WO2022250450A1 - 항 메소텔린 scFv를 포함하는 키메릭 항원 수용체 및 이의 용도 - Google Patents
항 메소텔린 scFv를 포함하는 키메릭 항원 수용체 및 이의 용도 Download PDFInfo
- Publication number
- WO2022250450A1 WO2022250450A1 PCT/KR2022/007425 KR2022007425W WO2022250450A1 WO 2022250450 A1 WO2022250450 A1 WO 2022250450A1 KR 2022007425 W KR2022007425 W KR 2022007425W WO 2022250450 A1 WO2022250450 A1 WO 2022250450A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- amino acid
- seq
- cells
- acid sequence
- antigen
- Prior art date
Links
- 108010019670 Chimeric Antigen Receptors Proteins 0.000 title claims abstract description 36
- 206010028980 Neoplasm Diseases 0.000 claims abstract description 65
- 201000011510 cancer Diseases 0.000 claims abstract description 24
- 210000004027 cell Anatomy 0.000 claims description 140
- 239000000427 antigen Substances 0.000 claims description 72
- 102000036639 antigens Human genes 0.000 claims description 72
- 108091007433 antigens Proteins 0.000 claims description 72
- 230000027455 binding Effects 0.000 claims description 60
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 50
- 239000012634 fragment Substances 0.000 claims description 36
- 239000013598 vector Substances 0.000 claims description 32
- 238000000034 method Methods 0.000 claims description 29
- 210000001744 T-lymphocyte Anatomy 0.000 claims description 20
- 150000007523 nucleic acids Chemical class 0.000 claims description 16
- 239000008194 pharmaceutical composition Substances 0.000 claims description 16
- 108020004707 nucleic acids Proteins 0.000 claims description 15
- 102000039446 nucleic acids Human genes 0.000 claims description 15
- 230000004068 intracellular signaling Effects 0.000 claims description 14
- 108091033319 polynucleotide Proteins 0.000 claims description 8
- 102000040430 polynucleotide Human genes 0.000 claims description 8
- 239000002157 polynucleotide Substances 0.000 claims description 8
- 238000012258 culturing Methods 0.000 claims description 7
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims description 4
- 108010083359 Antigen Receptors Proteins 0.000 claims description 4
- 102000006306 Antigen Receptors Human genes 0.000 claims description 4
- 238000004519 manufacturing process Methods 0.000 claims description 4
- 210000000581 natural killer T-cell Anatomy 0.000 claims description 2
- 210000000822 natural killer cell Anatomy 0.000 claims description 2
- PHWXUGHIIBDVKD-UHFFFAOYSA-N sitaxentan Chemical compound CC1=NOC(NS(=O)(=O)C2=C(SC=C2)C(=O)CC=2C(=CC=3OCOC=3C=2)C)=C1Cl PHWXUGHIIBDVKD-UHFFFAOYSA-N 0.000 claims 2
- 229960002578 sitaxentan Drugs 0.000 claims 2
- 210000004475 gamma-delta t lymphocyte Anatomy 0.000 claims 1
- 102000003735 Mesothelin Human genes 0.000 abstract description 46
- 108090000015 Mesothelin Proteins 0.000 abstract description 46
- 230000009870 specific binding Effects 0.000 abstract description 5
- 230000002265 prevention Effects 0.000 abstract description 2
- 230000014509 gene expression Effects 0.000 description 26
- 206010033128 Ovarian cancer Diseases 0.000 description 23
- 206010061535 Ovarian neoplasm Diseases 0.000 description 23
- 108090000623 proteins and genes Proteins 0.000 description 22
- 238000004091 panning Methods 0.000 description 18
- 102000004169 proteins and genes Human genes 0.000 description 16
- 238000010586 diagram Methods 0.000 description 15
- 235000018102 proteins Nutrition 0.000 description 14
- 108020004414 DNA Proteins 0.000 description 12
- 238000002965 ELISA Methods 0.000 description 12
- 235000001014 amino acid Nutrition 0.000 description 12
- 101000946843 Homo sapiens T-cell surface glycoprotein CD8 alpha chain Proteins 0.000 description 11
- 102100034922 T-cell surface glycoprotein CD8 alpha chain Human genes 0.000 description 11
- 239000013612 plasmid Substances 0.000 description 11
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 10
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 10
- 150000001413 amino acids Chemical class 0.000 description 10
- 229940024606 amino acid Drugs 0.000 description 9
- 230000008859 change Effects 0.000 description 9
- 239000007787 solid Substances 0.000 description 9
- 238000006467 substitution reaction Methods 0.000 description 9
- 238000012360 testing method Methods 0.000 description 9
- 241001465754 Metazoa Species 0.000 description 8
- 230000000694 effects Effects 0.000 description 8
- 239000002773 nucleotide Substances 0.000 description 8
- 125000003729 nucleotide group Chemical group 0.000 description 8
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 7
- 239000012981 Hank's balanced salt solution Substances 0.000 description 7
- 239000001963 growth medium Substances 0.000 description 7
- 239000002609 medium Substances 0.000 description 7
- 238000010172 mouse model Methods 0.000 description 7
- 108090000765 processed proteins & peptides Proteins 0.000 description 7
- 241000588724 Escherichia coli Species 0.000 description 6
- 241000700605 Viruses Species 0.000 description 6
- 238000002835 absorbance Methods 0.000 description 6
- 101150063416 add gene Proteins 0.000 description 6
- 238000010171 animal model Methods 0.000 description 6
- 238000012790 confirmation Methods 0.000 description 6
- 230000000139 costimulatory effect Effects 0.000 description 6
- 239000000203 mixture Substances 0.000 description 6
- 238000012986 modification Methods 0.000 description 6
- 230000004048 modification Effects 0.000 description 6
- 238000002823 phage display Methods 0.000 description 6
- 229920001184 polypeptide Polymers 0.000 description 6
- 102000004196 processed proteins & peptides Human genes 0.000 description 6
- 238000000746 purification Methods 0.000 description 6
- 239000000243 solution Substances 0.000 description 6
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 5
- 239000004480 active ingredient Substances 0.000 description 5
- 238000004587 chromatography analysis Methods 0.000 description 5
- 230000003834 intracellular effect Effects 0.000 description 5
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 5
- 201000002528 pancreatic cancer Diseases 0.000 description 5
- 208000008443 pancreatic carcinoma Diseases 0.000 description 5
- 230000001105 regulatory effect Effects 0.000 description 5
- 238000012216 screening Methods 0.000 description 5
- 108020004705 Codon Proteins 0.000 description 4
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 description 4
- 101000851370 Homo sapiens Tumor necrosis factor receptor superfamily member 9 Proteins 0.000 description 4
- 108091028043 Nucleic acid sequence Proteins 0.000 description 4
- 108010076504 Protein Sorting Signals Proteins 0.000 description 4
- 239000012980 RPMI-1640 medium Substances 0.000 description 4
- 102100036011 T-cell surface glycoprotein CD4 Human genes 0.000 description 4
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 description 4
- 208000003721 Triple Negative Breast Neoplasms Diseases 0.000 description 4
- 102100036856 Tumor necrosis factor receptor superfamily member 9 Human genes 0.000 description 4
- 239000002585 base Substances 0.000 description 4
- 230000037396 body weight Effects 0.000 description 4
- 210000000170 cell membrane Anatomy 0.000 description 4
- 238000006243 chemical reaction Methods 0.000 description 4
- 201000010099 disease Diseases 0.000 description 4
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 4
- 239000013604 expression vector Substances 0.000 description 4
- 238000000684 flow cytometry Methods 0.000 description 4
- 238000009472 formulation Methods 0.000 description 4
- 238000011532 immunohistochemical staining Methods 0.000 description 4
- 239000013642 negative control Substances 0.000 description 4
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 4
- 238000000926 separation method Methods 0.000 description 4
- 238000001890 transfection Methods 0.000 description 4
- 208000022679 triple-negative breast carcinoma Diseases 0.000 description 4
- 238000005406 washing Methods 0.000 description 4
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 3
- 208000031261 Acute myeloid leukaemia Diseases 0.000 description 3
- 102100024222 B-lymphocyte antigen CD19 Human genes 0.000 description 3
- 101000980825 Homo sapiens B-lymphocyte antigen CD19 Proteins 0.000 description 3
- 102000002698 KIR Receptors Human genes 0.000 description 3
- 108010043610 KIR Receptors Proteins 0.000 description 3
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 3
- 241000713666 Lentivirus Species 0.000 description 3
- 206010027406 Mesothelioma Diseases 0.000 description 3
- 229920001213 Polysorbate 20 Polymers 0.000 description 3
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 3
- 230000006044 T cell activation Effects 0.000 description 3
- 125000000539 amino acid group Chemical group 0.000 description 3
- 239000003153 chemical reaction reagent Substances 0.000 description 3
- 238000010367 cloning Methods 0.000 description 3
- 239000003814 drug Substances 0.000 description 3
- 239000003623 enhancer Substances 0.000 description 3
- 238000002474 experimental method Methods 0.000 description 3
- 230000006870 function Effects 0.000 description 3
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 3
- 230000008595 infiltration Effects 0.000 description 3
- 238000001764 infiltration Methods 0.000 description 3
- 210000004962 mammalian cell Anatomy 0.000 description 3
- 210000004379 membrane Anatomy 0.000 description 3
- 239000012528 membrane Substances 0.000 description 3
- 208000002154 non-small cell lung carcinoma Diseases 0.000 description 3
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 3
- 230000008569 process Effects 0.000 description 3
- 238000003259 recombinant expression Methods 0.000 description 3
- 230000028327 secretion Effects 0.000 description 3
- 230000011664 signaling Effects 0.000 description 3
- 239000007790 solid phase Substances 0.000 description 3
- 239000006228 supernatant Substances 0.000 description 3
- 230000008685 targeting Effects 0.000 description 3
- 210000001519 tissue Anatomy 0.000 description 3
- 238000013518 transcription Methods 0.000 description 3
- 230000035897 transcription Effects 0.000 description 3
- 238000010361 transduction Methods 0.000 description 3
- 230000026683 transduction Effects 0.000 description 3
- 230000009466 transformation Effects 0.000 description 3
- 208000029729 tumor suppressor gene on chromosome 11 Diseases 0.000 description 3
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- UAIUNKRWKOVEES-UHFFFAOYSA-N 3,3',5,5'-tetramethylbenzidine Chemical compound CC1=C(N)C(C)=CC(C=2C=C(C)C(N)=C(C)C=2)=C1 UAIUNKRWKOVEES-UHFFFAOYSA-N 0.000 description 2
- 206010006187 Breast cancer Diseases 0.000 description 2
- 208000026310 Breast neoplasm Diseases 0.000 description 2
- 210000001266 CD8-positive T-lymphocyte Anatomy 0.000 description 2
- 206010008342 Cervix carcinoma Diseases 0.000 description 2
- 108091026890 Coding region Proteins 0.000 description 2
- 206010009944 Colon cancer Diseases 0.000 description 2
- 206010014733 Endometrial cancer Diseases 0.000 description 2
- 206010014759 Endometrial neoplasm Diseases 0.000 description 2
- 208000000461 Esophageal Neoplasms Diseases 0.000 description 2
- WSFSSNUMVMOOMR-UHFFFAOYSA-N Formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 2
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 2
- 101000576802 Homo sapiens Mesothelin Proteins 0.000 description 2
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 2
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 2
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 2
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 2
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 2
- 241000711466 Murine hepatitis virus Species 0.000 description 2
- 241000711408 Murine respirovirus Species 0.000 description 2
- 241000699666 Mus <mouse, genus> Species 0.000 description 2
- 241000699670 Mus sp. Species 0.000 description 2
- 208000033776 Myeloid Acute Leukemia Diseases 0.000 description 2
- 206010030155 Oesophageal carcinoma Diseases 0.000 description 2
- 208000005718 Stomach Neoplasms Diseases 0.000 description 2
- 201000009365 Thymic carcinoma Diseases 0.000 description 2
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 2
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 2
- 238000001042 affinity chromatography Methods 0.000 description 2
- 235000004279 alanine Nutrition 0.000 description 2
- 238000004458 analytical method Methods 0.000 description 2
- 239000002246 antineoplastic agent Substances 0.000 description 2
- 238000011888 autopsy Methods 0.000 description 2
- 239000013602 bacteriophage vector Substances 0.000 description 2
- 238000009395 breeding Methods 0.000 description 2
- 230000001488 breeding effect Effects 0.000 description 2
- 230000005880 cancer cell killing Effects 0.000 description 2
- 238000005119 centrifugation Methods 0.000 description 2
- 201000010881 cervical cancer Diseases 0.000 description 2
- 208000006990 cholangiocarcinoma Diseases 0.000 description 2
- 208000029742 colonic neoplasm Diseases 0.000 description 2
- 238000010276 construction Methods 0.000 description 2
- 238000007796 conventional method Methods 0.000 description 2
- 239000013601 cosmid vector Substances 0.000 description 2
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 2
- 210000000805 cytoplasm Anatomy 0.000 description 2
- 230000003247 decreasing effect Effects 0.000 description 2
- 238000012217 deletion Methods 0.000 description 2
- 230000037430 deletion Effects 0.000 description 2
- 238000000502 dialysis Methods 0.000 description 2
- 238000009509 drug development Methods 0.000 description 2
- 208000018463 endometrial serous adenocarcinoma Diseases 0.000 description 2
- 201000004101 esophageal cancer Diseases 0.000 description 2
- 230000001747 exhibiting effect Effects 0.000 description 2
- 238000001914 filtration Methods 0.000 description 2
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 2
- 206010017758 gastric cancer Diseases 0.000 description 2
- 229930004094 glycosylphosphatidylinositol Natural products 0.000 description 2
- 230000036541 health Effects 0.000 description 2
- 210000004408 hybridoma Anatomy 0.000 description 2
- 239000012535 impurity Substances 0.000 description 2
- 208000015181 infectious disease Diseases 0.000 description 2
- 230000002601 intratumoral effect Effects 0.000 description 2
- 201000005202 lung cancer Diseases 0.000 description 2
- 208000020816 lung neoplasm Diseases 0.000 description 2
- 108010026228 mRNA guanylyltransferase Proteins 0.000 description 2
- 239000002547 new drug Substances 0.000 description 2
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 2
- 239000013600 plasmid vector Substances 0.000 description 2
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 2
- 239000003755 preservative agent Substances 0.000 description 2
- 230000004044 response Effects 0.000 description 2
- 238000012163 sequencing technique Methods 0.000 description 2
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 2
- 230000001954 sterilising effect Effects 0.000 description 2
- 238000004659 sterilization and disinfection Methods 0.000 description 2
- 201000011549 stomach cancer Diseases 0.000 description 2
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 2
- 208000008732 thymoma Diseases 0.000 description 2
- 238000011200 topical administration Methods 0.000 description 2
- GETQZCLCWQTVFV-UHFFFAOYSA-N trimethylamine Chemical compound CN(C)C GETQZCLCWQTVFV-UHFFFAOYSA-N 0.000 description 2
- 230000005909 tumor killing Effects 0.000 description 2
- 239000013603 viral vector Substances 0.000 description 2
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 2
- OZFAFGSSMRRTDW-UHFFFAOYSA-N (2,4-dichlorophenyl) benzenesulfonate Chemical compound ClC1=CC(Cl)=CC=C1OS(=O)(=O)C1=CC=CC=C1 OZFAFGSSMRRTDW-UHFFFAOYSA-N 0.000 description 1
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 1
- NFGXHKASABOEEW-UHFFFAOYSA-N 1-methylethyl 11-methoxy-3,7,11-trimethyl-2,4-dodecadienoate Chemical compound COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 description 1
- SXAMGRAIZSSWIH-UHFFFAOYSA-N 2-[3-[2-(2,3-dihydro-1H-inden-2-ylamino)pyrimidin-5-yl]-1,2,4-oxadiazol-5-yl]-1-(2,4,6,7-tetrahydrotriazolo[4,5-c]pyridin-5-yl)ethanone Chemical compound C1C(CC2=CC=CC=C12)NC1=NC=C(C=N1)C1=NOC(=N1)CC(=O)N1CC2=C(CC1)NN=N2 SXAMGRAIZSSWIH-UHFFFAOYSA-N 0.000 description 1
- ZRPAUEVGEGEPFQ-UHFFFAOYSA-N 2-[4-[2-(2,3-dihydro-1H-inden-2-ylamino)pyrimidin-5-yl]pyrazol-1-yl]-1-(2,4,6,7-tetrahydrotriazolo[4,5-c]pyridin-5-yl)ethanone Chemical compound C1C(CC2=CC=CC=C12)NC1=NC=C(C=N1)C=1C=NN(C=1)CC(=O)N1CC2=C(CC1)NN=N2 ZRPAUEVGEGEPFQ-UHFFFAOYSA-N 0.000 description 1
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 1
- TVEXGJYMHHTVKP-UHFFFAOYSA-N 6-oxabicyclo[3.2.1]oct-3-en-7-one Chemical compound C1C2C(=O)OC1C=CC2 TVEXGJYMHHTVKP-UHFFFAOYSA-N 0.000 description 1
- 102100023990 60S ribosomal protein L17 Human genes 0.000 description 1
- 206010002091 Anaesthesia Diseases 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 102100038080 B-cell receptor CD22 Human genes 0.000 description 1
- 208000032791 BCR-ABL1 positive chronic myelogenous leukemia Diseases 0.000 description 1
- 244000063299 Bacillus subtilis Species 0.000 description 1
- 235000014469 Bacillus subtilis Nutrition 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 241000282817 Bovidae Species 0.000 description 1
- 102100027207 CD27 antigen Human genes 0.000 description 1
- 101150013553 CD40 gene Proteins 0.000 description 1
- 241000282832 Camelidae Species 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 102100025466 Carcinoembryonic antigen-related cell adhesion molecule 3 Human genes 0.000 description 1
- 241000700199 Cavia porcellus Species 0.000 description 1
- 208000010833 Chronic myeloid leukaemia Diseases 0.000 description 1
- 241000699802 Cricetulus griseus Species 0.000 description 1
- 238000001712 DNA sequencing Methods 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 239000012591 Dulbecco’s Phosphate Buffered Saline Substances 0.000 description 1
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 1
- 238000001061 Dunnett's test Methods 0.000 description 1
- 241000283086 Equidae Species 0.000 description 1
- 206010015548 Euthanasia Diseases 0.000 description 1
- 206010015719 Exsanguination Diseases 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 102000003886 Glycoproteins Human genes 0.000 description 1
- 108090000288 Glycoproteins Proteins 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 102100022132 High affinity immunoglobulin epsilon receptor subunit gamma Human genes 0.000 description 1
- 108091010847 High affinity immunoglobulin epsilon receptor subunit gamma Proteins 0.000 description 1
- 101000884305 Homo sapiens B-cell receptor CD22 Proteins 0.000 description 1
- 101000914511 Homo sapiens CD27 antigen Proteins 0.000 description 1
- 101000914337 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 3 Proteins 0.000 description 1
- 101001109503 Homo sapiens NKG2-C type II integral membrane protein Proteins 0.000 description 1
- 101000716102 Homo sapiens T-cell surface glycoprotein CD4 Proteins 0.000 description 1
- 101000669447 Homo sapiens Toll-like receptor 4 Proteins 0.000 description 1
- 101000851376 Homo sapiens Tumor necrosis factor receptor superfamily member 8 Proteins 0.000 description 1
- -1 ICOS Proteins 0.000 description 1
- 229940076838 Immune checkpoint inhibitor Drugs 0.000 description 1
- 102000037984 Inhibitory immune checkpoint proteins Human genes 0.000 description 1
- 108091008026 Inhibitory immune checkpoint proteins Proteins 0.000 description 1
- 108020005350 Initiator Codon Proteins 0.000 description 1
- 108010002350 Interleukin-2 Proteins 0.000 description 1
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 1
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 1
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 1
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 1
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 108010064548 Lymphocyte Function-Associated Antigen-1 Proteins 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 102000012750 Membrane Glycoproteins Human genes 0.000 description 1
- 108010090054 Membrane Glycoproteins Proteins 0.000 description 1
- 241001529936 Murinae Species 0.000 description 1
- 241000008906 Murine coronavirus Species 0.000 description 1
- 101100341510 Mus musculus Itgal gene Proteins 0.000 description 1
- 241000202934 Mycoplasma pneumoniae Species 0.000 description 1
- 208000033761 Myelogenous Chronic BCR-ABL Positive Leukemia Diseases 0.000 description 1
- 102100022683 NKG2-C type II integral membrane protein Human genes 0.000 description 1
- 108010038807 Oligopeptides Proteins 0.000 description 1
- 102000015636 Oligopeptides Human genes 0.000 description 1
- 108700026244 Open Reading Frames Proteins 0.000 description 1
- 238000012408 PCR amplification Methods 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 229930182555 Penicillin Natural products 0.000 description 1
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 1
- 241000009328 Perro Species 0.000 description 1
- 206010035226 Plasma cell myeloma Diseases 0.000 description 1
- 101710089372 Programmed cell death protein 1 Proteins 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- 102000007327 Protamines Human genes 0.000 description 1
- 108010007568 Protamines Proteins 0.000 description 1
- 101710150344 Protein Rev Proteins 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 108091081024 Start codon Proteins 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 241000282887 Suidae Species 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- 102100039360 Toll-like receptor 4 Human genes 0.000 description 1
- 101710120037 Toxin CcdB Proteins 0.000 description 1
- 101710165473 Tumor necrosis factor receptor superfamily member 4 Proteins 0.000 description 1
- 102100022153 Tumor necrosis factor receptor superfamily member 4 Human genes 0.000 description 1
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 description 1
- 102100036857 Tumor necrosis factor receptor superfamily member 8 Human genes 0.000 description 1
- 206010064390 Tumour invasion Diseases 0.000 description 1
- 241000700618 Vaccinia virus Species 0.000 description 1
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 1
- 230000003187 abdominal effect Effects 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 238000007792 addition Methods 0.000 description 1
- 238000000246 agarose gel electrophoresis Methods 0.000 description 1
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 1
- 229960000723 ampicillin Drugs 0.000 description 1
- 230000037005 anaesthesia Effects 0.000 description 1
- 229940035676 analgesics Drugs 0.000 description 1
- 239000000730 antalgic agent Substances 0.000 description 1
- 230000001093 anti-cancer Effects 0.000 description 1
- 230000000890 antigenic effect Effects 0.000 description 1
- 230000001640 apoptogenic effect Effects 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 239000011324 bead Substances 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 210000001185 bone marrow Anatomy 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 230000009400 cancer invasion Effects 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 239000006143 cell culture medium Substances 0.000 description 1
- 230000005754 cellular signaling Effects 0.000 description 1
- 201000002687 childhood acute myeloid leukemia Diseases 0.000 description 1
- 208000019425 cirrhosis of liver Diseases 0.000 description 1
- 238000005352 clarification Methods 0.000 description 1
- 210000001072 colon Anatomy 0.000 description 1
- 238000010835 comparative analysis Methods 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- 230000001086 cytosolic effect Effects 0.000 description 1
- 230000001934 delay Effects 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 235000005911 diet Nutrition 0.000 description 1
- 230000037213 diet Effects 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 238000012377 drug delivery Methods 0.000 description 1
- 238000001035 drying Methods 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 238000010828 elution Methods 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 238000000605 extraction Methods 0.000 description 1
- 210000004700 fetal blood Anatomy 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 238000012215 gene cloning Methods 0.000 description 1
- 230000008571 general function Effects 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 238000000703 high-speed centrifugation Methods 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 238000005286 illumination Methods 0.000 description 1
- 230000003100 immobilizing effect Effects 0.000 description 1
- 239000012274 immune-checkpoint protein inhibitor Substances 0.000 description 1
- 230000036039 immunity Effects 0.000 description 1
- 230000003053 immunization Effects 0.000 description 1
- 238000002649 immunization Methods 0.000 description 1
- 230000016784 immunoglobulin production Effects 0.000 description 1
- 238000003364 immunohistochemistry Methods 0.000 description 1
- 238000012744 immunostaining Methods 0.000 description 1
- 238000009169 immunotherapy Methods 0.000 description 1
- 238000001727 in vivo Methods 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 239000004615 ingredient Substances 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 238000007689 inspection Methods 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 239000007928 intraperitoneal injection Substances 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 238000004255 ion exchange chromatography Methods 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 238000001638 lipofection Methods 0.000 description 1
- 238000011068 loading method Methods 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 239000013028 medium composition Substances 0.000 description 1
- 210000005033 mesothelial cell Anatomy 0.000 description 1
- 108020004999 messenger RNA Proteins 0.000 description 1
- 230000001394 metastastic effect Effects 0.000 description 1
- 206010061289 metastatic neoplasm Diseases 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- 244000005700 microbiome Species 0.000 description 1
- 238000001823 molecular biology technique Methods 0.000 description 1
- 238000012544 monitoring process Methods 0.000 description 1
- 230000035772 mutation Effects 0.000 description 1
- 201000000050 myeloid neoplasm Diseases 0.000 description 1
- 230000017074 necrotic cell death Effects 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 238000001543 one-way ANOVA Methods 0.000 description 1
- 210000003463 organelle Anatomy 0.000 description 1
- 210000001672 ovary Anatomy 0.000 description 1
- 230000002018 overexpression Effects 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 239000008188 pellet Substances 0.000 description 1
- 229940049954 penicillin Drugs 0.000 description 1
- 210000005259 peripheral blood Anatomy 0.000 description 1
- 239000011886 peripheral blood Substances 0.000 description 1
- 210000001322 periplasm Anatomy 0.000 description 1
- 210000003200 peritoneal cavity Anatomy 0.000 description 1
- 239000000546 pharmaceutical excipient Substances 0.000 description 1
- 239000012071 phase Substances 0.000 description 1
- 230000008488 polyadenylation Effects 0.000 description 1
- 229920000515 polycarbonate Polymers 0.000 description 1
- 239000004417 polycarbonate Substances 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 230000002335 preservative effect Effects 0.000 description 1
- 239000000047 product Substances 0.000 description 1
- 229950008679 protamine sulfate Drugs 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 239000011347 resin Substances 0.000 description 1
- 229920005989 resin Polymers 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 238000005185 salting out Methods 0.000 description 1
- 208000004548 serous cystadenocarcinoma Diseases 0.000 description 1
- 235000020183 skimmed milk Nutrition 0.000 description 1
- 239000002904 solvent Substances 0.000 description 1
- 125000006850 spacer group Chemical group 0.000 description 1
- 230000007480 spreading Effects 0.000 description 1
- 238000003892 spreading Methods 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 238000007619 statistical method Methods 0.000 description 1
- 210000002784 stomach Anatomy 0.000 description 1
- 229960005322 streptomycin Drugs 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- 238000011426 transformation method Methods 0.000 description 1
- 230000001131 transforming effect Effects 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- 210000004881 tumor cell Anatomy 0.000 description 1
- 238000000108 ultra-filtration Methods 0.000 description 1
- 241000701161 unidentified adenovirus Species 0.000 description 1
- 241000701447 unidentified baculovirus Species 0.000 description 1
- 241001430294 unidentified retrovirus Species 0.000 description 1
- 239000004474 valine Substances 0.000 description 1
- 210000003462 vein Anatomy 0.000 description 1
- 238000009423 ventilation Methods 0.000 description 1
- 238000012795 verification Methods 0.000 description 1
- 210000001835 viscera Anatomy 0.000 description 1
- 230000000007 visual effect Effects 0.000 description 1
- 230000004584 weight gain Effects 0.000 description 1
- 235000019786 weight gain Nutrition 0.000 description 1
- 230000004580 weight loss Effects 0.000 description 1
- 229960001600 xylazine Drugs 0.000 description 1
- BPICBUSOMSTKRF-UHFFFAOYSA-N xylazine Chemical compound CC1=CC=CC(C)=C1NC1=NCCCS1 BPICBUSOMSTKRF-UHFFFAOYSA-N 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/31—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterized by the route of administration
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterised by the cancer treated
- A61K2239/59—Reproductive system, e.g. uterus, ovaries, cervix or testes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/461—Cellular immunotherapy characterised by the cell type used
- A61K39/4611—T-cells, e.g. tumor infiltrating lymphocytes [TIL], lymphokine-activated killer cells [LAK] or regulatory T cells [Treg]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/463—Cellular immunotherapy characterised by recombinant expression
- A61K39/4631—Chimeric Antigen Receptors [CAR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/464—Cellular immunotherapy characterised by the antigen targeted or presented
- A61K39/4643—Vertebrate antigens
- A61K39/4644—Cancer antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/464—Cellular immunotherapy characterised by the antigen targeted or presented
- A61K39/4643—Vertebrate antigens
- A61K39/4644—Cancer antigens
- A61K39/464466—Adhesion molecules, e.g. NRCAM, EpCAM or cadherins
- A61K39/464468—Mesothelin [MSLN]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70517—CD8
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70575—NGF/TNF-superfamily, e.g. CD70, CD95L, CD153, CD154
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70578—NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/62—DNA sequences coding for fusion proteins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2121/00—Preparations for use in therapy
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/10—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterized by the structure of the chimeric antigen receptor [CAR]
- A61K2239/11—Antigen recognition domain
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/10—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterized by the structure of the chimeric antigen receptor [CAR]
- A61K2239/21—Transmembrane domain
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2300/00—Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/86—Viral vectors
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0636—T lymphocytes
- C12N5/0638—Cytotoxic T lymphocytes [CTL] or lymphokine activated killer cells [LAK]
Definitions
- An anti-mesothelin chimeric antigen receptor that specifically binds to mesothelin and uses thereof.
- immuno-anticancer agents such as immune checkpoint inhibitors and CAR-T cell therapeutics have demonstrated their effectiveness in various cancers, but it is reported that solid cancers do not respond significantly to these new types of immuno-anticancer agents. This is presumed to be because the fibrous tissue surrounding the tumor interferes with the immunotherapy response and makes drug delivery difficult. Therefore, as a specific and more effective CAR-T cancer treatment method, there is a need for research on how to develop an antibody that targets a protein specifically overexpressed on the surface of solid cancer cells as a cancer antigen, and to effectively treat solid cancer using this antibody. is emerging
- mesothelin is a glycoprotein anchored on the cell surface by a glycosylphosphatidylinositol (GPI) domain. It is normally expressed at a low level and restricted to the mesothelium surrounding the human cavity and internal organs, but pancreatic cancer. , it is known to be abundantly expressed in cancers such as mesothelioma, ovarian cancer, and non-small cell lung cancer.
- GPI glycosylphosphatidylinositol
- One aspect is to provide an anti-mesothelin antibody or antigen-binding fragment thereof.
- Another aspect is to provide an isolated nucleic acid encoding the anti-mesothelin antibody or antigen-binding fragment thereof.
- Another aspect is to provide a vector comprising the isolated nucleic acid.
- Another aspect is to provide an isolated host cell transformed with the vector.
- Another aspect is to provide a method for producing an anti-mesothelin antibody comprising culturing the isolated host cell to express the antibody.
- Another aspect is to provide a chimeric antigen receptor comprising an antigen binding domain, a hinge domain, a transmembrane domain and an intracellular signaling domain.
- Another aspect is to provide a polynucleotide encoding the chimeric antigen receptor.
- Another aspect is to provide a vector comprising the polynucleotide.
- Another aspect is to provide isolated cells transformed with the vector.
- Another aspect is a pharmaceutical composition
- a pharmaceutical composition comprising the isolated cells; medicinal use of the cells; and administering a therapeutically effective amount of the cells to a subject to provide a method for preventing or treating cancer.
- One aspect provides an anti-mesothelin antibody or antigen-binding fragment thereof.
- MSLN mesothelin
- Mesothelin shows low expression in normal mesothelial cells, but is highly expressed in solid cancer (solid tumor), esophageal cancer, breast cancer, triple-negative breast cancer (TNBC) , gastric cancer, cholangiocarcinoma, pancreatic cancer, colon cancer, lung cancer, thymic carcinoma, mesothelioma, ovarian cancer, Overexpression was confirmed in endometrial cancer, cervical cancer, uterin serous carcinoma (USC), and acute myeloid leukemia (AML) in children (Cancer Discov.
- MSLN3 was discovered as an antibody that specifically binds to the target antigen, mesothelin, through phage display antibody library panning.
- the term "antibody” refers to a generic term for proteins involved in in vivo immunity by selectively acting on antigens, and the types thereof are not particularly limited.
- the heavy and light chains of the antibody have an antigen binding site that recognizes an epitope including a variable region, and antigen specificity is revealed according to a change in the sequence of the variable region.
- the variable region of the antigen binding site is divided into a framework region (FR) with low variability and a complementarity determining region (CDR) with high variability, and both heavy and light chains are divided into CDR1, 2, and 3. It has a CDR region and four FR regions.
- the CDRs of each chain are typically named CDR1, CDR2, CDR3 sequentially starting from the N-terminus, and also identified by the chain in which the particular CDR is located.
- complementarity determining region refers to a region that imparts binding specificity to an antigen among variable regions of an antibody.
- epitope refers to a specific three-dimensional molecular structure within an antigen molecule to which an antibody can specifically bind.
- the antibody includes all of monoclonal antibodies, multispecific antibodies, human antibodies, humanized antibodies, and chimeric antibodies (eg, humanized murine antibodies).
- the antibody may include diabodies, triabodies, and tetrabodies.
- an antibody includes an "antigen-binding fragment” or “antibody fragment” of an antibody having antigen-binding ability.
- the antigen-binding fragment may be an antibody fragment comprising at least one complementarity determining region, for example, one selected from the group consisting of scFv, (scFv)2, scFv-Fc, Fab, Fab' and F(ab')2.
- Fab has a structure having variable regions of light and heavy chains, constant regions of light chains, and a first constant region (CH1) of heavy chains, and has one antigen-binding site.
- Fab' differs from Fab in that it has a hinge region containing one or more cysteine residues at the C-terminus of the heavy chain CH1 domain.
- An F(ab')2 antibody is produced by forming a disulfide bond between cysteine residues in the hinge region of Fab'.
- Fv is a minimal antibody fragment having only a heavy chain variable region and a light chain variable region.
- Double-chain Fv two-chain Fv
- scFv Single-chain Fv (scFv) generally has a dimer-like structure like double-chain Fv because the heavy chain variable region and light chain variable region are covalently linked through a peptide linker or directly linked at the C-terminus.
- the anti-mesothelin antibody or antigen-binding fragment thereof comprises a heavy chain CDR1 comprising an amino acid sequence consisting of SEQ ID NO: 1, a heavy chain CDR2 comprising an amino acid sequence consisting of SEQ ID NO: 2, and an amino acid sequence comprising SEQ ID NO: 3 It may be characterized in that it comprises a heavy chain CDR3, and a light chain CDR1 comprising the amino acid sequence consisting of SEQ ID NO: 4, a light chain CDR2 comprising the amino acid sequence consisting of SEQ ID NO: 5, and a light chain CDR3 comprising the amino acid sequence consisting of SEQ ID NO: 6. have.
- the anti-mesothelin antibody or antigen-binding fragment thereof has 80% or more sequence homology with the amino acid sequence of SEQ ID NO: 7, preferably 90% or more sequence homology, more preferably 95% or more sequence homology. It may be characterized by comprising a heavy chain variable region comprising sequences having homology, more preferably 100% homology.
- the anti-mesothelin antibody or antigen-binding fragment thereof has 80% or more sequence homology with the amino acid sequence of SEQ ID NO: 8, preferably 90% or more sequence homology, more preferably 95% or more sequence homology. It may be characterized by comprising a light chain variable region comprising a sequence having homology, more preferably 100% homology.
- the anti-mesothelin antibody or antigen-binding fragment thereof may include a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 7 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 8.
- the anti-mesothelin antibody or antigen-binding fragment thereof comprises an anti-mesothelin antibody or antigen-binding fragment comprising a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 7 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 8. It may be a mesothelin scFv (anti-MSLN3 scFv).
- the antibody or antigen-binding fragment thereof according to the above aspect may include not only the sequence of the anti-mesothelin-specific binding antibody described herein, but also a biological equivalent thereof, to the extent that it can specifically recognize mesothelin. have.
- additional changes may be made to the amino acid sequence of the antibody to further improve its binding affinity and/or other biological properties.
- amino acid sequence of the antibody may be substituted through conservative substitution.
- a “conservative substitution” as used herein refers to a modification of a polypeptide that involves substituting one or more amino acids with amino acids having similar biochemical properties that do not result in loss of biological or biochemical function of the polypeptide.
- a “conservative amino acid substitution” is a substitution in which an amino acid residue is replaced with an amino acid residue having a similar side chain.
- Classes of amino acid residues with similar side chains have been defined in the art. These classes include amino acids with basic side chains (e.g. lysine, arginine, histidine), amino acids with acidic side chains (e.g. aspartic acid, glutamic acid), and amino acids with uncharged polar side chains (e.g.
- glycine glycine
- amino acids with non-polar side chains e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan
- beta-branched side chains and amino acids with aromatic side chains eg, tyrosine, phenylalanine, tryptophan, histidine. It can be expected that the antibody according to one aspect may still retain its original activity even if some amino acid sequences of the antibody are substituted through conservative amino acid substitutions.
- the antibody of one aspect or the nucleic acid molecule encoding the same is interpreted as including a sequence showing substantial identity with the sequence described in SEQ ID NO.
- the substantial identity is at least 61% when the sequence and any other sequence are aligned so as to correspond as much as possible and the aligned sequence is analyzed using an algorithm commonly used in the art.
- homology more preferably 70% homology, still more preferably 80% homology, still more preferably 90% homology, still more preferably 95% homology, most preferably 98% homology It means a sequence showing % homology. Alignment methods for sequence comparison are known in the art.
- Another aspect provides an isolated nucleic acid encoding the antibody or antigen-binding fragment thereof.
- nucleic acid is meant to comprehensively include DNA and RNA molecules, and nucleotides, which are basic structural units in nucleic acids, include not only natural nucleotides, but also analogs in which sugar or base sites are modified.
- sequences of nucleic acids encoding the heavy and light chain variable regions of one aspect may be modified. Such modifications include additions, deletions, or non-conservative or conservative substitutions of nucleotides.
- the nucleic acid is also construed to include a nucleotide sequence that exhibits substantial identity to the nucleotide sequence of the nucleic acid. Substantial identity is at least 80% when the nucleotide sequence of one aspect and any other sequence are aligned so as to correspond as much as possible, and the aligned sequence is analyzed using an algorithm commonly used in the art. A nucleotide sequence exhibiting homology, more preferably at least 90% homology, most preferably at least 95% homology.
- Another aspect provides a vector comprising the isolated nucleic acid.
- the vector is used to convert DNA encoding partial or full-length light and heavy chains to standard molecular biology techniques (e.g., PCR amplification or high-resolution expression of the antibody of interest).
- cDNA cloning using hybridoma and may contain essential regulatory elements operably linked so that the DNA (gene) insert can be expressed.
- "Operably linked" means that a nucleic acid expression control sequence and a nucleic acid sequence encoding a protein or RNA of interest are functionally linked so as to perform a general function, and a gene is produced by an expression control sequence. It means that it is connected so that it can be expressed.
- expression control sequence refers to a DNA sequence that controls the expression of an operably linked DNA sequence in a specific host cell.
- regulatory sequences include a promoter for effecting transcription, any operator sequence for regulating transcription, a sequence encoding a suitable mRNA ribosome binding site, a sequence for regulating termination of transcription and translation, an initiation codon, a stop codon, a polyadede nylation signals and enhancers; and the like.
- a person skilled in the art can recognize that the design of an expression vector can be varied by selecting a regulatory sequence differently depending on factors such as the selection of a host cell to be transformed, the expression level of a protein, and the like.
- the type of vector is not particularly limited as long as it is a vector commonly used in the fields of cloning and antibody production, and examples thereof include, but are not limited to, plasmid vectors, cosmid vectors, bacteriophage vectors, and viral vectors.
- the plasmids include Escherichia coli-derived plasmids (pBR322, pBR325, pUC118, and pUC119, pET-21b(+)), Bacillus subtilis-derived plasmids (pUB110 and pTP5), and yeast-derived plasmids (YEp13, YEp24, and YCp50).
- the virus may be an animal virus such as retrovirus, adenovirus or vaccinia virus, or an insect virus such as baculovirus.
- a pComb3 series vector commonly used for phage display, etc. may be used, or a vector commonly used for protein expression in mammalian cells, such as pcDNA or pVITRO, may be used to express antibodies in mammalian cells. have.
- Another aspect provides an isolated host cell transformed with the vector.
- the term "transformation” means that a piece of DNA chain or a plasmid having a foreign gene of a different kind from that of the original cell penetrates into cells and binds to the DNA existing in the original cell, thereby inheriting the cell's inheritance. It refers to molecular biological techniques that change traits.
- the vector is transfected or transfected into a host cell.
- a variety of techniques commonly used to introduce exogenous nucleic acids (DNA or RNA) into prokaryotic or eukaryotic host cells for transfection or transfection, such as electrophoresis, calcium phosphate precipitation, DEAE-dextran Transfection or lipofection or the like can be used.
- Antibodies or antigen-binding fragments thereof may be expressed in eukaryotic cells, preferably mammalian host cells, considering the possibility of application to microorganisms such as bacteria ( E. coli ) or yeast (Yeast), or mammalian cells.
- the mammalian host cell is, for example, any one selected from the group consisting of Chinese Hamster Ovary (CHO) cells, NSO myeloma cells, COS cells, SP2 cells, F2N cells, HEK293 cells, and antibody-producing hybridoma cells. It may be, but is not limited thereto.
- Another aspect provides a method for preparing an anti-mesothelin antibody comprising culturing the isolated host cell to express the antibody.
- the method may include transforming a host cell for producing an antibody or antigen-binding fragment thereof of one aspect with a vector to which DNA encoding the antibody or antigen-binding fragment thereof is operably linked.
- the types of selected host cells and recombinant expression vectors are as described above, and this step can be carried out by selecting an appropriate transformation method.
- a recombinant expression vector encoding the antibody gene is introduced into a mammalian host cell, the antibody is secreted for a period of time sufficient to allow expression of the antibody in the host cell, or more preferably, secretion of the antibody into the culture medium in which the host cell is cultured. It can be prepared by culturing the host cells for a sufficient period of time.
- the method may additionally include the step of culturing the transformed isolated host cell to produce a polypeptide of an antibody or antigen-binding fragment thereof according to one aspect from a recombinant expression vector introduced into the host cell.
- the medium composition, culture conditions, culture time, etc. for culturing the selected host cell can be appropriately selected, and the antibody molecules produced in the host cell are accumulated in the cytoplasm of the cell or secreted outside the cell or into the culture medium by an appropriate signal sequence. or targeted to a periplasm or the like.
- the antibody according to one aspect may be refolded to have a functional structure by using a method known in the art to maintain the binding specificity to mesothelin.
- the heavy chain and light chain when producing an antibody in the form of IgG, may be expressed in separate cells and the heavy chain and light chain may be contacted in a separate step to form a complete antibody, or the heavy chain and light chain may be expressed in the same cell to It can also be made to form complete antibodies inside cells.
- the method may additionally include a step of obtaining an antibody or antigen-binding fragment thereof produced in the isolated host cell.
- the method of obtaining the antibody or antigen-binding fragment thereof produced in the host cell may be appropriately selected and adjusted in consideration of the characteristics of the polypeptide, the characteristics of the host cell, the expression method, or targeting of the polypeptide.
- the antibody or antigen-binding fragment thereof secreted into the culture medium can be recovered by obtaining the medium in which the host cells are cultured and removing impurities by centrifugation, etc. Cells may be lysed in a range that does not affect the functional structure of the antibody or antigen-binding fragment thereof in order to release and recover the antibody present in the organelle or cytoplasm to the outside of the cell.
- the obtained antibody may be further subjected to a process of further removing impurities and concentrating through a method such as chromatography, filtration through a filter, or dialysis. Separation or purification of the obtained antibody can be performed by separation and purification methods commonly used for proteins, such as chromatography.
- the chromatography may include, for example, affinity chromatography including a protein A column, protein G column, or protein L column, ion exchange chromatography, or hydrophobic chromatography.
- antibodies can be separated and purified by further combining filtration, ultrafiltration, salting out, dialysis and the like.
- Another aspect provides a chimeric antigen receptor comprising an antigen binding domain, a hinge domain, a transmembrane domain and an intracellular signaling domain.
- the chimeric antigen receptor is characterized in that it specifically binds to mesothelin, it includes an antigen-binding domain that specifically binds to mesothelin.
- the antigen-binding domain consists of heavy chain CDR1 comprising the amino acid sequence consisting of SEQ ID NO: 1, heavy chain CDR2 comprising the amino acid sequence consisting of SEQ ID NO: 2, heavy chain CDR3 comprising the amino acid sequence consisting of SEQ ID NO: 3, and SEQ ID NO: 4. It may include a light chain CDR1 comprising the amino acid sequence, a light chain CDR2 comprising the amino acid sequence consisting of SEQ ID NO: 5, and a light chain CDR3 comprising the amino acid sequence consisting of SEQ ID NO: 6, which is an anti-mesothelin antibody or Since it is the same as its antigen-binding fragment, overlapping descriptions are omitted.
- chimeric antigen receptor means that the structure of a chimeric antigen receptor includes an antigen binding (recognition) domain, a transmembrane domain, and an intracellular signaling domain.
- the antigen-binding fragment may be a scFv (single chain variable fragment).
- a hinge domain, a transmembrane domain, and an intracellular signaling domain included in the chimeric antigen receptor are well known in the art.
- the hinge domain is a domain connecting the anti-mesothelin antibody or antigen-binding fragment thereof and the transmembrane domain, and is also called a spacer, and has the purpose of extending the antigen-binding domain from the T cell membrane.
- the hinge domain may be a CD8 hinge domain, an IgG1 hinge domain, an IgG4 hinge domain, a CD28 extracellular region, a KIR (killer immunoglobulin-like receptor) extracellular region, and a combination thereof, but is not limited thereto, and is commonly used in the art. You can use any hinge domain you use.
- the transmembrane domain serves as a support for the chimeric antigen receptor molecule and can connect the hinge domain and the intracellular signaling domain.
- the transmembrane domain can penetrate the cell membrane of a cell so that the anti-mesothelin antibody or antigen-binding fragment thereof of the chimeric antigen receptor is located on the cell surface and the intracellular signaling domain is located within the cell.
- the transmembrane domain may be a transmembrane domain of CD3zeta (CD3z), CD4, CD8, CD28 or KIR protein, preferably a transmembrane domain of CD8 or CD28 may be used, but used for preparing a chimeric antigen receptor Any common transmembrane domain may be used without limitation.
- the intracellular signaling domain serves to receive the signal transmitted by the anti-mesothelin antibody or antigen-binding fragment thereof and deliver it into the cell to which the chimeric antigen receptor is bound.
- the intracellular signaling domain is not particularly limited to the type, as long as it is a part that transmits a signal that can lead to T cell activation when an antibody binds to an antigen-binding site present outside the cell, and various types of intracellular signaling domains can be used
- the intracellular signaling domain may be, for example, an immunoreceptor tyrosine-based activation motif or ITAM, and the ITAM is CD3zeta, FcR gamma, FcR beta, CD3 gamma, CD3 delta, CD3 but is not limited to those derived from epsilon, CDS, CD22, CD79a, CD79b, CD66d or Fc ⁇ RI ⁇ .
- the chimeric antigen receptor according to one aspect may further include a costimulatory domain together with an intracellular signaling domain.
- the costimulatory domain is a part that serves to transmit a signal to a T cell in addition to a signal by an intracellular signaling domain, and is an intracellular portion of a chimeric antigen receptor, including an intracellular domain of a costimulatory molecule.
- the costimulatory molecule is a cell surface molecule, and refers to a molecule required to bring about a sufficient response of lymphocytes to an antigen, such as CD27, CD28, 4-1BB, OX40, CD30, CD40, PD-1, ICOS, LFA- 1 (lymphocyte function-associated antigen-1), CD2, CD7, LIGHT, NKG2C, or B7-H3, but is not limited thereto.
- the costimulatory domain may be an intracellular portion of a molecule selected from the group consisting of such costimulatory molecules and combinations thereof.
- Each domain of the chimeric antigen receptor may optionally be linked by a short oligopeptide or polypeptide linker.
- a linker is capable of inducing T cell activation through an intracellular domain when an antigen is bound to an antibody located outside the cell, a linker known in the art may be used without being particularly limited in its length.
- the chimeric antigen receptor may include a modified form of the antibody and domains as described above.
- the modification may be performed by substituting, deleting, or adding one or more amino acids in the amino acid sequence of the wild-type antibody and domain without modifying the functions of the antibody and domain.
- the substitution is an alanine, or can be made by conservative amino acid substitution that does not affect the charge, polarity or hydrophobicity of the entire protein.
- Another aspect provides a polynucleotide encoding the chimeric antigen receptor.
- the polynucleotide is a coding region within a range that does not change the amino acid sequence of an antigen receptor expressed from the coding region due to codon degeneracy or in consideration of codons preferred in organisms intended to express the antigen receptor.
- Various modifications may be made to, and various modifications or modifications may be made within a range that does not affect gene expression even in parts other than the coding region, and those skilled in the art can understand that such modified genes are also included in the scope of the present invention. There will be.
- nucleic acid bases may be mutated by substitution, deletion, insertion, or a combination thereof, and these are also included in the scope of the present invention.
- Another aspect provides a vector comprising the polynucleotide and an isolated cell transformed with the vector.
- Vectors of the present invention include, but are not limited to, plasmid vectors, cosmid vectors, bacteriophage vectors and viral vectors. Suitable vectors include expression control elements such as promoters, operators, initiation codons, stop codons, polyadenylation signals and enhancers, as well as signal sequences or leader sequences for membrane targeting or secretion, and may be prepared in various ways depending on the purpose.
- cells may be transformed by introducing the vector into cells, and the isolated cells may be, but are not limited to, T cells, NK cells, NKT cells, or gamma delta ( ⁇ ) T cells.
- the isolated cells may be obtained or prepared from bone marrow, peripheral blood, peripheral blood mononuclear cells, or umbilical cord blood.
- Another aspect is a pharmaceutical composition
- a pharmaceutical composition comprising the isolated cells; medical use of the isolated cells; And it provides a method for preventing or treating cancer comprising administering a therapeutically effective amount of the isolated cells to a subject.
- the pharmaceutical composition or medicinal use may be for preventing or treating cancer.
- prevention refers to any activity that suppresses or delays the onset of cancer (tumor) by administration of the pharmaceutical composition according to the present invention.
- treatment refers to any activity in which symptoms of cancer (tumor) are improved or advantageously changed by administration of the pharmaceutical composition according to the present invention.
- the term "individual” means a subject in need of treatment of a disease, and more specifically, a human or non-human primate, rodent (rat, mouse, guinea pig, etc.), mouse, dog, Mammals such as cats, horses, cattle, sheep, pigs, goats, camels, and antelopes.
- rodent rat, mouse, guinea pig, etc.
- Mammals such as cats, horses, cattle, sheep, pigs, goats, camels, and antelopes.
- cancer refers to aggressive characteristics in which cells divide and grow beyond normal growth limits, invasive characteristics infiltrating surrounding tissues, and metastatic characteristics spreading to other parts of the body and outside the body. It is a general term for diseases caused by cells with In the present specification, the cancer is used in the same sense as a malignant tumor, and may preferably be mesothelin-positive or mesothelin overexpressing cancer.
- the cancer may preferably be a solid cancer, for example, more preferably a mesothelin-positive or mesothelin overexpressing solid cancer.
- the solid cancer is esophageal cancer, breast cancer, triple-negative breast cancer (TNBC), gastric cancer, cholangiocarcinoma, pancreatic cancer, colon Colon cancer, lung cancer, thymic carcinoma, mesothelioma, ovarian cancer, endometrial cancer, cervical cancer, uterine serous carcinoma (uterine serous carcinoma: USC), non-small cell lung cancer (non-small cell lung cancer), and pediatric acute myeloid leukemia (acute myeloid leukemia: AML), but may be any one selected from the group consisting of, but is not limited thereto.
- the pharmaceutical composition may include 10 to 95% by weight of cells of one aspect, which are active ingredients, based on the total weight of the pharmaceutical composition.
- the pharmaceutical composition of the present invention may further contain at least one active ingredient exhibiting the same or similar function in addition to the above active ingredient.
- the dose of the cells depends on the type of disease, the severity of the disease, the type and amount of active ingredients and other ingredients contained in the pharmaceutical composition, the type of formulation and the patient's age, weight, general health condition, sex and diet, administration time , it can be adjusted according to various factors including the route of administration, duration of treatment, and drugs used concurrently.
- the effective amount of the cells included in the pharmaceutical composition according to the present invention may be 1 x 10 5 to 1 x 10 11 cells/kg. At this time, the administration may be administered once a day, or may be divided and administered several times. An effective amount of a cell or pharmaceutical composition presented herein can be determined empirically without undue experimentation.
- the pharmaceutical composition may be a formulation having a formulation suitable for the purpose according to a conventional method in the pharmaceutical field.
- the composition may be administered after being formulated into a unit dosage form suitable for administration into the body of a patient according to a conventional method in the pharmaceutical field.
- one or more pharmaceutically acceptable conventional inert carriers for example, in the case of injections, preservatives, analgesics, solubilizers or stabilizers, etc., and in the case of formulations for topical administration, A base, excipient, lubricant or preservative may be further included.
- the cells or pharmaceutical compositions containing them may be administered to a subject by various methods known in the art, for example, intraperitoneal administration, intravenous administration, intramuscular administration, subcutaneous administration, intradermal administration, or oral administration. , It may be administered by topical administration, intranasal administration, intrapulmonary administration, intrarectal administration, etc., but is not limited thereto.
- the anti-mesothelin chimeric antigen receptor exhibits a specific binding ability to mesothelin, and thus can be usefully used for preventing or treating cancer in which mesothelin is overexpressed.
- FIG. 1 is a diagram schematically illustrating an antibody screening process through panning of a phage display antibody library.
- FIG. 2 shows the results of solid phase panning.
- FIG. 2A is a diagram showing phage output titers and
- FIG. 2B is an elution titer ratio (B) according to panning rounds.
- Figure 3 is a diagram showing the results of comparative analysis of the specific binding to the antigen MSLN of the clones obtained through phage ELISA.
- FIG. 4 is a view showing the result of confirming through flow cytometry whether clones selected using mesothelin-overexpressing cell lines bind to mesothelin present in actual cell membranes.
- 5 is a diagram showing the relative peak shift values of binding specificity to mesothelin of clones selected using a mesothelin-overexpressing cell line.
- Figure 6 is a diagram showing the results of SDS-PAGE analysis of purified anti-MSLN-scFv antibodies (loading 2 ⁇ g for each protein).
- NR Non-reducing condition
- R Reducing condition (100°C, 10 minutes).
- FIG. 7 is a diagram showing the results of analyzing the affinity of the anti-MSLN-scFv antibody to the antigen MSLN through ELISA.
- FIG. 8 is a schematic diagram of an anti-MSLN-CAR expression system according to an aspect comprising an MSLN-specific antigen-binding domain.
- Figure 9a is the result of confirming the expression of CAR in T cells into which the anti-MSLN-CAR was introduced; and FIG. 9B is a diagram showing the results of measuring the ratio of CD4+ and CD8+ T cells among CD3 positive T cells.
- Figure 10 shows the ovarian cancer (OVCAR-3) mouse model administered with HBSS (G1), Mock (G2), CD19-CAR-T (G3), and anti-MSLN3-CAR-introduced CAR-T cells (G4). It is a diagram confirming the change in weight by date.
- Figure 11 shows the ovarian cancer (OVCAR-3) mouse model administered with HBSS (G1), Mock (G2), CD19-CAR-T (G3), and anti-MSLN3-CAR-introduced CAR-T cells (G4).
- This is a diagram confirming the change in tumor volume by date. (*p ⁇ 0.05 vs. the vehicle control treated group (G1))
- Figure 12 shows the ovarian cancer (OVCAR-3) mouse model administered with HBSS (G1), Mock (G2), CD19-CAR-T (G3), and anti-MSLN3-CAR-introduced CAR-T cells (G4). It is a diagram confirming the size of the tumor on the 27th day.
- Figure 13 shows the ovarian cancer (OVCAR-3) mouse model administered with HBSS (G1), Mock (G2), CD19-CAR-T (G3), and anti-MSLN3-CAR-introduced CAR-T cells (G4). It is a diagram confirming the weight of the tumor on the 27th day.
- Figure 14 shows the ovarian cancer (OVCAR-3) mouse model administered with HBSS (G1), Mock (G2), CD19-CAR-T (G3), and anti-MSLN3-CAR-introduced CAR-T cells (G4). It is a diagram showing the result of confirming the result of immunohistochemical staining at a magnification of 5x.
- Figure 15 shows the ovarian cancer (OVCAR-3) mouse model administered with HBSS (G1), Mock (G2), CD19-CAR-T (G3), and anti-MSLN3-CAR-introduced CAR-T cells (G4). It is a diagram showing the result of confirming the result of immunohistochemical staining at 20x magnification.
- mesothelin MSLN
- KBIO human synthetic scFv phage display library KscFv-I was used according to the phage panning protocol established by the Osong Advanced Medical Industry Promotion Foundation New Drug Development Support Center. Phage panning against MSLN (Acro Biosystems) was performed up to 4 rounds.
- the phage display antibody library panning process is schematically shown in FIG. 1 .
- Panning was performed in two ways (solid and bead) depending on the method of immobilizing the antigen.
- solid phase panning immunization with 1 mL of human mesothelin protein (in PBS, 1st: 10 ⁇ g/mL, 2nd: 5 ⁇ g/mL, 3rd: 2.5 ⁇ g/mL, 4th: 1.25 ⁇ g/mL) It was fixed in a tube (immuunotube), and 1.3 x 10 13 cfu of the blocked phage library was mixed with 5mL of PBS (MPBS) containing 5% skim milk in the immunotube, and then bound at 37°C for 1.5 hours.
- MPBS PBS
- Example 2 Selection of positive clones through phage-specific ELISA
- the plate contents were removed and the plate was blocked with 150 ⁇ L of 5% MPBS for 1 hour at room temperature. Then, the contents of the plate were removed, and 30 ⁇ L of phage ( ⁇ 10 11 cfu) was added and incubated for 1.5 hours at room temperature. For negative control, 30 ⁇ L of PBS was added instead of phage.
- PBS-T PBS-0.05% Tween 20
- anti-M13-HRP diluted 1:5,000 in PBS
- the plate was washed 4 times with PBS-T solution, and 30 ⁇ L of TMB substrate reagent was added to each well and incubated for 8 minutes at room temperature to induce a color reaction. After stopping the color reaction by adding 30 ⁇ L of 2N H 2 SO 4 per well, absorbance (OD) at 450 nm was measured.
- Example 3 In order to determine whether the 19 phage clones selected in Example 3 bind to mesothelin present in the actual cell membrane, flow cytometry was performed using the pancreatic cancer cell line AsPC-1, a mesothelin overexpressing cell line, and the human chronic myeloid leukemia cell line K562 as a control. A flow cytometry analysis was performed.
- K562 and AsPC-1 cells were prepared to be 10 6 cells/well and washed with 300 ⁇ L of PBS. Cells were blocked for 30 minutes at 4°C with 300 ⁇ L of 4% MPBS, and at the same time, phage clones (10 12 /well) were blocked for 1 hour at room temperature, and then the phages and cells were incubated together at 4°C for 2 hours. After washing the cells with PBS, the cells were treated with 1 ⁇ g/mL of anti-M13-FITC and incubated at 4° C. for 1 hour. After washing the cells with PBS, the cells were resuspended in PBS and the results were analyzed using a flow cytometer (BD biosciences). The results are shown in Figures 4 and 5.
- MSLN3, MSLN6, and MSLN10 exhibited a relative peak shift value of 3.0% or more in the pancreatic cancer cell line AsPC-1. In the control K562 cell line, no significant peak shift was observed. From the above results, it was found that among the 19 clones, MSLN3, MSLN6 and MSLN10 showed high binding affinity to mesothelin present in the actual cell membrane.
- MSLN3, MSLN6, and MSLN10 showed relative peak shift values of 23.8%, 7.2%, and 4.8%, respectively, compared to the control K562 cells.
- all three clones specifically bind to the cell line in which mesothelin is overexpressed, and finally selected as clones for producing anti-MSLN antibody fragments.
- Example 6 Affinity analysis of anti-MSLN antibodies to antigens and selection of clones to be used as final anti-MSLN chimeric antigen receptors
- the affinity of each antibody to the antigen MSLN was compared and analyzed through ELISA using the three anti-MSLN antibody proteins prepared in Example 5 above. Specifically, a MaxiSorb ELISA plate (Nunc) was coated with 30 ⁇ L of human mesothelin protein at a concentration of 1 ⁇ g/mL per well and incubated at 4° C. overnight. Plate contents were removed and plates were blocked with 300 ⁇ L of 5% MPBS for 1 hour at room temperature. The purified antibody was serially diluted in PBS, and 30 ⁇ L was added to each well and incubated for 2 hours at room temperature. As a negative control, 60 ⁇ L of PBS was added instead of the purified antibody and incubated at 37° C. for 2 hours.
- the EC 50 values of the three antibodies were 145 nM, 67 nM, and 91 nM for MSLN3, MSLN6, and MSLN10, respectively, confirming that MSLN3 showed the highest binding affinity among the three antibodies (see Table 4 below). ).
- the MSLN3 was finally selected as a clone for producing an anti-MSLN antibody fragment, and the amino acid sequence of MSLN3 was confirmed and shown in Table 5 below.
- the heavy chain CDR1-3 amino acid sequence of MSLN3 is shown in SEQ ID NOS: 1 to 3
- the light chain CDR1-3 amino acid sequence is shown in SEQ ID NOS: 4 to 6, respectively
- the heavy chain amino acid sequence and light chain amino acid sequence are shown in SEQ ID NOS: 7 and 8, respectively. shown in
- Heavy chain CDR1-3 and light chain CDR1-3 amino acid sequences of MSLN3 from MSLN3 clones area amino acid sequence sequence number HCDR1 DYAMS One HCDR2 AISSSGGTTYYADSVKG 2 HCDR3 EEEGEWREYFDV 3 LCDR1 RASQSISSYLN 4 LCDR2 ATSTLQS 5 LCDR3 QQSYTFPYT 6 VH EVQLVESGGGLVQPGGSLRLSCAASGFTFSDYAMSWVRQAPGKGLEWVSAISSSGGTTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKEEEGEWREYFDVWGQGTLVTVSS 7 VL DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYATSTLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQSYTFPYTFGQGTKVEIK 8
- anti-MSLN-CAR anti-MSLN chimeric antigen receptor
- the vector belongs to the second-generation CAR lentiviral vector (pLV lentiviral vector) system possessed by the New Drug Development Support Center, and the system includes pMDLg / pRRE (addgene) encoding gag / pol, envelope encoding Rev protein ) plasmid pRSV-Rev (addgene) and the envelope plasmid pMD2.G (addgene) encoding the VSV-G protein.
- pMDLg / pRRE addgene
- pRSV-Rev addgene
- pMD2.G addgene
- Example 6 gene cloning was performed on the anti-MSLN scFv (antigen-binding domain) prepared in Example 6.
- Each anti-MSLN scFv and lentiviral vector of MSLN3 was digested with XhoI (R0146S, NEB) and EcoRI (R0101, NEB) at 37°C for 2 hours, subjected to agarose gel electrophoresis, and the identified products Purification was performed using FavorPrep Gel/PCR purification Mini kit (Favorgen).
- Each purified anti-MSLN scFv (100 ng) and vector (50 ng) were reacted at a ratio of 2:1 at 16 ° C for 16 hours to ligation, and then transformed into Stbl3 competent cells to form colonies was obtained.
- the colony was picked and grown in 5 mL of LB medium (ampicillin) to obtain plasmid DNA using a DNA plasmid mini-prep method.
- the plasmid DNA was digested with XhoI and EcoRI to confirm whether each inserted anti-MSLN scFv was well cloned into the vector. Afterwards, sequencing was performed to finally confirm the DNA sequence.
- the CD8 hinge and CD8 TM transmembrane as transmembrane regions
- the cytoplasmic region of 4-1BB as a signaling domain
- the intracellular domain of CD3 zeta (CD3z) as a T cell activation domain
- CD8 signal peptide SEQ ID NO: 10
- anti-MSLN3 scFv SEQ ID NO: 11
- CD8 hinge region SEQ ID NO: 12
- CD8 transmembrane region SEQ ID NO: 13
- 4-1BB It consists of a signaling domain (SEQ ID NO: 14) and a CD3 zeta signaling domain (SEQ ID NO: 15).
- SEQ ID NO: 14 signaling domain
- CD3 zeta signaling domain SEQ ID NO: 15
- the anti-MSLN-CAR lentivirus was produced by introducing the recombinant vector prepared in Example 7-1 into HEK293T cells.
- a schematic diagram of an anti-MSLN-CAR expression system according to one aspect comprising an MSLN-specific antigen-binding domain is shown in FIG. 8 .
- HEK293T cells were seeded in 100 mm tissue culture dishes at 6 x 10 6 cells/dish.
- MSLN-CAR-pLV, pMDLg/pRRE (addgene), pRSV-Rev (addgene), pMD2 were treated with Lipofectamine 3000 (Thermofisher) according to the reagent instructions. Transformation of .G (addgene) (5.5 ⁇ g:3.5 ⁇ g:1.5 ⁇ g:2 ⁇ g) was performed. CD19 (FMC63) was used as a control. After 4 hours of transformation, the medium was replaced with DMEM medium containing 3% FBS (Gibco), and the virus culture medium was harvested after 48 hours.
- Anti-CD3 (1 ⁇ g/mL) and anti-CD28 (3 ⁇ g/mL) antibodies were prepared in 5 mL of DPBS to the designated concentrations, vortexed, and then coated on a 24-well plate at 500 ⁇ l/well and stored overnight in a refrigerator at 4°C. did The next day, PBMC (primary human PBMC) was dissolved in 9 mL of T cell culture medium (10% FBS + RPMI1640 + 200 IU IL-2) and centrifuged at 1,500 rpm for 5 minutes.
- the supernatant was removed, resuspended in 1 mL of the culture medium, and cell counting was performed, diluted to 1 x 10 6 cells/mL, seeded in an antibody-coated 24-well plate, and cultured in a CO 2 incubator at 37°C. .
- all the PBMC cells were harvested, and the lentivirus was adjusted to an MOI (multiple of infection) of 5 at 5 x 10 5 cells/500 ⁇ L for lentiviral infection, and 10 ⁇ g/mL of protamine sulfate was added to infect new cells.
- 24-well plates were seeded (a). The 24-well plate was centrifuged at 300 g and 32° C. for 90 minutes, and then placed in a 37° C.
- T cells into which the anti-MSLN-CAR prepared in Example 8-1 was introduced Five days after the completion of lentiviral transduction of T cells, some anti-MSLN-CAR-T cells were harvested, biotin-MSLN (Acrobiosystems or Biolegend) was added, and incubated on ice for 20 minutes, the cells were washed, and PE-antibody - Add 1 ⁇ L of biotin and incubate on ice for 20 minutes. After washing the cells, the CAR expression rate was confirmed using FACS Canto II (BD), which is shown in FIG. 9A and Table 7.
- BD FACS Canto II
- Example 9 Confirmation of cancer cell killing effect of anti-MSLN-CAR-T cells based on tumor animal model
- the cells used in the ovarian cancer animal model were tested for Mycoplasma pneumoniae , Murine coronavirus (Mouse hepatitis virus, MHV), and Murine respirovirus (Sendai virus, SeV) and were confirmed negative before use.
- a medium composed of RPMI 1640, 20% FBS, and 1% P/S (penicillin/streptomycin) the cells were cultured in a CO 2 incubator at 37° C. and 5% CO 2 conditions.
- RPMI 1640 (LM01 51, Welgene) medium was used.
- the transplanted cancer cells and CAR-T cells and the composition of the test group are shown in Table 8 below.
- Cell concentration was adjusted using PBS, and 200 ⁇ L of each cell was subcutaneously implanted into mice, and groups were separated by random distribution method based on tumor size. Individual identification was performed using the ear-punch method during the test period, and An identification card was attached to each group.
- anti-MSLN-CAR-T cells were administered single-dose through a tail vein, and the body weight, tumor size, tumor volume, and tumor weight of the test group were measured twice a week from the start of administration.
- Weight gain was calculated using the formula below.
- Tumor volume (mm 3 ) was calculated using the following formula after measuring the short axis (A) and long axis (B) of the tumor using calipers.
- the tumor volume of the anti-MSLN3-CAR-T administration group which is the G4 group compared to the G1, G2, and G3 groups, hardly increased from the day of administration, and the tumor began to decrease from the 8th day after administration. A decreasing trend was confirmed.
- Figure 12 is a visual confirmation of the tumor size of each test group and control group on day 27 after CAR-T cell administration, and as confirmed in Figure 12, it was confirmed that the tumor size of the G4 group was significantly smaller than that of the G1 control group. .
- tumor weight did not increase after CAR-T administration, and tumor volume, tumor size and tumor It was confirmed that the weight of was also significantly decreased, confirming the cancer cell killing effect of anti-MSLN3-CAR-T in an ovarian cancer animal model expressing mesothelin.
- a single dose of anti-MSLN-CAR-T cells was administered intravenously, and anesthesia was induced by intraperitoneal injection of 50 mg/kg of Zoletil TM and 10 mg/kg of Xylazine, and the peritoneal cavity was induced. Euthanasia was performed by exsanguination after blood was drawn from the abdominal vena cava by opening the stomach. Thereafter, 3 cells per group were randomly selected, and some of the isolated tumors were fixed in 10% neutral formalin, and then slides were prepared and immunohistochemical staining (Immunohistochemistry: IHC) was performed for hCD3 ⁇ (cell signaling, Cat. No 58061). .
- IHC immunohistochemical staining
- intratumoral T cell infiltration was confirmed in the G2, G3, and G4 groups, and it was confirmed that the prepared MSLN-CAR-T cells effectively infiltrated intratumoral T cells.
- the tumor was in a very small state at the time of autopsy, and it was confirmed that the tumor was completely remitted (CR).
- CR remitted
- necrosis was confirmed in the tumor. Therefore, overall, it was confirmed that T cell infiltration into tumors was relatively high in a large number of individuals in the G4 group to which MSLN-CAR-T was administered.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Cell Biology (AREA)
- Genetics & Genomics (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Pharmacology & Pharmacy (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Epidemiology (AREA)
- Zoology (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Gastroenterology & Hepatology (AREA)
- Toxicology (AREA)
- Oncology (AREA)
- Engineering & Computer Science (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Biomedical Technology (AREA)
- Biotechnology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Engineering & Computer Science (AREA)
- Wood Science & Technology (AREA)
- Hospice & Palliative Care (AREA)
- Reproductive Health (AREA)
- Physics & Mathematics (AREA)
- Plant Pathology (AREA)
- Gynecology & Obstetrics (AREA)
- Pregnancy & Childbirth (AREA)
- Peptides Or Proteins (AREA)
Abstract
Description
3회차 패닝 (3 Round) |
흡광도 (450nm) | 양성 클론 (positive clone)의 수 | 특이 클론 (unique clone)의 수 |
3R-1 | > 0.7 | 35 | 6 |
3R-2 | > 0.7 | 4 | 1 |
3R-3 | > 0.7 | 8 | 2 |
3R-4 | > 0.5 | 34 | 9 |
3R-5 | > 0.5 | 24 | 2 |
총합 | 105 | 20 |
4회차 패닝 (4 Round) |
흡광도 (450nm) | 양성 클론 (positive clone)의 수 | 특이 클론 (unique clone)의 수 |
4R-1 | > 0.7 | 6 | 1 |
4R-2 | > 0.7 | 2 | 0 |
4R-3 | > 0.7 | 7 | 1 |
총합 | 15 | 2 |
3 + 4회차 패닝 | 총합 |
양성 클론 (positive clone)의 수 | 120 |
특이 클론 (unique clone)의 수 | 22 |
순위 | MSLN 클론 | R2 | EC50 (nM) |
1 | 3 | 0.999 | 145 |
2 | 10 | 0.988 | 91 |
3 | 6 | 0.988 | 67 |
영역 | 아미노산 서열 | 서열번호 | |
HCDR1 | DYAMS | 1 | |
HCDR2 | AISSSGGTTYYADSVKG | 2 | |
HCDR3 | EEEGEWREYFDV | 3 | |
LCDR1 | RASQSISSYLN | 4 | |
LCDR2 | ATSTLQS | 5 | |
LCDR3 | QQSYTFPYT | 6 | |
VH | EVQLVESGGGLVQPGGSLRLSCAASGFTFSDYAMSWVRQAPGKGLEWVSAISSSGGTTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKEEEGEWREYFDVWGQGTLVTVSS | 7 | |
VL | DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYATSTLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYTFPYTFGQGTKVEIK | 8 |
이름 | 염기서열 (5'-3') | 서열번호 |
CD8 | ATGGCCTTACCAGTGACCGCCTTGCTCCTGCCGCTGGCCTTGCTGCTCCACGCCGCCAGGCCG | 10 |
MSLN3 scFv | GAAGTACAGTTGGTCGAAAGTGGCGGTGGCCTCGTGCAACCGGGTGGTTCACTGCGTCTGAGCTGCGCCGCCTCGGGTTTTACTTTCTCTGATTATGCAATGTCTTGGGTTCGTCAGGCGCCGGGCAAGGGTCTCGAATGGGTTTCAGCAATCTCTTCTTCTGGTGGTACTACTTACTATGCCGATTCAGTGAAGGGTCGCTTTACCATTTCCCGTGACAACTCTAAGAATACTCTGTATCTGCAGATGAACTCGCTGCGTGCCGAAGACACGGCCGTCTATTATTGCGCCAAAGAAGAAGAAGGTGAATGGCGTGAATACTTCGATGTTTGGGGTCAGGGCACTTTAGTGACCGTCTCATCGGGTGGAGGCGGTTCAGGCGGAGGTGGATCCGGCGGTGGCGGATCGGACATTCAAATGACGCAGAGTCCCTCCTCACTGAGTGCTAGCGTGGGCGATCGTGTGACAATTACTTGTCGCGCTAGCCAGTCTATCTCTTCTTACCTGAACTGGTATCAGCAGAAACCGGGCAAGGCGCCAAAATTGCTGATTTACGCAACTTCCACTCTGCAGTCTGGTGTACCGTCCCGTTTCTCTGGCAGCGGTTCTGGTACGGATTTTACCCTGACCATCTCAAGCCTCCAGCCTGAAGATTTTGCCACCTATTATTGTCAGCAATCTTACACTTTTCCGTACACGTTCGGGCAGGGAACTAAAGTGGAAATTAAAGCCAGCACC | 11 |
CD8 hinge | ACCACGACGCCAGCGCCGCGACCACCAACACCGGCGCCCACCATCGCGTCGCAGCCCCTGTCCCTGCGCCCAGAGGCGTGCCGGCCAGCGGCGGGGGGCGCAGTGCACACGAGGGGGCTGGACTTCGCCTGTGAT | 12 |
CD8 TM | ATCTACATCTGGGCGCCCTTGGCCGGGACTTGTGGGGTCCTTCTCCTGTCACTGGTTATCACCCTTTACTGC | 13 |
4-1BB | AAACGGGGCAGAAAGAAACTCCTGTATATATTCAAACAACCATTTATGAGACCAGTACAAACTACTCAAGAGGAAGATGGCTGTAGCTGCCGATTTCCAGAAGAAGAAGAAGGAGGATGTGAACTG | 14 |
CD3z | AGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACACAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGAGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGC | 15 |
클론 | CAR 발현 % |
CD19 (FMC63) | 50.8% |
MSLN3 CAR scFv | 30.6% |
그룹 | N수 | 세포주 (세포수/마리) |
투여 물질 | 투여 경로 |
용량 (CAR-Ts/마리) |
부피 |
G1 | 6 | OVCAR-3 (1x107) |
HBSS | I.V | - | 200μL |
G2 | 6 | Mock | - | |||
G3 | 6 | CD19-CAR-T | 5 x 106 | |||
G4 | 6 | 항-MSLN3-CAR-T | 5 x 106 |
Claims (16)
- 서열번호 1로 이루어진 아미노산 서열을 포함하는 중쇄 CDR1, 서열번호 2로 이루어진 아미노산 서열을 포함하는 중쇄 CDR2 및 서열번호 3으로 이루어진 아미노산 서열을 포함하는 중쇄 CDR3을 포함하는 중쇄 가변영역; 및서열번호 4로 이루어진 아미노산 서열을 포함하는 경쇄 CDR1, 서열번호 5로 이루어진 아미노산 서열을 포함하는 경쇄 CDR2 및 서열번호 6으로 이루어진 아미노산 서열을 포함하는 경쇄 CDR3을 포함하는 경쇄 가변영역을 포함하는 항-메소텔린 항체 또는 이의 항원 결합 단편.
- 청구항 1에 있어서,서열번호 7로 이루어진 아미노산 서열을 포함하는 중쇄 가변영역을 포함하는 것인, 항-메소텔린 항체 또는 이의 항원 결합 단편.
- 청구항 1에 있어서,서열번호 8로 이루어진 아미노산 서열을 포함하는 경쇄 가변영역을 포함하는 것인, 항-메소텔린 항체 또는 이의 항원 결합 단편.
- 청구항 1에 있어서,서열번호 7로 이루어진 아미노산 서열을 포함하는 중쇄 가변영역 및 서열번호 8로 이루어진 아미노산 서열을 포함하는 경쇄 가변영역을 포함하는 것인, 항-메소텔린 항체 또는 이의 항원 결합 단편.
- 청구항 1 내지 4 중 어느 한 항에 따른 항체 또는 이의 항원 결합 단편을 코딩하는 분리된 핵산.
- 청구항 5의 분리된 핵산을 포함하는 벡터.
- 청구항 6의 벡터로 형질전환된 분리된 숙주세포.
- 청구항 7의 숙주세포를 배양하여 항체를 발현시키는 단계를 포함하는 항-메소텔린 항체를 제조하는 방법.
- 항원 결합 도메인, 힌지 (hinge) 도메인, 막관통 도메인 및 세포내 신호전달 도메인을 포함하는 키메릭 항원 수용체로서,상기 항원 결합 도메인은 서열번호 1로 이루어진 아미노산 서열을 포함하는 중쇄 CDR1, 서열번호 2로 이루어진 아미노산 서열을 포함하는 중쇄 CDR2 및 서열번호 3으로 이루어진 아미노산 서열을 포함하는 중쇄 CDR3을 포함하는 중쇄 가변영역; 및서열번호 4로 이루어진 아미노산 서열을 포함하는 경쇄 CDR1, 서열번호 5로 이루어진 아미노산 서열을 포함하는 경쇄 CDR2 및 서열번호 6으로 이루어진 아미노산 서열을 포함하는 경쇄 CDR3을 포함하는 경쇄 가변영역을 포함하는 항-메소텔린 항체 또는 이의 항원 결합 단편인 키메릭 항원 수용체.
- 청구항 9에 있어서,상기 항원 결합 도메인은 서열번호 7로 이루어진 아미노산 서열을 포함하는 중쇄 가변영역 및 서열번호 8로 이루어진 아미노산 서열을 포함하는 경쇄 가변영역을 포함하는 항-메소텔린 항체 또는 이의 항원 결합 단편인 것인, 키메릭 항원 수용체.
- 청구항 9에 있어서,상기 항원 결합 단편은 scFv (single chain variable fragment)인 것인, 키메릭 항원 수용체.
- 청구항 9의 키메릭 항원 수용체를 코딩하는 폴리뉴클레오티드.
- 청구항 12의 폴리뉴클레오티드를 포함하는 벡터.
- 청구항 13의 벡터로 형질전환된 분리된 세포.
- 청구항 14에 있어서,상기 세포는 T 세포, NK 세포, NKT 세포 또는 감마델타 T 세포 (gamma delta (γδ) T cells)인 것인, 분리된 세포.
- 청구항 15의 분리된 세포를 포함하는 암의 예방 또는 치료용 약학적 조성물.
Priority Applications (6)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CA3201255A CA3201255C (en) | 2021-05-26 | 2022-05-25 | Chimeric antigen receptor comprising anti-mesothelin scfv, and use thereof |
JP2023534124A JP7487989B2 (ja) | 2021-05-26 | 2022-05-25 | 抗メソテリンscFvを含むキメリック抗原受容体及びその用途 |
CN202280007899.2A CN116635406B (zh) | 2021-05-26 | 2022-05-25 | 一种包括抗间皮素scFv的嵌合抗原受体及其用途 |
AU2022279862A AU2022279862B2 (en) | 2021-05-26 | 2022-05-25 | Chimeric antigen receptor comprising anti-mesothelin scfv, and use thereof |
EP22811641.4A EP4242235A4 (en) | 2021-05-26 | 2022-05-25 | CHIMERIC ANTIGEN RECEPTOR COMPRISING AN ANTI-MESOTHELIN SCFV, AND ITS USE |
US18/255,814 US11883433B1 (en) | 2021-05-26 | 2022-05-25 | Chimeric antigen receptor comprising anti-mesothelin scFv, and use thereof |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR10-2021-0067904 | 2021-05-26 | ||
KR20210067904 | 2021-05-26 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2022250450A1 true WO2022250450A1 (ko) | 2022-12-01 |
Family
ID=84228886
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/KR2022/007425 WO2022250450A1 (ko) | 2021-05-26 | 2022-05-25 | 항 메소텔린 scFv를 포함하는 키메릭 항원 수용체 및 이의 용도 |
Country Status (8)
Country | Link |
---|---|
US (1) | US11883433B1 (ko) |
EP (1) | EP4242235A4 (ko) |
JP (1) | JP7487989B2 (ko) |
KR (1) | KR102507337B1 (ko) |
CN (1) | CN116635406B (ko) |
AU (1) | AU2022279862B2 (ko) |
CA (1) | CA3201255C (ko) |
WO (1) | WO2022250450A1 (ko) |
Citations (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
KR20160098259A (ko) * | 2013-12-19 | 2016-08-18 | 노파르티스 아게 | 인간 메조텔린 키메라 항원 수용체 및 그의 용도 |
CN106467573A (zh) * | 2015-08-21 | 2017-03-01 | 科济生物医药(上海)有限公司 | 抗间皮素全人抗体以及靶向间皮素的免疫效应细胞 |
WO2017052241A1 (en) * | 2015-09-24 | 2017-03-30 | Mogam Institute For Biomedical Research | Novel anti-mesothelin antibody and composition comprising the same |
US20190000944A1 (en) * | 2015-12-22 | 2019-01-03 | Novartis Ag | Mesothelin chimeric antigen receptor (car) and antibody against pd-l1 inhibitor for combined use in anticancer therapy |
KR20200090598A (ko) * | 2019-06-27 | 2020-07-29 | (주)녹십자셀 | 메소텔린 특이적인 키메라 항원 수용체 및 이를 발현하는 t 세포 |
KR102309543B1 (ko) * | 2020-08-04 | 2021-10-07 | 주식회사 셀렌진 | 메소텔린에 특이적으로 결합하는 항-메소텔린 키메릭 항원 수용체 |
Family Cites Families (8)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
RU2714902C2 (ru) * | 2013-12-19 | 2020-02-20 | Новартис Аг | Химерные рецепторы антигена против мезотелина человека и их применение |
EP3151854B1 (en) * | 2014-06-06 | 2020-02-26 | Memorial Sloan Kettering Cancer Center | Mesothelin-targeted chimeric antigen receptors and uses thereof |
IL300964A (en) | 2017-05-12 | 2023-04-01 | Harpoon Therapeutics Inc | mesothelin binding proteins |
WO2020043152A1 (en) * | 2018-08-29 | 2020-03-05 | Nanjing Legend Biotech Co., Ltd. | Anti-mesothelin chimeric antigen receptor (car) constructs and uses thereof |
CN109111528B (zh) * | 2018-09-20 | 2021-06-22 | 杭州普略生物科技有限公司 | 以msln为靶点的嵌合抗原受体 |
KR102070016B1 (ko) * | 2019-01-21 | 2020-01-29 | (주)녹십자셀 | 메소텔린 특이적인 키메라 항원 수용체 및 이를 발현하는 t 세포 |
CN109762844A (zh) * | 2019-01-31 | 2019-05-17 | 北京呈诺医学科技有限公司 | 一种靶标间皮素的car-nk细胞制备方法 |
CN114364702B (zh) * | 2020-08-04 | 2022-09-16 | 细胞基因股份公司 | 与间皮素特异性结合的抗-间皮素嵌合抗原受体 |
-
2022
- 2022-05-25 WO PCT/KR2022/007425 patent/WO2022250450A1/ko active Application Filing
- 2022-05-25 CN CN202280007899.2A patent/CN116635406B/zh active Active
- 2022-05-25 EP EP22811641.4A patent/EP4242235A4/en active Pending
- 2022-05-25 CA CA3201255A patent/CA3201255C/en active Active
- 2022-05-25 US US18/255,814 patent/US11883433B1/en active Active
- 2022-05-25 KR KR1020220064250A patent/KR102507337B1/ko active IP Right Grant
- 2022-05-25 AU AU2022279862A patent/AU2022279862B2/en active Active
- 2022-05-25 JP JP2023534124A patent/JP7487989B2/ja active Active
Patent Citations (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
KR20160098259A (ko) * | 2013-12-19 | 2016-08-18 | 노파르티스 아게 | 인간 메조텔린 키메라 항원 수용체 및 그의 용도 |
CN106467573A (zh) * | 2015-08-21 | 2017-03-01 | 科济生物医药(上海)有限公司 | 抗间皮素全人抗体以及靶向间皮素的免疫效应细胞 |
WO2017052241A1 (en) * | 2015-09-24 | 2017-03-30 | Mogam Institute For Biomedical Research | Novel anti-mesothelin antibody and composition comprising the same |
US20190000944A1 (en) * | 2015-12-22 | 2019-01-03 | Novartis Ag | Mesothelin chimeric antigen receptor (car) and antibody against pd-l1 inhibitor for combined use in anticancer therapy |
KR20200090598A (ko) * | 2019-06-27 | 2020-07-29 | (주)녹십자셀 | 메소텔린 특이적인 키메라 항원 수용체 및 이를 발현하는 t 세포 |
KR102309543B1 (ko) * | 2020-08-04 | 2021-10-07 | 주식회사 셀렌진 | 메소텔린에 특이적으로 결합하는 항-메소텔린 키메릭 항원 수용체 |
Non-Patent Citations (5)
Title |
---|
CANCER DISCOV, vol. 6, no. 2, February 2016 (2016-02-01), pages 133 - 46 |
EUR J HAEMATOL, vol. 79, no. 4, 2007, pages 281 - 286 |
GYNECOL ONCOL, vol. 105, no. 3, 2007, pages 563 - 570 |
J REPROD IMMUNOL, vol. 139, 2020, pages 103115 |
See also references of EP4242235A4 |
Also Published As
Publication number | Publication date |
---|---|
CA3201255A1 (en) | 2022-12-01 |
AU2022279862B2 (en) | 2024-02-29 |
US11883433B1 (en) | 2024-01-30 |
CA3201255C (en) | 2023-11-14 |
JP2023549977A (ja) | 2023-11-29 |
KR102507337B1 (ko) | 2023-03-08 |
EP4242235A1 (en) | 2023-09-13 |
AU2022279862A1 (en) | 2023-06-29 |
CN116635406A (zh) | 2023-08-22 |
KR20220159915A (ko) | 2022-12-05 |
EP4242235A4 (en) | 2024-03-20 |
CN116635406B (zh) | 2024-07-30 |
JP7487989B2 (ja) | 2024-05-21 |
US20240033291A1 (en) | 2024-02-01 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
WO2022030730A1 (ko) | 메소텔린에 특이적으로 결합하는 항-메소텔린 키메릭 항원 수용체 | |
WO2017074074A1 (en) | Novel anti-glypican 3 antibody and pharmaceutical composition containing the same | |
WO2021256724A1 (ko) | Bcma를 표적으로 하는 키메라 항원 수용체 및 이의 용도 | |
US20220010008A1 (en) | Anti-human interleukin 5(il-5) monoclonal antibody and use thereof | |
WO2021210939A1 (ko) | 항-her2 어피바디 및 이를 스위치 분자로 이용하는 스위처블 키메라 항원 수용체 | |
WO2020005003A1 (ko) | Lag-3에 특이적으로 결합하는 단클론항체 및 이의 용도 | |
CN114805582B (zh) | 抗Trop2纳米抗体及其用途 | |
WO2021235696A1 (ko) | Cd22에 특이적인 항체 및 이의 용도 | |
US11795215B2 (en) | Anti-mesothelin chimeric antigen receptor specifically binding to mesothelin | |
WO2024049161A1 (ko) | 신규한 항-pd-l1 키메릭 항원 수용체 및 이를 발현하는 면역세포 | |
WO2018128485A1 (ko) | 항-코티닌 키메릭 항원 수용체를 발현하는 자연살해 세포 | |
KR20220034117A (ko) | 면역 관문 차단 이중특이성 분자 | |
WO2022250450A1 (ko) | 항 메소텔린 scFv를 포함하는 키메릭 항원 수용체 및 이의 용도 | |
WO2023003404A1 (ko) | 신규한 키메릭 항원 수용체 및 이를 발현하는 면역세포 | |
WO2021235697A1 (ko) | Cd22에 특이적인 항체 및 이의 용도 | |
WO2016084993A1 (ko) | 신규 EGFRvIII 항체 및 이를 포함하는 조성물 | |
KR102688113B1 (ko) | 메소텔린에 대한 친화도가 상승된 키메릭 항원 수용체 및 이의 용도 | |
WO2018128486A1 (ko) | Ceacam6에 특이적으로 결합하는 항-ceacam6 키메릭 항원 수용체 | |
WO2023182866A1 (ko) | Hla-g 특이적 항체 및 이의 용도 | |
WO2022231298A1 (ko) | 신규한 항-cd5 키메릭 항원 수용체 및 이를 발현하는 면역세포 | |
WO2021246637A1 (ko) | Cd22에 특이적인 항체 및 이의 용도 | |
WO2022244908A1 (ko) | 항-bcam 항체 또는 그의 항원 결합 단편 | |
WO2021244587A1 (zh) | 一种抗PD-L1/TGF-β融合蛋白 | |
WO2019240523A1 (ko) | 신규 펩티드, 이를 포함하는 키메라 항원 수용체 및 이를 발현하는 면역 세포 | |
CN117264055A (zh) | 一种特异性结合人cd318的vhh抗体或其抗原结合片段及其制备方法和应用 |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22811641 Country of ref document: EP Kind code of ref document: A1 |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2022279862 Country of ref document: AU Ref document number: 202280007899.2 Country of ref document: CN |
|
ENP | Entry into the national phase |
Ref document number: 3201255 Country of ref document: CA |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2023534124 Country of ref document: JP |
|
ENP | Entry into the national phase |
Ref document number: 2022811641 Country of ref document: EP Effective date: 20230605 |
|
ENP | Entry into the national phase |
Ref document number: 2022279862 Country of ref document: AU Date of ref document: 20220525 Kind code of ref document: A |
|
NENP | Non-entry into the national phase |
Ref country code: DE |