAC GCC GAC TCA GTC AAG GGC CGC TTC ACA ATC TCC GCG GAC ACC AGC AAG AAC ACC GCG TAC CTC CAA ATG AAC TCG CTG CGC GCC GAA GAC ACC GCC GTG TAC TAT TGC GCG AGA TTC GTG TTC TTC CTG CCG TAC GCC ATG GAC TAC TGG GGC CAG GGA ACG CTG GTG ACC GTG AGT AGT GGT GGT GGT GGT AGC GGT GGA GGT GGT AGT GGT GGT GGT GGT TCC GAT ATC CAG ATG ACA CAG TCC CCC AGT TCA CTG TCC GCG TCC GTT GGG GAC CGT GTC ACC ATT ACC TGT CGC GCC AGT CAA GAC GTT AGC ACG GCG GTC GCG TGG TAC CAG CAA AAG CCA GGG AAG GCG CCA AAA CTG CTG ATC TAT AGC GCG AGC TTC CTC TAC AGC GGA GTC CCC AGT AGG TTC TCC GGA TCG GGG TCC GGC ACG GAC TTC ACC TTG ACC ATC TCC AGC CTC CAG CCG GAG GAT TTC GCT ACG TAC TAC TGC CAG CAG AGC TAC ACG ACG CCG CCC ACC TTC GGC CAA GGC ACC AAG GTG GAG ATA AAA CGT ACG GTT
서열번호 7
Scfv of pertuzumab protein seq
EVQLVESGGGLVQPGGSLRLSCAASGFTFTDYTMDWVRQAPGKGLEWVADVNPNSGGSIYNQRFKGRFTLSVDRSKNTLYLQMNSLRAEDTAVYYCARNLGPSFYFDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSLSASVGDRVTITCKASQDVSIGVAWYQQKPGKAPKLLIYSASYRYTGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYYIYPYTFGQGTKVEIKRT
Scfv of pertuzumab DNA seq
GAAGTTCAGCTGGTTGAAAGCGGCGGTGGTCTGGTTCAGCCGGGTGGTTCTCTGCGTCTGTCTTGTGCTGCTAGCGGTTTCACCTTTACTGATTACACCATGGATTGGGTTCGTCAGGCGCCGGGTAAAGGTCTGGAATGGGTTGCTGATGTGAACCCGAACTCTGGTGGTAGCATCTACAACCAGCGTTTCAAAGGTCGTTTTACCCTGTCTGTTGATCGTTCTAAAAACACCCTGTACCTGCAGATGAACAGCCTGCGTGCGGAAGATACCGCTGTATATTACTGTGCACGTAACCTGGGCCCGTCTTTTTATTTTGATTATTGGGGTCAGGGTACTCTGGTTACCGTTAGCTCTGGTGGTGGCGGTAGCGGCGGCGGTGGTAGCGGTGGTGGTGGTTCTGATATTCAAATGACCCAGTCTCCAAGCAGCCTGTCTGCTAGCGTTGGTGATCGTGTTACCATCACTTGTAAAGCATCCCAGGATGTTTCTATCGGTGTTGCGTGGTATCAACAGAAACCGGGTAAAGCACCGAAATTACTGATCTATTCCGCGTCTTATCGTTATACTGGCGTTCCGTCTCGTTTCTCTGGTTCTGGTAGCGGCACTGATTTCACCCTGACCATTTCTAGCCTGCAGCCGGAAGATTTCGCTACCTATTATTGCCAGCAGTATTATATTTACCCGTATACCTTCGGTCAGGGCACCAAAGTTGAAATTAAACGTACC
서열번호 8
Linker 1 Protein seq
SGGGGSGGGG
서열번호 9
Linker 2 Protein seq
GGGGSGGGGSGGGGSGQAGQHAAGSGSGSS
서열번호 10
Linker 3 Protein seq
GGGSGGGTGGGSGGG
서열번호 11
hRID- scfv of Trastuzumab-FR Vector DNA seq
gtggaggtggttccggtggtggtggtagtggtggaggtggtagtggccaggccggccagcacgcggccggcagcggatccggcagcagcggcagcagcagctcccagattcgtcagaattattccaccgacgtggaggcagccgtcaacagcctggtcaatttgtacctgcaggcctcctacacctacctctctctgggcttctatttcgaccgcgatgatgtggctctggaaggcgtgagccacttcttccgcgaactggccgaggagaagcgcgagggctacgagcgtctcctgaagatgcaaaaccagcgtggcggccgcgctctcttccaggacatcaagaagccagctgaagatgagtggggtaaaaccccagacgccatgaaagctgccatggccctggagaaaaagctgaaccaggcccttttggatcttcatgccctgggttctgcccgcacggacccccatctctgtgacttcctggagactcacttcctagatgaggaagtgaagcttatcaagaagatgggtgaccacctgaccaacctccacaggctgggtggcccggaggctgggctgggcgagtatctcttcgaaaggctcactctcaagcacgactaa
서열번호 12
hRID- scfv of Bevacizumab-FR Vector DNA seq
gtggttcaggtggtggtggtacgaccgcgtccacctcgcaggtgcgccagaactaccaccaggactcagaggccgccatcaaccgccagatcaacctggagctctacgcctcctacgtttacctgtccatgtcttactactttgaccgcgatgatgtggctttgaagaactttgccaaatactttcttcaccaatctcatgaggagagggaacatgctgagaaactgatgaagctgcagaaccaacgaggtggccgaatcttccttcaggatatcaagaaaccagactgtgatgactgggagagcgggctgaatgcaatggagtgtgcattacatttggaaaaaaatgtgaatcagtcactactggaactgcacaaactggccactgacaaaaatgacccccatttgtgtgacttcattgagacacattacctgaatgagcaggtgaaagccatcaaagaattgggtgaccacgtgaccaacttgcgcaagatgggagcgcccgaatctggcttggcggaatatctctttgacaagcacaccctgggagacagtgataatgaaagctga
서열번호 13
hRID- scvf of pertuzumab-FR Vector DNA seq
gcggtggtggtaccggtggtggtagcggtggtggtgtcgacatgagctctcagattcgtcagaactactccaccgacgtggaggcagcagttaacagcctggtcaacctgtacctgcaagcatcctacacctacctgtccctgggtttctacttcgaccgtgacgacgtagctctggaaggtgtttctcacttcttccgcgagctggcagaagagaaacgtgaaggttatgaacgcctgctgaaaatgcagaaccagcgcggtggtcgtgctctgttccaggacatcaagaaaccagctgaagatgaatggggcaaaaccccggatgccatgaaagctgccatggcgctggagaagaaactgaaccaggcgctgctggatctgcatgcgctgggttctgcgcgtactgatcctcatctgtgcgatttcctggaaactcactttctggatgaagaagtgaaactgatcaagaaaatgggcgaccacctgaccaatctgcaccgtctgggcggcccggaagcgggcctgggcgaatatctgtttgaacgtctgacgctgaaacacgactaaaagctt

Claims (16)

  1. 페리틴(ferritin) 단백질;
    상기 페리틴 단백질의 N-말단에 결합된, 단일사슬항체조각(Single-chain fragment variable); 및
    상기 단일사슬항체조각의 N-말단에 결합된, 인간 유래 라이실 tRNA 합성효소로부터 분리한 N-말단 도메인(hLysRS Nterminal appended RNA interacting domain; hRID)을 포함하는 융합단백질.
  2. 제1 항에 있어서,
    상기 단일사슬항체조각은 트라스투주맙(Trastuzumab), 베바시주맙(Bevacizumab) 및 퍼투주맙(pertuzumab)으로 이루어진 군에서 선택된 어느 하나의 항체로부터 유래된 것인, 융합단백질.
  3. 제1 항에 있어서,
    상기 hRID는 서열번호 1의 아미노산 서열로 표시되는 것인, 융합단백질.
  4. 제1 항에 있어서,
    상기 페리틴 단백질은 서열번호 4의 아미노산 서열로 표시되는 것인, 융합단백질.
  5. 제1 항에 있어서,
    상기 융합단백질은 단일사슬항체조각(scFv) 및 페리틴 단백질 사이에 링커 단백질를 더 포함하는 것인 융합단백질.
  6. 제5 항에 있어서,
    상기 링커 단백질은 서열번호 8 내지 10의 아미노산 서열 중 어느 하나로 표시되는 아미노산 서열을 갖는, 융합단백질.
  7. 제1 항의 융합단백질을 단량체로 하여 2개 내지 24개가 자가조립되어 형성되는 나노입자.
  8. 제1 항의 융합단백질을 코딩하는 폴리뉴클레오티드.
  9. 제8 항의 폴리뉴클레오티드를 포함하는 재조합 발현 벡터.
  10. 제9 항에 따른 발현 벡터로 형질 전환된 숙주세포.
  11. 제10 항에 있어서,
    상기 숙주세포는 에스케리키아(Escherichia)속 세균, 바실러스 (Bacillus)속 세균, 슈도모나스(Pseudomonas)속 세균, 유산균, 효모, 동물세포 및 곤충 세포로 이루어진 군에서 선택되는 것인 형질 전환된 숙주세포.
  12. (a) 페리틴(ferritin) 단백질; 및 상기 페리틴(ferritin) 단백질의 N-말단에 결합된 단일사슬항체조각(Single-chain variable fragment); 및 상기 단일사슬항체조각의 N-말단에 결합된, 인간 유래 라이실 tRNA 합성효소로부터 분리한 N-말단 도메인(hLysRS N-terminal appended RNA interacting domain; hRID) 으로 이루어진 융합단백질을 코딩하는 폴리뉴클레오티드를 포함하는 발현 벡터를 제조하는 단계;
    (b) 상기 발현 벡터를 숙주세포에 도입하여 형질전환체를 제조하는 단계;
    (c) 상기 형질전환체를 배양하여 상기 융합단백질의 발현을 유도하는 단계; 및
    (d) 상기 발현된 융합단백질의 자가조립에 의해 형성된 나노입자를 정제하는 단계;를 포함하는 나노입자의 제조방법.
  13. 제12 항에 있어서,
    상기 나노입자는 융합단백질을 단량체로 하여 2개 내지 24개가 자가조립되어 형성된 것인, 나노입자의 제조방법.
  14. 제12 항에 있어서,
    상기 단일사슬항체조각은, 트라스투주맙(Trastuzumab), 베바시주맙(Bevacizumab) 및 퍼투주맙(pertuzumab)으로 이루어진 군에서 선택된 어느 하나의 항체로부터 유래된 것인 나노입자의 제조방법.
  15. 제1 항의 융합단백질을 포함하는 질병의 개선 또는 치료용 약제학적 조성물.
  16. 표적질환을 치료하기 위한, 나노입자의 용도에 관한 것으로,
    상기 나노입자는, 페리틴(ferritin) 단백질; 상기 페리틴 단백질의 N-말단에 결합된, 단일사슬항체조각(Single-chain fragment variable); 및 상기 단일사슬항체조각의 N-말단에 결합된, 인간 유래 라이실 tRNA 합성효소로부터 분리한 N-말단 도메인(hLysRS Nterminal appended RNA interacting domain; hRID)을 포함하는 융합단백질이 단량체로서 2개 내지 24개가 자가조립되어 형성된 것을 특징으로 하는 나노입자의 용도.
PCT/KR2022/006597 2021-05-07 2022-05-09 단일사슬항체조각 및 페리틴의 융합단백질을 포함하는 나노입자 및 이의 용도 WO2022235140A1 (ko)

Priority Applications (1)

Application Number Priority Date Filing Date Title
KR1020237042487A KR20240008333A (ko) 2021-05-07 2022-05-09 단일사슬항체조각 및 페리틴의 융합단백질을 포함하는나노입자 및 이의 용도

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR10-2021-0059544 2021-05-07
KR20210059544 2021-05-07

Publications (1)

Publication Number Publication Date
WO2022235140A1 true WO2022235140A1 (ko) 2022-11-10

Family

ID=83932822

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2022/006597 WO2022235140A1 (ko) 2021-05-07 2022-05-09 단일사슬항체조각 및 페리틴의 융합단백질을 포함하는 나노입자 및 이의 용도

Country Status (2)

Country Link
KR (1) KR20240008333A (ko)
WO (1) WO2022235140A1 (ko)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN117586425A (zh) * 2024-01-19 2024-02-23 北京安百胜生物科技有限公司 一种重组呼吸道合胞病毒颗粒抗原其制备方法和应用

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20100159442A1 (en) * 2006-11-02 2010-06-24 Iti Scotland Limited Magnetic recognition system
KR20160094550A (ko) * 2015-01-30 2016-08-10 동국대학교 산학협력단 단일사슬항체조각과 페리틴을 포함하는 융합단백질 및 그의 용도
KR20180050261A (ko) * 2018-04-27 2018-05-14 동국대학교 산학협력단 단일사슬항체조각과 바이러스 외피 단백질을 포함하는 융합단백질 및 이의 용도
KR102076917B1 (ko) * 2018-10-25 2020-02-13 연세대학교 산학협력단 자가조립 나노 입자를 제조하기 위한 유전자 재조합 발현 벡터 시스템 및 이를 이용하는 방법

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20100159442A1 (en) * 2006-11-02 2010-06-24 Iti Scotland Limited Magnetic recognition system
KR20160094550A (ko) * 2015-01-30 2016-08-10 동국대학교 산학협력단 단일사슬항체조각과 페리틴을 포함하는 융합단백질 및 그의 용도
KR20180050261A (ko) * 2018-04-27 2018-05-14 동국대학교 산학협력단 단일사슬항체조각과 바이러스 외피 단백질을 포함하는 융합단백질 및 이의 용도
KR102076917B1 (ko) * 2018-10-25 2020-02-13 연세대학교 산학협력단 자가조립 나노 입자를 제조하기 위한 유전자 재조합 발현 벡터 시스템 및 이를 이용하는 방법

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
KIM YOUNG-SEOK, SON AHYUN, KIM JIHOON, KWON SOON BIN, KIM MYUNG HEE, KIM PAUL, KIM JIEUN, BYUN YOUNG HO, SUNG JEMIN, LEE JINHEE, Y: "Chaperna-Mediated Assembly of Ferritin-Based Middle East Respiratory Syndrome-Coronavirus Nanoparticles", FRONTIERS IN IMMUNOLOGY, vol. 9, 17 May 2018 (2018-05-17), XP055840832, DOI: 10.3389/fimmu.2018.01093 *

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN117586425A (zh) * 2024-01-19 2024-02-23 北京安百胜生物科技有限公司 一种重组呼吸道合胞病毒颗粒抗原其制备方法和应用

Also Published As

Publication number Publication date
KR20240008333A (ko) 2024-01-18

Similar Documents

Publication Publication Date Title
AU2016346864B2 (en) Long-acting FGF21 fusion proteins and pharmaceutical composition comprising same
KR102155875B1 (ko) 혈관신생 억제용 융합 단백질
WO2016153276A1 (ko) 뉴로필린1 특이적 결합 펩타이드 및 이 펩타이드가 융합된 융합 단백질, 및 이의 용도
WO2012165925A2 (ko) Hgf 활성을 가지는 c-met에 대한 인간항체 및 이의 용도
WO2019004799A1 (ko) Vegf-grab 단백질과 약물의 결합체 및 이의 용도
KR20240027854A (ko) Tgf-β-수용체 엑토도메인 융합 분자 및 그의 용도
WO2016114633A1 (en) Long-acting fgf21 fusion proteins and pharmaceutical composition comprising the same
WO2022235140A1 (ko) 단일사슬항체조각 및 페리틴의 융합단백질을 포함하는 나노입자 및 이의 용도
WO2020091529A1 (ko) 재조합 호흡기 세포융합 바이러스 f 단백질 및 이를 포함하는 백신 조성물
WO2021221470A1 (ko) 인터페론-베타 변이체와 항체가 융합된 재조합 단백질 및 이를 포함하는 약학 조성물
WO2021154046A1 (ko) pH-감응성 FC 변이체
WO2023214833A1 (ko) Glp-1, 면역글로불린 fc, 및 igf-1을 포함하는 융합단백질 및 이의 용도
WO2023055155A1 (ko) 혈액 뇌장벽 투과용 펩타이드 및 이의 용도
WO2020050626A1 (ko) O-글리코실화 가능한 폴리펩타이드 영역을 포함하는 융합 폴리펩타이드
WO2022164288A1 (ko) 비염증성 식세포작용 유도 활성을 갖는 융합분자
KR102352336B1 (ko) 글루카곤-유사 펩타이드-1 및 인터루킨-1 수용체 길항제를 포함하는 융합단백질 및 이의 용도
CN111819196A (zh) 双特异性hiv-1中和抗体
WO2018021778A1 (ko) Lrg1 당단백질을 포함하는 융합 단백질을 함유하는 발기부전, 허혈성 질환 또는 말초 신경질환의 예방 또는 치료용 조성물
AU2022316521B2 (en) A fusion protein comprising an antigen binding domain and a cytokine trimer domain
WO2020246760A1 (ko) 퇴행성관절염 예방 또는 치료용 항-oscar 항체
WO2023158027A1 (en) A fusion protein comprising an antigen binding domain and a cytokine trimer domain
WO2022010273A1 (ko) 보체 경로 억제제를 포함하는 융합단백질 및 이의 용도
WO2023132547A1 (ko) 혈관신생 억제제가 결합된 항-c3b 항체 또는 항-c5 항체 및 이의 용도
WO2019088658A1 (ko) Scf 및 갈렉틴-1을 표적으로 하는 이중표적항체 및 그 용도
WO2023055045A1 (ko) 코일드 코일 융합 단백질

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22799183

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 20237042487

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 1020237042487

Country of ref document: KR

NENP Non-entry into the national phase

Ref country code: DE

NENP Non-entry into the national phase

Ref country code: JP

122 Ep: pct application non-entry in european phase

Ref document number: 22799183

Country of ref document: EP

Kind code of ref document: A1