WO2023055045A1 - 코일드 코일 융합 단백질 - Google Patents

코일드 코일 융합 단백질 Download PDF

Info

Publication number
WO2023055045A1
WO2023055045A1 PCT/KR2022/014508 KR2022014508W WO2023055045A1 WO 2023055045 A1 WO2023055045 A1 WO 2023055045A1 KR 2022014508 W KR2022014508 W KR 2022014508W WO 2023055045 A1 WO2023055045 A1 WO 2023055045A1
Authority
WO
WIPO (PCT)
Prior art keywords
polypeptide
nucleic acid
seq
amino acid
fusion protein
Prior art date
Application number
PCT/KR2022/014508
Other languages
English (en)
French (fr)
Inventor
이대희
이정은
임성인
신고은
권혁택
양이지
Original Assignee
주식회사 엔바이오스
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from KR1020220121834A external-priority patent/KR20230046999A/ko
Application filed by 주식회사 엔바이오스 filed Critical 주식회사 엔바이오스
Publication of WO2023055045A1 publication Critical patent/WO2023055045A1/ko

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/30—Macromolecular organic or inorganic compounds, e.g. inorganic polyphosphates
    • A61K47/42—Proteins; Polypeptides; Degradation products thereof; Derivatives thereof, e.g. albumin, gelatin or zein
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K1/00—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length
    • C07K1/14—Extraction; Separation; Purification
    • C07K1/16—Extraction; Separation; Purification by chromatography
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/70—Vectors or expression systems specially adapted for E. coli

Definitions

  • the present invention relates to a coiled-coil scaffold with improved binding stability by co-expression. It relates to a fusion protein or drug delivery system capable of implementing a multi-complex of various functional molecules in a modular form by combining (proteins, antibody fragments, etc.).
  • the present inventors have made intensive efforts to develop a platform of fusion proteins or drug delivery systems that can easily load various types of drug moieties (therapeutic proteins, antibody fragments, etc.) and exhibit improved efficacy.
  • drug moieties therapeutic proteins, antibody fragments, etc.
  • the drug moiety is bound to the N-terminus or C-terminus of the polypeptide comprising positions 360-393 of the MBD2 amino acid sequence and the polypeptide comprising amino acid positions 138-178 of the p66 ⁇ amino acid sequence.
  • an object of the present invention is to provide a fusion protein comprising polypeptide 1 including self-association domain 1 and polypeptide 2 including self-association domain 2.
  • Another object of the present invention is to provide a nucleic acid molecule encoding the fusion protein.
  • Another object of the present invention is to provide a vector containing the nucleic acid molecule.
  • Another object of the present invention is to provide an expression construct comprising nucleic acid molecule 1 encoding polypeptide 1 comprising self-associating domain 1 and nucleic acid molecule 2 encoding polypeptide 2 comprising self-associating domain 2. .
  • Another object of the present invention is to provide a host cell comprising the vector or expression construct or transformed with the vector or expression construct.
  • Another object of the present invention is to provide a pharmaceutical composition for preventing or treating cancer comprising the fusion protein, nucleic acid molecule, vector, expression construct or host cell.
  • Another object of the present invention is to provide a kit comprising the polypeptide 1 or nucleic acid molecule 1 and the polypeptide 2 or nucleic acid molecule 2.
  • the present invention provides a fusion protein comprising polypeptide 1 comprising self-associating domain 1 and polypeptide 2 comprising self-associating domain 2.
  • fusion protein refers to a hybrid protein expressed by a nucleic acid molecule containing nucleotide sequences of at least two or more genes.
  • self-associating domain refers to a protein capable of self-associating with other self-associating domains to form a coiled coil.
  • self-associating domain 1 may self-associate with self-associating domain 2 to form a coiled coil.
  • the self-associating domains enable non-covalent bonds, which are hydrophobic and/or ionic interactions, with each other, allowing individual domains to bind (self-associate) with each other to form a coiled coil.
  • the self-associating domain 1 preferably includes the amino acid sequence of SEQ ID NO: 1, or an amino acid sequence in which an amino acid selected from the group consisting of 6th, 27th and combinations thereof in SEQ ID NO: 1 is mutated to cysteine, and more Preferably, an amino acid sequence selected from the group consisting of 6th, 27th and combinations thereof in SEQ ID NO: 1 is mutated to cysteine.
  • the self-associating domain 2 preferably includes the amino acid sequence of SEQ ID NO: 6, or an amino acid sequence in which an amino acid selected from the group consisting of 8th, 29th, and combinations thereof in SEQ ID NO: 6 is mutated to cysteine, and more Preferably, an amino acid sequence selected from the group consisting of positions 8, 29, and combinations thereof in SEQ ID NO: 6 is mutated to cysteine.
  • the mutation to cysteine at the amino acid position further induces a covalent bond (disulfide bond) between the two self-associating domains to form a more stable fusion protein.
  • the cysteine mutation site of the self-associated domain 1 (position 6, 27 in SEQ ID NO: 1) and the cysteine mutation site of self-association domain 2 (position 8, 29 in SEQ ID NO: 6) ) If a cysteine mutation is introduced at a position other than (e.g., the 16th and 20th positions in SEQ ID NO: 1 and/or the 18th and 11th positions in SEQ ID NO: 6, etc.), a stable fusion protein cannot be formed, or , it can be confirmed that the expression level is significantly decreased (Fig. 3a and b).
  • the self-associating domain 1 includes the amino acid sequence of SEQ ID NO: 2 or 3.
  • the self-associating domain 2 includes the amino acid sequence of SEQ ID NO: 7 or 8.
  • the fusion protein includes self-associating domain 1 comprising the amino acid sequence of SEQ ID NO: 2 and self-associating domain 2 comprising the amino acid sequence of SEQ ID NO: 7.
  • the fusion protein includes self-associating domain 1 comprising the amino acid sequence of SEQ ID NO: 3 and self-associating domain 2 comprising the amino acid sequence of SEQ ID NO: 8.
  • the fusion protein of the present invention may further include one or more drug moieties.
  • the fusion protein comprises a drug moiety at at least one site selected from the group consisting of the N-terminus and the C-terminus of the self-association domain 1 or polypeptide 1 including the self-association domain 1.
  • the fusion protein has a drug moiety at at least one site selected from the group consisting of the N-terminus and the C-terminus of the self-associating domain 2 or the polypeptide 2 including the self-associating domain 2.
  • polypeptide 1 is a self-associating domain 1 or a peptide including the self-associating domain 1, which has the property of self-associating with self-associating domain 2 or peptide 2 including the self-associating domain 2.
  • polypeptide 1 is a self-associating domain 1 or a peptide including the self-associating domain 1, which has the property of self-associating with self-associating domain 2 or peptide 2 including the self-associating domain 2.
  • polypeptide 2 is a self-associating domain 2 or a peptide including the self-associating domain 2, and has the property of self-associating with self-associating domain 1 or peptide 1 including the self-associating domain 1. means a peptide with
  • drug moiety refers to an antibody or antigen-binding fragment thereof, or a protein (eg, a therapeutic protein, ligand, receptor, Fc region) that interacts with or expresses other types of proteins or substances.
  • a protein eg, a therapeutic protein, ligand, receptor, Fc region
  • the protein may be a part of a domain or polypeptide responsible for a specific function, as well as a full-length protein, and may be a natural or artificial sequence.
  • antibody refers to a protein molecule that acts as a receptor that specifically recognizes an antigen, including an immunoglobulin molecule that is immunologically reactive with a specific antigen, and includes both polyclonal antibodies and monoclonal antibodies. .
  • Antibodies include antigen-binding fragments of antibody molecules (antibody fragments) as well as full-length antibody forms.
  • a complete antibody has two full-length light chains and two full-length heavy chains, each light chain being linked to the heavy chain by disulfide bonds.
  • the heavy chain constant region has gamma ( ⁇ ), mu ( ⁇ ), alpha ( ⁇ ), delta ( ⁇ ), and epsilon ( ⁇ ) types, and subclasses include gamma 1 ( ⁇ 1), gamma 2 ( ⁇ 2), and gamma 3 ( ⁇ 3). ), gamma 4 ( ⁇ 4), alpha 1 ( ⁇ 1) and alpha 2 ( ⁇ 2).
  • the constant region of the light chain has a kappa (kappa, ⁇ ) and lambda (lambda, ⁇ ) type.
  • the term "antigen-binding fragment of an antibody” refers to a fragment that specifically recognizes an antigen within the entire antibody molecule and retains an antigen-antibody binding function, and includes a single-domain antibody (sdAb), single-chain antibody (scFv) ), Fab, F(ab'), F(ab')2 and Fv, and the like.
  • fragments include a monovalent fragment consisting of VL, VH, CK (or CL) and CH1 domains (Fab fragment); a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region (F(ab')2 fragment); Fd fragment consisting of VH and CH1 domains; Fv fragments consisting of the VL and VH domains of one arm of an antibody and a disulfide-linked Fv (sdFv); dAb fragments consisting of the VH domain; and an isolated complementarity determining region (CDR) or combination of two or more isolated CDRs which may optionally be joined by a linker.
  • CDR complementarity determining region
  • the scFv can be linked by a linker to form a single protein chain in which the VL and VH regions are paired to form a monovalent molecule.
  • Such single-chain antibodies are also included in antibody fragments.
  • the antibody or antibody fragment includes a tetramer antibody comprising two heavy chain molecules and two light chain molecules; antibody light chain monomers; antibody heavy chain monomers; antibody light chain dimers, antibody heavy chain dimers; intrabody; monovalent antibodies; camel antibodies; and single-domain antibodies (sdAbs).
  • the antigen-binding fragment of an antibody as the drug moiety is scFv.
  • the protein as the drug moiety is albumin binding peptide (ABP) or tumor necrosis factor-related apoptosis-inducing ligand (TRAIL).
  • ABSin binding peptide ABSin binding peptide
  • TRAIL tumor necrosis factor-related apoptosis-inducing ligand
  • albumin-binding peptide refers to a peptide or protein that binds to albumin, a multifunctional plasma protein that plays an important role in maintaining blood osmotic pressure and transporting various substrates. Since albumin has binding ability to FcRn, it has a long plasma half-life of 3 weeks, and by including an albumin-binding peptide sequence having albumin-binding activity in the fusion protein, the half-life characteristic can be imparted.
  • albumin binding peptides have been disclosed in the art (Zorzi et al., Medchemcomm . 2019 Jul 1; 10(7): 1068-1081, etc.) and are incorporated herein by reference.
  • the term "trail” refers to a ligand that induces self-apoptosis of tumor cells as a type of tumor necrosis factor (TNF).
  • TNF tumor necrosis factor
  • TRAIL has four receptors, and among the receptors, death receptors (DR4, DR5) are overexpressed in cancer cell lines, and decoy receptors (DcR1, DcR2) are overexpressed in normal cell lines.
  • the TRAIL can induce the death of tumor cells by binding to death receptors such as DR4 and DR5 on the surface of tumor cells. In the case of the decoy receptor, it does not have a death domain at its c-terminus, so that apoptosis signal transduction is not transmitted into cells.
  • TRAIL-based treatment is a very effective next-generation anti-cancer treatment because it has the characteristic of inducing toxicity only to various cancer cell lines while being harmless to normal cells.
  • TRAIL its clinical application is limited due to poor structural stability and in vivo persistence because homotrimers, which are active forms of TRAIL monomers, are non-covalently linked.
  • the protein as the drug moiety is a trail trimer (timer).
  • the trail trimer binds to the N-terminus and/or C-terminus of the self-associating domain 1 or the polypeptide 1 including the self-associating domain 1, or the self-associating domain 2 or the polypeptide including the self-associating domain 2
  • trimers, hexamers, tetramers, dodecimers, etc. can be constructed in the fusion protein.
  • the trail hexamer formed by self-association of the trail trimer-self-associated domain 1 and the trail trimer-self-associated domain 2 is 1) the trail trimer-self-associated domain 1 or 2) the trail 3 It can be seen that the affinity with the death receptor is increased by 2-5 times compared to the case where the combination-self-association domain 2 is expressed alone (FIG. 4).
  • the trail hexamer formed by self-association of the trail trimer-self-associated domain 1 and the trail trimer-self-associated domain 2 is 1) the trail trimer-self-associated domain 1 or 2) the trail It can be seen that the cancer cell death rate increased more than 4 times compared to the case where the trimeric-self-associating domain 2 was expressed alone (FIGS. 5a and b).
  • N-terminus and C-terminus refer to the amino terminus and the carboxy terminus of a polypeptide.
  • the drug moiety is N-terminus and/or C-terminus of self-associating domain 1 or polypeptide 1 comprising self-associating domain 1 of a protein of the same class (eg, trail trimer + trail trimer, etc.) , or may be bound to the N-terminus and / or C-terminus of the self-associating domain 2 or polypeptide 2 including self-associating domain 2, and other types (e.g., trail trimer + ABP or trail Trimeric + ABP + scFv, etc.) proteins may be linked to each N-terminus and/or C-terminus, and a multiple complex of several functional molecules may be implemented in a modular form.
  • the drug moiety is bonded to the N-terminus or C-terminus of the polypeptide 1 or 2 by a linker.
  • linker refers to an amino acid sequence present between the N-terminus or C-terminus of the polypeptide 1 or 2 and the N-terminus or C-terminus of the drug moiety.
  • the linker may be any combination of amino acids, but is not limited thereto, and is a sequence that promotes binding and dissociation between the polypeptide 1 or 2 and the drug moiety, imparts flexibility to the coiled coil forming domain, or It can be introduced for the purpose of reducing steric hindrance that occurs when coil-forming domains bind.
  • the linker is preferably a glycine- and serine-rich sequence of any length, for example, Gly-Ser, Gly-Gly-Ser, Gly-Gly-Gly-Ser, Gly-Gly-Gly-Gly-Ser or any of these. The combination may be repeated, but is not limited thereto.
  • the present invention relates to a coiled-coil composite comprising the following configuration:
  • polypeptide 1 in which an amino acid selected from the group consisting of positions 6, 27, and combinations thereof in SEQ ID NO: 1 is mutated to cysteine;
  • the present invention provides a nucleic acid molecule encoding the fusion protein or coiled-coil complex.
  • nucleic acid molecule is meant to comprehensively include DNA (gDNA and cDNA) and RNA molecules, and nucleotides, which are basic structural units in nucleic acid molecules, are not only natural nucleotides, but also analogs with modified sugar or base sites. (analogue) is also included (Scheit, Nucleotide Analogs, John Wiley, New York (1980); Uhlman and Peyman, Chemical Reviews, (1990) 90:543-584).
  • sequence of the nucleic acid molecule encoding the fusion protein of the present invention may be modified. Such modifications include additions, deletions, or non-conservative or conservative substitutions of nucleotides.
  • nucleic acid molecules of the present invention are also construed to include nucleotide sequences exhibiting substantial identity to the nucleotide sequences described above.
  • the above substantial identity is at least 80% when the nucleotide sequence of the present invention and any other sequence described above are aligned so as to correspond as much as possible, and the aligned sequence is analyzed using an algorithm commonly used in the art. It means a nucleotide sequence showing homology, at least 90% homology in one specific example, and at least 95% homology in another specific example.
  • the nucleic acid molecule encoding the polypeptide 1 (nucleic acid molecule 1) and/or the nucleic acid molecule encoding the polypeptide 2 (nucleic acid molecule 2) are at the 5' end or the 3' end.
  • a nucleotide sequence encoding a drug moiety may be included at a position selected from the group consisting of:
  • the present invention provides a vector comprising the nucleic acid molecule.
  • vector refers to a delivery system capable of inserting a polynucleotide sequence for introduction into a cell capable of replicating the nucleic acid molecule sequence.
  • a polynucleotide sequence may be Exogenous or Heterologous.
  • Vectors include, but are not limited to, plasmids, cosmid vectors, and viral vectors (retroviruses, adenoviruses, and adeno-associated viral vectors, etc.).
  • expression construct refers to a vector comprising a nucleotide sequence encoding at least a portion of a gene product to be transcribed. In some cases, the RNA molecule is then translated into a protein, polypeptide, or peptide.
  • Expression vectors may contain various regulatory sequences. Along with regulatory sequences that control transcription and translation, vectors and expression vectors may also contain nucleic acid sequences that serve other functions.
  • the expression construct may include nucleic acid molecule 1 encoding the polypeptide 1 and nucleic acid molecule 2 encoding the polypeptide 2 in the same vector or in different vectors. The nucleic acid molecules 1 and 2 may form a fusion protein by self-binding to polypeptides 1 and 2 expressed from the same vector or different vectors in vitro or in vivo.
  • the present invention provides a host cell comprising, but transformed with, the vector or expression construct described above.
  • the term "cell” includes eukaryotic cells and prokaryotic cells, and refers to any transformable cell capable of replicating the vector or expressing a gene encoded by the vector.
  • a cell may be transfected, transduced, or transformed by the vector, which means a process in which an exogenous polynucleotide (nucleic acid molecule) is delivered or introduced into a host cell.
  • transformation is used as a meaning including the transfection (Transfected) and transduction (Transduced).
  • the (host) cells of the present invention are not limited, but preferably insect cells or mammalian cells, more preferably Sf9 in the case of insect cells, HEK293 cells in the case of mammalian cells, HeLa cells, ARPE-19 cells, RPE- 1 cell, HepG2 cell, Hep3B cell, Huh-7 cell, C8D1a cell, Neuro2A cell, CHO cell, MES13 cell, BHK-21 cell, COS7 cell, COP5 cell, A549 cell, MCF-7 cell, HC70 cell, HCC1428 cell , BT-549 cells, PC3 cells, LNCaP cells, Capan-1 cells, Panc-1 cells, MIA PaCa-2 cells, SW480 cells, HCT166 cells, LoVo cells, A172 cells, MKN-45 cells, MKN-74 cells, Kato-III cells, NCI-N87 cells, HT-144 cells, SK-MEL-2 cells, SH-SY5Y cells, C6 cells, HT-22 cells,
  • the host cell of the present invention is preferably an isolated host cell.
  • the present invention provides a composition comprising the above fusion protein, the above nucleic acid molecule, the above vector, the above expression construct or the above cell.
  • the present invention provides i) polypeptide 1 comprising the amino acid sequence of SEQ ID NO: 2 or 3 as self-associating domain 1 or nucleic acid molecule 1 encoding said polypeptide 1 and ii) self-associating domain 2 provides a composition comprising polypeptide 2 comprising the amino acid sequence of SEQ ID NO: 7 or 8 or nucleic acid molecule 2 encoding the polypeptide 2.
  • a drug moiety may be bound to the above site.
  • the composition comprises i) a polypeptide 1-drug moiety, a drug moiety-polypeptide 1 or a drug moiety-polypeptide 1-drug moiety and ii) a polypeptide 2-drug moiety, a drug moiety-poly Peptide 2 or Drug Moiety-Polypeptide 2-drug moiety.
  • a nucleotide sequence encoding a drug moiety may be attached to a position selected from the group consisting of the 5' end or the 3' end.
  • nucleotide sequences encoding nucleic acid molecule 1, nucleic acid molecule 2 and the drug moiety linked thereto, which are included in the composition may be present in the composition in the form of being inserted into one or a plurality of vectors.
  • the composition is a pharmaceutical composition for preventing or treating cancer.
  • the present invention provides a method for preventing or preventing cancer, comprising administering to a subject a pharmaceutically effective amount of the fusion protein, the nucleic acid molecule, the vector, the expression construct, the cell, or the composition. provides a treatment method.
  • the present invention provides for use in therapy of the above fusion protein, the nucleic acid molecule, the vector, the expression construct, the cell or the composition.
  • the therapeutic use is for the treatment of cancer.
  • prevention refers to inhibiting the occurrence of a disease or condition in a subject who has not been diagnosed with, but is likely to have, the disease or condition.
  • treatment refers to (a) inhibiting the development of a disease, disorder or condition; (b) alleviation of the disease, condition or symptom; or (c) eliminating the disease, disorder or condition.
  • composition of the present invention may be a composition for cancer treatment by itself, or may be administered together with other pharmacological ingredients to be applied as a therapeutic adjuvant to improve its therapeutic response.
  • treatment or “therapeutic agent” herein include the meaning of "therapeutic aid” or “therapeutic agent”.
  • administration refers to directly administering a therapeutically effective amount of the composition of the present invention to a subject so that the same amount is formed in the body of the subject.
  • the term "therapeutically effective amount” refers to an amount of the composition contained in a sufficient level to provide a therapeutic or preventive effect to a subject to whom the pharmaceutical composition of the present invention is to be administered. It is meant to include “a prophylactically effective amount”.
  • the term "subject” includes, without limitation, a human, mouse, rat, guinea pig, dog, cat, horse, cow, pig, monkey, chimpanzee, baboon or rhesus monkey. Specifically, the subject of the present invention is a human.
  • compositions disclosed herein having a desired degree of purity in a pharmaceutically acceptable carrier, excipient, or stabilizer
  • Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations employed, and include buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; Preservatives (such as octadecyldimethylbenzylammonium chloride; hexamethonium chloride; benzalkonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins such as serum albumin, gelatin, or immunoglobul
  • a pharmaceutical composition comprises a fusion protein, nucleic acid molecule, vector, expression construct or cell disclosed herein in a pharmaceutically acceptable carrier.
  • a pharmaceutical composition comprises an effective amount of a fusion protein, nucleic acid molecule, vector, expression construct or cell disclosed herein, and optionally one or more additional prophylactic or therapeutic agents, in a pharmaceutically acceptable carrier.
  • the fusion protein, nucleic acid molecule, vector, expression construct or cell is the only active ingredient included in the pharmaceutical composition.
  • Pharmaceutically acceptable carriers used in parenteral preparations include aqueous vehicles, non-aqueous vehicles, antimicrobial agents, isotonic agents, buffers, antioxidants, local anesthetics, suspending and dispersing agents, emulsifiers, sequestering or chelating agents for metal ions, and other pharmaceutical pharmaceutical agents. contains substances that are permitted as Examples of aqueous vehicles include Sodium Chloride Injection, Ringer's Injection, Isotonic Dextrose Injection, Sterile Water Injection, Dextrose and Lactated Ringer's Injection.
  • Non-aqueous vehicles include fixed oils of vegetable origin, cottonseed oil, corn oil, sesame oil and peanut oil.
  • Bacteriostatic or fungicidal concentrations of antimicrobial agents may be added to parenteral preparations packaged in multi-dose containers, such as phenols or cresols, mercury-containing materials, benzyl alcohol, chlorobutanol, methyl and propyl p-hydroxybenzoic acid esters, thimero flesh, benzalkonium chloride and benzethonium chloride.
  • Isotonic agents include sodium chloride and dextrose.
  • Buffers include phosphate and citrate.
  • Antioxidants include sodium bisulfate.
  • Local anesthetics include procaine hydrochloride.
  • Suspending and dispersing agents include sodium carboxymethylcellulose, hydroxypropyl methylcellulose and polyvinylpyrrolidone.
  • Emulsifiers include polysorbate 80 ( TWEEN® 80). Sequestering or chelating agents for metal ions include EDTA. Pharmaceutical carriers also include ethyl alcohol, polyethylene glycol and propylene glycol for water miscible vehicles and sodium hydroxide, hydrochloric acid, citric acid or lactic acid for pH adjustment.
  • a pharmaceutical composition may be formulated for any route of administration to a subject.
  • routes of administration include intranasal, oral, parenteral, intrathecal, intraventricular, pulmonary, subcutaneous, or intraventricular routes.
  • Parenteral administration featuring subcutaneous, intramuscular or intravenous injection is also contemplated.
  • Injectables can be prepared in conventional forms, either as liquid solutions or suspensions, solid forms suitable for solution or suspension in liquid prior to injection, or as emulsions.
  • Injectables, solutions and emulsions also contain one or more excipients. Suitable excipients are, for example, water, saline, dextrose, glycerol or ethanol.
  • the pharmaceutical composition to be administered may also contain minor amounts of non-toxic auxiliary substances such as wetting or emulsifying agents, pH buffering agents, stabilizers, solubility enhancing agents, and other agents such as sodium acetate, sorbitan monolaurate, triethanolamine It may contain oleate and cyclodextrin.
  • auxiliary substances such as wetting or emulsifying agents, pH buffering agents, stabilizers, solubility enhancing agents, and other agents such as sodium acetate, sorbitan monolaurate, triethanolamine It may contain oleate and cyclodextrin.
  • Preparations for parenteral administration of pharmaceutical compositions include sterile dry soluble products, such as lyophilized powders, sterile ready-to-injectable suspensions, which may be combined with a solvent immediately prior to use, including sterile ready-to-inject solutions, tablets for subcutaneous injection, Includes sterile dry insoluble products and sterile emulsions which can be combined directly with the vehicle immediately prior to use.
  • the solution may be aqueous or non-aqueous.
  • a pharmaceutical composition disclosed herein may also be formulated to be targeted to a specific tissue, receptor, or other body region of a subject to be treated.
  • a variety of targeting methods are known to those skilled in the art. Use of this targeting method in the present compositions is contemplated. Non-limiting examples of targeting methods are U.S. Patent Nos. 6,316,652, 6,274,552, 6,271,359, 6,253,872, 6,139,865, 6,131,570, 6,120,751, 6,071,495, 6,060,082, 63,048,7 6,039,975, 6,004,534, 5,985,307, 5,972,366, 5,900,252, 5,840,674, 5,759,542 and 5,709,874.
  • the pharmaceutical compositions disclosed herein can be used to treat cancer.
  • compositions used for in vivo administration may be sterile. Sterilization may be, for example, by filtration through sterile filtration membranes.
  • the present invention provides a kit comprising:
  • Polypeptide 1 comprising an amino acid sequence in which an amino acid selected from the group consisting of positions 6, 27, and combinations thereof in SEQ ID NO: 1 is mutated to cysteine, or a nucleic acid molecule 1 encoding the same;
  • polypeptide 2 comprising an amino acid sequence in which an amino acid selected from the group consisting of positions 8 and 29 in SEQ ID NO: 6 and combinations thereof is mutated to cysteine, or nucleic acid molecule 2 encoding the same;
  • one or more of (i) polypeptide 1 or nucleic acid molecule 1 encoding the same, (ii) polypeptide 2 or nucleic acid molecule 2 encoding the same, and (iii) polypeptides 1 and 2 described herein.
  • one or more containers filled with a coding nucleotide sequence; Optional instructions for use; pharmaceutical packs or kits are disclosed herein.
  • a kit contains a pharmaceutical composition disclosed herein and any prophylactic or therapeutic agent disclosed herein.
  • a composition for preventing or treating cancer is disclosed, wherein the kit includes instructions for the composition disclosed herein.
  • the present invention provides a polypeptide comprising a self-associating domain, a fusion protein comprising the polypeptide or a nucleic acid molecule encoding the same, or a composition comprising the polypeptide, fusion protein or nucleic acid molecule.
  • the fusion protein of the present invention binds or mounts various drug moieties (proteins, antibody fragments, etc.) according to the desired purpose, implements them in a modular form, and binds them by self-assembly, thereby improving binding ability to the target and/or An increase in the activity of the drug can be achieved.
  • Figure 1a shows the results of predicting the structures of Coil C'-GFP-6xHis and Coil C-mCherry-6xHis using Alphafold2.
  • Figure 1b is the result of measuring the molecular weight of purified C'-GFP and C-mCherry by SDS-PAGE.
  • 2a is a result of performing native PAGE to confirm that the coil fusion fluorescent protein is correctly folded.
  • Figure 2b is the result of determining the binding parameters by examining the thermodynamics between C'-GFP and C-mCherry using isothermal titration calorimetry (ITC).
  • 3a shows the result of confirming whether Ala27-Ile8, Thr6-Arg29, Coiled coil_F1, and Coiled coil_F2 form a stable complex.
  • Figure 3b is a result of comparing the relative expression levels of Ala27-Ile8, Thr6-Arg29, Coiled coil_F1 and Coiled coil_F2.
  • Figure 3c shows the relative comparison of the FRET efficiencies of Thr6-Arg29 and C'-GFP/C-mCherry when the FRET efficiency of Ala27-Ile8 is set at 100%.
  • Figure 4 shows the affinity between the TRAIL hexamer and the death receptor (DR and scTRAIL-C + scTRAIL-C') and the affinity between the TRAIL trimer-C or the TRAIL trimer-C' and the death receptor (DR and scTRAIL-C or This is the result of comparison with DR and scTRAIL-C').
  • Figure 5a shows the flow cytometry of glioblastoma cell lines treated with a positive control (R & D TRAIL) and TRAIL trimer-C (I) or TRAIL trimer-C' (II) test group and TRAIL hexamer test group (I + II). This is the result observed using (FACS).
  • FIG. 5B is a result of comparing the cancer cell death rates of a positive control group (PC) and a TRAIL trimer-C (T1) or TRAIL trimer-C' (T2) test group and a TRAIL hexamer test group (T3).
  • PC positive control group
  • T1 TRAIL trimer-C
  • T2 TRAIL trimer-C'
  • T3 TRAIL hexamer test group
  • NaCl sodium chloride
  • imidazole NaOH (sodium hydroxide)
  • tris hydroxymethyl aminomethane
  • glycerol 99.8%
  • methyl alcohol 99.8%
  • acetic acid 99.7%
  • H2PO4 dihydrogen phosphate
  • SAMCHUN three thousand
  • Yeast extract, agar, 6N-HCl (6N-Hydrochloric acid) and bromophenol blue were purchased from Daejeong (DAEJUNG).
  • BL21(DE3) chemically competent E.coli was purchased from Enzynomics. 10% SDS solution, DTT (DL-Dithiothreitol) and Coomassie bright blue G-250 staining solution were purchased from Biosesang.
  • Bacto tryptone was purchased from BD DIFCO. Ampicillin sodium salt and lysozyme were purchased from SIGMA. Isopropyl ⁇ -D-1-thiogalactopyranoside (IPTG) was purchased from BIONEER. DPBS (Dulbecco's Phosphate Buffered Saline) was purchased from WELGENE. Glycine was purchased from DUKSAN. Tris/Gycine SDS Pre-cast gel 8-16% and Tris/Glycine non-SDS Pre-cast gel 12% were purchased from KOMABIOTECH. Polypropylene columns and PD10 columns were purchased from QIAGEN and GE Healthcare, respectively. Unstained protein MW markers from Pierce Biotechnology Inc. were used for SDS-PAGE analysis.
  • Ampicillin inserts encoding the coiled-coil region of human MBD2 or variants thereof (amino acids 360-393, SEQ ID NOs: 1-5) or p66 or variants thereof (amino acids 138-178, SEQ ID NOs: 6-10) It was inserted into pET21a with resistance.
  • pET-GFP-p66 ⁇ was created by cloning GFP-p66 ⁇ between NdeI and XhoI of pET21a, and mCherry-MBD2 was also cloned between NdeI and XhoI of pET21a. The experiment was performed at BIONICS.
  • BL21[DE3] chemically competent cells
  • 50 ul each was placed in a microcentrifuge tube, and 1 ul of the expression vector was added thereto.
  • the expression vector was added to one side and the expression vector was not added to the other side.
  • 30 min on ice 30 sec heat shock at 42° C., 2 min on ice.
  • 70 ul each was absorbed into a Luria Bertani agar plate.
  • colonies were collected for about 12 hours or more in an incubator set at 37° C., put into 5 ml of Luria Bertani medium, and cultured overnight at 37° C. and 200 rpm in a shaking incubator.
  • 400 mL of Luria Bertani medium was placed in a 1 L Erlenmeyer flask and placed in a shaking incubator set at 37°C and 200 rpm.
  • 400 ul of ampicillin was added and the tube culture was induced with Isopropyl ⁇ -D-1-thiogalactopyranoside at A600 0.6. Cells were harvested when the A600 was measured and reached 2. All absorbances were measured with a Biodrop Duo Micro Volume Spectrophotometer (BIODROP).
  • the weight of the medium expressed for centrifugation was divided exactly in half, put into Oak Ridge Centrifuge Tubes, and centrifuged at 4000 rcf, 10 minutes, 4 ° C. The supernatant was discarded and the precipitated cells were stored at -20 ° C. 20 mL lysis buffer was added to each cell pellet and the pellet was lysed. Thereafter, the dissolved solution was taken in a 50 mL conical tube, 400 ul of lysozyme was added, and the mixture was mixed at 4° C. for 30 minutes using a rotator. The well-mixed solution was sonicated on ice, sonicated for 7 minutes, and centrifuged at 10000 rcf for 20 minutes at 4°C to discard the precipitate and collect the supernatant.
  • the mixture was mixed for 10 minutes with a rotator.
  • the solution was added to a polypropylene column (5 mL) to obtain only the protein in solution.
  • About 15 mL of wash buffer was flowed over the beads to remove impurities.
  • Elution buffer was added to the bead 5 times at 500 ul each, and the solution coming out of the column was put into a sterilized micro tube. Since the purified GFP-p66alpha and mCherry-MBD2 were contained in the elution buffer, the buffer was changed to PBS. After filling the PD10 column with PBS, 2.5 mL of the protein-containing solution was added, and the protein buffer was changed by adding 3 mL of PBS.
  • Size exclusion chromatography was performed on a ProteoSEC Dynamic 11/30 3-70 HR SEC column (Protein Ark, UK) equilibrated with PBS.
  • a sample eluted from Ni-NTA was concentrated with a centrifugal filter, filtered with a 0.22 ⁇ m syringe filter, and loaded onto a column.
  • Chromatography was performed on AKTAprime plus using PBS at a flow rate of 1 ml/min, and the eluted protein fraction was separately collected.
  • ITC analysis was performed using MicroCal Auto-iTC200 (Malvern Panalytical) at the Korea Basic Science Institute (Ochang, Korea). Binding affinity was measured using 40 ul C'-GFP and 200 ⁇ l C-mCherry in PBS buffer (pH 7.5). For the titration experiment, 2 ul of C'-GFP was injected 19 times in C-mCherry for 4 seconds at 150 second intervals at 25°C, and the data were analyzed using MicroCal Origin 7.0 software. N is the stoichiometric number, K D is the binding affinity, and ⁇ H and ⁇ S are changes in enthalpy and binding entropy, respectively.
  • C'-GFP Coil C'-GFP-6xHis fusion protein
  • C-mCherry Coil C-mCherry-6xHis fusion protein
  • pET-C'-GFP and pET-C-mCherry were expressed in the E. coli BL21 system and purified by affinity chromatography followed by FPLC. As a result of purification, high-purity protein was obtained in a yield of about 4 mg or more per liter of culture medium. Protein samples collected after purification were separated by SDS-PAGE, stained with Coomassie Brilliant Blue, and visualized by bleaching (Fig. 1b).
  • the predicted molecular weights of the proteins were 33.64 kDa and 32.65 kDa for C'-GFP and C-mCherry, respectively, and SDS-PAGE gave molecular weight estimates near the 35 kDa marker similar to the results.
  • a disulfide bridge formed between two thiol groups of intramolecular or intermolecular cysteine (Cys) residues can serve as an important component of correct protein folding and structural stability.
  • Cys intramolecular or intermolecular cysteine
  • Transformed BL21 (DE3) E. coli cells were cultured for 12 hours in a solid LB medium in which ampicillin concentration was adjusted to 0.1 mg/mL. Then, the strain for which the insertion of the vector was confirmed was inoculated into 2xYT medium (ampicillin 0.1 mg/mL, the same below), incubated at 37°C for 12 hours, and then diluted 1:100 into 2xYT medium and inoculated, stirred at 200 rpm, Incubated at 30 °C. When the absorbance reached 0.4-0.5 at 600 nm, IPTG was added to a final concentration of 1.0 mM to induce protein expression, and then the temperature was lowered to 16-18°C. After culturing for 20-40 hours, the cells were centrifuged at 4000 g for 10 minutes, collected as cell pellets, and stored frozen at -20°C.
  • 2xYT medium ampicillin 0.1 mg/mL, the same below
  • lysis buffer pH 8.0, 50 mM sodium phosphate, 0.3 M NaCl, and 10 mM imidazole
  • Lysozyme was added to the pellet to resuspend frozen cells.
  • Lysozyme was added to a final concentration of 1 mg/mL.
  • mixing was performed while rotating at 4°C for 30 minutes.
  • sonication was performed at intervals of 10 seconds for 8 minutes, and centrifugation was performed again at 10,000 g for 30 minutes to separate proteins and cell remnants.
  • the supernatant containing the protein was transferred separately, 1.5 mL of Ni-NTA agarose beads were added, and then the mixture was rotated at 4° C. for 30 minutes.
  • wash buffer pH 8.0, 50 mM sodium phosphate, 0.3 M NaCl, and 20 mM imidazole
  • 500 uL of elution buffer 50 mM sodium phosphate (pH 8.0), 0.3 M NaCl, and 250 mM imidazole
  • concentration of each solution dispensed at 280 nm was measured using Biodrop and stored in a refrigerator at 4°C.
  • TRAIL-C TRAIL trimer-C
  • TRAIL-C' TRAIL trimer-C'
  • DR TRAIL trimer-C or TRAIL tri Affinity between fusion-C' and the death receptor (DR)
  • scTRAIL-C+scTRAIL-C' affinity between the trail hexamer
  • DR is a cognate receptor for TRAIL.
  • a death receptor Biolegend
  • Flamma® 648 Sulfo-NHS ester dissolved in DMSO were mixed at a molar ratio of 1:5 and reacted at room temperature for 1 hour.
  • Zebajel Spin Desalting Column (40K MWCO, 0.5 mL) removes the preservation solution through centrifugation at 1500 g for 1 minute before injecting the sample, fills the column with 450 uL of a 150 mM sodium carbonate solution, and then desalts the column again at 1500 g. Minute centrifugation was performed.
  • centrifugation was performed at 1500 g for 2 minutes to remove trace amounts of DMSO from the sample, and the sample was replaced with a sodium carbonate solution to separate non-labeled and labeled DR.
  • the measured intensity was adjusted using a labeled DR. It was confirmed that the fluorescence intensity value appeared between 800 and 1000 by adjusting the excitation power after filling the four capillaries with the same concentration of labeled DR.
  • TRAIL single molecule TRAIL
  • TRAIL trimer-C single molecule TRAIL
  • TRAIL trimer-C single molecule TRAIL
  • TRAIL hexamer TRAIL hexamer
  • Receptor-ligand mixing method is as follows: First, dispense 10 uL each of 15 racks except for the first rack of death receptor, which is a receptor protein. Next, put 20 uL of trail trimer-C, which acts as a ligand, in the first rack, take 10 uL from the first rack, dilute it in the second rack, take 10 uL again, and dilute it in the third rack. go ahead As a result, the 216-fold diluted sample becomes the final 16th sample.
  • the affinity between the TRAIL hexamer and the death receptor (163 nM) is about 2-5 times higher than that between TRAIL trimer-C or TRAIL trimer-C' and the death receptor (337 nM and 787 nM, respectively). It was confirmed that it was formed high (FIG. 4).

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Medicinal Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Biophysics (AREA)
  • Zoology (AREA)
  • Veterinary Medicine (AREA)
  • Biochemistry (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Epidemiology (AREA)
  • General Engineering & Computer Science (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Biomedical Technology (AREA)
  • Immunology (AREA)
  • Wood Science & Technology (AREA)
  • Biotechnology (AREA)
  • Toxicology (AREA)
  • Plant Pathology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Microbiology (AREA)
  • Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • Cell Biology (AREA)
  • Inorganic Chemistry (AREA)
  • Peptides Or Proteins (AREA)

Abstract

본 발명은 자가결합 도메인을 포함하는 폴리펩타이드, 상기 폴리펩타이드를 포함하는 융합 단백질 또는 이를 코딩하는 핵산 분자나, 상기 폴리펩타이드, 융합 단백질 또는 핵산 분자를 포함하는 조성물에 관한 것이다. 본 발명의 융합 단백질 또는 조성물은 원하는 목적에 따라 다양한 약물 모이어티(단백질, 항체 절편 등)를 결합 또는 탑재하여 이를 모듈형식으로 구현하고, 자가결합에 의해 결합시킴으로써 타겟에 대한 향상된 결합력 및/또는 약물의 활성 증가를 달성할 수 있다.

Description

코일드 코일 융합 단백질
본 발명은 공동발현에 의한 결합 안정성이 향상된 코일드 코일 스캐폴드에 관한 것으로, 본 발명에서 제시하는 코일드 코일 스캐폴드는 MBD2-p66α (Methyl-binding domain protein2 - Transcriptional repressor p66α) 복합체에 약물 모이어티(단백질, 항체 절편 등)가 결합되어, 여러 기능성 분자의 다중복합체를 모듈형식으로 구현할 수 있는 융합 단백질 또는 약물 전달체에 관한 것이다.
현재 사용 중이거나 개발 중인 약물 전달체의 경우 보편적으로 이중약물탑재가 최대이며 탑재되는 약물의 형태가 한 가지에 한정되어 있다. 또한 새로운 약물을 탑재해 전달체를 만들기 위해서는 기존의 약물 전달체를 생산하는 공정을 동일하게 진행해야 한다는 비효율성을 가져 탑재되는 약물의 조합을 간편하게 바꿀 수 없다는 단점을 가진다.
[선행기술문헌]
[특허문헌]
US 2014-0073566 A1
본 발명자들은 다양한 종류의 약물 모이어티(치료용 단백질, 항체 절편 등)를 손쉽게 탑재할 수 있으면서도, 개선된 약효를 나타낼 수 있는 융합 단백질 또는 약물 전달체의 플랫폼을 개발하고자 예의 노력을 하였다. 그 결과 MBD2 아미노산 서열의 360-393 위치를 포함하는 폴리펩타이드 및 p66α 아미노산 서열의 138-178 아미노산 위치를 포함하는 폴리펩타이드의 N-말단 또는 C-말단에 약물 모이어티를 결합할 경우, 상기 2가지 폴리펩타이드가 자가결합에 의해 결합함으로써 타겟에 대한 향상된 결합력 및/또는 약물의 활성을 나타낸다는 것을 확인함으로써 본 발명을 완성하게 되었다.
따라서 본 발명의 목적은, 자가결합 도메인 1을 포함하는 폴리펩타이드 1 및 자가결합 도메인 2를 포함하는 폴리펩타이드 2를 포함하는 융합 단백질을 제공하는데 있다.
본 발명의 다른 목적은, 상기 융합 단백질을 코딩하는 핵산 분자를 제공하는데 있다.
본 발명의 또 다른 목적은, 상기 핵산 분자를 포함하는 벡터를 제공하는데 있다.
본 발명의 또 다른 목적은, 자가결합 도메인 1을 포함하는 폴리펩타이드 1을 코딩하는 핵산분자 1 및 자가결합 도메인 2를 포함하는 폴리펩타이드 2를 코딩하는 핵산분자 2를 포함하는 발현 구축물을 제공하는데 있다.
본 발명의 또 다른 목적은, 상기 벡터 또는 발현 구축물을 포함하거나 상기 벡터 또는 발현 구축물로 형질전환된 숙주세포를 제공하는데 있다.
본 발명의 또 다른 목적은, 상기 융합 단백질, 핵산 분자, 벡터, 발현 구축물 또는 숙주세포를 포함하는 암의 예방 또는 치료용 약제학적 조성물을 제공하는데 있다.
본 발명의 또 다른 목적은, 상기 폴리펩타이드 1 또는 핵산분자 1 및 폴리펩타이드 2 또는 핵산분자 2를 포함하는 키트를 제공하는데 있다.
본 발명의 다른 목적 및 이점은 하기의 발명의 상세한 설명, 청구범위 및 도면에 의해 보다 명확하게 된다.
본 발명의 일 양태에 따르면, 본 발명은 자가결합 도메인 1을 포함하는 폴리펩타이드 1 및 자가결합 도메인 2를 포함하는 폴리펩타이드 2를 포함하는 융합 단백질을 제공한다.
본 명세서에서 용어 "융합 단백질"은 적어도 두 개 이상 유전자의 뉴클레오타이드 서열을 포함하는 핵산 분자에 의해 발현된 하이브리드 단백질을 의미한다.
본 명세서에서 용어 "자가결합 도메인"은 다른 자가결합 도메인과 자가결합하여 코일드 코일을 형성할 수 있는 단백질을 의미한다. 예를 들어, 자가결합 도메인 1은 자가결합 도메인 2와 자가결합하여 코일드 코일을 형성할 수 있다. 상기 자가결합 도메인은 상호 간에 소수성 및/또는 이온성 상호작용인 비공유결합을 가능하게 하여, 개별 도메인들이 서로 결합(자가결합)하여 코일드 코일을 형성할 수 있도록 한다.
상기 자가결합 도메인 1은 바람직하게는 서열번호 1의 아미노산 서열, 또는 상기 서열번호 1에서 6번째, 27번째 및 이들의 조합으로 구성된 군으로부터 선택되는 아미노산이 시스테인으로 변이된 아미노산 서열을 포함하며, 보다 바람직하게는 상기 서열번호 1에서 6번째, 27번째 및 이들의 조합으로 구성된 군으로부터 선택되는 아미노산이 시스테인으로 변이된 아미노산 서열을 포함한다.
상기 자가결합 도메인 2는 바람직하게는 서열번호 6의 아미노산 서열, 또는 상기 서열번호 6에서 8번째, 29번째 및 이들의 조합으로 구성된 군으로부터 선택되는 아미노산이 시스테인으로 변이된 아미노산 서열을 포함하며, 보다 바람직하게는 상기 서열번호 6에서 8번째, 29번째 및 이들의 조합으로 구성된 군으로부터 선택되는 아미노산이 시스테인으로 변이된 아미노산 서열을 포함한다.
상기 아미노산 위치에서의 시스테인으로의 변이는 2가지의 자가결합 도메인 간 공유결합(이황화 결합)을 추가로 유도하여 보다 안정적인 융합 단백질을 형성할 수 있도록 한다.
본 발명의 일 실시예에 따르면, 상기 자가결합 도메인 1의 시스테인 변이 위치(서열번호 1에서 6번째, 27번째 위치) 및 자가결합 도메인 2의 시스테인 변이 위치(서열번호 6에서 8번째, 29번째 위치)가 아닌 다른 위치(예를 들어, 서열번호 1에서 16번째, 20번째 위치 및/또는 서열번호 6에서 18번째, 11번째 위치 등)에 시스테인 변이가 도입될 경우 안정적인 융합 단백질을 형성하지 못하거나, 발현량이 현저히 떨어지는 것을 확인할 수 있다(도 3a 및 b).
본 발명의 바람직한 구현예에 따르면, 상기 자가결합 도메인 1은 서열번호 2 또는 3의 아미노산 서열을 포함하는 것이다.
본 발명의 바람직한 구현예에 따르면, 상기 자가결합 도메인 2는 서열번호 7 또는 8의 아미노산 서열을 포함하는 것이다.
본 발명의 바람직한 구현예에 따르면, 상기 융합 단백질은 서열번호 2의 아미노산 서열을 포함하는 자가결합 도메인 1 및 서열번호 7의 아미노산 서열을 포함하는 자가결합 도메인 2를 포함하는 것이다.
본 발명의 바람직한 구현예에 따르면, 상기 융합 단백질은 서열번호 3의 아미노산 서열을 포함하는 자가결합 도메인 1 및 서열번호 8의 아미노산 서열을 포함하는 자가결합 도메인 2를 포함하는 것이다.
본 발명의 융합 단백질은 1 이상의 약물 모이어티(drug moiety)를 추가로 포함할 수 있다.
본 발명의 바람직한 구현예에 따르면, 상기 융합 단백질은 상기 자가결합 도메인 1 또는 자가결합 도메인 1을 포함하는 폴리펩타이드 1의 N-말단 및 C-말단으로 구성된 군으로부터 선택되는 1 이상의 부위에 약물 모이어티를 포함한다.
본 발명의 바람직한 구현예에 따르면, 상기 융합 단백질은 상기 자가결합 도메인 2 또는 자가결합 도메인 2를 포함하는 폴리펩타이드 2의 N-말단 및 C-말단으로 구성된 군으로부터 선택되는 1 이상의 부위에 약물 모이어티를 포함한다.
본 명세서에서 사용된 용어 " 폴리펩타이드 1"은 상기 자가결합 도메인 1 또는 상기 자가결합 도메인 1을 포함하는 펩타이드로서, 자가결합 도메인 2 또는 상기 자가결합 도메인 2를 포함하는 펩타이드 2와 자가결합하는 성질을 갖는 펩타이드를 의미한다.
본 명세서에서 사용된 용어 " 폴리펩타이드 2"는 상기 자가결합 도메인 2 또는 상기 자가결합 도메인 2를 포함하는 펩타이드로서, 자가결합 도메인 1 또는 상기 자가결합 도메인 1을 포함하는 펩타이드 1과 자가결합하는 성질을 갖는 펩타이드를 의미한다.
본 명세서에서 사용된 용어 "약물 모이어티"는 항체 또는 이의 항원결합 단편, 또는 단백질(예를 들어, 치료용 단백질, 리간드, 리셉터, Fc 부위) 등 다른 종류의 단백질 또는 물질과 상호작용하거나, 발현 시 특정 기능을 수행할 수 있는 물질을 말한다. 상기 단백질은 전장 단백질뿐만 아니라, 특정 기능을 담당하는 도메인 또는 폴리펩타이드의 일부일 수 있으며, 천연형이거나 인위적인 서열일 수 있다.
본 명세서에서 용어 "항체"는 면역학적으로 특정 항원과 반응성을 갖는 면역글로불린 분자를 포함하는, 항원을 특이적으로 인식하는 수용체 역할을 하는 단백질 분자를 의미하며 다클론항체 및 단클론항체를 모두 포함한다.
항체는 완전한 전장(full-length) 항체 형태뿐만 아니라 항체 분자의 항원 결합 단편(항체 단편)을 포함한다. 완전한 항체는 2개의 전체 길이의 경쇄 및 2개의 전체 길이의 중쇄를 가지는 구조로서 각각의 경쇄는 중쇄와 이황화 결합으로 연결되어 있다. 중쇄 불변영역은 감마(γ), 뮤(μ), 알파(α), 델타(δ) 및 엡실론(ε) 타입을 가지고 서브클래스로 감마1(γ1), 감마2(γ2), 감마3(γ3), 감마4(γ4), 알파1(α1) 및 알파2(α2)를 가진다. 경쇄의 불변영역은 카파(kappa, κ) 및 람다(lambda, λ) 타입을 가진다.
본 명세서에서 용어 "항체의 항원 결합 단편"은 전체 항체 분자 내에서 항원을 특이적으로 인식하고 항원-항체 결합 기능을 보유하는 단편을 의미하며, 단일-도메인 항체(sdAb), 단일쇄 항체(scFv), Fab, F(ab'), F(ab')2 및 Fv 등을 포함한다. 단편의 예로는, VL, VH, Cκ (또는 CL) 및 CH1 도메인으로 구성된 1가 단편(Fab 단편); 힌지 영역에서 이황화물 브릿지에 의해 연결된 2개의 Fab 단편을 포함하는 2가 단편(F(ab')2 단편); VH 및 CH1 도메인으로 구성된 Fd 단편; 항체의 하나의 암(arm)의 VL 및 VH 도메인, 및 이황화물-연결된 Fv(sdFv)로 구성된 Fv 단편; VH 도메인으로 구성된 dAb 단편; 및 분리된 상보성 결정 영역(CDR) 또는 링커에 의해 선택적으로 이어질 수 있는 둘 이상의 분리된 CDR의 조합을 포함한다. 또한, scFv는 VL과 VH 영역이 쌍을 이루어 1가 분자를 형성한 단일 단백질 사슬을 이루도록 링커에 의해 이어질 수 있다. 이러한 단일쇄 항체도 항체의 단편에 포함된다. 또한, 상기 항체 또는 항체의 단편은 2개의 중쇄 분자와 2개의 경쇄 분자를 포함하는 테트라머 항체; 항체 경쇄 모노머; 항체 중쇄 모노머; 항체 경쇄 다이머, 항체 중쇄 다이머; 인트라바디; 1가 항체; 낙타 항체; 및 단일-도메인 항체(sdAb)를 포함한다.
본 발명의 바람직한 구현예에 따르면, 상기 약물 모이어티로서 항체의 항원결합 단편은 scFv인 것이다.
본 발명의 바람직한 구현예에 따르면, 상기 약물 모이어티로서 단백질은 알부민 결합 펩타이드(ABP; Albumin binding peptide) 또는 트레일(TRAIL; Tumor necrosis factor-related apoptosis-inducing ligand)인 것이다.
본 명세서에서 사용된 용어 "알부민 결합 펩타이드"는 혈액 삼투압의 유지, 다양한 기질의 수송 등에 있어서 중요한 역할을 하는 다기능성 혈장 단백질인 알부민에 결합하는 펩타이드 또는 단백질을 의미한다. 알부민은 FcRn에 대한 결합력을 갖고 있기 때문에 3주의 긴 혈장 반감기를 가지며, 알부민에 결합 활성을 보유하는 알부민 결합 펩타이드의 서열을 융합 단백질에 포함시킴으로써 반감기 증가의 특성을 부여할 수 있다. 당업계에는 다양한 종류의 알부민 결합 펩타이드가 개시(Zorzi et al., Medchemcomm. 2019 Jul 1; 10(7): 1068-1081 등)되어 있으며 본 명세서에 참조로 삽입된다.
본 명세서에서 사용된 용어 "트레일"은 종양괴사인자(Tumor necrosis factor, TNF)의 일종으로 종양세포의 자가 세포사멸을 유도하는 리간드를 의미한다. TRAIL은 4개의 수용체를 갖고 있으며, 상기 수용체 중 사멸 수용체(death receptor, DR4, DR5)는 암 세포주에서, 디코이 수용체(Decoy receptor, DcR1, DcR2)는 정상 세포주에서 과발현된다. 상기 TRAIL은 종양세포의 표면에 있는 DR4 및 DR5와 같은 사멸 수용체에 결합하여 종양세포의 사멸을 유도할 수 있다. 상기 디코이 수용체의 경우는 c- 말단에 사멸 도메인을 가지고 있지 않아 세포사멸 신호전달이 세포 내로 전해지지 않는다. 따라서, TRAIL을 기반으로 하는 치료는 정상세포에 대해서는 무해하면서 다양한 암 세포주에 대해서만 독성을 유도한다는 특징을 가지고 있어 매우 효과적인 차세대 항암 치료제이다. 그러나, TRAIL을 상기 장점에도 불구하고 트레일 단량체(monomer)의 활성형인 삼합체(homotrimer)는 비공유결합으로 연결되어 있어 구조 안정성 및 체내 지속성이 빈약하여 임상적 응용이 제한적이다.
본 발명의 바람직한 구현예에 따르면, 상기 약물 모이어티로서 단백질은 트레일 삼합체(timer)인 것인 것이다.
상기 트레일 삼합체는 상기 자가결합 도메인 1 또는 자가결합 도메인 1을 포함하는 폴리펩타이드 1의 N-말단 및/또는 C-말단에 결합되거나, 상기 자가결합 도메인 2 또는 자가결합 도메인 2를 포함하는 폴레펩타이드 2의 N-말단 및/또는 C-말단에 결합됨으로써, 삼합체, 육합체, 구합체, 십이합체 등을 융합 단백질 내에 구축할 수 있다.
본 발명의 일 실시예에 따르면, 트레일 삼합체-자가결합 도메인 1 및 트레일 삼합체-자가결합 도메인 2가 자가결합되어 형성된 트레일 육합체는 1) 트레일 삼합체-자가결합 도메인 1 또는 2) 트레일 삼합체-자가결합 도메인 2가 단독으로 발현된 경우와 비교하여 사멸 수용체와의 친화도가 2-5배 증가된 것을 확인할 수 있다(도 4).
본 발명의 또 다른 실시예에 따르면, 트레일 삼합체-자가결합 도메인 1 및 트레일 삼합체-자가결합 도메인 2가 자가결합되어 형성된 트레일 육합체는 1) 트레일 삼합체-자가결합 도메인 1 또는 2) 트레일 삼합체-자가결합 도메인 2가 단독으로 발현된 경우와 비교하여 암 세포 사멸률이 4배 이상 증가된 것을 확인할 수 있다(도 5a 및 b).
본 명세서에서 사용된 용어 "N-말단" 및 "C-말단"은 폴리펩타이드에 있어서 아미노 말단 및 카복시 말단을 의미한다. 상기 약물 모이어티는 같은 종류(예를 들어, 트레일 삼합체+ 트레일 삼합체 등)의 단백질이 상기 자가결합 도메인 1 또는 자가결합 도메인 1을 포함하는 폴리펩타이드 1의 N-말단 및/또는 C-말단에 결합되거나, 상기 자가결합 도메인 2 또는 자가결합 도메인 2를 포함하는 폴레펩타이드 2의 N-말단 및/또는 C-말단에 결합될 수 있으며, 다른 종류(예를 들어, 트레일 삼합체+ABP 또는 트레일 삼합체+ABP+scFv 등)의 단백질들이 각각의 N-말단 및/또는 C-말단에 결합될 수도 있으며, 여러 기능성 분자의 다중복합체를 모듈형식으로 구현할 수 있다.
본 발명의 바람직한 구현예에 다르면, 상기 약물 모이어티는 상기 폴리펩타이드 1 또는 2의 N-말단 또는 C-말단에 링커로 결합된 것이다.
본 명세서에 사용된 용어 "링커"는 상기 폴리펩타이드 1 또는 2의 N-말단 또는 C-말단 및 약물 모이어티의 N-말단 또는 C-말단 사이에 존재하는 아미노산서열을 의미한다. 상기 링커는 임의의 아미노산 조합인 것을 수 있으나, 이에 한정되는 것은 아니며, 상기 폴리펩타이드 1 또는 2와 약물 모이어티의 결합 및 해리를 촉진하는 서열이나, 코일드 코일 형성 도메인에 유연성을 부여하거나, 코일드코일 형성 도메인이 결합할 때 발생하는 입체 장애 등을 감소시킬 목적으로 도입할 수 있다. 상기 링커는 임의의 길이의 글라이신 및 세린 풍부 서열이 바람직하며, 예를 들어, Gly-Ser, Gly-Gly-Ser, Gly-Gly-Gly-Ser, Gly-Gly-Gly-Gly-Ser 또는 이들의 조합이 반복되는 것일 수 있으나 이에 한정되는 것은 아니다.
본 발명의 바람직한 구현예에 따르면, 본 발명은 하기의 구성을 포함하는 코일드-코일(Coiled-Coil) 복합체에 관한 것이다:
(i) 서열번호 1에서 6번째, 27번째 및 이들의 조합으로 구성된 군으로부터 선택되는 아미노산이 시스테인으로 변이된 폴리펩타이드 1; 및
(ii) 서열번호 6에서 8번째, 29번째 및 이들의 조합으로 구성된 군으로부터 선택되는 아미노산이 시스테인으로 변이된 폴리펩타이드 2.
본 발명의 다른 양태에 따르면, 본 발명은 상기 융합 단백질 또는 코일드-코일 복합체를 코딩하는 핵산 분자를 제공한다.
본 명세서에서 용어 "핵산 분자"는 DNA(gDNA 및 cDNA) 그리고 RNA 분자를 포괄적으로 포함하는 의미를 가지며, 핵산 분자에서 기본 구성단위인 뉴클레오타이드는 자연의 뉴클레오타이드뿐만 아니라, 당 또는 염기 부위가 변형된 유사체(analogue)도 포함한다(Scheit, Nucleotide Analogs, John Wiley, New York(1980); Uhlman 및 Peyman, Chemical Reviews, (1990) 90:543-584). 본 발명의 융합 단백질을 코딩하는 핵산 분자의 서열은 변형될 수 있다. 상기 변형은 뉴클레오타이드의 추가, 결실, 또는 비보존적 치환 또는 보존적 치환을 포함한다.
본 발명의 핵산 분자는 상기한 뉴클레오타이드 서열에 대하여 실질적인 동일성을 나타내는 뉴클레오타이드 서열도 포함하는 것으로 해석된다. 상기의 실질적인 동일성은, 상기한 본 발명의 뉴클레오타이드 서열과 임의의 다른 서열을 최대한 대응되도록 얼라인하고, 당업계에서 통상적으로 이용되는 알고리즘을 이용하여 얼라인 된 서열을 분석한 경우에, 최소 80%의 상동성, 일 특정예에서는 최소 90%의 상동성, 다른 특정예에서는 최소 95%의 상동성을 나타내는 뉴클레오타이드 서열을 의미한다.
본 발명의 바람직한 구현예에 따르면, 상기 폴리펩타이드 1을 코딩하는 핵산분자(핵산분자 1) 및/또는 상기 폴리펩타이드 2를 코딩하는 핵산분자 (핵산분자 2)의 의 5' 말단 또는 3' 말단으로 구성된 군으로부터 선택되는 위치에 약물 모이어티를 코딩하는 뉴클레오타이드 서열이 포함될 수 있다.
본 발명의 또 다른 양태에 따르면, 본 발명은 상기 핵산 분자를 포함하는 벡터를 제공한다.
본 명세서에서 용어 "벡터"는 상기 핵산 분자 서열을 복제할 수 있는 세포로의 도입을 위해서 폴리뉴클레오타이드 서열을 삽입할 수 있는 전달체를 의미한다. 폴리뉴클레오타이드 서열은 외생(Exogenous) 또는 이종(Heterologous)일 수 있다. 벡터로서는 플라스미드, 코스미드 벡터 및 바이러스 벡터(레트로바이러스, 아데노바이러스 및 아데노-부속 바이러스 벡터 등)를 들 수 있으나, 이에 제한되지 않는다. 당업자는 표준적인 재조합 기술에 의해 벡터를 구축할 수 있다(Maniatis, et al., Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Press, Cold Spring Harbor, N.Y., 1988; 및 Ausubel et al., In: Current Protocols in Molecular Biology, John, Wiley & Sons, Inc, NY, 1994 등).
본 명세서에서 용어 "발현 구축물"은 전사되는 유전자 산물 중 적어도 일부분을 코딩하는 뉴클레오타이드 서열을 포함한 벡터를 의미한다. 일부의 경우에는 그 후 RNA 분자가 단백질, 폴리펩타이드, 또는 펩타이드로 번역된다. 발현 벡터에는 다양한 조절서열을 포함할 수 있다. 전사 및 번역을 조절하는 조절서열과 함께 벡터 및 발현 벡터에는 또 다른 기능도 제공하는 핵산 서열도 포함될 수 있다. 상기 발현 구축물은 동일한 벡터 내에 상기 폴리펩타이드 1을 코딩하는 핵산분자 1 및 상기 폴리펩타이드 2를 코딩하는 핵산분자 2를 동시에 포함하거나, 상이한 벡터 내에 포함할 수 있다. 상기 핵산분자 1 및 2는 인 비트로 또는 인 비보에서 동일한 벡터 또는 상이한 벡터로부터 발현된 폴리펩타이드 1 및 2가 자가결합으로 결합하여 융합 단백질을 형성할 수 있다.
본 발명의 또 다른 양태에 따르면, 본 발명은 전술한 벡터 또는 발현 구축물을 포함하가나 상기 벡터 또는 발현 구축물로 형질전환된 숙주세포를 제공한다.
본 명세서에서 용어 "세포"는 진핵세포 및 원핵세포를 포함하며, 상기 벡터를 복제할 수 있거나 벡터에 의해 코딩되는 유전자를 발현할 수 있는 임의의 형질 전환 가능한 세포를 의미한다. 세포는 상기 벡터에 의해 형질감염(Transfected), 형질도입(Transduced) 또는 형질전환(Transformed) 될 수 있으며, 이는 외생의 폴리뉴클레오타이드(핵산분자)가 숙주세포 내에 전달되거나 도입되는 과정을 의미한다. 본 명세서에서 용어 "형질전환"은 상기 형질감염(Transfected) 및 형질도입(Transduced)을 포함하는 의미로 사용된다.
본 발명의(숙주)세포는 제한되지 않으나, 바람직하게는 곤충세포 또는 포유동물 세포, 보다 바람직하게는 곤충세포의 경우 Sf9, 포유동물 세포의 경우 HEK293 세포, HeLa 세포, ARPE-19 세포, RPE-1 세포, HepG2 세포, Hep3B 세포, Huh-7 세포, C8D1a 세포, Neuro2A 세포, CHO 세포, MES13 세포, BHK-21 세포, COS7 세포, COP5 세포, A549 세포, MCF-7 세포, HC70 세포, HCC1428 세포, BT-549 세포,PC3 세포, LNCaP 세포, Capan-1 세포, Panc-1 세포, MIA PaCa-2 세포, SW480 세포, HCT166 세포, LoVo 세포, A172 세포, MKN-45 세포, MKN-74 세포, Kato-III 세포, NCI-N87 세포, HT-144 세포, SK-MEL-2 세포, SH-SY5Y 세포, C6 세포, HT-22 세포, PC-12 세포, NIH3T3 세포 등을 이용할 수 있다.
본 발명의 숙주세포는 바람직하게는 단리된 숙주세포이다.
본 발명의 또 다른 양태에 따르면, 본 발명은 전술한 융합 단백질, 상기 핵산분자, 상기 벡터, 상기 발현 구축물 또는 상기 세포를 포함하는 조성물을 제공한다.
본 발명의 또 다른 양태에 따르면, 본 발명은 i) 자가결합 도메인 1로써 서열번호 2 또는 3의 아미노산 서열을 포함하는 폴리펩타이드 1 또는 상기 폴리펩타이드 1을 코딩하는 핵산 분자 1 및 ii) 자가결합 도메인 2로써 서열번호 7 또는 8의 아미노산 서열을 포함하는 폴리펩타이드 2 또는 상기 폴리펩타이드 2를 코딩하는 핵산 분자 2를 포함하는 조성물을 제공한다.
본 발명에 있어서 상기 "폴리펩타이드", "핵산 분자", "약물 모이어티" 등 상기 기술한 항목과 동일한 내용에 대해서는 명세서의 복잡성 및 반복을 피하기 위해 생략하기로 한다.
상기 조성물에 포함되는, 서열번호 2 또는 3의 아미노산 서열을 포함하는 폴리펩타이드 1 및 서열번호 7 또는 8의 아미노산 서열을 포함하는 폴리펩타이드 2의 N-말단 및 C-말단으로 구성된 군으로부터 선택되는 1 이상의 부위에는 약물 모이어티가 결합될 수 있다.
따라서, 상기 조성물은 i) 폴리펩타이드 1-약물 모이어티, 약물 모이어티-폴리펩타이드 1 또는 약물 모이어티-폴리펩타이드 1-약물 모이어티 및 ii) 폴리펩타이드 2-약물 모이어티, 약물 모이어티-폴리펩타이드 2 또는 약물 모이어티-폴리펩타이드 2-약물 모이어티를 포함할 수 있다.
또한, 상기 조성물에 포함되는, 서열번호 2 또는 3의 아미노산 서열을 포함하는 폴리펩타이드 1을 코딩하는 핵산 분자 1 및 서열번호 7 또는 8의 아미노산 서열을 포함하는 폴리펩타이드 2를 코딩하는 핵산 분자 2의 5' 말단 또는 3' 말단으로 구성된 군으로부터 선택되는 위치에 약물 모이어티를 코딩하는 뉴클레오타이드 서열이 결합될 수 있다.
또한, 상기 조성물에 포함되는, 핵산분자 1, 핵산분자 2 및 이에 결합된 약물 모이어티를 코딩하는 뉴클레오타이드 서열은 하나 또는 복수의 벡터에 삽입된 형태로 조성물 내에 존재할 수 있다.
본 발명의 바람직한 구현예에 따르면, 상기 조성물은 암의 예방 또는 치료용 약제학적 조성물인 것이다.
본 발명의 또 다른 양태에 따르면, 본 발명은 전술한 융합 단백질, 상기 핵산분자, 상기 벡터, 상기 발현 구축물, 상기 세포 또는 상기 조성물의 약제학적 유효량을 대상체에게 투여하는 단계를 포함하는 암의 예방 또는 치료방법을 제공한다.
본 발명의 또 다른 양태에 따르면, 본 발명은 전술한 융합 단백질, 상기 핵산분자, 상기 벡터, 상기 발현 구축물, 상기 세포 또는 상기 조성물의 치료용도(for use in therapy)를 제공한다.
본 발명의 바람직한 구현예에 따르면, 상기 치료용도는 암의 치료용도인 것이다.
본 명세서에서 용어 "예방"은 질환 또는 질병을 보유하고 있다고 진단된 적은 없으나, 이러한 질환 또는 질병에 걸릴 가능성이 있는 대상체에서 질환 또는 질병의 발생을 억제하는 것을 의미한다.
본 명세서에서 용어 "치료"는 (a) 질환, 질병 또는 증상의 발전의 억제; (b) 질환, 질병 또는 증상의 경감; 또는 (c) 질환, 질병 또는 증상을 제거하는 것을 의미한다.
따라서, 본 발명의 조성물은 그 자체로 암 치료용 조성물이 될 수도 있고, 혹은 다른 약리성분과 함께 투여되어 이의 치료 반응성을 향상시키는 치료 보조제로 적용될 수도 있다. 이에, 본 명세서에서 용어 "치료" 또는 "치료제"는 "치료 보조" 또는 "치료 보조제"의 의미를 포함한다.
본 명세서에서 용어 "투여" 또는 "투여하다"는 본 발명의 조성물의 치료적 유효량을 대상체에 직접적으로 투여함으로써 대상체의 체내에서 동일한 양이 형성되도록 하는 것을 말한다.
본 발명에서 용어 "치료적 유효량"은 본 발명의 약제학적 조성물을 투여하고자 하는 개체에게 조성물 내의 약리성분이 치료적 또는 예방적 효과를 제공하기에 충분한 정도로 함유된 조성물의 함량을 의미하며, 이에 "예방적 유효량"을 포함하는 의미이다.
본 명세서에서 용어 "대상체"는 제한없이 인간, 마우스, 래트, 기니아 피그, 개, 고양이, 말, 소, 돼지, 원숭이, 침팬지, 비비 또는 붉은털 원숭이를 포함한다. 구체적으로는, 본 발명의 대상체는 인간이다.
약제학적으로 허용되는 담체, 부형제 또는 안정제(Remington's Pharmaceutical Sciences (1990) Mack Publishing Co., Easton, PA) 중에서 원하는 정도의 순도를 가진, 본 명세서에 개시된 조성물이 본 명세서에 개시된다. 허용되는 담체, 부형제 또는 안정제는 이용된 투약량 및 농도에서 수혜자에게 비독성이며, 버퍼, 예컨대 포스페이트, 시트레이트 및 다른 유기산; 아스코르브산 및 메티오닌을 포함하는 항산화제; 보존제(예컨대 염화 옥타데실디메틸벤질암모늄; 염화헥사메토늄; 염화벤잘코늄; 페놀, 부틸 또는 벤질 알코올; 알킬 파라벤, 예컨대 메틸 또는 프로필 파라벤; 카테콜; 레졸시놀; 사이클로헥산올; 3-펜타놀; 및 m-크레졸); 저 분자량(약 10개 잔기 미만) 폴리펩타이드; 단백질, 예컨대 혈청 알부민, 젤라틴, 또는 면역글로불린; 친수성 중합체, 예컨대 폴리비닐피롤리돈; 아미노산, 예컨대 글리신, 글루타민, 아스파라긴, 히스티딘, 아르기닌, 또는 리신; 단당류, 이당류, 및 글루코오스, 만노오스, 또는 덱스트린을 포함하는 다른 탄수화물들; 킬레이트화제, 예컨대 EDTA; 당, 예컨대 수크로오스, 만니톨, 트레할로오스 또는 소르비톨; 염-형성 반대-이온, 예컨대 나트륨; 금속 복합체(예를 들어 Zn-단백질 복합체); 및/또는 비-이온 계면활성제, 예컨대 TWEEN®, PLURONICS® 또는 폴리에틸렌 글리콜(PEG)을 포함한다.
일부 구체예에서, 약제학적 조성물은 본 명세서에 개시된 융합 단백질, 핵산 분자, 벡터, 발현 구축물 또는 세포를, 약제학적으로 허용되는 담체 중에 포함한다. 특정 구체예에서, 약제학적 조성물은 본 명세서에 개시된 융합 단백질, 핵산 분자, 벡터, 발현 구축물 또는 세포의 유효량, 및 선택적으로 하나 이상의 추가의 예방 또는 치료제를, 약제학적으로 허용되는 담체 중에 포함한다. 일부 구체예에서, 융합 단백질, 핵산 분자, 벡터, 발현 구축물 또는 세포는 약제학적 조성물에 포함된 유일한 활성 성분이다.
비경구 제조물에서 사용된 약제학적으로 허용되는 담체는 수성 비히클, 비수성 비히클, 항균제, 등장제, 버퍼, 항산화제, 국소 마취제, 현탁 및 분산제, 유화제, 금소 이온의 봉쇄 또는 킬레이트화제 및 다른 제약학적으로 허용되는 물질을 포함한다. 수성 비히클의 예들은 염화나트륨 주사액, 링거 주사액, 등장 덱스트로오스 주사액, 멸균수 주사액, 덱스트로오스 및 락테이트 링거 주사액을 포함한다. 비수성 비히클은 식물 기원의 고정유, 면실유, 옥수수유, 참깨유 및 땅콩유를 포함한다. 정균 또는 정진균 농도의 항균제가 다수-용량 용기에 패키지된 비경구 제조물에 첨가될 수 있으며, 이들은 페놀 또는 크레졸, 수은함유물질, 벤질 알코올, 클로로부탄올, 메틸 및 프로필 p-하이드록시벤조산 에스테르, 티메로살, 염화벤잘코늄 및 염화벤제토늄을 포함한다. 등장제는 염화나트륨 및 덱스트로오스를 포함한다. 버퍼는 포스페이트 및 시트레이트를 포함한다. 항산화제는 중황산나트륨을 포함한다. 국소 마취제는 프로카인 염산염을 포함한다. 현탁 및 분산제는 나트륨 카복시메틸셀룰로오스, 하이드록시프로필 메틸셀룰로오스 및 폴리비닐피롤리돈을 포함한다. 유화제는 폴리소르베이트 80(TWEEN® 80)을 포함한다. 금속 이온의 봉쇄 또는 킬레이트화제는 EDTA를 포함한다. 제약학적 담체는 또한 수 혼화성 비히클용 에틸 알코올, 폴리에틸렌 글리콜 및 프로필렌 글리콜을 포함하고, pH 조정용 수산화나트륨, 염산, 시트르산 또는 락트산을 포함한다.
약제학적 조성물은 대상에 대한 임의의 투여 경로에 맞게 제제화될 수 있다. 투여 경로의 구체적인 예들은 비내, 경구, 비경구, 척추강내, 뇌실내, 폐, 피하, 또는 심실내 경로를 포함한다. 피하, 근육내 또는 정맥내 주사를 특징으로 하는 비경구 투여가 또한 고려된다. 주사가능물질이 종래의 형태로, 액체 용액 또는 현탁액, 주사 전에 액체 중에서 용액 또는 현탁액으로 되기에 적합한 고체 형태, 또는 에멀젼으로서 제조될 수 있다. 주사가능물질, 용액 및 에멀젼은 또한 하나 이상의 부형제를 함유한다. 적합한 부형제는, 예를 들어 물, 식염수, 덱스트로오스, 글리세롤 또는 에탄올이다. 이에 더하여, 원한다면, 투여될 제약학적 조성물은 또한 소량의 비-독성 보조 물질, 예컨대 습윤 또는 유화제, pH 완충제, 안정제, 용해성 증진제, 및 다른 제제들, 예컨대 나트륨 아세테이트, 소르비탄 모노라우레이트, 트리에탄올아민 올레에이트 및 사이클로덱스트린을 함유할 수 있다.
약제학적 조성물의 비경구 투여용 제조물은 바로 주사 가능한 멸균 용액, 피하주사용 정제를 포함하는 사용 직전에 용매와 바로 조합될 수 있는 멸균 건조 가용성 제품, 예컨대 동결건조된 분말, 바로 주사 가능한 멸균 현탁액, 사용 직전에 비히클과 바로 조합될 수 있는 멸균 건조 불용성 제품 및 멸균 에멀젼을 포함한다. 용액은 수성 또는 비수성일 수 있다.
본 명세서에 개시된 약제학적 조성물은 또한 치료될 대상의 특정 조직, 수용체, 또는 다른 신체 영역에 표적화되도록 제제화될 수 있다. 다양한 표적화 방법이 당업자에게 공지되어 있다. 이러한 표적화 방법을 본 조성물에 사용하는 것이 고려된다. 표적화 방법의 비제한적 예들은 미국특허 제6,316,652호, 제6,274,552호, 제6,271,359호, 제6,253,872호, 제6,139,865호, 제6,131,570호, 제6,120,751호, 제6,071,495호, 제6,060,082호, 제6,048,736호, 제6,039,975호, 제6,004,534호, 제5,985,307호, 제5,972,366호, 제5,900,252호, 제5,840,674호, 제5,759,542호 및 제5,709,874호를 참고한다. 특정한 구체예에서, 본 명세서에 개시된 약제학적 조성물은 암을 치료하기 위해 사용될 수 있다.
생체내 투여에 사용되는 조성물은 멸균될 수 있다. 예를 들어, 멸균 여과 막을 통한 여과에 의해 멸균될 수 있다.
본 발명의 또 다른 양태에 따르면, 본 발명은 하기의 구성을 포함하는 키트를 제공한다:
(i) 서열번호 1에서 6번째, 27번째 및 이들의 조합으로 구성된 군으로부터 선택되는 아미노산이 시스테인으로 변이된 아미노산 서열을 포함하는 폴리펩타이드 1 또는 이를 코딩하는 핵산분자 1;
(ii) 서열번호 6에서 8번째, 29번째 및 이들의 조합으로 구성된 군으로부터 선택되는 아미노산이 시스테인으로 변이된 아미노산 서열을 포함하는 폴리펩타이드 2 또는 이를 코딩하는 핵산분자 2; 및
(iii) 상기 폴리펩타이드 1 및 2의 N-말단 및 C-말단으로 구성된 군으로부터 선택되는 1 이상의 부위에 결합된 약물 모이어티 또는 상기 핵산분자 1 및 2의 5' 말단 또는 3' 말단으로 구성된 군으로부터 선택되는 부위에 결합된 약물 모이어티 코딩 뉴클레오타이드 서열(nucleic acid encoding a drug moiety).
본 발명에 있어서 상기 "폴리펩타이드", "핵산 분자", "약물 모이어티" 등 상기 기술한 항목과 동일한 내용에 대해서는 명세서의 복잡성 및 반복을 피하기 위해 생략하기로 한다.
일부 구체예에서, 본 명세서에 개시된 하나 이상의 (i) 폴리펩타이드 1 또는 이를 코딩하는 핵산분자 1, (ii) 폴리펩타이드 2 또는 이를 코딩하는 핵산분자 2, 및 (iii) 상기 폴리펩타이드 1 및 2의 N-말단 및 C-말단으로 구성된 군으로부터 선택되는 1 이상의 부위에 결합된 약물 모이어티 또는 상기 핵산분자 1 및 2의 5' 말단 또는 3' 말단으로 구성된 군으로부터 선택되는 위치에 결합된 약물 모이어티 코딩 뉴클레오타이드 서열로 채워진 하나 이상의 용기; 선택적인 사용 설명서;를 포함하는 약제학적 팩 또는 키트가 본 명세서에 개시된다. 일부 구체예에서, 키트는 본 명세서에 개시된 약제학적 조성물 및 본 명세서에 개시된 임의의 예방 또는 치료제를 함유한다. 일부 구체예에서, 키트는 본 명세서에 개시된 조성물에 대한 설명서를 포함하는 암의 예방 또는 치료용 조성물이 개시된다.
본 발명의 특징 및 이점을 요약하면 다음과 같다:
(i) 본 발명은 자가결합 도메인을 포함하는 폴리펩타이드, 상기 폴리펩타이드를 포함하는 융합 단백질 또는 이를 코딩하는 핵산 분자나, 상기 폴리펩타이드, 융합 단백질 또는 핵산 분자를 포함하는 조성물을 제공한다.
(ii) 본 발명의 융합 단백질은 원하는 목적에 따라 다양한 약물 모이어티(단백질, 항체 절편 등)를 결합 또는 탑재하여 이를 모듈형식으로 구현하고, 자가결합에 의해 결합시킴으로써 타겟에 대한 향상된 결합력 및/또는 약물의 활성 증가를 달성할 수 있다.
도 1a는 Alphafold2를 이용하여 코일 C'-GFP-6xHis 및 코일 C-mCherry-6xHis의 구조를 예측한 결과이다.
도 1b는 정제된 C'-GFP 및 C- mCherry의 분자량을 SDS-PAGE로 측정한 결과이다.
도 2a는 코일 융합 형광 단백질이 올바르게 접혔는지 확인하기 위해 Native PAGE를 수행한 결과이다.
도 2b는 등온 적정 열량계(ITC)를 사용하여 C'-GFP와 C-mCherry 사이의 열역학을 조사하여 결합 매개변수를 결정한 결과이다.
도 3a는 Ala27-Ile8, Thr6-Arg29, Coiled coil_F1 및 Coiled coil_F2가 안정적인 복합체를 형성하는지 여부를 확인한 결과이다.
도 3b는 Ala27-Ile8, Thr6-Arg29, Coiled coil_F1 및 Coiled coil_F2의 상대적 발현량을 비교한 결과이다.
도 3c는 Ala27-Ile8의 FRET 효율을 100%로 두었을 때, Thr6-Arg29, C'-GFP/C-mCherry의 FRET 효율을 상대적으로 비교한 결과이다.
도 4는 트레일 육합체와 사멸수용체의 친화도(DR and scTRAIL-C+scTRAIL-C')를 트레일 삼합체-C 또는 트레일 삼합체- C'과 사멸수용체의 친화도(DR and scTRAIL-C or DR and scTRAIL-C')와 비교한 결과이다.
도 5a는 양성 대조군(R&D TRAIL) 및 트레일 삼합체-C (I) 또는 트레일 삼합체-C'(II) 시험군과 트레일 육합체 시험군(I+II)을 처리한 교모세포종 세포주 를 유세포 분석기 (FACS)를 이용하여 관찰한 결과이다.
도 5b는 양성 대조군(PC) 및 트레일 삼합체-C (T1) 또는 트레일 삼합체-C'(T2) 시험군과 트레일 육합체 시험군(T3)의 암세포 사멸율을 비교한 결과이다.
이하, 실시 예를 통하여 본 발명을 더욱 상세히 설명하고자 한다. 이들 실시 예는 오로지 본 발명을 보다 구체적으로 설명하기 위한 것으로, 본 발명의 요지에 따라 본 발명의 범위가 이들 실시 예에 의해 제한되지 않는다는 것은 당업계에서 통상의 지식을 가진 자에 있어서 자명할 것이다.
실시예
재료 및 방법
1. 재료
NaCl(염화나트륨), 이미다졸, NaOH(수산화나트륨), 트리스(하이드록시메틸)아미노메탄, 글리세롤(99.8%), 메틸알코올(99.8%), 초산(99.7%), H2PO4(인산 이수소)는 삼천(SAMCHUN)에서 구입하였다. 효모 추출물, 한천, 6N-HCl(6N-Hydrochloric acid) 및 Bromophenol blue는 대정(DAEJUNG)에서 구입하였다. BL21(DE3) chemically competent E.coli는 엔자이오믹스(Enzynomics)에서 구입하였다. 10% SDS 용액, DTT(DL-Dithiothreitol) 및 Coomassie bright blue G-250 염색 용액은 바이오세상(Biosesang)에서 구입하였다. Bacto tryptone은 BD DIFCO에서 구입하였다. 암피실린 나트륨 염 및 리소자임은 SIGMA에서 구입하였다. 이소프로필 β-D-1-티오갈락토피라노사이드(IPTG)는 바이오니아(BIONEER)에서 구입하였다. DPBS(Dulbecco's Phosphate Buffered Saline)는 웰진(WELGENE)에서 구입하였다. 글리신은 덕산(DUKSAN)에서 구입하였다. Tris/Gycine SDS Pre-cast gel 8-16% 및 Tris/Glycine non-SDS Pre-cast gel 12%는 KOMABIOTECH에서 구입하였다. 폴리프로필렌 컬럼과 PD10 컬럼은 각각 QIAGEN 및 GE 헬스케어에서 구입하였다. Pierce Biotechnology Inc.의 염색되지 않은 단백질 MW 마커를 SDS-PAGE 분석에 사용하였다.
2. 플라스미드 구축 및 박테리아 균주
인간 MBD2 또는 이의 변이체(아미노산 360-393, 서열번호 1 내지 5) 또는 p66 또는 이의 변이체(아미노산 138-178, 서열번호 6 내지 10)의 코일드 코일(coiled-coil) 영역을 인코딩하는 삽입물을 암피실린 내성을 지닌 pET21a에 삽입하였다. pET-GFP-p66α는 pET21a의 NdeI 와 XhoI 사이에 GFP-p66α를 클로닝하여 생성되었으며, mCherry- MBD2도 pET21a의 NdeI 와 XhoI 사이에 클로닝되었다. 상기 실험은 BIONICS에서 수행되었다.
Peptide Mutation SEQ ID NO Sequence
MBD2 야생형 1 KAFIVTDEDIRKQEERVQQVRKKLEEALMADILS
A27C 2 KAFIVTDEDIRKQEERVQQVRKKLEECLMADILS
T6C 3 KAFIVCDEDIRKQEERVQQVRKKLEEALMADILS
R16C 4 KAFIVTDEDIRKQEECVQQVRKKLEEALMADILS
V20C 5 KAFIVTDEDIRKQEERVQQCRKKLEEALMADILS
p66α 야생형 6 PEERERMIKQLKEELRLEEAKLVLLKKLRQSQIQKEATAQK
I8C 7 PEERERMCKQLKEELRLEEAKLVLLKKLRQSQIQKEATAQK
R29C 8 PEERERMIKQLKEELRLEEAKLVLLKKLCQSQIQKEATAQK
E18C 9 PEERERMIKQLKEELRLCEAKLVLLKKLRQSQIQKEATAQK
L11C 10 PEERERMIKQCKEELRLEEAKLVLLKKLRQSQIQKEATAQK
인간 MBD2 또는 이의 변이체 및 p66α 또는 이의 변이체 서열
3. 단백질 발현 및 정제
- 배양
BL21[DE3](chemically competent cell)을 얼음 위에서 해동하여 각각 50 ul씩 취하여 microcentrifuge tube에 넣고 발현 벡터 1 ul를 가하였다. 이때, 음성대조용 microcentrifuge tube 2개를 준비한 후 한쪽에는 발현벡터를 추가하고 한쪽에는 발현벡터를 추가하지 않고 수행하였다. 얼음 위에 30분, 42℃에서 30초 열 충격, 얼음 위에 2분 두었다. 그런 다음 Luria Bertani 배지 200 ul를 첨가한 후 각각 70 ul씩 취하여 Luria Bertani agar plate에 흡수시켰다. 마지막으로 37℃로 설정한 인큐베이터에서 약 12시간 이상 콜로니를 채취하여 Luria Bertani 배지 5 ml에 넣고 진탕 인큐베이터에서 37℃ 200 rpm으로 밤새 배양하였다. Luria Bertani 배지 400 mL를 취하여 1 L 삼각 플라스크에 넣고 37℃ 및 200 rpm으로 설정된 진탕 배양기에 넣었다. 온도가 조절되면 앰피실린 400 ul를 첨가하고 튜브 배양물을 첨가하고 A600 0.6에서 Isopropyl β-D-1-thiogalactopyranoside로 유도하였다. A600이 측정되어 2에 도달하면 세포를 수집하였다. 모든 흡광도는 Biodrop Duo Micro Volume Spectrophotometer(BIODROP)로 측정되었다.
- 세포 수확/용해
원심분리용으로 표현된 배지의 중량을 정확히 반으로 나누어 Oak Ridge Centrifuge Tubes에 넣고 4000 rcf, 10분, 4℃에서 원심분리한 후 상등액을 버리고 침전된 세포를 -20℃에서 보관하였다. 각 세포 펠릿에 20 mL 용해 완충액을 추가하고 펠릿을 용해하였다. 그 후, 녹인 용액을 50 mL 원뿔형 튜브에 취하고, 라이소자임 400 ul를 가하고 로테이터를 이용하여 4℃에서 30분간 혼합하였다. 잘 혼합된 용액을 얼음 위에서 초음파 처리한 후 7분간 초음파 처리하고 10000 rcf, 20 분, 4℃에서 원심분리하여 침전물을 버리고 상등액을 수집하였다.
- 친화력 정제
용액에 Ni-NTA Agarose 1.5 mL를 첨가한 후 Rotator로 10분간 혼합하였다. 용액에서 단백질만 얻기 위해 용액을 폴리프로필렌 컬럼(5 mL)에 추가하였다. 세척 완충액으로 불순물을 제거하기 위해 비드 위로 약 15 mL를 흘려주었다. 500 ul씩 bead에 elution buffer를 5회 첨가하고 컬럼에서 나오는 용액을 멸균된 micro tube에 넣었다. 정제된 GFP-p66alpha와 mCherry-MBD2는 elution buffer에 들어있기 때문에 buffer를 PBS로 갈아주었다. PD10 컬럼을 PBS로 채운 후 단백질 함유 용액 2.5 mL를 추가하고 PBS 3 mL를 추가하여 단백질의 버퍼를 변경하였다.
- 크기 배제 크로마토그래피(FPLC)
크기 배제 크로마토그래피(SEC)는 PBS로 평형화된 ProteoSEC Dynamic 11/30 3-70 HR SEC 컬럼(Protein Ark, UK)에서 수행되었다. Ni-NTA에서 용출된 시료를 원심 필터로 농축하고 0.22μm 시린지 필터로 여과하여 컬럼에 로딩하였다. 1 ml/min의 유속으로 PBS를 사용하여 AKTAprime plus에서 크로마토그래피를 수행하고 용출된 단백질 분획을 별도로 수집하였다.
4. 단백질 전기영동
단백질 정제의 다양한 단계에서 수집된 샘플을 나트륨 도데실 설페이트(SDS)를 함유하는 12% 불연속 폴리아크릴아미드 겔에서 분석하였다. 단백질 샘플을 순수한 증류수와 혼합하고 SDS-PAGE로 분리하기 전에 98℃에서 7분 동안 배양하였다. 단백질을 시각화하기 위해 젤을 Coomassie Brilliant Blue로 염색했다. Native PAGE는 최대 125V의 전압에서 2시간 동안 12% 폴리아크릴아미드 겔에서 실행되었다. 그 후, UV를 조사하여 단백질의 형광을 관찰하였다.
5. 등온 적정 열량계
ITC 분석은 한국기초과학연구원(오창, 한국)에서 MicroCal Auto-iTC200(Malvern Panalytical)을 사용하여 수행하였다. 결합 친화도는 PBS 완충액(pH 7.5)에서 40 ul C'-GFP 및 200 ㎕ C- mCherry를 사용하여 측정하였다. 적정 실험을 위해 2 ul의 C'-GFP를 25℃에서 150초 간격으로 4초 동안 C- mCherry에 19회 주입하고 MicroCal Origin 7.0 소프트웨어를 사용하여 데이터를 분석하였다. N은 화학량론적 수, KD는 결합 친화도, ΔH, ΔS는 각각 엔탈피 및 결합 엔트로피의 변화이다.
6. 크기 배제 크로마토그래피 (HPLC)
단백질-단백질 상호작용을 분석하기 위해 YL HPLC 시스템(Semi-prep)(YL9100S HPLC)에서 PBS(pH 7.5)로 평형화된 Cytiva superdex 200 increase 10/300 GL 컬럼을 사용했다. 샘플(C'-GFP 및 C- mCherry 또는 C'-GFP/C- mCherry)을 단독으로 또는 등몰 비율로 혼합하여 컬럼에 로딩하였다. 용리액은 280 nm에서 흡광도를 검출하여 모니터링하였다.
7. 형광 공명 에너지 전달 분석(FRET 분석)
야생형 GFP 단독 또는 C'-GFP/C-mCherry, Ala27-Ile8 및 Thr6-Arg29를 동일 몰수로 혼합한 샘플을 인산완충식염수(PBS)로 알맞게 희석하여 총 부피가 200 μl이고 농도는 4 μM이 되도록 하였다. 상기 샘플을 96-웰 플레이트로 옮기고 각 웰의 488 nm 흡광도와 510 nm 발광도(형광)를 Synergy H1 Hybrid Multi-Mode Microplate Reader(BioTek)로 측정하였다. 야생형 GFP 단독 샘플의 단위 흡광도 당 발광도(A), 각 샘플의 단위 흡광도 당 발광도(B)를 산출한 후 아래의 식을 이용해 형광 공명 에너지 전달 효율을 계산하였다.
Figure PCTKR2022014508-appb-img-000001
실험결과
1. 형광 단백질 융합 야생형 코일의 생성 및 특성분석
코일드 코일을 스캐폴드로 사용하여 비천연 이종이량체 단백질 복합체를 만들기 위하여, 서로 상보적으로 자가조립하는 p66alpha와 MBD2의 코일드 코일 영역인 138-178(coil C') 및 360-393(coil C) 아미노산을 사용하려 하였다. 그런 다음 녹색 형광 단백질(GFP)과 적색 형광 단백질 중 하나인 mCherry를 사용하여 코일의 발현과 복합체 형성을 시각적으로 추적하였다. GFP 및 mCherry는 각각 코일 C' 및 코일 C의 C-말단에 융합되었다. 6-히스티딘 태그(6xHis)를 각 형광 단백질의 C-말단에 추가로 융합하여 니켈-니트릴로트리아세트산 아가로스 수지를 사용하여 단백질을 정제하였다. Alphafold2를 이용하여 코일 C'-GFP-6xHis 융합 단백질(이하 C'-GFP라 함)과 코일 C-mCherry-6xHis 융합 단백질(이하 C-mCherry라고 함)의 복잡한 구조를 예측하였다(도 1a). pET-C'-GFP 및 pET-C-mCherry는 E. coli BL21 시스템에서 발현되었고 친화성 크로마토그래피에 이어 FPLC로 정제되었다. 정제 결과, 배양액 1리터당 약 4 mg 이상의 수율로 고순도 단백질을 얻었다. 정제 후 채취한 단백질 시료를 SDS-PAGE로 분리하여 Coomassie Brilliant Blue로 염색한 후 탈색하여 가시화하였다 (도 1b). 단백질의 예상 분자량은 C'-GFP 및 C- mCherry에 대해 각각 33.64 kDa 및 32.65 kDa였으며, SDS-PAGE는 결과와 유사한 35 kDa 마커 근처의 분자량 추정치를 제공했다.
정제 후, 코일 융합 형광 단백질이 올바르게 접혔는지 확인하기 위해 Native PAGE를 수행하였다. Native PAGE의 결과, C'-GFP와 C- mCherry 가 단독으로 존재할 경우 녹색 형광과 적색 형광을 나타내는 것을 확인하였다(도 2a). 그러나 C'-GFP와 C- mCherry를 1:1 비율로 혼합했을 때 녹색 형광과 적색 형광이 합쳐져 노란색 형광이 관찰되었다. 이것은 각 형광 단백질이 올바르게 접혀 있고 융합된 코일이 상보적으로 자가 조립됨을 나타낸다. 등온 적정 열량계(ITC)를 사용하여 C'-GFP와 C-mCherry 사이의 열역학을 조사하여 결합 매개변수를 결정하였다. C'-GFP와 C-mCherry 사이의 측정된 매개변수는 N = 0.7, KD = 10.7 nM, ΔH = -2.6 kcal/mol, ΔS = -52.4 cal/mol/deg이었으며, 두 분자 사이의 반응은 자발적으로 구동되었으며 높은 결합 친화도를 나타냈다(도 2b). 또한 C'-GFP와 C-mCherry는 0.7:1의 비율로 반응하여 이론상 1:1의 비율보다 낮았다. 이것은 코일 사이의 동종이량체 형성 또는 실제 농도와 등온선을 맞추는 데 사용된 농도의 차이로 인한 오류일 수 있다. 요약하면, 우리는 정확하게 접힐 수 있고 높은 친화성을 갖고 결합하여 이종이량체 복합체를 형성할 수 있는 C'-GFP 및 C-mCherry를 발현하였다.
2. 코일형 시스테인 돌연변이체의 설계 및 안정성 평가
분자내 또는 분자간 시스테인(Cys) 잔기의 두 티올 그룹 사이에 형성된 이황화 다리는 올바른 단백질 폴딩 및 구조적 안정성의 중요한 구성 요소 역할을 할 수 있다. 자가 결합 시, 해리에 대한 향상된 내성을 제공하기 위해 우리는 이황화 결합 코일드 코일 복합체를 생성하고자 하였다. 이를 위해 우리는 기존의 코일드 코일 상호작용의 억제를 최소화하면서 이황화 결합을 형성할 수 있는 한 쌍의 잔기의 위치를 찾았다. C'_Ile8-C_Ala27(I8C-A27C)(서열번호 7 + 서열번호 2) 및 C'_Arg29-C_Thr6(R29C-T6C)(서열번호 8 + 서열번호 3)은 양호한 정전기 상호작용을 유지하며 이황화 결합이 형성되는 최적의 가교 부위라고 판단되었다. 돌연변이에 의한 코일드 코일 상호작용의 억제 정도를 조사하기 위해, 양호한 정전기 상호작용 잔기 쌍 C'_Glu18-C_Arg16(E18C-R16C)(서열번호 9 + 서열번호 4) 및 C'_Leu11-C_Val20(L11C-V20C)(서열번호 10 + 서열번호 5)를 선택하여 비교하였다. DTT 및 돌연변이 유무에 따른 야생형 GFP-C'와 야생형 mCherry-C 의 코일드 코일 상호작용(서열번호 6 + 서열번호 1)(GFP-C' + mCherry-C)을 Native PAGE로 분석한 결과 C'_Ile8-C_Ala27(I8C-A27C)(서열번호 7 + 서열번호 2)(Ala27-Ile8) 및 C'_Arg29-C_Thr6(R29C-T6C)(서열번호 8 + 서열번호 3)(Thr6-Arg29)는 C'_Glu18-C_Arg16(E18C-R16C)(서열번호 9 + 서열번호 4)(Coiled coil_F1) 및 C'_Leu11-C_Val20(L11C-V20C)(서열번호 10 + 서열번호 5) (Coiled coil_F2)와 비교하여 보다 안정적인 복합체를 형성하는 것으로 나타났다(도 3a). 또한, 상대적인 발현량을 비교한 결과 Ala27-Ile8 및 Thr6-Arg29가 Coiled coil_F1 및 Coiled coil_F2 보다 2배 이상 높은 것을 확인할 수 있었다(도 3b). 또한, Ala27-Ile8 및 Thr6-Arg29의 안정적 코일드 코일 상호작용에 기인하는 GFP, mCherry 분자 사이의 형광 공명 에너지 전달 효율을 정량 분석(FRET 분석)한 결과 야생형 (GFP-C' + mCherry-C) 보다 2배 이상의 높은 효율을 확인할 수 있었다(도 3c).
3. 트레일 삼합체-코일 및 트레일 육합체 제조
3.1. 세포발현 및 정제
두 종의 단백질(트레일 삼합체-MBD2(scTRAIL-C), 트레일 삼합체-p66α (scTRAIL-C'))을 형질전환된 대장균의 배양을 통해 각각 발현하고 친화성 크로마토그래피를 이용해 정제하였다. 보다 구체적으로 트레일 삼합체-MBD 및 트레일 삼합체-p66α는 다음의 고정을 통해 발현 및 정제하였다:
형질전환 된 BL21 (DE3) 대장균 세포를 암피실린 농도를 0.1 mg/mL로 조절한 고체 LB배지에서 12시간 배양하였다. 이후 벡터의 삽입이 확인된 균주를 2xYT 배지 (암피실린 0.1 mg/mL, 이하 동일)에 접종하여 37℃에서 12시간 배양시킨 후 다시 2xYT 배지에 1:100으로 희석시켜 접종하고 200 rpm 조건으로 교반하며 30℃에서 배양하였다. 흡광도가 600 nm에서 0.4-0.5가 되었을 때 단백질 발현 유도를 위해 IPTG를 최종 농도 1.0 mM이 되도록 첨가한 후 온도를 16-18℃로 낮춰주었다. 20-40시간 배양 후 4000 g 조건으로 10분 동안 원심분리하여 세포 펠렛으로 수거하여 -20℃에 냉동보관하였다.
세포에서 단백질을 정제하기 위해 lysis buffer (pH8.0, 50 mM sodium phosphate, 0.3 M NaCl, 그리고 10 mM imidazole) 40 mL를 펠렛에 첨가하여 얼어있던 세포를 재부유 시켜주었다. Lysozyme을 최종 농도 1 mg/mL로 첨가한 후 4℃에서 30분 정도 회전시키며 혼합 과정을 진행하였다. 그 후 8분 동안 10초 간격으로 초음파 분해를 진행하였고 다시 10,000 g 조건에서 30분 동안 원심 분리를 진행하여 단백질과 세포 잔유물을 분리하였다. 단백질이 포함된 상등액을 따로 옮겨 Ni-NTA agarose beads를 1.5 mL 첨가한 후 4℃에서 30분간 회전시키며 혼합하였다. Gravity-flow 컬럼을 고정시킨 후 Ni-NTA를 혼합시킨 상등액을 컬럼으로 내려주며 beads와 flow through를 분리하였다. Flow through는 제거한 후 beads 세척을 위해 wash buffer (pH 8.0, 50 mM sodium phosphate, 0.3 M NaCl, 그리고 20 mM imidazole)를 충분히 흘려 내려주며 flow through로 흘러나오는 용액의 흡광도가 280nm에서 0.00이 될 때까지 beads에 접착된 불순물을 제거하였다. Beads와 결합된 단백질을 따로 분리하기 위해 elution buffer (50 mM sodium phosphate (pH 8.0), 0.3 M NaCl, 그리고 250 mM imidazole)를 500 uL씩 흘려주며 flow through 를 micro tube에 분주하였다. Biodrop을 이용하여 280 nm에서 분주 된 용액의 농도를 각각 측정하고 4℃에서 냉장보관하였다.
3.2. 특성 평가
Binding assay (MicroScale Thermophoresis, MST)를 이용하여 1) 트레일 삼합체-C (scTRAIL-C)와 트레일 삼합체-C' (scTRAIL-C')의 친화도, 2) 트레일 삼합체-C 또는 트레일 삼합체-C'과 사멸수용체 (DR)의 친화도 및 3) 트레일 육합체 (scTRAIL-C+scTRAIL-C')와 사멸수용체 (death receptor, DR)의 친화도를 측정하였다. DR은 트레일의 동족수용체 (Cognate receptor)이다.
보다 구체적으로 하기의 방법에 따라 측정하였다:
분석 전 샘플 전처리를 위해 사멸수용체 (Biolegend)와 DMSO에 용해된 Flamma® 648 Sulfo-NHS ester를 1:5의 molar ratio로 혼합한 후 실온에서 1시간 동안 반응시켰다. Zeba쪠 Spin Desalting 컬럼 (40K MWCO, 0.5 mL)은 샘플을 주입하기 전 1500 g 조건으로 1분 원심 분리를 통해 보존 용액을 제거하고 탄산나트륨 150 mM 용액 450 uL를 컬럼에 채운 후 다시 1500 g 조건으로 1분 원심 분리를 진행하였다. 이후 반응시킨 DR 혼합물을 100-150 uL 주입한 후 1500 g 조건으로 2분 원심 분리를 진행하여 샘플에 미량 포함된 DMSO를 제거하고 탄산나트륨 용액으로 갈아줌과 동시에 non-labeled 와 labeled DR을 분리하였다.
Monolith NT.115 (Germany) MST 기기를 이용해 샘플을 분석하기 전 labeled DR을 이용해 측정 세기를 조절하였다. 4개의 capillary에 동일한 농도의 labeled DR을 채워준 후 측정하며 excitation power를 조절하여 fluorescence intensity값이 800-1000사이에 나타나는 것을 확인하였다.
Ligand로 사용될 재조합 단백질은 각각 단일 분자 트레일 (MonoTRAIL), 트레일 삼합체-C와 트레일 삼합체-C, 또는 트레일 육합체로 진행하였다. Receptor-ligand 혼합 방법은 다음과 같다: 먼저 receptor 단백질인 사멸수용체를 첫 번째 rack을 제외한 15개의 rack에 10 uL씩 분주한다. 다음으로 ligand로 작용하는 트레일 삼합체-C를 첫 번째 rack에 20 uL를 담고 차례로 10 uL를 처음 rack에서 뽑아 두 번째 rack에 희석하고 다시 10 uL를 뽑아 세 번째 rack에 희석하는 방식으로 동일하게 16번 진행한다. 결과적으로 216배 희석된 샘플이 최종 16번째 샘플이 된다. 16개의 서로 다른 capillary에 서로 다른 농도의 샘플을 주입한 후 detection장치에 고정시켜주고 측정을 시작한다. 이때 excitation power값은 초기 설정 값의 2배 증가한 값으로 진행한다. 이후 트레일 삼합체- C', 육합체 트레일 모두 같은 방식으로 진행한다.
실험결과, 트레일 육합체와 사멸수용체의 친화도(163 nM)는 트레일 삼합체-C 또는 트레일 삼합체- C'과 사멸수용체의 친화도(각각 337 nM, 787 nM)에 비해 약 2-5배 높게 형성되었음을 확인할 수 있었다(도 4).
3.3. In vitro cell assay
양성 대조군 (R&D TRAIL, R&D systems, Minneapolis, MN, USA), 트레일 삼합체-C (I), 트레일 삼합체-C' (II), 트레일 육합체 (I+II) 로 각각 4시간 동안 처리한 교모세포종 세포주 U87-luc 세포 (PerkinElmer, Akron, Ohio, USA)를 유세포 분석기 (FACS)를 이용하여 관찰하여 보았다.
상기 분석결과, 5% 미만의 사멸률을 나타낸 트레일 삼합체-C (I) 또는 트레일 삼합체-C'(II) 시험군과는 대조적으로 트레일 육합체 시험군(I+II)은 약 30%의 사멸률을 보였으며, 이는 양성 대조군(R&D TRAIL)의 사멸률인 8%보다도 약 4배 높은 수치임이 확인되었다(도 5a 및 b).
이상, 본 발명의 실시예들에 대하여 설명하였으나, 해당 기술 분야에서 통상의 지식을 가진 자라면 특허청구범위에 기재된 본 발명의 사상으로부터 벗어나지 않는 범위 내에서, 구성 요소의 부가, 변경, 삭제 또는 추가 등에 의해 본 발명을 다양하게 수정 및 변경시킬 수 있을 것이며, 이 또한 본 발명의 권리범위 내에 포함된다고 할 것이다.

Claims (15)

  1. 하기의 구성을 포함하는 융합 단백질:
    (i) 서열번호 1의 아미노산 서열, 또는 상기 서열번호 1에서 6번째, 27번째 및 이들의 조합으로 구성된 군으로부터 선택되는 아미노산이 시스테인으로 변이된 아미노산 서열을 포함하는 폴리펩타이드 1;
    (ii) 서열번호 6의 아미노산 서열, 또는 상기 서열번호 6에서 8번째, 29번째 및 이들의 조합으로 구성된 군으로부터 선택되는 아미노산이 시스테인으로 변이된 아미노산 서열을 포함하는 폴리펩타이드 2; 및
    (iii) 상기 폴리펩타이드 1 및 2의 N-말단 및 C-말단으로 구성된 군으로부터 선택되는 1 이상의 부위에 결합된 약물 모이어티; 로서,
    상기 폴리펩타이드 1 및 2는 자가결합으로 결합되는 것을 특징으로 하는, 융합 단백질.
  2. 제 1 항에 있어서,
    상기 약물 모이어티는 항체 또는 이의 항원결합 단편, 또는 단백질인 것을 특징으로 하는 융합 단백질.
  3. 제 2 항에 있어서,
    상기 항체의 항원결합 단편은 scFv인 것을 특징으로 하는 융합 단백질.
  4. 제 2 항에 있어서,
    상기 단백질은 알부민 결합 펩타이드(ABP; Albumin binding peptide) 또는 트레일(TRAIL; Tumor necrosis factor-related apoptosis-inducing ligand)인 것을 특징으로 하는 융합 단백질.
  5. 제 4 항에 있어서,
    상기 단백질은 트레일 삼합체(timer)인 것을 특징으로 하는 융합 단백질.
  6. 제 1 항에 있어서,
    상기 약물 모이어티는 상기 폴리펩타이드 1 또는 2의 N-말단 또는 C-말단에 링커로 결합된 것을 특징으로 하는 융합 단백질.
  7. 제 1 항의 융합 단백질을 코딩하는 핵산 분자.
  8. 제 7 항의 핵산 분자를 포함하는 벡터.
  9. 하기의 구성을 포함하는 발현 구축물:
    (i) 서열번호 1의 아미노산 서열, 또는 상기 서열번호 1에서 6번째, 27번째 및 이들의 조합으로 구성된 군으로부터 선택되는 아미노산이 시스테인으로 변이된 아미노산 서열을 포함하는 폴리펩타이드 1을 코딩하는 핵산분자 1; 및
    (ii) 서열번호 6의 아미노산 서열, 또는 상기 서열번호 6에서 8번째, 29번째 및 이들의 조합으로 구성된 군으로부터 선택되는 아미노산이 시스테인으로 변이된 아미노산 서열을 포함하는 폴리펩타이드 2를 코딩하는 핵산분자 2;를 포함하는 발현 구축물로서,
    상기 핵산분자 1 및 2는 동일한 벡터 또는 상이한 벡터에서 발현되어 폴리펩타이드 1 및 2가 자가결합으로 결합할 수 있는 것을 특징으로 하는, 발현 구축물.
  10. 제 8 항의 벡터 또는 제 9 항의 발현 구축물을 포함하는 숙주세포.
  11. 하기의 구성을 포함하는 조성물:
    i) 자가결합 도메인 1로써 서열번호 2 또는 3의 아미노산 서열을 포함하는 폴리펩타이드 1 또는 상기 폴리펩타이드 1을 코딩하는 핵산 분자 1; 및
    ii) 자가결합 도메인 2로써 서열번호 7 또는 8의 아미노산 서열을 포함하는 폴리펩타이드 2 또는 상기 폴리펩타이드 2를 코딩하는 핵산 분자 2.
  12. 제 1 항의 융합 단백질, 제 7 항의 핵산 분자, 제 8 항의 벡터, 제 9 항의 발현 구축물, 제 10 항의 숙주세포 또는 제 11 항의 조성물을 포함하는 암의 예방 또는 치료용 약제학적 조성물.
  13. 제 1 항의 융합 단백질, 제 7 항의 핵산 분자, 제 8 항의 벡터, 제 9 항의 발현 구축물, 제 10 항의 숙주세포 또는 제 11 항의 조성물을 이를 필요로 하는 대상에게 투여하는 단계를 포함하는 암의 치료방법.
  14. 하기의 구성을 포함하는 키트:
    (i) 서열번호 1에서 6번째, 27번째 및 이들의 조합으로 구성된 군으로부터 선택되는 아미노산이 시스테인으로 변이된 아미노산 서열을 포함하는 폴리펩타이드 1 또는 이를 코딩하는 핵산분자 1;
    (ii) 서열번호 6에서 8번째, 29번째 및 이들의 조합으로 구성된 군으로부터 선택되는 아미노산이 시스테인으로 변이된 아미노산 서열을 포함하는 폴리펩타이드 2 또는 이를 코딩하는 핵산분자 2; 및
    (iii) 상기 폴리펩타이드 1 및 2의 N-말단 및 C-말단으로 구성된 군으로부터 선택되는 1 이상의 부위에 결합된 약물 모이어티 또는 상기 핵산분자 1 및 2의 5' 말단 또는 3' 말단으로 구성된 군으로부터 선택되는 위치에 결합된 약물 모이어티 코딩 뉴클레오타이드 서열(nucleic acid encoding a drug moiety).
  15. 제 14 항에 있어서,
    상기 약물 모이어티는 트레일(TRAIL)인 것을 특징으로 하는 키트.
PCT/KR2022/014508 2021-09-29 2022-09-28 코일드 코일 융합 단백질 WO2023055045A1 (ko)

Applications Claiming Priority (6)

Application Number Priority Date Filing Date Title
KR20210128551 2021-09-29
KR10-2021-0128551 2021-09-29
KR10-2022-0043553 2022-04-07
KR20220043553 2022-04-07
KR10-2022-0121834 2022-09-26
KR1020220121834A KR20230046999A (ko) 2021-09-29 2022-09-26 코일드 코일 융합 단백질

Publications (1)

Publication Number Publication Date
WO2023055045A1 true WO2023055045A1 (ko) 2023-04-06

Family

ID=85783169

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2022/014508 WO2023055045A1 (ko) 2021-09-29 2022-09-28 코일드 코일 융합 단백질

Country Status (1)

Country Link
WO (1) WO2023055045A1 (ko)

Citations (19)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5709874A (en) 1993-04-14 1998-01-20 Emory University Device for local drug delivery and methods for using the same
US5759542A (en) 1994-08-05 1998-06-02 New England Deaconess Hospital Corporation Compositions and methods for the delivery of drugs by platelets for the treatment of cardiovascular and other diseases
US5840674A (en) 1990-11-01 1998-11-24 Oregon Health Sciences University Covalent microparticle-drug conjugates for biological targeting
US5900252A (en) 1990-04-17 1999-05-04 Eurand International S.P.A. Method for targeted and controlled release of drugs in the intestinal tract and more particularly in the colon
US5972366A (en) 1994-11-28 1999-10-26 The Unites States Of America As Represented By The Secretary Of The Army Drug releasing surgical implant or dressing material
US5985307A (en) 1993-04-14 1999-11-16 Emory University Device and method for non-occlusive localized drug delivery
US6004534A (en) 1993-07-23 1999-12-21 Massachusetts Institute Of Technology Targeted polymerized liposomes for improved drug delivery
US6039975A (en) 1995-10-17 2000-03-21 Hoffman-La Roche Inc. Colon targeted delivery system
US6048736A (en) 1998-04-29 2000-04-11 Kosak; Kenneth M. Cyclodextrin polymers for carrying and releasing drugs
US6060082A (en) 1997-04-18 2000-05-09 Massachusetts Institute Of Technology Polymerized liposomes targeted to M cells and useful for oral or mucosal drug delivery
US6071495A (en) 1989-12-22 2000-06-06 Imarx Pharmaceutical Corp. Targeted gas and gaseous precursor-filled liposomes
US6120751A (en) 1997-03-21 2000-09-19 Imarx Pharmaceutical Corp. Charged lipids and uses for the same
US6131570A (en) 1998-06-30 2000-10-17 Aradigm Corporation Temperature controlling device for aerosol drug delivery
US6139865A (en) 1996-10-01 2000-10-31 Eurand America, Inc. Taste-masked microcapsule compositions and methods of manufacture
US6253872B1 (en) 1996-05-29 2001-07-03 Gmundner Fertigteile Gesellschaft M.B.H & Co., Kg Track soundproofing arrangement
US6271359B1 (en) 1999-04-14 2001-08-07 Musc Foundation For Research Development Tissue-specific and pathogen-specific toxic agents and ribozymes
US6274552B1 (en) 1993-03-18 2001-08-14 Cytimmune Sciences, Inc. Composition and method for delivery of biologically-active factors
US6316652B1 (en) 1995-06-06 2001-11-13 Kosta Steliou Drug mitochondrial targeting agents
US10610514B2 (en) * 2016-11-24 2020-04-07 Industry-University Cooperation Foundation Hanyang University Composition comprising compound inhibiting interactions of MBD2 and P66α for anti-metastasis and prevention and treatment of cancer disease

Patent Citations (19)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6071495A (en) 1989-12-22 2000-06-06 Imarx Pharmaceutical Corp. Targeted gas and gaseous precursor-filled liposomes
US5900252A (en) 1990-04-17 1999-05-04 Eurand International S.P.A. Method for targeted and controlled release of drugs in the intestinal tract and more particularly in the colon
US5840674A (en) 1990-11-01 1998-11-24 Oregon Health Sciences University Covalent microparticle-drug conjugates for biological targeting
US6274552B1 (en) 1993-03-18 2001-08-14 Cytimmune Sciences, Inc. Composition and method for delivery of biologically-active factors
US5709874A (en) 1993-04-14 1998-01-20 Emory University Device for local drug delivery and methods for using the same
US5985307A (en) 1993-04-14 1999-11-16 Emory University Device and method for non-occlusive localized drug delivery
US6004534A (en) 1993-07-23 1999-12-21 Massachusetts Institute Of Technology Targeted polymerized liposomes for improved drug delivery
US5759542A (en) 1994-08-05 1998-06-02 New England Deaconess Hospital Corporation Compositions and methods for the delivery of drugs by platelets for the treatment of cardiovascular and other diseases
US5972366A (en) 1994-11-28 1999-10-26 The Unites States Of America As Represented By The Secretary Of The Army Drug releasing surgical implant or dressing material
US6316652B1 (en) 1995-06-06 2001-11-13 Kosta Steliou Drug mitochondrial targeting agents
US6039975A (en) 1995-10-17 2000-03-21 Hoffman-La Roche Inc. Colon targeted delivery system
US6253872B1 (en) 1996-05-29 2001-07-03 Gmundner Fertigteile Gesellschaft M.B.H & Co., Kg Track soundproofing arrangement
US6139865A (en) 1996-10-01 2000-10-31 Eurand America, Inc. Taste-masked microcapsule compositions and methods of manufacture
US6120751A (en) 1997-03-21 2000-09-19 Imarx Pharmaceutical Corp. Charged lipids and uses for the same
US6060082A (en) 1997-04-18 2000-05-09 Massachusetts Institute Of Technology Polymerized liposomes targeted to M cells and useful for oral or mucosal drug delivery
US6048736A (en) 1998-04-29 2000-04-11 Kosak; Kenneth M. Cyclodextrin polymers for carrying and releasing drugs
US6131570A (en) 1998-06-30 2000-10-17 Aradigm Corporation Temperature controlling device for aerosol drug delivery
US6271359B1 (en) 1999-04-14 2001-08-07 Musc Foundation For Research Development Tissue-specific and pathogen-specific toxic agents and ribozymes
US10610514B2 (en) * 2016-11-24 2020-04-07 Industry-University Cooperation Foundation Hanyang University Composition comprising compound inhibiting interactions of MBD2 and P66α for anti-metastasis and prevention and treatment of cancer disease

Non-Patent Citations (10)

* Cited by examiner, † Cited by third party
Title
"Remington's Pharmaceutical Sciences", 1990, MACK PUBLISHING CO.
AUSUBEL ET AL.: "Current Protocols in Molecular Biology", 1994, JOHN, WILEY & SONS, INC.
MANIATIS ET AL.: "Molecular Cloning, A Laboratory Manual", 1988, COLD SPRING HARBOR PRESS
MCFARLANE, A.A. ; ORRISS, G.L. ; STETEFELD, J.: "The use of coiled-coil proteins in drug delivery systems", EUROPEAN JOURNAL OF PHARMACOLOGY, vol. 625, no. 1-3, 25 December 2009 (2009-12-25), NL , pages 101 - 107, XP026762252, ISSN: 0014-2999, DOI: 10.1016/j.ejphar.2009.05.034 *
MIN YOUNG KIM, INSUNG NA, JI SOOK KIM, SEUNG HAN SON, SUNGWOO CHOI, SEOL EUI LEE, JI-HUN KIM, KISEOK JANG, GIL ALTEROVITZ, YU CHEN: "Rational discovery of antimetastatic agents targeting the intrinsically disordered region of MBD2", SCIENCE ADVANCES, vol. 5, no. 11, 1 November 2019 (2019-11-01), pages eaav9810 - 20, XP055714849, DOI: 10.1126/sciadv.aav9810 *
N. M. WALAVALKAR, N. GORDON, D. C. WILLIAMS: "Unique Features of the Anti-parallel, Heterodimeric Coiled-coil Interaction between Methyl-cytosine Binding Domain 2 (MBD2) Homologues and GATA Zinc Finger Domain Containing 2A (GATAD2A/p66 )", JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 288, no. 5, 1 February 2013 (2013-02-01), US , pages 3419 - 3427, XP055236750, ISSN: 0021-9258, DOI: 10.1074/jbc.M112.431346 *
SCHEIT: "Nucleotide Analogs", 1980, JOHN WILEY
UHLMANPEYMAN, CHEMICAL REVIEWS, vol. 90, 1990, pages 543 - 584
UTTERSTRÖM JOHANNA, NAEIMIPOUR SAJJAD, SELEGÅRD ROBERT, AILI DANIEL: "Coiled coil-based therapeutics and drug delivery systems", ADVANCED DRUG DELIVERY REVIEWS, vol. 170, 1 March 2021 (2021-03-01), Amsterdam , NL , pages 26 - 43, XP055911868, ISSN: 0169-409X, DOI: 10.1016/j.addr.2020.12.012 *
ZORZI ET AL., MEDCHEMCOMM., vol. 10, no. 7, 1 July 2019 (2019-07-01), pages 1068 - 1081

Similar Documents

Publication Publication Date Title
KR102155875B1 (ko) 혈관신생 억제용 융합 단백질
EP2994487B1 (en) Trimeric antigen binding molecules
US20160031985A1 (en) Charge-engineered antibodies or compositions of penetration-enhanced targeting proteins and methods of use
WO2014081202A1 (ko) Vegfr-2와 dll4를 표적으로 하는 이중표적항체 및 이를 포함하는 약학적 조성물
KR102342934B1 (ko) 항체-약물 접합체 및 면역독소
WO2022030730A1 (ko) 메소텔린에 특이적으로 결합하는 항-메소텔린 키메릭 항원 수용체
WO2012169822A2 (ko) 암세포 증식 억제와 혈관신생 억제를 위한 융합 단백질 및 이를 포함한 항암 조성물
WO2016089126A1 (ko) 뉴로필린 1(Neuropilin 1)에 대한 항체 및 이의 용도
JP2016027801A (ja) 改良された抗血清アルブミン結合変異体
WO2023055045A1 (ko) 코일드 코일 융합 단백질
US20220354960A1 (en) Immune checkpoint blocking bispecific molecules
WO2017074013A1 (ko) 인간 및 마우스 sema3a에 교차결합하는 항체 및 그의 용도
WO2020108636A1 (zh) 全人抗gitr抗体及其制备方法
WO2022235140A1 (ko) 단일사슬항체조각 및 페리틴의 융합단백질을 포함하는 나노입자 및 이의 용도
AU2021324738B2 (en) Fusion protein comprising IL-12 and anti-fap antibody, and use thereof
WO2016084993A1 (ko) 신규 EGFRvIII 항체 및 이를 포함하는 조성물
US20220363778A1 (en) Targeted delivery of tumor matrix modifying enzymes
KR20230046999A (ko) 코일드 코일 융합 단백질
WO2024039238A1 (ko) 단일쇄 가변 단편의 변이 단백질
WO2022250450A1 (ko) 항 메소텔린 scFv를 포함하는 키메릭 항원 수용체 및 이의 용도
WO2017209553A2 (ko) 환자 유래 세포를 이용한 항체 스크리닝 방법
KR20210021992A (ko) 망막 색소 변성증 치료용 펩티드
AU2022316521B2 (en) A fusion protein comprising an antigen binding domain and a cytokine trimer domain
WO2023158027A1 (en) A fusion protein comprising an antigen binding domain and a cytokine trimer domain
WO2023167560A1 (ko) Vegf-grab 및 pd-1 또는 pd-l1 길항제를 포함하는 병용 투여용 조성물

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22876817

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 18570711

Country of ref document: US

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2022876817

Country of ref document: EP

Effective date: 20240429