WO2018226897A1 - Expression of novel cell tags - Google Patents

Expression of novel cell tags Download PDF

Info

Publication number
WO2018226897A1
WO2018226897A1 PCT/US2018/036357 US2018036357W WO2018226897A1 WO 2018226897 A1 WO2018226897 A1 WO 2018226897A1 US 2018036357 W US2018036357 W US 2018036357W WO 2018226897 A1 WO2018226897 A1 WO 2018226897A1
Authority
WO
WIPO (PCT)
Prior art keywords
polypeptide
seq
polynucleotide
domain
cell
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2018/036357
Other languages
English (en)
French (fr)
Inventor
Rutul SHAH
Peter Emtage
Ramya YARLAGADDA
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Precigen Inc
Original Assignee
Intrexon Corp
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to EP18812776.5A priority Critical patent/EP3635132A4/en
Priority to CA3065930A priority patent/CA3065930A1/en
Priority to IL270990A priority patent/IL270990B2/en
Priority to JP2019567571A priority patent/JP7262403B2/ja
Priority to AU2018281316A priority patent/AU2018281316B2/en
Priority to KR1020207000388A priority patent/KR102557834B1/ko
Priority to KR1020237024368A priority patent/KR102719575B1/ko
Priority to IL306102A priority patent/IL306102B2/en
Priority to CN201880051711.8A priority patent/CN110997920A/zh
Application filed by Intrexon Corp filed Critical Intrexon Corp
Priority to EP25206364.9A priority patent/EP4681734A3/en
Priority to RU2019142086A priority patent/RU2796334C9/ru
Publication of WO2018226897A1 publication Critical patent/WO2018226897A1/en
Anticipated expiration legal-status Critical
Priority to ZA2019/08215A priority patent/ZA201908215B/en
Priority to JP2023063807A priority patent/JP7713486B2/ja
Priority to AU2024205827A priority patent/AU2024205827B2/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/10Transferases (2.)
    • C12N9/12Transferases (2.) transferring phosphorus containing groups, e.g. kinases (2.7)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • A61K35/14Blood; Artificial blood
    • A61K35/17Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/11T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/30Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
    • A61K40/31Chimeric antigen receptors [CAR]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/421Immunoglobulin superfamily
    • A61K40/4211CD19 or B4
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/54Interleukins [IL]
    • C07K14/5443IL-15
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/7051T-cell receptor (TcR)-CD3 complex
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/70521CD28, CD152
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70578NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70592CD52
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70596Molecules with a "CD"-designation not provided for elsewhere
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/71Receptors; Cell surface antigens; Cell surface determinants for growth factors; for growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2887Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against CD20
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/32Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products of oncogenes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y207/00Transferases transferring phosphorus-containing groups (2.7)
    • C12Y207/10Protein-tyrosine kinases (2.7.10)
    • C12Y207/10001Receptor protein-tyrosine kinase (2.7.10.1)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/515Animal cells
    • A61K2039/5156Animal cells expressing foreign proteins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/515Animal cells
    • A61K2039/5158Antigen-pulsed cells, e.g. T-cells
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C07K2317/732Antibody-dependent cellular cytotoxicity [ADCC]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C07K2317/734Complement-dependent cytotoxicity [CDC]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/33Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies

Definitions

  • polypeptide constructs and polynucleotides which can be expressed in cells to address one or more of the above deficiencies.
  • polypeptide construct and polynucleotide encoding the polypeptide construct, the polypeptide construct comprising a truncated variant of a natural polypeptide.
  • the polypeptide construct can further comprise a transmembrane domain or a fragment thereof, a signal peptide and/or a peptide linker.
  • engineered cells expressing the polynucleotides and polypeptide constructs. The engineered cells can express the polypeptide constructs at the cell surface thereby providing for a cell marker (or "cell tag") which in some embodiments uniquely identifies the engineered cells.
  • polypeptide construct and polynucleotide encoding the polypeptide construct, the polypeptide construct comprising a truncated variant of a natural polypeptide and a transmembrane domain.
  • the truncated variant comprises an extracellular domain or portion thereof and a transmembrane domain or portion thereof.
  • the polypeptide construct can comprise a transmembrane domain and a truncated variant derived from different natural proteins.
  • the truncated variant transmembrane domain of a polypeptide construct is a single-pass transmembrane domain.
  • the transmembrane domain of a polypeptide construct is a multiple-pass transmembrane domain.
  • polypeptide construct and a polynucleotide encoding the polypeptide construct, the polypeptide construct including a transmembrane dimerization domain capable of coupling a cell surface polypeptide (e.g., a truncated variant fused to the
  • transmembrane domain at the cell surface to a second cell surface polypeptide.
  • the coupling of cell surface polypeptides via a transmembrane dimerization domain can amplify a signal originating at the cell surface polypeptides relative to a non- dimerized configuration.
  • a polypeptide construct described herein can comprise a truncated variant of a natural polypeptide, a transmembrane domain, an optional peptide linker connecting the truncated variant to the transmembrane domain, and a signal peptide directing the polypeptide construct to a cell surface.
  • a polypeptide construct contains a truncated variant or fragment thereof which is derived from a different natural protein than a transmembrane domain or fragment thereof fused either directly or indirectly to the truncated variant or fragment thereof.
  • a particular domain (e.g. extracellular domain) of a polypeptide construct described herein is chimeric and contains amino acid sequences derived from different natural proteins.
  • compositions comprising a polypeptide construct including a cell surface polypeptide and a trans-membrane dimerization domain, wherein the trans-membrane dimerization domain induces dimerization of the cell surface polypeptide and the cell surface polypeptide binds a predetermined antibody or a variant or fragment thereof.
  • cell tags that include truncated variants of polypeptides, such as HERl, CD20, LNGFR and CD52.
  • the truncated variants of the polypeptides do not bind an endogenous receptor.
  • the disclosed truncated non-immunogenic polypeptides can be used as cell tags for example as a cell marker, depletion marker or kill tag.
  • compositions comprising engineered cells that express polypeptide constructs or polynucleotides as described herein.
  • the engineered cells further express at least one of a chimeric antigen receptor (CAR), a T-cell receptor (TCR) and/or a cytokine.
  • CAR chimeric antigen receptor
  • TCR T-cell receptor
  • kits for use in the methods comprising a cell surface polypeptide and a transmembrane dimerization domain, wherein said trans-membrane dimerization domain induces dimerization of said cell surface polypeptide, and wherein said cell surface polypeptide binds a predetermined antibody or a variant or fragment thereof.
  • said cell surface polypeptide comprises at least one of a HERl polypeptide, a LNGFR polypeptide, a CD20 polypeptide and a CD52 polypeptide.
  • said cell surface polypeptide comprises a HERl polypeptide
  • said HER 1 polypeptide comprises a polypeptide sequence which has at least 70%, 75%, 80%, 85%, 90%, 95%, 99% or 99.5% identity to a sequence shown in SEQ ID Nos: :211, 212, 213, 214, 215, 216 or 217.
  • said HERl polypeptide comprises a polypeptide sequence comprising a sequence shown in SEQ ID NOs: 211, 212, 213, 214, 215, 216 or 217.
  • said cell surface polypeptide comprises a CD20 polypeptide
  • said CD20 polypeptide comprises a polypeptide sequence which has at least 70%, 75%, 80%, 85%, 90%, 95%, 99% or 99.5% identity to a sequence shown in SEQ ID NO:218, SEQ ID NO:219 or SEQ ID NO:220.
  • said CD20 polypeptide comprises a polypeptide sequence comprising a sequence shown in SEQ ID NO:218, SEQ ID NO:219 or SEQ ID
  • said cell surface polypeptide comprises a LNGFR polypeptide
  • said LNGFR polypeptide comprises a polypeptide sequence which has at least 70%, 75%, 80%, 85%, 90%, 95%, 99% or 99.5% identity to a sequence shown in SEQ ID NO: 156, SEQ ID NO: 158 or SEQ ID NO: 160.
  • said cell surface polypeptide comprises a LNGFR polypeptide
  • said LNGFR polypeptide comprises a polypeptide sequence which has at least 70%, 75%, 80%, 85%, 90%, 95%, 99% or 99.5% identity to a sequence shown in SEQ ID NO: 156, SEQ ID NO: 158 or SEQ ID NO: 160.
  • said cell surface polypeptide does not bind an endogenous receptor.
  • said trans-membrane dimerization domain can form either a homodimer or a heterodimer with a complementary dimerization domain.
  • said transmembrane dimerization domain comprises at least one cysteine residue.
  • said trans-membrane dimerization domain comprises a glycophorin A transmembrane domain or fragment or variant thereof, a glycophorin A-integrin ⁇ 3 chimeric transmembrane domain or fragment or variant thereof or a CD3 zeta transmembrane domain.
  • such a cell surface polypeptide comprises at least a HERl polypeptide.
  • said polypeptide construct is expressed in an engineered cell.
  • said engineered cell is an animal cell.
  • said animal cell is a human cell.
  • said human cell is a T cell or K cell.
  • said engineered cell further comprises a Sleeping Beauty transposase.
  • said engineered cell further expresses at least one additional exogenous polypeptide. In some cases, said engineered cell further expresses at least one exogenous receptor polypeptide or fragment thereof. In some instances, said engineered cell further expresses at least one of a chimeric antigen receptor (CAR), a T-cell receptor (TCR) and a cytokine.
  • CAR chimeric antigen receptor
  • TCR T-cell receptor
  • said engineered cell further expresses at least one CAR and wherein said CAR binds at least one of CD19, CD33, BCMA, CD44, a-Folate receptor, CAIX, CD30, RORl, CEA, EGP-2, EGP-40, HER2, HER3, Folate-binding Protein, GD2, GD3, IL-13R- a2, KDR, EDB-F, mesothelin, CD22, EGFR, MUC-1, MUC-16, MAGE-A1, h5T4, PSMA, TAG-72, EGFRvIII, CD123 and VEGF-R2.
  • CAR binds at least one of CD19, CD33, BCMA, CD44, a-Folate receptor, CAIX, CD30, RORl, CEA, EGP-2, EGP-40, HER2, HER3, Folate-binding Protein, GD2, GD3, IL-13R- a2, KDR, EDB-F, mesothelin, CD
  • said engineered cell further expresses at least one recombinant cytokine.
  • said recombinant cytokine comprises at least one of IL-15, mbIL-15, IL-2, IL- 12, and IL-21.
  • said polypeptide construct is encoded by a polynucleotide incorporated into said engineered cell by genome editing.
  • said genome editing comprises use of at least a site specific serine recombinase system.
  • said polypeptide construct comprises a linker that fuses said cell surface polypeptide to said transmembrane dimerization domain.
  • a polypeptide homo-dimer or heterodimer comprises the polypeptide construct.
  • a polynucleotide encoding a polypeptide construct comprising a non- immunogenic cell surface polypeptide fused to a trans-membrane dimerization domain, wherein said trans-membrane dimerization domain induces dimerization of said cell surface polypeptide.
  • said cell surface polypeptide does not bind an endogenous receptor. In some cases, said cell surface polypeptide does not contain any endogenous signaling or trafficking functions.
  • said polynucleotide comprises at least one sequence encoding at least one heterologous gene.
  • said at least one heterologous gene is modulated by an inducible promoter.
  • said at least one heterologous gene comprises at least one of a chimeric antigen receptor (CAR), a T-cell receptor (TCR) and a cytokine.
  • said at least one heterologous gene comprises said CAR, and wherein said CAR binds at least one of CD19, CD33, BCMA, CD44, a-Folate receptor, CAIX, CD30, RORl, CEA, EGP-2, EGP-40, HER2, HER3, Folate-binding Protein, GD2, GD3, IL-13R-a2, KDR, EDB-F, mesothelin, CD22, EGFR, MUC-1, MUC-16, MAGE-A1, h5T4, PSMA, TAG-72, EGFRvIII, CD123 and VEGF-R2.
  • said at least one heterologous gene comprises a cytokine.
  • said cytokine comprises at least one of IL-15, IL-2, IL-12, IL-21, and a fusion of IL- 15 and IL-15Roc.
  • said cytokine is in secreted form. In some instances, said cytokine is in membrane bound form.
  • said polynucleotide comprises at least one sequence comprising a polypeptide linker selected from the group consisting of 2A, GSG-2A, GSG linker (SEQ ID NO: 16), SGSG linker (SEQ ID NO: 18), furinlink variants and derivatives thereof.
  • said 2A linker is a p2A linker a T2A linker, F2A linker or E2A linker.
  • said polypeptide construct acts as a tag to enrich cells, select cells, or induce cell death in cells expressing said cell surface molecule.
  • said cell surface polypeptide comprises at least one of a HERl polypeptide, a LNGFR polypeptide, a CD20 polypeptide and a CD52 polypeptide.
  • said trans-membrane dimerization domain comprises a glycophorin A transmembrane domain or fragment or variant thereof, a glycophorin A-integrin ⁇ 3 chimeric transmembrane domain or fragment or variant thereof, or a CD3 zeta transmembrane domain.
  • a vector comprises the polynucleotide.
  • said vector is a lentivirus vector, a retroviral vector, or a non-viral vector.
  • the non-viral vector is a Sleeping Beauty transposon.
  • said polynucleotide is incorporated into an engineered cell by genome editing.
  • said genome editing comprises use of at least a site specific serine recombinase system.
  • a method of regulating activity of genetically engineered cells in a subject comprising: providing to said subject an amount of genetically engineered cells encoding a polypeptide construct comprising a cell surface polypeptide fused to a trans-membrane dimerization domain, wherein said trans-membrane dimerization domain induces dimerization of said cell surface polypeptide, and wherein said cell surface polypeptide binds a predetermined binding partner or a variant or fragment thereof; and providing to said subject said predetermined binding partner in an amount sufficient to bind and thereby regulating activity of said genetically engineered cells.
  • said cell surface polypeptide is a non-immunogenic polypeptide.
  • said cell surface polypeptide comprises at least one of a HERl polypeptide, a LNGFR polypeptide, a CD20 polypeptide and a CD52 polypeptide.
  • said cell surface polypeptide does not bind an endogenous receptor.
  • said trans-membrane dimerization domain can form either a homodimer or a heterodimer with a complementary dimerization domain.
  • said trans-membrane dimerization domain comprises at least one cysteine residue.
  • said trans-membrane dimerization domain comprises a glycophorin A transmembrane domain or fragment or variant thereof, a glycophorin A-integrin ⁇ 3 chimeric transmembrane domain or fragment or variant thereof, or a CD3 zeta transmembrane domain.
  • said binding partner comprises an antibody, or cell surface polypeptide binding region thereof.
  • said antibody comprises at least one of:
  • said antibody comprises at least one of: rituximab, cetuximab, alemtuzumab, panitumumab and necitumumab.
  • said genetically engineered cells comprise at least one of: T cells and K cells. In some embodiments, at least one of said genetically engineered cells further expresses at least one additional exogenous polypeptide. In some instances, at least one of said genetically engineered cells further expresses at least one of a chimeric antigen receptor (CAR), a T-cell receptor (TCR) and a cytokine.
  • CAR chimeric antigen receptor
  • TCR T-cell receptor
  • cytokine cytokine
  • At least one of said genetically engineered cells further expresses at least one CAR and wherein said CAR binds at least one of CD 19, CD33, BCMA, CD44, a-Folate receptor, CAIX, CD30, ROR1, CEA, EGP-2, EGP-40, HER2, HER3, Folate-binding Protein, GD2, GD3, IL-13R-a2, KDR, EDB-F, mesothelin, CD22, EGFR, MUC-1, MUC-16, MAGE-A1, h5T4, PSMA, TAG-72, EGFRvIII, CD123 and VEGF-R2.
  • At least one of said genetically engineered cells further expresses at least one recombinant cytokine.
  • said recombinant cytokine comprises at least one of IL-15, mbIL-15, IL-2, IL-12, and IL-21.
  • said predetermined binding partner is provided in an amount sufficient to cause a reduction in at least one symptom associated with a cytokine storm or a systemic inflammatory response.
  • said predetermined binding partner is provided in an amount sufficient to cause a reduction in at least one symptom associated with tumor lysis syndrome.
  • said polypeptide construct is encoded by a polynucleotide incorporated into said engineered cells by genome editing.
  • said genome editing comprises use of at least a site specific serine recombinase system.
  • a polynucleotide encoding a truncated non-immunogenic CD20 polypeptide that binds an anti-CD20 antibody, wherein said truncated non-immunogenic CD20 polypeptide does not bind an endogenous receptor.
  • said CD20 polypeptide comprises a polypeptide sequence which has at least 70%, 75%, 80%, 85%, 90%, 95%, 99% or 99.5% identity to the sequence shown in SEQ ID NO: 109. In some cases, said CD20 polypeptide comprises a polypeptide sequence comprising the sequence of SEQ ID NO: 109. In some instances, said CD20 polypeptide binds said anti-CD20 antibody with at least 50%, 60%, 70%, 80% or 90% the binding efficiency as native CD20. In some embodiments, said anti-CD20 antibody comprises at least one of:
  • rituximab cetuximab, tositumomab, veltuzumab, afutuzumab, blontuvetmab and obinutuzumab.
  • HERl polypeptide consisting of at least a HERl Domain III or fragment thereof, and a truncated HERl Domain IV, wherein said HERl polypeptide binds an anti-HERl antibody, and wherein said HERl polypeptide is expressed in an engineered cell.
  • said truncated HERl Domain IV comprises a truncation of at least 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45% or 50% of said HERl Domain IV.
  • said truncated HERl Domain IV comprises a polypeptide sequence which has at least 70%, 75%, 80%, 85%, 90%, 95%, 99% or 99.5% identity to a sequence shown in SEQ ID NOs:203, 204, 205, 206, 207, 208 or 209.
  • said truncated HERl Domain IV comprises a polypeptide sequence comprising a sequence shown in SEQ ID NOs: 203, 204, 205, 206, 207, 208 or 209.
  • said HERl Domain III or fragment thereof comprises a polypeptide sequence which has at least 70%, 75%, 80%, 85%, 90%, 95%, 99% or 99.5%) identity to the sequence shown in SEQ ID NO:200. In some cases, said HERl Domain III comprises a polypeptide sequence comprising the sequence shown in SEQ ID NO:200.
  • said polynucleotide further encodes a CD28 trans-membrane domain and a peptide linker for coupling said HERl polypeptide to said CD28 trans-membrane domain.
  • said polynucleotide encodes a polypeptide construct comprising a polypeptide sequence comprising the sequence shown in SEQ ID NO:57.
  • said anti- HERl antibody comprises at least one of: rituximab, cetuximab, futuximab, depatuxizumab, imgatuzumab, laprituximab, matuzumab, necitumumab, nimotuzumab, panitumumab, and zalutumumab.
  • a polynucleotide encoding a truncated non-immunogenic CD52 polypeptide that binds an anti-CD52 antibody, wherein said truncated non-immunogenic CD52 polypeptide does not bind an endogenous receptor, and wherein said non-immunogenic CD52 polypeptide is expressed in an engineered cell.
  • said CD52 polypeptide comprises a polypeptide sequence which has at least 70%, 75%, 80%, 85%, 90%, 95%, 99% or 99.5% identity to the sequence shown in SEQ ID NO: 143. In some instances, said CD52 polypeptide comprises a polypeptide sequence comprising the sequence shown in SEQ ID NO: 143.
  • a polynucleotide is expressed in a cell further comprising at least one sequence encoding at least one heterologous gene.
  • said at least one heterologous gene is modulated by an inducible promoter.
  • said at least one heterologous gene comprises at least one of a chimeric antigen receptor (CAR), a T-cell receptor (TCR) and a cytokine.
  • said at least one heterologous gene comprises a CAR, and wherein said CAR binds at least one of CD19, CD33, BCMA, CD44, a-Folate receptor, CAIX, CD30, ROR1, CEA, EGP-2, EGP-40, HER2, HER3, Folate-binding Protein, GD2, GD3, IL-13R-a2, KDR, EDB-F, mesothelin, CD22, EGFR, MUC-1, MUC-16, MAGE-A1, h5T4, PSMA, TAG-72, EGFRvIII, CD123 and VEGF-R2.
  • CAR binds at least one of CD19, CD33, BCMA, CD44, a-Folate receptor, CAIX, CD30, ROR1, CEA, EGP-2, EGP-40, HER2, HER3, Folate-binding Protein, GD2, GD3, IL-13R-a2, KDR, EDB-F, mesothelin, CD22,
  • said at least one heterologous gene comprises a cytokine.
  • said cytokine comprises at least one of IL-15, IL-2, IL-12, IL-21, and a fusion of IL-15 and IL-15Roc.
  • said cytokine is in secreted form.
  • said cytokine is in membrane bound form.
  • a vector comprises said polynucleotide.
  • said vector is a lentivirus vector, a retroviral vector, or a non-viral vector.
  • said non-viral vector is a Sleeping Beauty transposon.
  • said polynucleotide is incorporated into an engineered cell by genome editing.
  • said genome editing comprises use of at least a site specific serine recombinase system.
  • an engineered cell encodes the polynucleotide.
  • the engineered cell is a T cell or an NK cell.
  • the polynucleotide encodes a polypeptide.
  • a method of treating cancer comprising administering to a subject an effective amount of an engineered cell comprising a polynucleotide.
  • the method further comprises administering at least one binding partner capable of binding to a polypeptide expressed on said engineered cell.
  • said binding partner is an antibody.
  • a method of regulating activity of genetically engineered cells in a subject comprising providing to said subject an amount of genetically engineered cells encoding a polypeptide construct comprising a cell surface polypeptide which is a chimeric polypeptide comprising a first truncated non-immunogenic polypeptide and a second truncated non- immunogenic polypeptide, and wherein said cell surface polypeptide binds at least one predetermined binding partner or a variant or fragment thereof; and providing to said subject said predetermined binding partner in an amount sufficient to bind and thereby regulating activity of said genetically engineered cells.
  • said first truncated non-immunogenic polypeptide comprises a fragment or derivative of a member of the EGFR family.
  • said second truncated non-immunogenic polypeptide comprises a fragment or derivative of a member of the EGFR family.
  • said first truncated non-immunogenic polypeptide comprises a HER1 polypeptide.
  • said HER1 polypeptide comprises a polypeptide sequence which has at least 70%, 75%, 80%, 85%, 90%, 95%, 99% or 99.5% identity to a sequence shown in SEQ ID NOs:211, 212, 213, 214, 215, 216 or 217.
  • said HER1 polypeptide comprises a polypeptide sequence comprising a sequence shown in SEQ ID NOs: 211, 212, 213, 214, 215, 216 or 217.
  • said HERl polypeptide comprises a polypeptide sequence comprising the sequence shown in SEQ ID NO:211.
  • said second truncated non-immunogenic polypeptide comprises at least one of a HER2 polypeptide, an ErbB3 polypeptide and an ErbB4 polypeptide.
  • said polypeptide construct comprises a polypeptide sequence which has at least 70%, 75%, 80%, 85%, 90%, 95%, 99% or 99.5% identity to a sequence shown in SEQ ID NO:89, SEQ ID NO:93, SEQ ID NO:97, SEQ ID NO: 101 or SEQ ID NO: 105.
  • said at least one predetermined binding partner binds said HER1 polypeptide.
  • said at least one predetermined binding partner comprises at least one of rituximab, cetuximab, futuximab, depatuxizumab, imgatuzumab, laprituximab, matuzumab, necitumumab, nimotuzumab, panitumumab, and zalutumumab.
  • said at least one predetermined binding partner further includes a second predetermined binding partner that binds said second truncated non-immunogenic polypeptide.
  • said second truncated non-immunogenic polypeptide is a HER2 polypeptide, and said second predetermined binding partner is pertuzumab.
  • said polypeptide construct further comprises a signal peptide. In some instances, said polypeptide construct further comprises a trans-membrane domain. In some embodiments, said trans-membrane domain comprises a trans-membrane dimerization domain. In some cases, said trans-membrane dimerization domain comprises a glycophorin A
  • trans-membrane domain a glycophorin A-integrin ⁇ 3 chimeric transmembrane domain or a CD3 zeta transmembrane domain.
  • said trans-membrane dimerization domain comprises a polypeptide sequence which has at least 70%, 75%, 80%, 85%, 90%, 95%, 99% or 99.5% identity to a sequence shown in SEQ ID NO:26, SEQ ID NO:28, SEQ ID NO:30 or SEQ ID NO:32.
  • said trans-membrane dimerization domain comprises a polypeptide sequence comprising a sequence shown in SEQ ID NO:26, SEQ ID NO:28, SEQ ID NO:30 or SEQ ID NO:32.
  • said first truncated non-immunogenic polypeptide comprises a CD20 polypeptide.
  • said CD20 polypeptide comprises a polypeptide sequence which has at least 70%, 75%, 80%, 85%, 90%, 95%, 99% or 99.5% identity to a sequence shown in SEQ ID NO:218, SEQ ID NO:219 or SEQ ID NO:220.
  • said CD20 polypeptide comprises a polypeptide sequence comprising a sequence shown in SEQ ID NO:218, SEQ ID NO:219 or SEQ ID NO:220.
  • said at least one predetermined binding partner comprises at least one of: rituximab, tositumomab, veltuzumab, afutuzumab,
  • a polypeptide construct comprising a truncated non-immunogenic HERl polypeptide consisting of a HERl Domain III and a truncated HERl Domain IV, wherein said HERl polypeptide binds an anti-HERl antibody; a CD28 trans-membrane domain; and a peptide linker for coupling said HERl polypeptide to said CD28 transmembrane domain; wherein said polypeptide construct is expressed in an engineered cell.
  • said HERl Domain III comprises a polypeptide sequence comprising the sequence shown in SEQ ID NO:200 and said HERl Domain IV comprises a polypeptide sequence comprising the sequence shown in SEQ ID NO:203.
  • said CD28 trans-membrane domain comprises a polypeptide sequence comprising the sequence shown in SEQ ID NO:36 and said peptide linker comprises a G4S peptide linker (SEQ ID NO: 221).
  • said G4S peptide linker (SEQ ID NO: 221) comprises a polypeptide sequence comprising the sequence shown in SEQ ID NO:22.
  • said polypeptide construct comprises a polypeptide sequence comprising the sequence shown in SEQ ID NO:57.
  • said anti-HERl antibody comprises at least one of rituximab, cetuximab, futuximab, depatuxizumab, imgatuzumab, laprituximab, matuzumab, necitumumab,
  • nimotuzumab panitumumab, and zalutumumab.
  • polypeptide construct comprising a truncated non-immunogenic CD20 polypeptide, wherein said CD20 polypeptide binds an anti-CD20 antibody; wherein said polypeptide construct is expressed in an engineered cell.
  • said polypeptide construct has at least 70%, 75%, 80%, 85%, 90%, 95%, 99% or 99.5% identity to the sequence shown in SEQ ID NO: 109.
  • said polypeptide construct comprises a polypeptide sequence comprising the sequence shown in SEQ ID NO: 109.
  • said anti-CD20 antibody comprises at least one of:
  • rituximab tositumomab, veltuzumab, afutuzumab, blontuvetmab and obinutuzumab.
  • FIG. 1 shows expression levels of full-length CD20 cell tag (corresponding to SEQ ID NO: 107) and two forms of truncated CD20 (CD20tl corresponding to SEQ ID NO: 109 and CD20t4 corresponding to SEQ ID NO: 115) in HEK-293T cells as detected by flow cytometry using rituximab compared to a control cell tag. Shaded areas denote mock-transfected control cells whereas non-shaded areas denote expression of cell tags from transfected cells. Each transfection was performed in triplicate.
  • FIG. 2 shows co-expression of CD20tl cell tag (corresponding to SEQ ID NO: 109; y- axis) and a chimeric antigen receptor (CAR; x-axis) in human peripheral mononuclear cells (PBMCs) co-transfected with Sleeping Beauty transposon vectors encoding both genes (right panel) compared to non-transfected cells (left panel).
  • CD20tl cell tag corresponding to SEQ ID NO: 109; y- axis
  • CAR chimeric antigen receptor
  • FIG. 3 shows specific dose dependent antibody-dependent cell-mediated cytotoxicity (represented by fold-induction; y-axis) induced by rituximab in Jurkat cell line transfected with CD20t-l .
  • Non-transfected parental Jurkat cells and non-specific antibody cetuximab showed no activity.
  • FIG. 4A is a schematic diagram illustrating embodiments of a polypeptide construct described herein.
  • the top panel shows an embodiment of a polypeptide construct comprising a signal peptide for directing the polypeptide construct to the cell surface, truncated variant of a natural polypeptide, an optional linker, and a transmembrane (TM) domain.
  • TM transmembrane
  • the bottom panel illustrates an embodiment of a polypeptide construct expressed in an engineered cell described herein.
  • the polypeptide construct is anchored to the cell surface by a transmembrane (TM) domain, which is fused to an extracellular-oriented truncated variant via an optional peptide linker.
  • the linker serves as an extension to direct and extend the truncated variant from cell surface, thus optimizing binding of an antibody or binding partner (represented by anti -truncated variant antibody) to an epitope of the truncated variant.
  • FIG. 4B is a schematic diagram illustrating an embodiment of a polypeptide construct described herein.
  • each of the HER(m) Domain III and HER(n) Domain IV present different epitopes which are recognized by different antibodies (i.e., Anti-HER(m) and Anti- HER(n) antibody, respectively).
  • FIG. 4C is a schematic diagram illustrating a specific embodiment in which the HER(m) Domain III of FIG. 4B corresponds to an EGFR Domain III, recognized by an Anti- EGFR antibody, which is fused to Domain IV of either HER2, ErbB3 or ErbB4 at c-terminus followed by a TM domain.
  • FIG. 4D shows expression of truncated HERl (HERlt) polypeptide expressed in human donor PBMCs transfected with different EGFR-Erb4 chimeras (truncated EGFR-ErbB4 (JM-a) corresponding to SEQ ID NO: 101 and truncated EGFR-ErbB4 (JM-b) corresponding to SEQ ID NO: 105) and stained with an anti-HERlt antibody ("stain”) compared to isotype control ("isotype”) and mock cells that have not been transfected with HERlt.
  • JM-a truncated EGFR-ErbB4
  • JM-b truncated EGFR-ErbB4
  • FIG. 4E shows expression of HERlt polypeptide in human donor PBMCs transfected with different HERlt variants (HERltl corresponding to SEQ ID NO:57, HERlt2 corresponding to SEQ ID NO:59, HERlt3 corresponding to SEQ ID NO:61, HERlt4 corresponding to SEQ ID NO:63, HERlt5 corresponding to SEQ ID NO:65, HERlt6 corresponding to SEQ ID NO:67, and HERlt7 corresponding to SEQ ID NO:69) compared to mock cells that have not been transfected with HERlt.
  • FIG. 4E shows expression of HERlt polypeptide in human donor PBMCs transfected with different HERlt variants (HERltl corresponding to SEQ ID NO:57, HERlt2 corresponding to SEQ ID NO:59, HERlt3 corresponding to SEQ ID NO:61, HERlt4 corresponding to SEQ ID NO:63, HERlt
  • 5A shows antibody -based detection of HERltl expression (corresponding to SEQ ID NO:57; y-axis) and expression of CAR (x-axis) as measured by flow cytometry in cells co- transfected with lentiviral vector encoding both proteins (right panel) compared to control cells not transfected with HERlt or CAR (left panel).
  • FIG. 5B shows levels of HERltl (corresponding to SEQ ID NO:57; y-axis) and a CAR (x-axis) in cells transfected with Sleeping Beauty transposon vectors encoding CAR alone (left panel) and CAR together with HERlt 1 (right panel) and stained with anti-HERl antibody and CAR specific proteins (bottom panel) compared to an isotype control (top panel).
  • FIG. 6 shows cetuximab- and alemtuzumab-mediated ADCC activity (expressed as % specific killing; y-axis) in NK cells (left), CD 16 NK cells (middle), and CD 16 NK cells transfected with CAR and HERltl (right). Cetuximab showed specific ADCC in presence of HERltl .
  • FIG. 7A shows expression of a CAR and HERltl cell tag (corresponding to SEQ ID NO:57) as measured by flow cytometry in genetically modified SUP-T1 reporter cell line (SUP- Tl/CAR-HERltl) .
  • SUP-Tl/CAR-HERltl cell line was sorted by FACS to enrich for high (middle panel) or medium (right panel) level of HERltl expression as detected by flow cytometry.
  • Left panel shows staining of SUP-Tl/CAR-HERltl using isotype antibody control for flow cytometry.
  • FIG. 7B shows specific ADCC (represented by fold-induction; y-axis) of SUP-Tl/CAR-HERltl cell line induced by cetuximab which is dependent on HERltl expression as well as cetuximab dose levels.
  • Non-specific antibody rituximab showed no ADCC of SUP- Tl/CAR-HERltl .
  • FIG. 8 shows a Western blot analysis showing expression of HERltl cell tag in genetically modified SUP-Tl cell lines.
  • Lane 1 IP antibody only; Lane 2: Jurkat cells only; Lane 3 : SUPTl/HERltl (high levels of HERltl); Lane 4: SUPTl/HERltl (low levels of HERltl); Lane 5: A431 cells expressing full-length HERl; Lane 6: Marker.
  • Bold arrow points to protein pulled down by cetuximab in all lines except A431.
  • HERltl corresponds to SEQ ID NO:57.
  • FIG. 9 shows the efficacy of elimination of CD 19 CAR-T cells co-expressing HERltl cell tag by ADCC (left panel) and CDC (right panel) in the presence of cetuximab or non-specific antibody rituximab.
  • FIG. 10 is a schematic diagram showing different embodiments of polypeptide constructs described herein.
  • First-generation truncated cell tags (top) comprise a truncated variant and a non-dimerizing transmembrane domain (TM) connected by an optional peptide linker.
  • Next-generation truncated cell tags (bottom panel) include a transmembrane dimerization n domain (TM-A) that facilitates dimerization of truncated variants on the cell surface.
  • TM-A transmembrane dimerization n domain
  • anti -truncated variant antibody binds to an epitope on the truncated variant.
  • FIG. 11 demonstrates expression levels of CD 19 CAR in primary T cells modified to co-express CD 19 CAR and HERlt cell tag.
  • HERtl cell tags utilized include truncated HER1 polypeptide with a transmembrane dimerization domain (variants HERlt8 corresponding to SEQ ID NO:71, HERlt9 corresponding to SEQ ID NO:75, and HERltlO corresponding to SEQ ID NO:79) and a polypeptide construct comprising a truncated HER1 polypeptide without a transmembrane dimerization domain (HERltl corresponding to SEQ ID NO:57) compared to T cells expressing CD 19 CAR alone (% of Parent).
  • FIG. 12 demonstrates expression levels of HERlt cells tag in primary T cells modified to co-express CD 19 CAR and HERlt cell tag.
  • HERlt cell tags utilized include a truncated HERl polypeptide with a transmembrane dimerization domain (variants HERlt8 corresponding to SEQ ID NO:71, HERlt9 corresponding to SEQ ID NO:75, and HerltlO corresponding to SEQ ID NO:79) and a polypeptide construct comprising a truncated HERl polypeptide without a dimerization domain (HERltl corresponding to SEQ ID NO:57) compared to T cells expressing CD 19 CAR alone (% of Parent).
  • FIG. 13A and FIG. 13B shows the superior effects of cetuximab -mediated ADCC (represented by % specific lysis; y-axis) of CD 19 CAR-T target cells co-expressing a polypeptide construct comprising a truncated HERl polypeptide with a dimerization domain (variants HERlt8 corresponding to SEQ ID NO:71, HERlt9 corresponding to SEQ ID NO:75, and HERltlO corresponding to SEQ ID NO:79) over a polypeptide construct comprising a truncated HERl polypeptide without a dimerization domain (HERlt control corresponding to SEQ ID NO:57).
  • NK cells were utilized as effector cells.
  • Rituximab was utilized as non-specific antibody control for ADCC assay.
  • FIG. 14 shows selective elimination of genetically modified-T cells (CD 19 CAR-mblL- 15-T cells) expressing HERltl by cetuximab-mediated ADCC.
  • compositions of the invention can be used to achieve methods of the invention.
  • the term "about” in relation to a reference numerical value and its grammatical equivalents as used herein can include the numerical value itself and a range of values plus or minus 10% from that numerical value.
  • the amount “about 10” includes 10 and any amounts from 9 to 11.
  • the term “about” in relation to a reference numerical value can also include a range of values plus or minus 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or 1% from that value.
  • isolated is meant the removal of a nucleic acid from its natural environment.
  • purified is meant that a given nucleic acid, whether one that has been removed from nature (including genomic DNA and mRNA) or synthesized (including cDNA) and/or amplified under laboratory conditions, has been increased in purity, wherein “purity” is a relative term, not “absolute purity.” It is to be understood, however, that nucleic acids and proteins may be formulated with diluents or adjuvants and still for practical purposes be isolated. For example, nucleic acids typically are mixed with an acceptable carrier or diluent when used for introduction into cells.
  • Polynucleotide or “oligonucleotide” as used herein refers to a polymeric form of nucleotides of any length, either ribonucleotides or deoxyribonucleotides. This term refers only to the primary structure of the molecule. Thus, this term includes double and single stranded DNA, triplex DNA, as well as double and single stranded RNA. It also includes modified, for example, by methylation and/or by capping, and unmodified forms of the polynucleotide. The term is also meant to include molecules that include non-naturally occurring or synthetic nucleotides as well as nucleotide analogs.
  • Polypeptide is used interchangeably with the terms “polypeptides” and “protein(s),” and refers to a polymer of amino acid residues.
  • a “mature protein” is a protein which is full- length and which, optionally, includes glycosylation or other modifications typical for the protein in a given cellular environment.
  • Polypeptides and proteins disclosed herein can comprise synthetic amino acids in place of one or more naturally-occurring amino acids.
  • synthetic amino acids are known in the art, and include, for example, aminocyclohexane carboxylic acid, norleucine, a-amino n-decanoic acid, homoserine, S- acetylaminomethyl-cysteine, trans-3- and trans-4-hydroxyproline, 4-aminophenylalanine, 4- nitrophenylalanine, 4-chlorophenylalanine, 4-carboxyphenylalanine, ⁇ -phenylserine ⁇ - hydroxyphenylalanine, phenylglycine, a-naphthylalanine, cyclohexylalanine, cyclohexylglycine, indoline-2-carboxylic acid, l,2,3,4-tetrahydroisoquinoline-3-carbox
  • polypeptides described herein in an engineered cell can be associated with post-translational modifications of one or more amino acids of the polypeptide constructs.
  • post-translational modifications include phosphorylation, acylation including acetylation and formylation, glycosylation
  • Antibody refers to monoclonal or polyclonal antibodies.
  • a whole antibody typically consists of four polypeptides: two identical copies of a heavy (H) chain polypeptide and two identical copies of a light (L) chain polypeptide.
  • Each of the heavy chains contains one N-terminal variable (VH) region and three C-terminal constant (CHI, CH2 and CH3) regions, and each light chain contains one N-terminal variable (VL) region and one C- terminal constant (CL) region.
  • the variable regions of each pair of light and heavy chains form the antigen binding site of an antibody.
  • the VH and VL regions have a similar general structure, with each region comprising four framework regions, whose sequences are relatively conserved.
  • the framework regions are connected by three complementarity determining regions (CDRs).
  • the three CDRs known as CDR1, CDR2, and CDR3, form the "hypervariable region" of an antibody, which is responsible for antigen binding.
  • Antigen recognition moiety or domain refers to a molecule or portion of a molecule that specifically binds to an antigen.
  • the antigen recognition moiety is an antibody, antibody like molecule or fragment thereof and the antigen is a tumor antigen.
  • Antibody like molecules may be for example proteins that are members of the Ig- superfamily which are able to selectively bind a partner. MHC molecules and T cell receptors are such molecules. In some embodiments the antibody-like molecule is a TCR. In some embodiments the TCR has been modified to increase its MHC binding affinity.
  • fragment of an antibody “antibody fragment,” “functional fragment of an antibody,” and “antigen-binding portion” are used interchangeably herein to mean one or more fragments or portions of an antibody that retain the ability to specifically bind to an antigen (see, generally, Holliger et al., Nat. Biotech., 23(9): 1126-1129 (2005)).
  • the antibody fragment desirably comprises, for example, one or more CDRs, the variable region (or portions thereof), the constant region (or portions thereof), or combinations thereof.
  • antibody fragments include, but are not limited to, (i) a Fab fragment, which is a monovalent fragment consisting of the VL, VH, CL, and CHI domains; (ii) a F(ab')2 fragment, which is a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the stalk region; (iii) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody; (iv) a single chain Fv (scFv), which is a monovalent molecule consisting of the two domains of the Fv fragment (i.e., VL and VH) joined by a synthetic linker which enables the two domains to be synthesized as a single polypeptide chain (see, e.g., Bird et al., Science, 242
  • a diabody which is a dimer of polypeptide chains, wherein each polypeptide chain comprises a VH connected to a VL by a peptide linker that is too short to allow pairing between the VH and VL on the same polypeptide chain, thereby driving the pairing between the complementary domains on different VH-VL polypeptide chains to generate a dimeric molecule having two functional antigen binding sites.
  • Antibody fragments are known in the art and are described in more detail in, e.g., U.S. Pat. No. 8,603,950.
  • Nucleic acids and/or nucleic acid sequences are "homologous" when they are derived, naturally or artificially, from a common ancestral nucleic acid or nucleic acid sequence.
  • Proteins and/or protein sequences are homologous when their encoding DNAs are derived, naturally or artificially, from a common ancestral nucleic acid or nucleic acid sequence.
  • the homologous molecules can be termed homologs.
  • any naturally occurring proteins, as described herein can be modified by any available mutagenesis method. When expressed, this
  • mutagenized nucleic acid encodes a polypeptide that is homologous to the protein encoded by the original nucleic acid. Homology is generally inferred from sequence identity between two or more nucleic acids or proteins (or sequences thereof). The precise percentage of identity between sequences that is useful in establishing homology varies with the nucleic acid and protein at issue, but as little as 25% sequence identity is routinely used to establish homology. Higher levels of sequence identity, e.g., 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or 99% or more can also be used to establish homology.
  • nucleic acid sequences or amino acid sequences of polypeptides refers to the residues in the two sequences which are the same when aligned for maximum correspondence over a specified comparison window.
  • a polypeptide herein is at least 60%, 65%>, 70%, 75%, 80%>, 85%), 90%), 98%o 99%o or 100% identical to a reference polypeptide, or a fragment thereof, e.g. , as measured by BLASTP (or CLUSTAL, or any other available alignment software) using default parameters.
  • nucleic acids can also be described with reference to a starting nucleic acid, e.g.
  • they can be 50%, 60%, 70%, 75%, 80%, 85%, 90%, 98%, 99% or 100% identical to a reference nucleic acid or a fragment thereof, e.g. , as measured by BLASTN (or CLUSTAL, or any other available alignment software) using default parameters.
  • BLASTN or CLUSTAL, or any other available alignment software
  • one molecule is said to have certain percentage of sequence identity with a larger molecule, it means that when the two molecules are optimally aligned, said percentage of residues in the smaller molecule finds a match residue in the larger molecule in accordance with the order by which the two molecules are optimally aligned.
  • Transposon or "transposable element” (TE) is a vector DNA sequence that can change its position within the genome, sometimes creating or reversing mutations and altering the cell's genome size. Transposition often results in duplication of the TE.
  • Class I TEs are copied in two stages: first, they are transcribed from DNA to RNA, and the RNA produced is then reverse transcribed to DNA. This copied DNA is then inserted at a new position into the genome. The reverse transcription step is catalyzed by a reverse transcriptase, which may be encoded by the TE itself.
  • the characteristics of retrotransposons are similar to retroviruses, such as HIV.
  • the cut-and-paste transposition mechanism of class II TEs does not involve an RNA intermediate.
  • the transpositions are catalyzed by several transposase enzymes. Some transposases non-specifically bind to any target site in DNA, whereas others bind to specific DNA sequence targets.
  • the transposase makes a staggered cut at the target site resulting in single-strand 5 ' or 3 ' DNA overhangs (sticky ends). This step cuts out the DNA transposon, which is then ligated into a new target site; this process involves activity of a DNA polymerase that fills in gaps and of a DNA ligase that closes the sugar-phosphate backbone. This results in duplication of the target site.
  • the insertion sites of DNA transposons may be identified by short direct repeats which may be created by the staggered cut in the target DNA and filling in by DNA polymerase, followed by a series of inverted repeats important for the TE excision by transposase.
  • Cut-and-paste TEs may be duplicated if their transposition takes place during S phase of the cell cycle when a donor site has already been replicated, but a target site has not yet been replicated. Transposition can be classified as either "autonomous" or "non-autonomous" in both Class I and Class II TEs. Autonomous TEs can move by themselves while non-autonomous TEs require the presence of another TE to move. This is often because non-autonomous TEs lack transposase (for class II) or reverse transcriptase (for class I).
  • Transposase refers an enzyme that binds to the end of a transposon and catalyzes the movement of the transposon to another part of the genome by a cut and paste mechanism or a replicative transposition mechanism.
  • the transposase' s catalytic activity can be utilized to move gene(s) from a vector to the genome.
  • the nucleic acid sequences and vectors disclosed or contemplated herein may be introduced into a cell by "transfection,” “transformation,” “nucleofection” or “transduction.”
  • Transfection refers to the introduction of one or more exogenous polynucleotides into a host cell by using physical or chemical methods.
  • Many transfection techniques are known in the art and include, for example, calcium phosphate DNA co-precipitation (see, e.g., Murray E. J. (ed.), Methods in Molecular Biology, Vol.
  • Phage or viral vectors can be introduced into host cells, after growth of infectious particles in suitable packaging cells, many of which are commercially available.
  • Tumor antigen refers to any antigenic substance produced or overexpressed in tumor cells. It may, for example, trigger an immune response in the host.
  • tumor antigens may be proteins that are expressed by both healthy and tumor cells but because they identify a certain tumor type, are a suitable therapeutic target.
  • Promoter refers to a region of a polynucleotide that initiates transcription of a coding sequence. Promoters are located near the transcription start sites of genes, on the same strand and upstream on the DNA (towards the 5' region of the sense strand). Some promoters are constitutive as they are active in all circumstances in the cell, while others are regulated becoming active in response to specific stimuli, e.g., an inducible promoter.
  • promoter activity refers to the extent of expression of nucleotide sequence that is operably linked to the promoter whose activity is being measured. Promoter activity may be measured directly by determining the amount of RNA transcript produced, for example by Northern blot analysis or indirectly by determining the amount of product coded for by the linked nucleic acid sequence, such as a reporter nucleic acid sequence linked to the promoter.
  • inducible promoter refers to a promoter which is induced into activity by the presence or absence of transcriptional regulators, e.g., biotic or abiotic factors. Inducible promoters are useful because the expression of genes operably linked to them can be turned on or off at certain stages of development of an organism or in a particular tissue. Examples of inducible promoters are alcohol-regulated promoters, tetracycline-regulated promoters, steroid- regulated promoters, metal-regulated promoters, pathogenesis-regulated promoters, temperature- regulated promoters and light-regulated promoters. In some embodiments, the inducible promoter is part of a genetic switch.
  • Enhancer refers to a DNA sequence that increases transcription of, for example, a nucleic acid sequence to which it is operably linked. Enhancers can be located many kilobases away from the coding region of the nucleic acid sequence and can mediate the binding of regulatory factors, patterns of DNA methylation, or changes in DNA structure. A large number of enhancers from a variety of different sources are well known in the art and are available as or within cloned polynucleotides (from, e.g., depositories such as the ATCC as well as other commercial or individual sources). A number of polynucleotides comprising promoters (such as the commonly-used CMV promoter) also comprise enhancer sequences.
  • Enhancers can be located upstream, within, or downstream of coding sequences.
  • the term "Ig enhancers” refers to enhancer elements derived from enhancer regions mapped within the immunoglobulin (Ig) locus (such enhancers include for example, the heavy chain (mu) 5' enhancers, light chain (kappa) 5' enhancers, kappa and mu intronic enhancers, and 3' enhancers (see generally Paul W. E. (ed), Fundamental Immunology, 3rd Edition, Raven Press, New York (1993), pages 353-363; and U.S. Pat. No. 5,885,827).
  • Coding sequence refers to a segment of a polynucleotide that codes for a polypeptide. The region or sequence is bounded nearer the 5' end by a start codon and nearer the 3' end with a stop codon. Coding sequences may also be referred to as open reading frames.
  • operably linked refers to the physical and/or functional linkage of a DNA segment to another DNA segment in such a way as to allow the segments to function in their intended manners.
  • a DNA sequence encoding a gene product is operably linked to a regulatory sequence when it is linked to the regulatory sequence, such as, for example, promoters, enhancers and/or silencers, in a manner which allows modulation of transcription of the DNA sequence, directly or indirectly.
  • a DNA sequence is operably linked to a promoter when it is ligated to the promoter downstream with respect to the transcription initiation site of the promoter, in the correct reading frame with respect to the transcription initiation site and allows transcription elongation to proceed through the DNA sequence.
  • An enhancer or silencer is operably linked to a DNA sequence coding for a gene product when it is ligated to the DNA sequence in such a manner as to increase or decrease, respectively, the transcription of the DNA sequence. Enhancers and silencers may be located upstream, downstream or embedded within the coding regions of the DNA sequence.
  • a DNA for a signal sequence is operably linked to DNA coding for a polypeptide if the signal sequence is expressed as a pre-protein that participates in the secretion of the polypeptide. Linkage of DNA sequences to regulatory sequences is typically accomplished by ligation at suitable restriction sites or via adapters or linkers inserted in the sequence using restriction endonucleases known to one of skill in the art.
  • transcriptional regulator refers to a biochemical element that acts to prevent or inhibit the transcription of a promoter-driven DNA sequence under certain environmental conditions (e.g., a repressor or nuclear inhibitory protein), or to permit or stimulate the transcription of the promoter-driven DNA sequence under certain environmental conditions (e.g., an inducer or an enhancer).
  • induction refers to an increase in nucleic acid sequence transcription, promoter activity and/or expression brought about by a transcriptional regulator, relative to some basal level of transcription.
  • a "target” gene or “heterologous” gene, or “gene of interest (GO I)” refers to a gene introduced into the host cell by gene transfer.
  • Recombinase refers to a group of enzymes that can facilitate site- specific recombination between defined sites, where the sites are physically separated on a single DNA molecule or where the sites reside on separate DNA molecules.
  • the DNA sequences of the defined recombination sites are not necessarily identical.
  • Initiation of recombination depends on protein-DNA interaction, within the group there are a large number of proteins that catalyze phage integration and excision (e.g., integrase, . ⁇ 031), resolution of circular plasmids (e.g., Tn3, gamma delta, Cre, Flp), DNA inversion for expression of alternate genes (e.g., Hin, Gin, Pin), assembly of genes during development (e.g., Anabaena nitrogen fixation genes), and transposition (e.g., IS607 transposon).
  • Most site-specific recombinases fall into one of the two families, based on evolutionary and mechanistic relatedness.
  • ⁇ integrase family or tyrosine recombinases e.g. , Cre, Flp, Xer D
  • resolvase/integrase family or serine recombinase family e.g., ⁇ jC31, TP901-1, Tn3, gamma delta
  • Recombination attachment sites are specific polynucleotide sequences that are recognized by the recombinase enzymes described herein. Typically, two different sites are involved (termed “complementary sites"), one present in the target nucleic acid (e.g., a chromosome or episome of a eukaryote or prokaryote) and another on the nucleic acid that is to be integrated at the target recombination site.
  • the terms “attB” and “attP,” which refer to attachment (or recombination) sites originally from a bacterial target and a phage donor, respectively, are used herein although recombination sites for particular enzymes may have different names.
  • the recombination sites typically include left and right arms separated by a core or spacer region.
  • an attB recombination site consists of BOB', where B and B' are the left and right arms, respectively, and O is the core region.
  • attP is POP', where P and P' are the arms and O is again the core region.
  • the recombination sites that flank the integrated DNA are referred to as "attL” and "attR.”
  • the attL and attR sites using the terminology above, thus consist of BOP' and POB", respectively.
  • the "O" is omitted and attB and attP, for example, are designated as BB' and PP', respectively.
  • genome editing refers to the insertion, deletion or replacement of nucleotides of DNA in the genome of a living organism. Typically genome editing uses engineered nucleases which can create site-specific double-stranded breaks at a predetermined location of the genome.
  • the present disclosure contemplates any means for editing genomes.
  • Non-limiting examples of genome editing techniques include CRISPR, Argonaute and AttSite site-specific serine recombinase systems.
  • a “CRISPR gene editing system” of "CRISPR system” refers to any RNA-guided Cas protein-mediated process for targeting a change in DNA sequence to a specific region of a genome.
  • Argonaute gene editing system refers to any single- stranded DNA guided Argonaute endonuclease-mediated process for targeting a change in DNA sequence to a specific region of a genome.
  • AttSite gene editing system or “site-specific serine recombinase gene editing system” or “site specific serine recombinase system” refer to any process that involves providing a eukaryotic ceil that comprises a first recombination attachment site and a second recombination attachment site; contacting the first and second recombination attachment sites with a prokaryotic recombinase polypeptide, resulting in recombination between the recombination attachment sites, wherein the recombinase polypeptide can mediate recombination between the first and second recombination attachment sites, the first recombination attachment site is a phage genomic recombination attachment site (attP) or a phage genomic re
  • polynucleotide or polypeptide refers to the naturally occurring form of the molecule which can be found in a wildtype ceil or organism.
  • a molecule which is found in an organism endogenousiy can be contrasted with an engineered molecule as described herein which typically does not occur naturally.
  • an engineered molecule can comprise a variant of a naturally occurring polypeptide or polynucleotide.
  • the variant of a naturally occurring polypeptide is a truncated variant of a naturally occurring polypeptide.
  • truncated variant refers to a protein or polypeptide which is missing one or more sequences of amino acids and/or domains relative to the endogenous version of the protein or polypeptide.
  • a truncated variant incorporated into a polypeptide construct described herein can be missing a sequence of amino acids which corresponds to a domain ⁇ e.g., intracellular signaling domain, transmembrane domain, ligand binding domain, etc) normally present in the endogenous protein.
  • the natural version of the truncated polypeptide can be derived from any organism, including mammalian species such as mice, rats, rabbits and humans. Engineered
  • polynucleotides and polypeptides described herein can be expressed in an engineered cell
  • an engineered cell is a cell which has been modified from its natural or endogenous state.
  • An example of an engineered cell is a cell described herein which has been modified ⁇ e.g., by transfection of a polynucleotide into the cell) to encode a truncated variant of a natural polypeptide or a truncated variant of a natural polynucleotide.
  • polypeptide constructs comprising polypeptide constructs, polynucleotides encoding the same, engineered cells harboring and/or expressing the polypeptide constructs and polynucleotides and methods of regulating activity of the engineered cells.
  • Engineered cells as described herein can include immune effector cells engineered to encode and to express cytokines, chimeric antigen receptors and T-cell receptors.
  • regulating refers generally to a regulation of the activity or amount of the engineered cells after administration to a subject.
  • regulating activity of engineered cells refers to a depletion of the engineered cells in a subject.
  • regulating activity of the engineered cells refers to depletion of some engineered cells in a subject as a result of administering to the subject an amount of an antibody or binding partner that binds a polypeptide construct expressed on the engineered cells.
  • regulating activity of the engineered cells refers to a depletion of the engineered cells as a result of activating cell death via binding of an antibody or binding partner to a polypeptide construct described herein expressed on or associated with said engineered cell. In some embodiments, regulating activity of the engineered cells refers to activating an ADCC or CDC pathway in the engineered cells.
  • engineered cells described herein can encode and express a polypeptide construct at the cell surface as a novel cell tag.
  • a cell tag can in some embodiments function as a cell marker which labels, marks or flags a cell expressing the cell tag as an engineered cell.
  • the cell tag has been engineered to lack epitopes recognized by endogenous proteins, such a cell tag can function to uniquely distinguish an engineered cell from other cells in an organism, for example during adoptive cell immunotherapy.
  • the polypeptides, polynucleotides and engineered cells described herein can be used to minimize or eliminate toxicities of immunotherapy in subjects where safety is a concern (e.g. due to a potential for onset of cytokine storm).
  • the cell tags described herein can include one or more epitopes recognized by an antibody introduced during immunotherapy to thereby induce a cellular mechanism that will slow therapeutic output and/or mitigate possible side effects of therapy.
  • the antibody binds to the epitope to induce antibody-dependent cell-mediated cytotoxicity (ADCC) and/or complement-dependent cytotoxicity (CDC).
  • ADCC antibody-dependent cell-mediated cytotoxicity
  • CDC complement-dependent cytotoxicity
  • the cell tags described herein can provide for a depletion marker or "kill tag" unique to engineered cells allowing practitioners to control therapeutic output and thereby optimize efficacy and safety of therapy.
  • engineered cells can be sensitized to cell depletion strategies by expressing a polypeptide construct capable of dimerizing or multimerizing at the surface of engineered cells.
  • dimerized or multimerized polypeptides can be used to amplify a depletion signal and thereby rapidly downregulate or eliminate the engineered immune cell therapy in subjects who are prone to or are experiencing side effects related to therapy.
  • the administration of engineered cells expressing a dimerizing or multimerizing polypeptide construct can provide for further control and optimization over cell depletion interventions.
  • implementation of the polynucleotide constructs disclosed herein as a part of a "kill switch” (or “suicide switch”) system employing an inducible promoter can allow for control over when a particular polypeptide construct is expressed, thereby conferring additional control points over immunotherapy at both the transcriptional and post-translational levels.
  • the cell tags described herein can be used to enrich for engineered cells that specifically express such cell tags.
  • the cell tags can be used to enrich for certain engineered cells to isolate certain engineered cells that only express such cell tags to achieve necessary purity to allow for expansion of select cells of therapeutic interest.
  • Various methods such as FACs, column purification or magnetic beads based methods can be utilized as appropriate.
  • the polypeptide constructs disclosed herein can comprise one or more domains or specific fragments thereof.
  • the polypeptide construct can comprise a signal peptide sequence, an extracellular domain, a peptide linker and a transmembrane domain, each of which functions to confer a particular desired property to the polypeptide construct.
  • the polypeptide construct can include a signal peptide to post-translationally direct the polypeptide construct to the cell surface; a transmembrane domain to anchor the polypeptide domain to the cell; an extracellular portion, which can include a truncated variant of a natural polypeptide; and a peptide linker connecting the transmembrane domain to the extracellular portion.
  • the peptide linker functions as an extracellular peptide extension to position the extracellular portion of the polypeptide in the extracellular matrix and thereby make it available to confer cell tag functionality (e.g., to present or to extend an epitope to allow access to bind an antibody).
  • one or more of the above domains may not be present in the polypeptide construct.
  • a polypeptide construct described herein can be engineered to lack a peptide linker domain.
  • a polypeptide construct comprises one or more domains derived from different proteins (i.e., the polypeptide construct is chimeric).
  • extracellular when used with reference to a portion of a polypeptide construct refers to the amino acids of the polypeptide which are positioned on the exterior of the cell membrane.
  • the extracellular portion can be referred to as a cell surface polypeptide.
  • a portion (e.g., distal portion) of a cell surface polypeptide extends or protrudes distally into the extracellular space from the plasma membrane of a cell.
  • the extending portion may be bound and thereby recognized by an antibody or antigen-recognizing polypeptide that has a structure complementary to and specific for the structure of the extending portion.
  • a cell surface polypeptide can encompass polypeptides or fragments thereof which occur naturally at the surface of the cell as well as polypeptides or fragments thereof which are not found naturally at the cell surface (e.g., a truncated variant of a natural polypeptide).
  • the extracellular portion or cell surface polypeptide can include a truncated variant of a natural polypeptide.
  • the truncated variant can for example, extend from the exterior of the plasma membrane (e.g. via a linker connected to or adjacent to the transmembrane domain) into the extracellular space.
  • the truncated variant is missing amino acids which in the natural version of the polypeptide contribute to an intracellular domain and/or a transmembrane domain.
  • the truncated variant can be modified from an endogenous polypeptide in any way to produce an extracellular portion of a cell tag.
  • the truncated variant can be modified to reduce or eliminate amino acids which normally function to comprise an epitope in the extracellular domain which can be recognized by an endogenous protein, such as an antigen or receptor.
  • an endogenous protein such as an antigen or receptor.
  • the truncated variant can be made unreactive or immunologically/epitopically silent at the cell surface, or reduced or minimized in its reactivity or binding with endogenous molecules.
  • Any modification to a natural polypeptide to remove natural epitopes is contemplated herein, including truncation of all or part of an extracellular domain, and removal of one or more amino acids which form part of an epitope, or are post- translationally modified to form part of an epitope.
  • a truncated variant described herein can be epitopically silent with respect to endogenous signaling pathways
  • the truncated variant can include one or more epitopes which are capable of being recognized by a molecule (e.g., antibody) that does not normally contact a surface of a cell corresponding to an engineered cell described herein.
  • an antibody or binding partner specific for an epitope of the truncated variant is introduced exogenously (e.g., during immunotherapy using adopted cells).
  • an epitope of the truncated variant capable of being recognized by an introduced antibody or fragment thereof can be referred to as dormant or quiescent.
  • a cell tag incorporated at the cell surface of an engineered cell used for adoptive immunotherapy can contain an epitope which lies dormant until the proper molecule is introduced into a subject to trigger or activate the cell tag (i.e., via recognition of the epitope).
  • an epitope does not interfere with the therapeutic output of the engineered cells where therapy is proceeding as desired (i.e., the epitope remains silent or quiescent), but embodies a trigger which can be activated to downregulate cellular output where for any reason the immunotherapy needs to be subdued.
  • the present disclosure contemplates the use of any antibody or small molecule which is capable of recognizing an epitope of a cell tag to suppress the therapeutic output of an engineered cell expressing the tag via elimination of such cells (e.g., via ADCC or CDC).
  • Non-limiting examples of antibodies which can be used to recognize an epitope of an extracellular domain (e.g., truncated variant) of a cell tag include rituximab, cetuximab, gefitinib, erlotinib, afatinib, brigatinib, icotinib, osimertinib,
  • panitumumab panitumumab, zalutumumab, nimotuzumab, matuzumab, afutuzumab, blontuvetmab,
  • obinutuzumab ibritumomab tiuxetan, tositumomab, ofatumumab, ocaratuzumab, ocrelizumab, TRU-015 (Trubion), veltuzumab (EVIMU-106), alemtuzumab, ANT 1034, HI 186(Bio Rad), YTH34.5 (Bio Rad) and YTH66.9HL (Bio-Rad), trastuzumab and pertuzumab.
  • Another example of a modification which can be made to an endogenous polypeptide to produce a truncated variant as contemplated herein is to remove one or more amino acids which normally contribute to or participate in intracellular signaling and/or trafficking pathways.
  • Truncation of an endogenous polypeptide to remove signaling domains reinforces the function of a cell tag as a dormant, inducible cell marker which in its dormant state does not interfere with cellular function (e.g. in adopted cells during adoptive cell therapy).
  • the cell surface polypeptide of the polypeptide construct can comprise a truncated variant of a receptor tyrosine kinase.
  • a truncated variant of a receptor from the EGF receptor family e.g., a truncated variant of HER1
  • PDGF receptor family e.g., a truncated variant of HER1
  • VEGF receptor family e.g., insulin receptor family, FGF receptor family, Trk receptor family and Eph receptor family.
  • the cell surface polypeptide can comprise a truncated variant of a CD protein (e.g., CD20 or CD52) or a truncated variant of LNFGR (CD271).
  • the cell surface polypeptide of the cell tag can include a truncated variant which has been modified to remove a transmembrane domain and intracellular signaling portion of the natural or endogenous polypeptide.
  • the truncation of the transmembrane domain and intracellular signaling portion frees the cell surface or extracellular portion of the polypeptide from its endogenous context, for example making it available for incorporation into a chimeric polypeptide construct that includes the cell surface polypeptide fused to a
  • transmembrane domain e.g., via a linker
  • chimeric polypeptide constructs in turn can confer the cell surface polypeptide (e.g., truncated variant) with altered activity or characteristics compared to the endogenous version of the polypeptide.
  • a cell surface polypeptide is capable of dimerizing when expressed in a chimeric polypeptide construct.
  • polypeptide constructs can be expressed in the same engineered cell.
  • a cell disclosed herein can express multiple polypeptide constructs that differ in the identity of the cell surface polypeptide and/or transmembrane domain.
  • a polypeptide construct described herein can include a cell surface polypeptide comprising a truncated variant of a natural polypeptide, a transmembrane domain fused to the cell surface polypeptide, optionally a linker connecting the truncated variant to the
  • transmembrane domain and a signal peptide directing the cell tag to a cell surface of an engineered cell.
  • a signal peptide is a sequence of amino acids typically located at the N-terminus of a newly synthesized protein or polypeptide which directs the protein or polypeptide to the cell surface.
  • the signal peptide directs the polypeptide to the cell surface to be inserted (e.g., via a transmembrane domain) into the cellular membrane.
  • a polypeptide construct described herein is synthesized with the signal peptide, but then post- translationally processed to cleave the signal peptide such that the mature polypeptide construct lacks the signal peptide amino acid sequence.
  • the signal peptide sequence is not cleaved and remains in the mature polypeptide construct.
  • a polypeptide construct comprising any known or unknown signal peptide capable of directing and/or trafficking the polypeptide construct to the cell surface.
  • a polypeptide construct comprises a signal sequence corresponding to the signal peptide of GMCSFRa, Ig Kappa, Immunoglobulin E, CD8a, TVB2 (T21 A), CD52 or Low-affinity nerve growth factor receptor (LNGFR,
  • the signal peptide is encoded by a polynucleotide comprising a nucleotide sequence which has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity with a nucleotide sequence selected from the list consisting of SEQ ID NO: 1; SEQ ID NO:3; SEQ ID NO:5; SEQ ID NO:7; SEQ ID NO:9; SEQ ID NO: 11; or SEQ ID NO: 13.
  • the signal peptide comprises an amino acid sequence which has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity with an amino acid sequence selected from the list consisting of SEQ ID NO:2; SEQ ID NO:4; SEQ ID NO:6; SEQ ID NO:8; SEQ ID NO: 10; SEQ ID NO: 12; and SEQ ID NO: 14.
  • a polypeptide construct described herein can comprise a peptide linker to connect a domain or fragment thereof of the polypeptide construct to a different domain or fragment thereof of the polypeptide construct.
  • a peptide linker connects the transmembrane domain of the polypeptide construct to a cell surface polypeptide ⁇ e.g. truncated variant of a natural polypeptide) of the polypeptide construct.
  • a polypeptide construct can comprise a peptide linker comprising a GSG linker (SEQ ID NO: 16), SGSG linker (SEQ ID NO: 18), (G4S)3 linker (SEQ ID NO: 20), (G4S)4 linker (SEQ ID NO: 22) and/or a Whitlow linker.
  • a peptide linker of any length or size to link a transmembrane domain to a cell surface polypeptide ⁇ e.g. truncated variant).
  • a peptide linker is sized to maintain the distance between the truncated variant and the
  • transmembrane domain at about the same distance as occurs between the natural non-truncated version of the polypeptide and its endogenous transmembrane domain.
  • a peptide linker can be used to link together domains or portions thereof other than a transmembrane domain.
  • a peptide linker can connect two protein moieties of the cell surface polypeptide.
  • the cell surface polypeptide can be chimeric and comprise truncated variants from multiple natural polypeptides which can be connected via a peptide linker.
  • An example is a polypeptide construct comprising HERlt together with one or more truncated variants of another member of the EGFR family (e.g.,
  • the cell surface polypeptide can comprise a concatemer of two or more copies of a truncated variant connected via a peptide linker (e.g. SEQ ID NO: 123 comprising two copies of a CD20 truncated polypeptide linked via an SGS linker).
  • a peptide linker e.g. SEQ ID NO: 123 comprising two copies of a CD20 truncated polypeptide linked via an SGS linker.
  • the peptide linker is encoded by a polynucleotide comprising a nucleotide sequence which has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity to a nucleotide sequence selected from the list consisting of SEQ ID NO: 15; SEQ ID NO: 17; SEQ ID NO: 19; SEQ ID NO:21; and SEQ ID NO:23.
  • the peptide linker comprises an amino acid sequence which has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100%) identity to an amino acid sequence selected from the list consisting of SEQ ID NO: 16; SEQ ID NO: 18; SEQ ID NO:20; SEQ ID NO:22; and SEQ ID NO:24.
  • a polypeptide construct described herein can include a transmembrane domain that can be inserted into a plasma membrane to anchor the polypeptide construct at the cell surface.
  • the present disclosure provides for a polypeptide construct comprising one or more of any known or unknown transmembrane domains or fragments thereof.
  • the polypeptide construct comprising one or more of any known or unknown transmembrane domains or fragments thereof.
  • transmembrane domain of the polypeptide construct can comprise a transmembrane domain derived from and/or homologous to one or more natural proteins.
  • the transmembrane domain of the polypeptide construct comprises an amino acid sequence corresponding to the transmembrane domain of a single natural protein.
  • the transmembrane domain of the polypeptide construct comprises a chimeric transmembrane domain comprising amino acid sequences derived from two or more natural proteins.
  • a polypeptide construct described herein can comprise a transmembrane domain which is single-pass or multi-pass.
  • CD8a is an example of a protein having a single-pass
  • a polypeptide construct disclosed herein comprises a transmembrane domain corresponding to and/or homologous to a transmembrane domain or fragment thereof from the CD8a protein.
  • the transmembrane domain of the polypeptide construct is encoded by a polynucleotide comprising a nucleotide sequence which has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity to a nucleotide sequence of SEQ ID NO:33.
  • the transmembrane domain comprises an amino acid sequence which has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity to an amino acid sequence of SEQ ID NO:34.
  • An example of a multi-pass protein is CD28.
  • the first and second binders are CD28 and the second binders.
  • transmembrane domain of a polypeptide construct can comprise a transmembrane domain corresponding to and/or homologous to a transmembrane domain or fragment thereof from the CD28 protein.
  • the transmembrane domain of the polypeptide construct is encoded by a polynucleotide comprising a nucleotide sequence which has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity to a nucleotide sequence of SEQ ID NO:35.
  • the transmembrane domain comprises an amino acid sequence which has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity to an amino acid sequence of SEQ ID NO:36.
  • the transmembrane domain is a transmembrane dimerization domain.
  • transmembrane dimerization domain refers to a transmembrane domain or fragment thereof that is capable of physically interacting or “dimerizing" within the plasma membrane of a cell with a second transmembrane domain or fragment thereof.
  • the transmembrane dimerization domain is comprised within a first polypeptide construct which dimerizes via the transmembrane dimerization domain with a second polypeptide.
  • transmembrane dimerization domain of a first polypeptide is fused at its distal (extracellular oriented) end to a first cell surface polypeptide
  • a transmembrane dimerization domain of a second polypeptide is fused at its distal end to a second cell surface polypeptide
  • physical interaction of the first and second transmembrane domains within the cell membrane can result in the dimerization of the first and second cell surface polypeptides.
  • the transmembrane domain can multimerize to from a trimer, a tetramer or a multimer.
  • a transmembrane dimerization domain induces dimerization of cell surface polypeptides without the requirement for any extracellular inducing agent (e.g., ligand or antibody specific for an epitope of the cell surface polypeptide).
  • a transmembrane dimerization domain can induce dimerization of a cell surface polypeptide by spontaneously physically interacting or coupling with a second transmembrane dimerization domain within the cell membrane of a cell.
  • a cell expressing a polypeptide construct described herein can display dimerized cell surface polypeptides on a cell surface of the cell prior to the administration of any extracellular cell surface binding agent comprising an antibody, protein, ligand or molecule described herein. Dimerization of cell surface polypeptides via a transmembrane dimerization domain can leverage a cell expressing such a polypeptide construct towards an enhanced cellular response when the dimerized cell surface polypeptides contact and recognize a ligand or antibody.
  • a pair of HERlt cell surface polypeptides can be dimerized prior to or at the time of contact with a CDC- or ADCC-inducing agent such as cetuximab.
  • a CDC- or ADCC-inducing agent such as cetuximab.
  • administration of the binding agent at times of distress can amplify the cytotoxic effect thereby increasing the likelihood that a cell will be killed.
  • an agent that binds to a cell surface polypeptide e.g.
  • dimerized cell surface polypeptide to induce a cellular response in an engineered cell expressing a polypeptide construct disclosed herein is provided exogenously and/or does not exist endogenously.
  • the present disclosure provides for a transmembrane dimerization domain to facilitate dimerization of any cell surface polypeptide, including truncated variants of natural polypeptides, such as HERlt, LNGFRt, CD20t and CD52t.
  • a transmembrane dimerization domain can form a covalent link with a second transmembrane domain to induce dimerization of the cell surface polypeptide.
  • the covalent connection is in the form of a disulfide bond formed between cysteine amino acids present in each of the adjacent transmembrane domains.
  • a transmembrane dimerization domain within the cell membrane can form a non- covalent connection with a second transmembrane domain to induce dimerization of the cell surface polypeptide.
  • a polypeptide construct described herein can have a transmembrane dimerization domain that physically interacts with another transmembrane dimerization domain.
  • the first and second transmembrane dimerization domains of the respective first and second polypeptide constructs can either have the same amino acid sequence (i.e., homodimer with respect to the transmembrane dimerization domain) or different amino acid sequences (i.e., heterodimer with respect to the transmembrane dimerization domain).
  • each respective transmembrane dimerization domain of a dimerized polypeptide pair comprises at least one cysteine residue that mediates formation of a disulfide bridge between corresponding cysteine residues in the first and second transmembrane dimerization domains.
  • the transmembrane domain of a polypeptide construct can comprise an amino acid sequence corresponding to and/or homologous to an amino acid sequence of the protein glycophorin A.
  • a glycophorin A amino acid sequence incorporated into a polypeptide construct described herein includes the transmembrane domain or fragment thereof of glycophorin A.
  • the transmembrane domain of the polypeptide construct can include one or more amino acids that normally flank the glycophorin A
  • a polypeptide construct comprising all or part of a glycophorin A transmembrane domain is capable of dimerizing (e.g., homodimerizing) with a second polypeptide construct comprising all or part of a glycophorin A transmembrane domain.
  • the amino acid sequence incorporated from glycophorin A into the polypeptide construct can define a transmembrane dimerization domain.
  • the glycophorin A dimerization domain can comprise the dimerization motif GXXXG.
  • a polypeptide construct comprises a transmembrane domain including at least amino acids E91-R1 16 of glycophorin A. In some embodiments, a polypeptide construct comprises a transmembrane domain including at least amino acids 192-11 14 of glycophorin A. In embodiments, a polypeptide construct comprises a transmembrane domain corresponding to a glycophorin A domain or fragment thereof encoded by a polynucleotide comprising a nucleotide sequence which has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100%) identity to a nucleotide sequence selected from the list consisting of SEQ ID NO:25 and SEQ ID NO:27.
  • the polypeptide construct comprises a transmembrane domain corresponding to a glycophorin A domain or portion thereof which has at least 70%, 75%, 80%, 85%), 90%), 95%), 99%), or 100% identity to an amino acid sequence selected from the list consisting of SEQ ID NO:26 and SEQ ID NO:28.
  • a polypeptide construct described herein can include a transmembrane domain which is a chimera of amino acid sequences from two or more natural polypeptides.
  • the transmembrane domain can include an amino acid sequence corresponding to a glycophorin A domain or portion thereof linked or fused to an amino acid sequence from a second protein.
  • such a chimeric transmembrane domain is capable of dimerization with a second transmembrane domain (e.g., chimeric or non-chimeric) and thus embodies a
  • transmembrane dimerization domain an amino acid sequence corresponding to a glycophorin A transmembrane domain or fragment thereof can be fused to an amino acid sequence corresponding to a domain or fragment thereof of integrin ⁇ 3 to form a chimeric transmembrane domain of a polypeptide construct.
  • the polypeptide construct comprises a transmembrane domain comprising amino acids I92-L109 of glycophorin A fused to amino acids A737-W741 of integrin ⁇ 3.
  • a polypeptide construct comprises a transmembrane domain corresponding to a glycophorin A-integrin ⁇ 3 chimeric sequence encoded by a polynucleotide comprising a nucleotide sequence which has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity with the nucleotide sequence of SEQ ID NO:29.
  • the polypeptide construct comprises a transmembrane domain which has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity with the amino acid sequence of SEQ ID NO:30.
  • the transmembrane domain of a polypeptide construct can comprise an amino acid sequence corresponding to and/or homologous to an amino acid sequence within a
  • a polypeptide construct comprising a transmembrane domain or fragment thereof of a CD3 zeta chain is capable of dimerizing (e.g., homodimerizing) with a second polypeptide construct comprising a
  • the polypeptide construct comprises a transmembrane domain encoded by a polynucleotide comprising a nucleotide sequence which has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity to a nucleotide sequence of SEQ ID NO:31.
  • the transmembrane domain is encoded by a polynucleotide comprising the nucleotide sequence of SEQ ID NO:31.
  • the polypeptide construct comprises a transmembrane domain which has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity to an amino acid sequence of SEQ ID NO:32.
  • the transmembrane domain of a polynucleotide construct herein can comprise an amino acid sequence corresponding to and/or homologous to a transmembrane domain or fragment thereof from the proteins CTLA4 (cytotoxic T-lymphocyte protein 4) and/or LNGFR (TNFRSF 16).
  • CTLA4 cytotoxic T-lymphocyte protein 4
  • LNGFR LNGFR
  • the polypeptide construct can comprise a transmembrane domain encoded by a polynucleotide comprising a nucleotide sequence which has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity to a nucleotide sequence selected from the list consisting of SEQ ID NO:37 and SEQ ID NO 39.
  • the polypeptide construct comprises a transmembrane domain which has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100%) identity to an amino acid sequence selected from the list consisting of SEQ ID NO: 38 and SEQ ID NO: 40.
  • a polypeptide construct described herein can comprise a cell surface polypeptide linked to the transmembrane domain.
  • the cell surface polypeptide comprises a truncated variant of a natural polypeptide.
  • a wide variety of natural polypeptides are provided as a precursor or substrate to produce a truncated variant incorporated into a polypeptide construct.
  • Each natural polypeptide precursor can further be subject to multiple different truncations to yield a large number of possible truncated variants for use in the polypeptide constructs described herein.
  • precursors include epidermal growth factor receptor (EGFR or HERl) isoform a precursor ⁇ e.g., SEQ ID NO:50); receptor tyrosine protein kinase ErbB2 (HER2) isoform a precursor ⁇ e.g., SEQ ID NO:51); receptor tyrosine-protein kinase ErbB3 (HER3) isoform 1 precursor ⁇ e.g., SEQ ID NO:52), receptor tyrosine protein kinase ErbB4 (HER4) isoform JM-a/CVT-1 precursor ⁇ e.g., SEQ ID NO:53), receptor tyrosine protein kinase ErbB4 (HER4) isoform JM-b isoform X7 (e.g., SEQ ID NO:54), CD20 precursor (e.g., SEQ ID NO:
  • CD52 precursor CD52 precursor
  • LNGFR precursor e.g., SEQ ID NO: 154
  • the cell surface polypeptide comprises a truncated HERl polypeptide (herein designated HERlt or EGFRt).
  • Natural HERl includes an extracellular region comprising Domain I, II, III and IV, a transmembrane domain, and an intracellular tyrosine kinase and regulatory region.
  • Certain antibodies capable of inducing ADCC e.g., panitumumab and cetuximab are known to bind to Domain III of endogenous HERl .
  • HERl polypeptide constructs comprising HERl polypeptides which are truncated for any amino acids, domains or fragments of endogenous HERl .
  • a HERl polypeptide can comprise a HERlt polypeptide.
  • a HERl polypeptide consists of or consists essentially of a HERlt polypeptide.
  • a HERl polypeptide can comprise a HERlt polypeptide in addition to other HERl domains (e.g. a HERl transmembrane domain).
  • a HERl polypeptide can lack an intracellular domain or fragment thereof normally found in HERl, including the tyrosine kinase domain and regulatory region. In some embodiments, the HERl polypeptide can lack a transmembrane domain or fragment thereof normally found in HERl . In some embodiments, the HERl polypeptide can lack an extracellular domain or fragment thereof normally found in HERl, including all or part of Domain I, Domain II and Domain IV normally found in HERl .
  • a cell surface polypeptide comprises a HERlt polypeptide lacking a fragment of Domain III normally found in HERl .
  • the HERlt polypeptide consists of or consists essentially of all or a part of Domain III of the endogenous HER1 protein.
  • the HERlt polypeptide consists of or consists essentially of all of Domain III of the endogenous HER1 protein.
  • HERlt Domain III incorporated into the cell surface polypeptide is encoded by a polynucleotide comprising a nucleotide sequence which has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity to a nucleotide sequence of SEQ ID NO: 199.
  • HERlt Domain III incorporated into the cell surface polypeptide is encoded by a polynucleotide comprising a nucleotide sequence which has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity to a nucleotide sequence of SEQ ID NO: 199.
  • incorporated into the cell surface polypeptide has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100%) identity to an amino acid sequence of SEQ ID NO:200.
  • a HERlt polypeptide incorporated into the cell surface polypeptide comprises Domain IV or a fragment thereof of endogenous HERl .
  • An endogenous HERl Domain IV can be encoded by a polynucleotide comprising a nucleotide sequence which has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity to a nucleotide sequence of SEQ ID NO:201.
  • an endogenous HERlt Domain IV has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity to an amino acid sequence of SEQ ID NO:202.
  • the HERlt polypeptide incorporated into a cell surface polypeptide can comprise a truncated Domain IV.
  • the HERlt truncated Domain IV can comprise a truncation of at least 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 100% of Domain IV of natural HERl .
  • the HERlt truncated Domain IV incorporated into the cell surface polypeptide has at least 70%, 75%, 80%, 85%), 90%), 95%), 99%), or 100% identity to an amino acid sequence selected from the list consisting of SEQ ID NO:203, SEQ ID NO: SEQ ID NO:204, SEQ ID NO:205, SEQ ID NO:
  • a polypeptide construct described herein can comprise a HERlt polypeptide
  • a HERlt polypeptide comprises HERl Domain III and Domain IV having at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity to the amino acid sequence of SEQ ID NO:210.
  • a polypeptide construct described herein can comprise a HERlt polypeptide
  • a HERlt polypeptide has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity to an amino acid sequence selected from the list consisting of SEQ ID NO:211, SEQ ID NO:212, SEQ ID NO:213, SEQ ID NO:214, SEQ ID NO:215, SEQ ID NO:216, and SEQ ID NO:217.
  • Natural HERl also contains multiple disulfide bond pairs in Domain IV.
  • the HERlt truncated Domain IV can comprise truncation at positions to preserve disulfide bond pairs.
  • G4S linkers G4S linkers
  • 7 residue linker between domain IV and EGFR transmembrane domain can be further removed as this linker plays a role in dimerization of EGFR receptors, which leads to EGF ligand activation.
  • a HERlt polypeptide incorporated into a cell surface polypeptide described herein can include an epitope that can be recognized by an exogenously introduced binding partner or antibody.
  • a HERlt polypeptide can incorporate a cetuximab-binding domain in order to facilitate targeted depletion of cells expressing a polypeptide construct described herein. Depletion can be due for example to cell death resulting from CDC and/or ADCC.
  • Non-limiting examples of molecules which can be endogenously introduced to bind to and/or recognize an epitope on a cell surface polypeptide comprising HERlt can include cetuximab, gefitinib, erlotinib, afatinib, brigatinib, icotinib, osimertinib, panitumumab, zalutumumab, nimotuzumab, and matuzumab.
  • the antibody can be a monoclonal antibody, scFv, scFab, diabody, or camelid antibody.
  • the antibody can be conjugated to a drug or a toxin.
  • a cell surface polypeptide incorporated into a polypeptide construct described herein can comprise truncated variants of multiple different natural polypeptides.
  • the cell surface polypeptide can comprise a polypeptide chimera comprising multiple truncated polypeptides from the EGFR family.
  • FIG. 4B illustrates an embodiment of a polypeptide construct conferring cell tag functionality, wherein the cell surface polypeptide comprises Domain III from one member of the HER/EGFR family (HER(m)) and Domain IV or a fragment thereof from a different member of the HER/EGFR family (HER(n)).
  • chimeric cell surface polypeptides comprising any combination of extracellular domains from two or more of EGFR/HERl, HER2, ErbB3 and ErbB4.
  • FIG. 4C depicts the specific case where Domain III is derived from EGFR/HERl .
  • the chimeric cell surface polypeptide comprises Domain III from EGFR and Domain IV from HER2
  • engineered cells expressing the polypeptide can be susceptible to both the antibodies cetuximab (recognizing Domain III of EGFR) and trastuzumab (recognizing Domain IV of HER2).
  • cetuximab recognizing Domain III of EGFR
  • trastuzumab recognizing Domain IV of HER2
  • the chimeric cell surface polypeptides described herein provide a further mechanism to control immune cell behavior during immunotherapy, by providing for binding sites for multiple antibiotics/binding partners. For example, in a circumstance where a subject experiencing side effects during adoptive cell therapy does not respond to an
  • antibiotic e.g., cetuximab
  • trastuzumab a different antibody targeting an epitope on one of the truncated variants in the chimeric cell surface polypeptide
  • a different antibody e.g., trastuzumab
  • a chimeric cell surface polypeptide can be fused to a
  • transmembrane domain which is homologous to an EGFR family member.
  • the transmembrane domain can correspond to a transmembrane domain from EGFR/HER1, HER2, ErbB3 or ErbB4.
  • the transmembrane domain can be homologous to a non-EGFR transmembrane domain, including a transmembrane domain corresponding to SEQ ID NO:26, SEQ ID NO:28, SEQ ID NO:30, SEQ ID NO:32, SEQ ID NO:34, SEQ ID NO:36, SEQ ID NO:38 and SEQ ID NO:40.
  • a chimeric cell surface polypeptide can comprise a chimera of a HERlt polypeptide and a truncated HER2 (HER2t) polypeptide or fragment thereof.
  • the polypeptide construct can comprise a HERlt/EGFRt polypeptide comprising HERl Domain III and a HER2t polypeptide comprising a HER2 Domain IV and HER2 transmembrane domain.
  • the EGFR-HER2 chimeric cell surface polypeptide fused to the HER2 transmembrane domain can be encoded by a polynucleotide comprising a nucleotide sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 99% or 100% identity to a nucleotide sequence selected from the group consisting of SEQ ID NO:88 and SEQ ID NO:92 (delta 16).
  • the EGFR-HER2 chimeric cell surface polypeptide fused to the HER2 transmembrane domain has at least 70%, 75%, 80%, 85%, 90%, 95%, 99% or 100% identity to an amino acid sequence selected from the group consisting of SEQ ID NO: 89 and SEQ ID NO:93 (delta 16).
  • a chimeric cell surface polypeptide can comprise a chimera of a HERlt polypeptide and a truncated ErbB3 (ErbB3t) polypeptide or fragment thereof.
  • the polypeptide construct can comprise a HERlt/EGFRt polypeptide comprising HERl Domain III and an ErbB3t polypeptide comprising an ErbB3 Domain IV and ErbB3
  • the EGFR-ErbB3 chimeric cell surface polypeptide fused to the ErbB3 transmembrane domain can be encoded by a polynucleotide comprising a nucleotide sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 99% or 100% identity to the nucleotide sequence of SEQ ID NO:96.
  • the EGFR-ErbB3 chimeric cell surface polypeptide fused to the ErbB3 transmembrane domain has at least 70%, 75%, 80%, 85%, 90%, 95%, 99% or 100% identity to the amino acid sequence of SEQ ID NO:97.
  • a chimeric cell surface polypeptide can comprise a chimera of a HERlt polypeptide and a truncated ErbB4 (ErbB4t) polypeptide or fragment thereof.
  • the polypeptide construct can comprise a HERlt/EGFRt polypeptide comprising Domain III and an ErbB4t polypeptide comprising ErbB4 Domain IV and ErbB4 transmembrane domain.
  • an ErbB4t polypeptide can comprise a JM-a extracellular juxtamembrane domain encoded by the ErbB4 JM-a alternative transcript.
  • an ErbB4t polypeptide can comprise a JM-b extracellular juxtamembrane domain encoded by the ErbB4 JM-b alternative transcript.
  • the chimeric cell surface polypeptide fused to the ErbB4 transmembrane domain can be encoded by a polynucleotide comprising a nucleotide sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 99% or 100%) identity to s nucleotide sequence selected from the list consisting of SEQ ID NO: 100 (EGFR-ErbB4 (JM-a)) and SEQ ID NO: 104 (EGFR-ErbB4 (JM-b)).
  • the EGFR-ErbB4 chimeric cell surface polypeptide fused to the ErbB4 transmembrane domain has at least 70%, 75%, 80%, 85%, 90%, 95%, 99% or 100% identity to the amino acid sequence selected from the list consisting of SEQ ID NO: 101 (EGFR-ErbB4 (JM-a)) and SEQ ID NO: 105 (EGFR-ErbB4 (JM-b)).
  • a polypeptide construct described herein can comprise any combination of signal peptide, cell surface polypeptide comprising a HERlt polypeptide (e.g., comprising only HERlt or a chimeric polypeptide comprising HERlt), transmembrane domain and optionally a linker.
  • a polypeptide construct can comprise a cell surface polypeptide comprising a HERlt polypeptide or a chimeric polypeptide comprising HERlt linked or fused to a derivative or fragment of a CD28 transmembrane domain via a linker (e.g., one or more (e.g., 1-4) copies of (G4S (SEQ ID NO: 221))).
  • the cell surface polypeptide can include a HERlt polypeptide encoded by a polynucleotide comprising a nucleotide sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 99% or 100% identity to a nucleotide sequence selected from the list consisting of SEQ ID NO:56 (HERltl); SEQ ID NO:58 (HERlt2); SEQ ID NO:60 (HERlt3); SEQ ID NO:62 (HERlt4); SEQ.
  • the cell surface polypeptide can include a HERlt polypeptide comprising an amino acid sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 99% or 100% identity to an amino acid sequence selected from the list consisting of SEQ ID NO:55 (HERlt); SEQ ID NO:57 (HERltl); SEQ ID NO:59 (HERlt2); SEQ ID NO:61 (HERlt3); SEQ.
  • HERlt4 SEQ ID NO:65 (HERlt5); SEQ ID NO:67 (HERlt6); SEQ ID NO:69 (HERlt7); SEQ ID NO:73(HERlt8); SEQ ID NO:77 (HERlt9); SEQ ID NO:81 (HERltlO); and SEQ ID NO:85 (HERltl 1).
  • a polypeptide construct can comprise a signal peptide, a cell surface polypeptide comprising a HERlt polypeptide or a chimeric polypeptide comprising a HERlt polypeptide, a transmembrane domain comprising a transmembrane dimerization domain, and a linker to connect the transmembrane domain and cell surface polypeptide.
  • a polypeptide construct can comprise an Ig Kappa signal peptide, a particular truncated variant of HERl, a linker (e.g.
  • a polypeptide construct comprising a HERlt polypeptide and a transmembrane dimerization domain is encoded by a polynucleotide comprising a nucleotide sequence which has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity to a nucleotide sequence selected from the list consisting of SEQ ID NO:70 (glycophorin A; HERlt8); SEQ ID NO:74 (glycophorin A; HERlt9); SEQ ID NO:78 (glycophorin A; HERltlO); and SEQ ID NO:82 (CD3 zeta; HERltl 1).
  • a polypeptide construct can comprise a cell surface polypeptide comprising a HERlt-HER2t chimera linked to a HER2 transmembrane domain.
  • the truncated HERlt-HER2t chimera and transmembrane domain can be further connected to a signal peptide (e.g., GMCSFRa) which directs the polypeptide construct to the cell surface.
  • GMCSFRa signal peptide
  • the polypeptide construct is encoded by a polynucleotide having at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100%) identity to a nucleotide sequence selected from the list consisting of SEQ ID NO:86 and SEQ ID NO:90 (delta 16).
  • the polypeptide construct has an amino acid sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity to an amino acid sequence selected from the list consisting of SEQ ID NO:87 and SEQ ID NO:91 (delta 16).
  • a polypeptide construct can comprise a cell surface polypeptide comprising a HERlt-ErbB3t chimera linked to an ErbB3 transmembrane domain.
  • the HERlt-ErbB3t chimera and transmembrane domain is further connected to a signal peptide (e.g., GMCSFRa) which directs the polypeptide construct to the cell surface.
  • the polypeptide construct is encoded by a polynucleotide having at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity to a nucleotide sequence of SEQ ID NO:94.
  • the polypeptide construct has an amino acid sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity to the amino acid sequence of SEQ ID NO:95.
  • a polypeptide construct can comprise a cell surface polypeptide comprising a HERlt-ErbB4t chimera linked to an ErbB4 transmembrane domain.
  • the HERlt-ErbB4t chimera and transmembrane domain is further connected to a signal peptide (e.g., GMCSFRa) which directs the polypeptide construct to the cell surface.
  • GMCSFRa signal peptide
  • the polypeptide construct is encoded by a polynucleotide having at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity to a nucleotide sequence selected from the list consisting of SEQ ID NO:98 (JM-a variant) and SEQ ID NO: 102 (JM-b variant).
  • the polypeptide construct has an amino acid sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity to an amino acid sequence selected from the list consisting of SEQ ID NO:99 (JM-a variant) and SEQ ID NO: 103 (JM-b variant).
  • a polypeptide construct comprising a HERlt polypeptide can comprise any signal peptide capable of directing the polypeptide construct to the cell surface.
  • a cell surface polypeptide comprising a HERlt polypeptide e.g., comprising an amino acid sequence which has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity to an amino acid sequence selected from the list consisting of SEQ ID NO:200, SEQ ID NO:210, SEQ ID
  • SEQ ID NO:21 1 SEQ ID NO:212, SEQ ID NO:213, SEQ ID NO:214, SEQ ID NO:215, SEQ ID NO:216 and SEQ ID NO:217) can be fused to a signal peptide comprising an amino acid sequence which has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity to an amino acid sequence selected from the list consisting of SEQ ID NO:2 (GMCSFRa), SEQ ID NO:4 (Ig Kappa), SEQ ID NO: 6 (Immunoglobulin E), SEQ ID NO: 8 (CD8a), SEQ ID NO: 10 (TVB2), SEQ ID NO: 12 (CD52) or SEQ ID NO: 14 (LNFGR).
  • GMCSFRa GMCSFRa
  • SEQ ID NO:4 Ig Kappa
  • SEQ ID NO: 6 Immunoglobulin E
  • SEQ ID NO: 8 CD8a
  • SEQ ID NO: 10 TVB2
  • a polypeptide construct comprising a HERlt polypeptide can comprise any
  • transmembrane domain including a transmembrane domain that does not comprise a dimerization domain.
  • a cell surface polypeptide comprising a HERlt polypeptide e.g., comprising an amino acid sequence which has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%), or 100% identity to an amino acid sequence selected from the list consisting of SEQ ID NO:200, SEQ ID NO:210, SEQ ID NO:21 1, SEQ ID NO:212, SEQ ID NO:213, SEQ ID
  • SEQ ID NO:214, SEQ ID NO:215, SEQ ID NO:216 and SEQ ID NO:217) can be linked to a
  • transmembrane domain comprising an amino acid sequence which has at least 70%, 75%, 80%, 85%), 90%), 95%), 99%), or 100% identity to an amino acid sequence selected from the list consisting of SEQ ID NO:26 (glycophorin A E91-R1 16), SEQ ID NO:28 (glycophorin A 192- II 14), SEQ ID NO:30 (glycophorin A(I92-L109).integrin ⁇ 3 (A737-W741), SEQ ID NO:32 (CD3 zeta chain), SEQ ID NO: 34 (CD8a), SEQ ID NO:36 (CD28), SEQ ID NO:38 (CTLA4) and SEQ ID NO:40 (LNGFR).
  • a polypeptide construct comprising a HERlt polypeptide can comprise any peptide linker (or in some embodiments no peptide linker).
  • a cell surface polypeptide comprising HERlt e.g., comprising an amino acid sequence which has at least 70%, 75%, 80%, 85%), 90%), 95%), 99%
  • a cell surface polypeptide comprising HERlt e.g., comprising an amino acid sequence which has at least 70%, 75%, 80%, 85%), 90%), 95%), 99%
  • SEQ ID NO:200, SEQ ID NO:210, SEQ ID NO:21 1, SEQ ID NO:212, SEQ ID NO:213, SEQ ID NO:214, SEQ ID NO:215, SEQ ID NO:216 and SEQ ID NO:21-7 can be fused to a peptide linker comprising an amino acid sequence which has at least 70%, 75%, 80%, 85%, 90%), 95%), 99%), or 100%) identity to an amino acid sequence selected from the
  • a cell surface polypeptide can incorporate a truncated CD polypeptide.
  • the cell surface polypeptide can include a truncated CD20 polypeptide (herein designated CD20t).
  • CD20t truncated CD20 polypeptide
  • the natural CD20 polypeptide is a multi-pass transmembrane protein encoded by a membrane-spanning 4-domains subfamily A member 1 (MS4A1) gene.
  • full-length CD20 can be encoded by a polynucleotide comprising the nucleotide sequence of SEQ ID NO: 106, and full-length CD20 amino acid sequence can correspond to the amino acid sequence of SEQ ID NO: 107.
  • CD20 comprises 4 transmembrane domain passes encompassing amino acids 57-78, 85-105, 121-141, and 189-209. In some embodiments, CD20 comprises 2 extracellular domains encompassing amino acids 79-84 and 142-188. In some embodiments, CD20 comprises 3 cytoplasmic domains encompassing amino acids 1-56, 106-120 and 210-297. [0170] Provided herein are polypeptide constructs comprising CD20 polypeptides which are truncated for any amino acids, domains or fragments of endogenous CD20. Herein a CD20 polypeptide can comprise a CD20t polypeptide.
  • a CD20 polypeptide consists of or consists essentially of a CD20t polypeptide.
  • a CD20 polypeptide can comprise a CD20t polypeptide in addition to another CD20 domain or portion thereof (e.g. a CD20 transmembrane domain and/or cytoplasmic domain).
  • a CD20 polypeptide can be truncated for an intracellular cytoplasmic (e.g. signaling) domain or portion thereof, a transmembrane (e.g. helical) domain or portion thereof, and/or an extracellular domain or portion thereof.
  • a CD20 polypeptide can be missing multiple domains or multiple portions of a domain relative to the wildtype polypeptide.
  • a CD20 polypeptide comprises M1-E263 of endogenous CD20 (SEQ ID NO: 109; CD20tl), M1 17-N214 of endogenous CD20 (SEQ ID NO: 1 1 1 (CD20t2), M1-N214 of endogenous CD20 (SEQ ID NO: 1 15; CD20t4), V82-N214 of endogenous CD20 (SEQ ID NO: 1 17; CD20t5), or V82-I186 of endogenous CD20 (SEQ ID NO: 1 19, CD20t6).
  • a CD20t polypeptide can comprise an extracellular domain or fragment thereof.
  • a CD20t polypeptide has at least 70%, 75%, 80%, 85%, 90%), 95%), 99%), or 100% identity to an amino acid sequence selected from the list consisting of SEQ ID NO:218, SEQ ID NO:219 and SEQ ID NO:220.
  • a CD20t polypeptide can be linked to a transmembrane domain or fragment thereof.
  • a polypeptide construct comprises a CD20t polypeptide linked to a CD20 transmembrane domain.
  • a polypeptide construct comprising a CD20t polypeptide linked to a CD20 transmembrane domain is encoded by a polynucleotide comprising a nucleotide sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 99% or 100% identity to a nucleotide sequence selected from the list consisting of SEQ ID NO: 108 (CD20tl encoding M1-E263); SEQ ID NO: 1 10 (CD20t2 encoding Ml 17-N214); SEQ ID NO: 1 14 (CD20t4 encoding M1-N214); SEQ ID NO: 1 16 (CD20t5 encoding V82-N214); SEQ ID NO: 1 18 (CD20t6 encoding V82-I186); SEQ ID NO: 132 (CD20U3 encoding Ml -A54 and C1 1 1-P297); SEQ ID NO: 134 (CD20U4 encoding M1-A54 and C
  • a polypeptide construct comprising a CD20t polypeptide linked to a CD20 transmembrane domain can comprise an amino acid sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 99% or 100% identity to an amino acid sequence selected from the list consisting of SEQ ID NO: 109 (CD20tl : M1-E263); SEQ ID NCv l l l (CD20t2: M117-N214); SEQ ID NO: 115 (CD20t4: M1-N214); SEQ ID NO: 117 (CD20t5: V82-N214); SEQ ID NO: 119 (CD20t6: V82-I186); SEQ ID NO: 133 (CD20tl3 : Ml- A54 and C111-P297); SEQ ID NO: 135 (CD20U4: M1-A54 and C111-E281); SEQ ID NO: 137 (CD20U5: M1-A54 and C111-E263);
  • a CD20t polypeptide can retain at least one copy of a rituximab- binding mimotope of endogenous CD20, as described in Philip et al, (2014), "A highly compact epitope-based marker/suicide gene for easier and safer T-cell therapy," Blood: 124: 1277-1287.
  • one or more copies of a rituximab-binding epitope of CD20t can be fused to one or more CD-34-derived amino acid sequences, such as the amino-terminal 40 amino acids of CD34 which facilitate binding of an anti-CD34 monoclonal antibody.
  • a CD20t polypeptide can have multiple domains removed, or a portion of multiple domains removed.
  • a cell surface polypeptide incorporating a CD20t polypeptide can include an epitope that can be recognized by an exogenously introduced antibody or binding partner.
  • a CD20t polypeptide included in the cell surface polypeptide can incorporate a rituximab-binding domain in order to facilitate targeted depletion of cells expressing a polypeptide construct described herein ⁇ e.g., via CDC and/or antibody-dependent cellular cytotoxicity ADCC).
  • Non- limiting examples of antibodies which can be used to bind to an epitope of a cell surface polypeptide comprising a CD20t polypeptide include rituximab, hOUBM3/6, afutuzumab, blontuvetmab, obinutuzumab, ibritumomab tiuxetan, tositumomab, ofatumumab, ocaratuzumab, ocrelizumab, TRU-015 (Trubion) and veltuzumab (IMMU-106).
  • the antibody can be a monoclonal antibody, scFv, scFab, diabody, or camelid antibody.
  • the antibody can be conjugated to a drug or a toxin.
  • the CD20t polypeptide includes an epitope found in an extracellular domain of endogenous CD20.
  • an epitope of the CD20t polypeptide includes amino acids 170-185 of endogenous CD20.
  • an epitope of the CD20t polypeptide includes amino acids 170-173 and 182-185 of endogenous CD20.
  • a cell surface polypeptide comprising a CD20t polypeptide is chimeric for a truncated variant of one or more additional polypeptides.
  • a chimeric cell surface polypeptide can comprise a CD20t polypeptide and a truncated CD8a (CD8at) polypeptide.
  • a cell surface polypeptide can further comprise multiple CD20t linked sequences together as a concatemer.
  • a cell surface polypeptide can comprise the same CD20t amino acid sequence repeated in succession, or different CD20t variants connected together.
  • CD20t amino acid sequences are linked together in the cell surface polypeptide by a peptide linker.
  • an SGS or SG4S linker (SEQ ID NO: 223) can be used to link together repeating CD20 amino acid sequences in a cell surface polypeptide (e.g., see SEQ ID NO: 123 (SGS linker) and SEQ ID NO: 129 (SG4S linker (SEQ ID NO: 223)), which further comprise the cell surface polypeptide linked to a CD28 transmembrane domain by an SG4S linker (SEQ ID NO: 223).
  • a polypeptide construct described herein can comprise any combination of signal peptide, cell surface polypeptide comprising a CD20t polypeptide (e.g., comprising only CD20t or a CD20t chimera), transmembrane domain and optionally a linker.
  • a CD20t polypeptide e.g., comprising only CD20t or a CD20t chimera
  • transmembrane domain e.g., CD20t chimera
  • polypeptide construct can comprise an SG4S linker (SEQ ID NO: 223) which connects or fuses a cell surface polypeptide comprising a CD20t polypeptide to a transmembrane domain.
  • a transmembrane domain is derived from or homologous to a transmembrane domain or fragment thereof from CD20, CD28 or CD8a.
  • a polypeptide construct comprising CD20t is encoded by a polynucleotide comprising a nucleotide sequence selected from the list consisting of SEQ ID NO: 1 12 (CD20t3 encoding CD20t (K142-S 188) and CD8a (I183-T203) transmembrane domain); SEQ ID NO: 120 (CD20t7 encoding CD20t (P160- Q187), an SG4S linker (SEQ ID NO: 223) and CD28 (I96-D172) transmembrane domain); SEQ ID NO: 122 (CD20t8 encoding a CD20t-concatemer (P160-Q187 separated by an SGS linker), SG4S linker (SEQ ID NO: 223) and CD28 (I96-D 172) transmembrane domain); SEQ ID NO: 124 (CD20t9 encoding CD20t (P160-Q187), an SG4S linker (SEQ ID NO: 223) and
  • a polypeptide construct comprising CD20t comprises an amino acid sequence selected from the list consisting of SEQ ID NO: 1 13 (CD20t3; CD20t (K142-S 188) and CD8a (I183-T203) transmembrane domain); SEQ ID NO: 121 (CD20t7 encoding CD20t (P160-Q187), an SG4S linker (SEQ ID NO: 223) and CD28 (I96-D172) transmembrane domain); SEQ ID NO: 123 (CD20t8 encoding a CD20t-concatemer (P160-Q187 separated by an SGS linker), SG4S linker (SEQ ID NO: 223) and CD28 (I96-D172) transmembrane domain); SEQ ID NO: 125 (CD20t9 encoding CD20t (P160-Q187), an SG4S linker (SEQ ID NO: 223) and a CD8a (P120-V201) transmembrane domain); SEQ ID NO
  • a polypeptide construct comprising a CD20t polypeptide can comprise any signal peptide capable of directing the polypeptide construct to the cell surface.
  • a polypeptide construct comprising a CD20t polypeptide e.g., a polypeptide which comprises an amino acid sequence selected from the list consisting of SEQ ID NO:218, SEQ ID NO:219 and SEQ ID NO:220
  • a signal peptide comprising an amino acid sequence which has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity to an amino acid sequence selected from the list consisting of SEQ ID NO:2 (GMCSFRa), SEQ ID NO:4 (IG Kappa), SEQ ID NO: 6 (Immunoglobulin E), SEQ ID NO: 8 (CD8a), SEQ ID NO: 10 (TVB2), SEQ ID NO: 12 (CD52) or SEQ ID NO: 14 (LNFGR).
  • SEQ ID NO:2 GMCSFRa
  • a polypeptide construct comprising a CD20t polypeptide can comprise any
  • transmembrane domain including a transmembrane domain that comprises a dimerization domain or does not comprise a dimerization domain.
  • a polypeptide construct comprising a CD20t polypeptide e.g., a polypeptide which comprises an amino acid sequence selected from the list consisting of SEQ ID NO:218, SEQ ID NO:219 and SEQ ID NO:220
  • a transmembrane domain comprising an amino acid sequence which has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity to an amino acid sequence selected from the list consisting of SEQ ID NO:26 (glycophorin A E91-R1 16), SEQ ID NO:28 (glycophorin A 192- II 14), SEQ ID NO:30 (glycophorin A (I92-L109).integrin ⁇ 3 (A737-W741), SEQ ID NO:32 (CD3 zeta chain), SEQ ID NO: 34 (CD8a
  • a polypeptide construct comprising a CD20t polypeptide can comprise any peptide linker (or in some embodiments no peptide linker).
  • a polypeptide construct comprising a CD20t polypeptide e.g., a polypeptide which comprises an amino acid sequence selected from the list consisting of SEQ ID NO:218, SEQ ID NO:219 and SEQ ID NO:220
  • a polypeptide linker comprising an amino acid sequence which has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity to an amino acid sequence selected from the list consisting of SEQ ID NO: 16 (GSG), SEQ ID NO: 18 (SGSG), SEQ ID NO:20 ((G4S)3), SEQ ID NO:22 ((G4S)4) and SEQ ID NO:24 (Whitlow).
  • CD52 occurs endogenously in humans as a peptide of 12 amino acids linked at its C-terminus to a glycosylphosphatidylinositol (GPI) anchor.
  • GPI glycosylphosphatidylinositol
  • GPI glycophosphatidylinositol
  • CD52 polypeptide constructs comprising CD52 polypeptides which are truncated for any amino acids, domains or fragments of endogenous CD52.
  • a CD52 polypeptide can comprise a truncated CD52 (CD52t) polypeptide.
  • a CD52 polypeptide consists of or consists essentially of a cell surface polypeptide comprising a CD52t polypeptide.
  • a CD52 polypeptide can comprise a cell surface polypeptide comprising a CD52t polypeptide in addition to other CD52 domains (e.g. a CD52 signal peptide).
  • polypeptide constructs which comprise a cell surface polypeptide comprising a truncated CD52t polypeptide.
  • a CD52t polypeptide is linked to a CD52 signal peptide for directing the truncated variant to the cell surface.
  • a cell surface polypeptide comprising a CD52t polypeptide can incorporate one or more epitopes that can be recognized by an exogenously introduced antibody or binding partner.
  • a CD52t polypeptide can incorporate one or more alemtuzumab-binding domains and thereby facilitate targeted depletion of cells expressing a polypeptide construct described herein.
  • targeted depletion can result from alemtuzumab-mediated CDC and/or ADCC, or another cellular mechanism which mediates the cytotoxic effects of alemtuzumab recognition.
  • anti-CD52 molecules which can recognize a cell surface polypeptide comprising a CD52t polypeptide include alemtuzumab, ANT 1034, HI 186(Bio Rad), YTH34.5 (Bio Rad) and YTH66.9HL (Bio-Rad).
  • the antibody can be a monoclonal antibody, scFv, scFab, diabody, or camelid antibody.
  • a polynucleotide sequence encoding a CD52 epitope comprises a nucleotide sequence which has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity to the nucleotide sequence of SEQ ID NO: 142.
  • a CD52 epitope has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 143.
  • a polypeptide construct described herein can have multiple epitopes which can be recognized by an antibody or binding partner.
  • a polypeptide construct comprising a CD52t polypeptide can comprise multiple epitopes specific for a binding partner (e.g., alemtuzumab).
  • a CD52t polypeptide comprises multiple copies (e.g., at least two copies, at least three copies, at least four copies, at least five copies, at least six copies, or at least ten copies) of the amino acid sequence shown in SEQ ID NO: 143. Each copy or repeat of the amino acid sequence can be separated in a polypeptide construct by a linker (e.g., Whitlow linker).
  • a polypeptide construct comprises a CD52 signal peptide linked to one or more copies of a CD52t polypeptide fused to a Whitlow linker, which is linked (e.g. via one or more copies of a (G4S) linker (SEQ ID NO: 221)) to a transmembrane domain (e.g., CD28 transmembrane domain or a fragment thereof).
  • a CD52 signal peptide linked to one or more copies of a CD52t polypeptide fused to a Whitlow linker, which is linked (e.g. via one or more copies of a (G4S) linker (SEQ ID NO: 221)) to a transmembrane domain (e.g., CD28 transmembrane domain or a fragment thereof).
  • a polypeptide construct comprising a CD52t polypeptide is encoded by a polynucleotide which has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity to a nucleotide sequence selected from the list consisting of SEQ ID NO: 144 (CD52tl; encoding one copy of an epitope/linker; ), SEQ ID NO: 146 (CD52t2; encoding two copies of an
  • a polypeptide comprising a CD52t polypeptide has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100%) identity to an amino acid sequence selected from the list consisting of SEQ ID NO: 145 (CD52tl; encoding one copy of an epitope/linker; ), SEQ ID NO: 147 (CD52t2; encoding two copies of an epitope/linker), and SEQ ID NO: 149 (CD52t3; encoding three copies of an epitope/linker)
  • a polypeptide construct comprising a CD52t polypeptide can comprise any
  • transmembrane domain including a transmembrane domain that comprises a dimerization domain or does not comprise a dimerization domain.
  • a cell surface polypeptide comprising a CD52t polypeptide can be fused via a linker (e.g. 3xGS linker (SEQ ID NO: 224)) to a transmembrane domain comprising a transmembrane dimerization domain (e.g. derived from or homologous to a transmembrane domain of glycophorin A or glycophorin A-integrin ⁇ 3).
  • a polypeptide construct comprising a CD52t polypeptide has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity to an amino acid sequence selected from the list consisting of SEQ ID NO: 150 (CD52t4; CD52 signal peptide, 3xGS peptide linker (SEQ ID NO: 224) and glycophorin A transmembrane domain), SEQ ID NO: 151 (CD52t5; CD52 signal peptide, 3xGS peptide linker (SEQ ID NO: 224) and glycophorin A transmembrane domain), and SEQ ID NO: 152 (CD52t6; CD52 signal peptide, 3xGS linker (SEQ ID NO: 224) and glycophorin A-integrin ⁇ 3 transmembrane domain).
  • SEQ ID NO: 150 CD52t4; CD52 signal peptide, 3xGS peptide linker (SEQ ID NO: 224) and glycophorin A transmembrane domain
  • a polypeptide construct comprising a CD52t polypeptide (e.g., SEQ ID NO: 143, which can be linked to a CD52 signal peptide to give rise to an amino acid sequence which has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity to an amino acid sequence selected from the list consisting of SEQ ID NO: 145, SEQ ID NO: 147, and SEQ ID NO: 149) can be linked to a transmembrane domain comprising an amino acid sequence which has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity to an amino acid sequence selected from the list consisting of SEQ ID NO:26 (glycophorin A E91-R1 16), SEQ ID NO:28 (glycophorin A 192-11 14), SEQ ID NO:30 (glycophorin A(I92-L109).integrin ⁇ 3 (A737-W741), SEQ ID NO:32 (
  • a polypeptide construct comprising a CD52t polypeptide can comprise any signal peptide capable of directing the polypeptide construct to the cell surface.
  • a CD52t polypeptide is linked to a signal peptide of CD52 (e.g., the polypeptide construct comprises an amino acid sequence which has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100%) identity to the amino acid sequence selected from the list consisting of SEQ ID NO: 145, SEQ ID NO: 147, and SEQ ID NO: 149).
  • a polypeptide construct comprises a CD52t polypeptide (e.g., SEQ ID NO: 143) linked to a signal peptide comprising an amino acid sequence which has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity to an amino acid sequence selected from the list consisting of SEQ ID NO:2 (GMCSFRa), SEQ ID NO:4 (IG Kappa), SEQ ID NO:6 (Immunoglobulin E), SEQ ID NO:8 (CD8a), SEQ ID NO: 10 (TVB2), SEQ ID NO: 12 (CD52) or SEQ ID NO: 14 (LNFGR).
  • CD52t polypeptide e.g., SEQ ID NO: 143 linked to a signal peptide comprising an amino acid sequence which has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity to an amino acid sequence selected from the list consisting of SEQ ID NO:2 (GMCSFRa), SEQ ID NO:
  • a polypeptide construct comprising a CD52t polypeptide can comprise any peptide linker (or in some embodiments no peptide linker).
  • a cell surface polypeptide comprising CD52t e.g., comprising an amino acid sequence which has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 143
  • a peptide linker comprising an amino acid sequence which has at least 70%, 75%, 80%, 85%), 90%, 95%, 99%, or 100% identity to an amino acid sequence selected from the list consisting of SEQ ID NO: 16 (GSG), SEQ ID NO: 18 (SGSG), SEQ ID NO:20 ((G4S)3), SEQ ID NO:22 ((G4S)4) and SEQ ID NO:24 (Whitlow).
  • the cell surface polypeptide can include a truncated version of a polypeptide from the tumor necrosis factor (TNF) receptor superfamily.
  • TNF tumor necrosis factor
  • LNGFR is a single-pass type I transmembrane glycoprotein having an extracellular domain exhibiting a folded structure due in part to disulfide bond formation between cysteine residues of the protein.
  • a polynucleotide encoding LNGFR or a portion thereof comprises a nucleotide sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity to a nucleotide sequence selected from the list consisting of SEQ ID NO: 153, SEQ ID NO: 155 (encoding K29-N250 of the LNGFR extracellular domain), SEQ ID NO: 157 (encoding E65- N250 including cysteine residues 2,3,4 capable of forming disulfide bonds), and SEQ ID NO:
  • LNGFR has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity to an amino acid sequence selected from the list consisting of SEQ ID NO: 154, SEQ ID NO: 156 (comprising K29-N250 of the LNGFR extracellular domain), SEQ ID NO: 158 (comprising E65- N250 including cysteine residues 2,3,4 capable of forming disulfide bonds), and SEQ ID NO:
  • an LNGFR polypeptide can comprise an LNGFRt polypeptide.
  • an LNGFR polypeptide consists of or consists essentially of a cell surface polypeptide comprising an LNGFRt polypeptide.
  • an LNGFR polypeptide can comprise a cell surface polypeptide comprising an LNGFRt polypeptide in addition to other LNGFR domains (e.g. an LNGFR transmembrane domain).
  • a polypeptide construct can comprise a truncated LNGFR (herein LNGFRt) polypeptide with any domain or fragment thereof truncated relative to the wildtype protein.
  • LNGFRt polypeptide can be truncated for one or more of the transmembrane domain or a portion thereof, the intracellular domain or a portion thereof, or the extracellular domain or a portion thereof.
  • an LNGFRt polypeptide can be truncated for one or more TNFR-Cys repeats that form a natural binding domain for its ligands (e.g., NGF, BDNF, NTF3 and NTF4).
  • a polypeptide construct comprises an LNGFRt polypeptide comprising the entire extracellular domain (SEQ ID NO: 156).
  • a polypeptide construct comprising an LNGFRt polypeptide is fused to an LNGFR transmembrane domain.
  • a polynucleotide encoding an LNGFRt polypeptide linked to an LNGFR transmembrane domain comprises a nucleotide sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity to the nucleotide sequence of SEQ ID NO: 161 (LNGFRtl).
  • an LNGFRt polypeptide linked to an LNGFR transmembrane domain has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 162 (LNGFRtl).
  • a polypeptide construct comprising an LNGFRt polypeptide can comprise any transmembrane domain, including a transmembrane domain that comprises a dimerization domain or does not comprise a dimerization domain.
  • a polypeptide construct can comprise an LNGFRt polypeptide linked to an LNGFR transmembrane domain or a fragment thereof.
  • a LNGFRt polypeptide can be fused (e.g., via a linker) to a transmembrane domain or fragment thereof derived from a different polypeptide, including a transmembrane domain capable of dimerization.
  • a polypeptide construct comprising an LNGFRt polypeptide has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity to an amino acid sequence selected from the list consisting of SEQ ID NO: 163
  • LNGFRt2 entire LNGFR extracellular domain; GS linker and CD28 transmembrane domain
  • SEQ ID NO: 164 LNGFRt3; fragment of LNGFR extracellular domain including cysteine residues 2-4, a GS peptide linker and a CD28 transmembrane domain
  • SEQ ID NO: 165 SEQ ID NO: 165
  • LNGFRt3 fragment of LNGFR extracellular domain including cysteine residues 3-4, a GS peptide linker and a CD28 transmembrane domain
  • SEQ ID NO: 166 fragment of LNGFR extracellular domain including cysteine residues 3-4, GS linker and glycophorin A transmembrane domain
  • SEQ ID NO: 167 fragment of LNGFR extracellular domain including cysteine residues 3-4, GS linker and glycophorin A transmembrane domain
  • SEQ ID NO: 168 LNGFRt7; fragment of LNGFR extracellular domain comprising cysteine residues 3-4, GS linker and glycophorin A-integrin ⁇ 3 transmembrane domain
  • a polypeptide construct comprising an LNGFRt polypeptide can be fused to a transmembrane domain comprising an amino acid sequence which has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity to an amino acid sequence selected from the list consisting of SEQ ID NO:26 (glycophorin A E91-R1 16), SEQ ID NO:28 (glycophorin A 192- II 14), SEQ ID NO:30 (glycophorin A(I92-L109).integrin ⁇ 3 (A737-W741), SEQ ID NO:32 (CD3 zeta chain), SEQ ID NO: 34 (CD8a), SEQ ID NO:36 (CD28), SEQ ID NO:38 (CTLA4) and SEQ ID NO:40 (LNGFR).
  • a polypeptide construct comprising an LNGFRt polypeptide can comprise any signal peptide capable of directing the polypeptide construct to the cell surface.
  • a cell surface polypeptide comprising an LNGFRt polypeptide can be fused to a signal peptide comprising an amino acid sequence which has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100%) identity to an amino acid sequence selected from the list consisting of SEQ ID NO:2 (GMCSFRa), SEQ ID NO:4 (IG Kappa), SEQ ID NO:6 (Immunoglobulin E), SEQ ID NO:8 (CD8a), SEQ ID NO: 10 (TVB2), SEQ ID NO: 12 (CD52) or SEQ ID NO: 14 (LNFGR).
  • a polypeptide construct comprising an LNGFRt polypeptide can comprise any peptide linker (or in some embodiments no peptide linker).
  • a cell surface polypeptide comprising an LNGFRt polypeptide can be fused to a peptide linker comprising an amino acid sequence which has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity to an amino acid sequence selected from the list consisting of SEQ ID NO: 16 (GSG), SEQ ID NO: 18 (SGSG), SEQ ID NO:20 ((G4S)3), SEQ ID NO:22 ((G4S)4) and SEQ ID NO:24 (Whitlow).
  • polypeptide constructs described herein can be encoded by one or more amino acids
  • an "expression vector” or “vector” is any genetic element, e.g., a plasmid, chromosome, virus, transposon, behaving either as an autonomous unit of polynucleotide replication within a cell. ⁇ i.e. capable of replication under its own control) or being rendered capable of replication by insertion into a host cell chromosome, having attached to it another polynucleotide segment, so as to bring about the replication and/or expression of the attached segment.
  • Suitable vectors include, but are not limited to, plasmids, transposons, bacteriophages and cosmids. Vectors may contain
  • polynucleotide sequences which are necessary to effect ligation or insertion of the vector into a desired host cell and to effect the expression of the attached segment. Such sequences differ depending on the host organism; they include promoter sequences to effect transcription, enhancer sequences to increase transcription, ribosomal binding site sequences and transcription and translation termination sequences.
  • expression vectors may be capable of directly expressing nucleic acid sequence products encoded therein without ligation or integration of the vector into host cell DNA sequences.
  • a vector also can comprise a "selectable marker gene.”
  • selectable marker gene refers to a nucleic acid sequence that allows cells expressing the nucleic acid sequence to be specifically selected for or against, in the presence of a corresponding selective agent. Suitable selectable marker genes are known in the art and described in, e.g., International Patent Application Publications WO 1992/08796 and WO 1994/28143; Wigler et al., Proc. Natl. Acad. Sci. USA, 77: 3567 (1980); O'Hare et al., Proc. Natl. Acad. Sci. USA, 78: 1527 (1981); Mulligan & Berg, Proc. Natl.
  • the vector is an "episomal expression vector” or "episome,” which is able to replicate in a host cell, and persists as an extrachromosomal segment of DNA within the host cell in the presence of appropriate selective pressure (see, e.g., Conese et al., Gene Therapy, 1 1 : 1735-1742 (2004)).
  • Representative commercially available episomal expression vectors include, but are not limited to, episomal plasmids that utilize Epstein Ban- Nuclear Antigen 1 (EBNA1) and the Epstein Barr Virus (EBV) origin of replication (oriP).
  • the vectors pREP4, pCEP4, pREP7, and pcDNA3.1 from Invitrogen (Carlsbad, Calif.) and pBK- CMV from Stratagene (La Jolla, Calif.) represent non-limiting examples of an episomal vector that uses T-antigen and the SV40 origin of replication in lieu of EBNA1 and oriP.
  • polypeptide construct which can comprise a signal peptide, a transmembrane domain, a cell surface polypeptide comprising a truncated variant of a natural polypeptide, and optionally a peptide linker connecting the transmembrane domain to the cell surface polypeptide.
  • FIG. 4A illustrates an embodiment of a polypeptide construct having cell tag functionality. The truncated variant extends into the extracellular matrix via a peptide linker connecting to the transmembrane domain.
  • the truncated variant can include one or more epitopes for an anti -truncated variant antibody (e.g., exogenously added) which can recognize and bind to the truncated variant/cell tag.
  • binding of the antibody to the truncated variant can result in cell depletion (e.g., via ADCC), which can be beneficial for example during adoptive cell therapy where the cell has been engineered to express one or more additional molecules such as a cytokine, TCR and/or CAR.
  • different polypeptide constructs comprise a constant transmembrane domain and signal peptide, but vary in the identity of the truncated variant incorporated into the polypeptide construct.
  • different polypeptide constructs can comprise different truncated variants of the same natural polypeptide.
  • the polypeptide constructs may further differ based on the presence/absence of a peptide linker in the polypeptide construct or the length of the peptide linker.
  • the peptide linker of each polypeptide construct is sized to maintain a relatively constant distance between the distal end of the particular truncated variant and the cell surface.
  • a polynucleotide can comprise a vector comprising a sequence encoding a signal peptide and a transmembrane domain (e.g. either comprising or lacking a transmembrane dimerization domain).
  • the vector can provide for the cloning of an insert between the signal peptide and the transmembrane domain, such that the insert comprises a nucleotide sequence encoding a particular truncated variant and optionally a peptide linker.
  • vectors can be provided that comprise a polynucleotide encoding a signal peptide, a particular truncated variant and optionally a linker, and provide for the insertion of a nucleotide sequence encoding a transmembrane domain adjacent to the coding sequence for the truncated variant or linker.
  • a series of vectors that maintain as constant a particular domain or domains in a resultant polypeptide construct, but allow for the swapping in and out of a domain that may be variable between polypeptide constructs
  • the present disclosure facilitates the production of polypeptide constructs comprising any combination of signal peptide, truncated variant, transmembrane domain and linker.
  • a polynucleotide vector useful for the methods and compositions described herein can be a good manufacturing practices (GMP) compatible vector.
  • GMP good manufacturing practices
  • a GMP vector may be purer than a non-GMP vector.
  • purity can be measured by bioburden.
  • bioburden can be the presence or absence of aerobes, anaerobes, sporeformers, fungi, or combinations thereof in a vector composition.
  • a pure vector can be endotoxin low or endotoxin free. Purity can also be measured by double-stranded primer-walking sequencing. Plasmid identity can be a source of determining purity of a vector.
  • a GMP vector of the invention can be from 10% to 99% more pure than a non-GMP vector.
  • a GMP vector can be from 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% more pure than a non-GMP vector as measured by the presence of bioburden, endotoxin, sequencing, or combinations thereof.
  • a terminator sequence at the end of the first gene program is used.
  • a terminator sequence can ensure that a transcript is terminating prior to initiating a second gene program.
  • an expression vectors may contain sequences necessary for the termination of transcription and for stabilizing an mRNA. Such sequences are commonly available from the 5' and, occasionally 3', untranslated regions of eukaryotic or viral DNAs or cDNAs. These regions can contain nucleotide segments transcribed as polyadenylated fragments in the untranslated portion of the mRNA. Cells comprising the expression vector are grown under conditions that provide for expression of the desired polypeptide, either in vivo or in vitro.
  • a spacer sequence can be used at the end of a first polypeptide encoded by a polynucleotide in a vector. In other cases, a spacer sequence can be used at the end of a second gene in a vector. A spacer sequence can also be used following a first gene and a second gene in a vector.
  • vectors can be used to express a polypeptide encoded by a gene, or portion of a gene of interest.
  • a gene of portion or a gene can be inserted by using any method, viral or non- viral.
  • a method can be a non-viral based technique.
  • polypeptide constructs disclosed herein can encode one or more proteins in addition to or alongside the polynucleotide constructs described above.
  • the polypeptide constructs can be linked to a chimeric antigen receptor (CAR), a T-cell receptor (TCR) and/or a cytokine.
  • CAR chimeric antigen receptor
  • TCR T-cell receptor
  • the chimeric receptor comprises an antigen binding region that enables recognition and binding to an antigen, for instance, a tumor antigen such as a tumor-associated antigen or a tumor-specific antigen.
  • the antigen binding region comprises an antibody or binding fragment, for example, an Fab, an Fab', an F(ab')2, an F(ab')3, an scFv, an sc(Fv)2, a dsFv, a diabody, a minibody, and a nanobody or binding fragments thereof.
  • the antigen binding region comprises an scFv.
  • the chimeric receptor comprises an scFv ⁇ e.g., a chimeric antigen receptor (CAR)).
  • the chimeric antigen receptor comprises a pattern-recognition receptor.
  • the chimeric receptor comprises an engineered T-cell receptor (TCR).
  • a cell expressing a polypeptide construct described herein also expresses one or more chimeric antigen receptors (CARs).
  • a chimeric antigen receptor as described herein, is an engineered receptor which grafts an exogenous specificity onto an immune effector cell.
  • a CAR comprises an extracellular domain (ectodomain) that comprises an antigen binding domain, a stalk region, a transmembrane domain and an intracellular (endodomain) domain.
  • the intracellular domain further comprises one or more intracellular signaling domains.
  • a CAR described herein comprises an antigen binding domain, a stalk region, a transmembrane domain, one or more costimulatory domains, and a signaling domain for T-cell activation.
  • the CAR of the present disclosure comprises a target-specific binding element otherwise referred to as an antigen-binding moiety.
  • the CAR of the present disclosure is engineered to target a tumor antigen of interest by way of engineering a desired antigen-binding moiety that specifically binds to a predetermined antigen on a tumor cell.
  • tumor antigen or “hyperproliferative disorder antigen” or “antigen associated with a hyperproliferative disorder” refers to antigens that are common to specific hyperproliferative disorders such as cancer.
  • An antigen binding domain can comprise complementary determining regions of a monoclonal antibody, variable regions of a monoclonal antibody, and/or antigen binding fragments thereof.
  • a complementarity determining region is a short amino acid sequence found in the variable domains of antigen receptor (e.g., immunoglobulin and T-cell receptor) proteins that assumes a structure that complements the structure of an antigen and therefore provides the receptor with its specificity for that particular antigen.
  • Each polypeptide chain of an antigen receptor can contain three CDRs (CDR1, CDR2, and CDR3).
  • an antigen binding domain comprises F(ab')2, Fab', Fab, Fv, or scFv.
  • an antigen binding domain is a scFv. In some cases, an antigen binding domain is a Fab. In some cases, an antigen binding domain is a Fab' . In some cases, an antigen binding domain is F(ab')2. In some cases, an antigen binding domain is a Fv.
  • a CAR described herein comprises an antigen binding domain that binds to an epitope on CD19, CD20, CD33, CD44, BCMA, CD123, EGFRvIII, a-Folate receptor, CAIX, CD30, ROR1, CEA, EGP-2, EGP-40, HER2, HER3, Folate-binding Protein, GD2, GD3, IL-13R-a2, KDR, EDB-F, mesothelin, CD22, EGFR, MUC-1, MUC-16, MAGE-Al, h5T4, PSMA, TAG-72 or VEGF-R2.
  • a CAR described herein comprises an antigen binding domain that binds to an epitope on CD19, CD33, BCMA, CD44, a-Folate receptor, CAIX, CD30, ROR1, CEA, EGP-2, EGP-40, HER2, HER3, Folate-binding Protein, GD2, GD3, IL-13R-a2, KDR, EDB-F, mesothelin, CD22, EGFR, MUC-1, MUC-16, MAGE-Al, h5T4, PSMA, TAG-72, EGFRvIII, CD123 and VEGF-R2.
  • a CAR described herein comprises an antigen binding domain that binds to an epitope on CD 19 or CD33. In some instances, a CAR described herein comprises an antigen binding domain that binds to an epitope on CD 19. In some cases, a CAR described herein comprises an antigen binding domain that binds to an epitope on CD33. In further embodiments, a CAR or a chimeric receptor or antigen binding polypeptide described herein comprises an autoantigen or an antigen binding region that binds to an epitope on HLA-A2, myelin oligodendrocyte glycoprotein (MOG), factor VIII (FVIII), MAdCAMl, SDF1, or collagen type II.
  • MOG myelin oligodendrocyte glycoprotein
  • FVIII factor VIII
  • MAdCAMl SDF1, or collagen type II.
  • the polynucleotides, polypeptides and methods described herein can be used for the treatment of a hyperproliferative disease, such as a cancer, an autoimmune disease or for the treatment of an infection, such as a viral, bacterial or parasitic infection.
  • a hyperproliferative disease such as a cancer
  • an autoimmune disease or for the treatment of an infection, such as a viral, bacterial or parasitic infection.
  • the antigen is an antigen that is elevated in cancer cells, in autoimmune cells or in cells that are infected by a virus, bacteria or parasite.
  • Pathogens that may be targeted include, without limitation, Plasmodium, trypanosome, Aspergillus, Candida, Hepatitis A, Hepatitis B, Hepatitis C, HSV, HPV, RSV, EBV, CMV, JC virus, BK virus, or Ebola pathogens.
  • Autoimmune diseases can include graft-versus-host disease, rheumatoid arthritis, lupus, celiac disease, Crohn's disease, Sjogren Syndrome, polymyalgia rheumatic, multiple sclerosis, neuromyelitis optica, ankylosing spondylitis, Type 1 diabetes, alopecia areata, vasculitis, temporal arteritis, bullous pemphigoid, psoriasis, pemphigus vulgaris, or autoimmune uveitis.
  • the pathogen recognized by a CAR may be essentially any kind of pathogen, but in some embodiments the pathogen is a fungus, bacteria, or virus.
  • exemplary viral pathogens include those of the families of Adenoviridae, Epstein-Barr virus (EBV), Cytomegalovirus (CMV), Respiratory Syncytial Virus (RSV), JC virus, BK virus, HPV, HSV, HHV family of viruses, Hepatitis family of viruses, Picornaviridae, Herpesviridae, Hepadnaviridae,
  • Exemplary pathogenic viruses cause smallpox, influenza, mumps, measles, chickenpox, ebola, and rubella.
  • Exemplary pathogenic fungi include Candida, Aspergillus, Cryptococcus, Histoplasma, Pneumocystis, and Stachybotrys .
  • Exemplary pathogenic bacteria include Streptococcus, Pseudomonas, Shigella, Campylobacter,
  • the pathogen receptor Dectin-1 may be used to generate a CAR that recognizes the carbohydrate structure on the cell wall of fungi such as Aspergillus.
  • CARs can be made based on an antibody recognizing viral determinants ⁇ e.g., the glycoproteins from CMV and Ebola) to interrupt viral infections and pathology.
  • a "stalk” region is used to link the antigen-binding domain to the transmembrane domain.
  • a "stalk domain” or “stalk region” comprise any oligonucleotide- or polypeptide that functions to link the transmembrane domain to, either the extracellular domain or, the cytoplasmic domain in the polypeptide chain.
  • it is flexible enough to allow the antigen-binding domain to orient in different directions to facilitate antigen recognition.
  • the stalk region comprises the hinge region from IgGl .
  • the stalk region comprises the CH2CH3 region of immunoglobulin and optionally portions of CD3.
  • the stalk region comprises a CD8a hinge region, an IgG4-Fc 12 amino acid hinge region (ESKYGPPCPPCP (SEQ ID NO: 225)) or IgG4 hinge regions as described in WO/2017/073755.
  • the transmembrane domain can be derived from either a natural or a synthetic source. Where the source is natural, the domain can be derived from any membrane-bound or transmembrane protein. Suitable transmembrane domains can include the transmembrane region(s) of alpha, beta or zeta chain of the T-cell receptor; or a transmembrane region from CD28, CD3 epsilon, ⁇ 3 ⁇ , CD45, CD4, CD5, CD8a, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137 or CD154. Alternatively the transmembrane domain can be synthetic, and can comprise hydrophobic residues such as leucine and valine.
  • a triplet of phenylalanine, tryptophan and valine is found at one or both termini of a synthetic transmembrane domain.
  • a short oligonucleotide or polypeptide linker in some embodiments, between 2 and 10 amino acids in length may form the linkage between the transmembrane domain and the cytoplasmic signaling domain of a CAR.
  • the linker is a glycine-serine linker.
  • the transmembrane domain comprises a CD8a transmembrane domain or a ⁇ 3 ⁇ transmembrane domain.
  • the transmembrane domain comprises a CD8a transmembrane domain.
  • the transmembrane domain comprises a ⁇ 3 ⁇ transmembrane domain.
  • the transmembrane domain comprises a transmembrane dimerization domain.
  • the intracellular domain can comprise one or more costimulatory domains.
  • costimulatory domains include, but are not limited to, CD8, CD27, CD28, 4-1BB (CD137), ICOS, DAP10, DAP 12, OX40 (CD134) or fragment or combination thereof.
  • a CAR described herein comprises one or more, or two or more of costimulatory domains selected from CD8, CD27, CD28, 4-1BB (CD137), ICOS, DAP10, DAP 12, OX40 (CD134) or fragment or combination thereof.
  • a CAR described herein comprises one or more, or two or more of costimulatory domains selected from CD27, CD28, 4-1BB (CD137), ICOS, OX40 (CD 134) or fragment or combination thereof. In some instances, a CAR described herein comprises one or more, or two or more of costimulatory domains selected from CD8, CD28, 4- IBB (CD 137), or fragment or combination thereof. In some instances, a CAR described herein comprises one or more, or two or more of costimulatory domains selected from CD28, 4- 1BB (CD137), or fragment or combination thereof. In some instances, a CAR described herein comprises costimulatory domains CD28 and 4-1BB (CD137) or their respective fragments thereof.
  • a CAR described herein comprises costimulatory domains CD28 and OX40 (CD 134) or their respective fragments thereof. In some instances, a CAR described herein comprises costimulatory domains CD8 and CD28 or their respective fragments thereof. In some instances, a CAR described herein comprises costimulatory domains CD28 or a fragment thereof. In some instances, a CAR described herein comprises costimulatory domains 4-1BB (CD137) or a fragment thereof. In some instances, a CAR described herein comprises costimulatory domains OX40 (CD 134) or a fragment thereof. In some instances, a CAR described herein comprises costimulatory domains CD8 or a fragment thereof.
  • the intracellular signaling domain also known as cytoplasmic domain, of the CAR of the present disclosure, is responsible for activation of at least one of the normal effector functions of the immune cell in which the CAR has been placed.
  • effector function refers to a specialized function of a cell. Effector function of a T cell, for example, may be cytolytic activity or helper activity including the secretion of cytokines.
  • intracellular signaling domain refers to the portion of a protein which transduces the effector function signal and directs the cell to perform a specialized function. While usually the entire intracellular signaling domain can be employed, in many cases it is not necessary to use the entire chain.
  • the intracellular domain further comprises a signaling domain for T-cell activation.
  • the signaling domain for T-cell activation comprises a domain derived from TCR zeta, FcR gamma, FcR beta, CD3 gamma, CD3 delta, CD3 epsilon, CD5, CD22, CD79a, CD79b or CD66d.
  • the signaling domain for T-cell activation comprises a domain derived from CD3 ⁇ .
  • a nucleic acid sequence encoding a functional portion of the CAR can encode a protein comprising, for example, about 10%, 25%, 30%, 50%, 68%, 80%, 90%, 95%, or more, of the parent CAR.
  • the term "functional variant,” as used herein, refers to a polypeptide, or a protein having substantial or significant sequence identity or similarity to the reference polypeptide, and retains the biological activity of the reference polypeptide of which it is a variant.
  • Functional variants encompass, for example, those variants of the CAR described herein (the parent CAR) that retain the ability to recognize target cells to a similar extent, the same extent, or to a higher extent, as the parent CAR.
  • a nucleic acid sequence encoding a functional variant of the CAR can be for example, about 10% identical, about 25% identical, about 30% identical, about 50% identical, about 65% identical, about 80%) identical, about 90% identical, about 95% identical, or about 99% identical to the nucleic acid sequence encoding the parent CAR.
  • polypeptide constructs disclosed herein can be co-expressed in an engineered cell with a CAR.
  • a polypeptide construct and CAR can be encoded by a single transcript.
  • an engineered cell co-expressing the polypeptide constructs with the CAR can be primed to respond in a relatively short time frame to the administration of exogenous antibodies that target the cell tags conferred by the truncated variants disclosed herein.
  • CD 19 is a cell surface glycoprotein of the immunoglobulin superfamily. In some instances, CD 19 has been detected in solid tumors such as pancreatic cancer, liver cancer, and prostate cancer. [0221] In some embodiments, the antigen binding moiety of a CAR described herein, is specific to CD 19. A CD19-specific CAR, when expressed on the cell surface, may redirect the specificity of T cells to human CD19.
  • the antigen binding domain comprises a single chain antibody fragment (scFv) comprising a variable domain light chain (VL) and variable domain heavy chain (VH) of a target antigen specific monoclonal anti-CD 19 antibody joined by a flexible linker, such as a glycine- serine linker or a Whitlow linker.
  • scFv are SJ25Cland/or FMC63.
  • the scFv is humanized.
  • the antigen binding moiety may comprise VH and VL that are directionally linked, for example, from N to C terminus, VH-linker-VL or VL-linker-VH.
  • described herein include a CD19-specific CAR, in which the antigen binding domain comprises a scFv that binds CD 19. In some instances, the antigen binding domain recognizes an epitope on CD 19.
  • the antigen binding domain recognizes an epitope on CD 19 that is also recognized by JCAR014, JCAR015, JCAR017, or 19-28z CAR (Juno Therapeutics).
  • described herein include a CD19-specific CAR-T cell, in which the antigen binding domain recognizes an epitope on CD 19 that is also recognized by JCAR014, JCAR015, JCAR017, or 19-28z CAR (Juno Therapeutics).
  • the CD19-specific CAR-T cell further comprises a transmembrane domain selected from a CD8alpha transmembrane domain or a CD3 ⁇ transmembrane domain; one or more costimulatory domains selected from CD27, CD28, 4-1BB (CD137), ICOS, DAP10, DAP 12, OX40 (CD134) or fragment or combination thereof; and a signaling domain from CD3 ⁇ .
  • CD19-specific CAR-T cell comprises a scFv antigen binding domain, and the antigen binding domain recognizes an epitope on CD 19 that is also recognized by JCAR014, JCAR015, JCAR017, or 19-28z CAR (Juno Therapeutics).
  • the CD19-specific CAR-T cell further comprises a transmembrane domain selected from a CD8alpha transmembrane domain or a CD3 ⁇ transmembrane domain; one or more costimulatory domains selected from CD27, CD28, 4-1BB (CD137), ICOS, DAP10, DAP12, OX40 (CD134) or fragment or combination thereof; and a signaling domain from ⁇ 3 ⁇ .
  • a CD19-specific CAR-T cell described herein comprises an anti- CD ⁇ antibody described in US20160152723.
  • the antigen binding domain recognizes an epitope on CD 19 that is also recognized by KTE-C19 (Kite Pharma, Inc.).
  • described herein include a CD19-specific CAR-T cell, in which the antigen binding domain recognizes an epitope on CD 19 that is also recognized by KTE-C19.
  • the CD19-specific CAR-T cell further comprises a transmembrane domain selected from a CD8alpha transmembrane domain or a CD3 ⁇ transmembrane domain; one or more costimulatory domains selected from CD27, CD28, 4-1BB (CD137), ICOS, DAP10, DAP 12, OX40 (CD134) or fragment or combination thereof; and a signaling domain from CD3 ⁇ .
  • a CD19-specific CAR-T cell comprises a scFv antigen binding domain, and the antigen binding domain recognizes an epitope on CD 19 that is also recognized by KTE-C19.
  • the CD19-specific CAR-T cell further comprises a transmembrane domain selected from a CD8alpha transmembrane domain or a CD3 ⁇ transmembrane domain; one or more costimulatory domains selected from CD27, CD28, 4- IBB (CD137), ICOS, DAP10, DAP 12, OX40 (CD134) or fragment or combination thereof; and a signaling domain from ⁇ 3 ⁇ .
  • a CD19-specific CAR-T cell described herein comprises an anti- CD ⁇ antibody described in WO2015187528 or fragment or derivative thereof.
  • the antigen binding domain recognizes an epitope on CD 19 that is also recognized by CTL019 (Novartis).
  • CTL019 Novartis
  • described herein include a CD19-specific CAR-T cell, in which the antigen binding domain recognizes an epitope on CD 19 that is also recognized by CTL019.
  • the CD19-specific CAR-T cell further comprises a transmembrane domain selected from a CD8alpha transmembrane domain or a ⁇ 3 ⁇ transmembrane domain; one or more costimulatory domains selected from CD27, CD28, 4- IBB (CD137), ICOS, DAP10, DAP 12, OX40 (CD134) or fragment or combination thereof; and a signaling domain from ⁇ 3 ⁇ .
  • a CD19-specific CAR-T cell comprises a scFv antigen binding domain, and the antigen binding domain recognizes an epitope on CD 19 that is also recognized by CTL019.
  • the CD19-specific CAR-T cell further comprises a transmembrane domain selected from a CD8alpha transmembrane domain or a ⁇ 3 ⁇ transmembrane domain; one or more costimulatory domains selected from CD27, CD28, 4- IBB (CD137), ICOS, DAP10, DAP 12, OX40 (CD134) or fragment or combination thereof; and a signaling domain from ⁇ 3 ⁇ .
  • the antigen binding domain recognizes an epitope on CD19 that is also recognized by UCART19 (Cellectis).
  • described herein include a CD19-specific CAR-T cell, in which the antigen binding domain recognizes an epitope on CD 19 that is also recognized by UCART19.
  • the CD19-specific CAR-T cell further comprises a transmembrane domain selected from a CD8alpha transmembrane domain or a ⁇ 3 ⁇ transmembrane domain; one or more costimulatory domains selected from CD27, CD28, 4-1BB (CD137), ICOS, DAP10, DAP12,OX40 (CD134) or fragment or combination thereof; and a signaling domain from ⁇ 3 ⁇ .
  • a CD19-specific CAR-T cell comprises a scFv antigen binding domain, and the antigen binding domain recognizes an epitope on CD 19 that is also recognized by UCART19.
  • the CD19-specific CAR-T cell further comprises a transmembrane domain selected from a CD8alpha transmembrane domain or a CD3 ⁇ transmembrane domain; one or more costimulatory domains selected from CD27, CD28, 4- IBB (CD137), ICOS, DAP10, DAP 12, OX40 (CD134) or fragment or combination thereof; and a signaling domain from ⁇ 3 ⁇ .
  • the antigen binding domain recognizes an epitope on CD 19 that is also recognized by BPX-401 (Bellicum).
  • described herein include a CD19-specific CAR-T cell, in which the antigen binding domain recognizes an epitope on CD 19 that is also recognized by BPX-401.
  • the CD19-specific CAR-T cell further comprises a transmembrane domain selected from a CD8alpha transmembrane domain or a ⁇ 3 ⁇ transmembrane domain; one or more costimulatory domains selected from CD27, CD28, 4- IBB (CD137), ICOS, DAP10, DAP 12, OX40 (CD134) or fragment or combination thereof; and a signaling domain from ⁇ 3 ⁇ .
  • a CD19-specific CAR-T cell comprises a scFv antigen binding domain, and the antigen binding domain recognizes an epitope on CD 19 that is also recognized by BPX-401.
  • the CD19-specific CAR-T cell further comprises a transmembrane domain selected from a CD8alpha transmembrane domain or a ⁇ 3 ⁇ transmembrane domain; one or more costimulatory domains selected from CD27, CD28, 4- IBB (CD137), ICOS, DAP10, DAP 12, OX40 (CD134) or fragment or combination thereof; and a signaling domain from ⁇ 3 ⁇ .
  • the antigen binding domain recognizes an epitope on CD 19 that is also recognized by blinatumomab (Amgen), coltuximabravtansine (ImmunoGen Inc./Sanofi-aventis), MOR208 (Morphosys AG/Xencor Inc.), MEDI-551 (Medimmune), denintuzumabmafodotin (Seattle Genetics), B4 (or DI-B4) (Merck Serono), taplitumomabpaptox (National Cancer Institute), XmAb 5871 (Amgen/Xencor, Inc.), MDX-1342 (Medarex) or AFM11 (Affimed).
  • the CD19-specific CAR further comprises a transmembrane domain selected from a CD8alpha transmembrane domain or a ⁇ 3 ⁇ transmembrane domain; one or more costimulatory domains selected from CD27, CD28, 4-1BB (CD137), ICOS, DAP10, DAP 12, OX40 (CD134) or fragment or combination thereof; and a signaling domain from CD3 ⁇ .
  • Some embodiments described herein include a CD19-specific CAR-T cell, in which the antigen binding domain comprises a F(ab')2, Fab', Fab, Fv, or scFv. In some instances, the antigen binding domain recognizes an epitope on CD 19.
  • the antigen binding domain recognizes an epitope on CD 19 that is also recognized by blinatumomab (Amgen), coltuximabravtansine (ImmunoGen Inc./Sanofi-aventis), MOR208 (Morphosys AG/Xencor Inc.), MEDI-551 (Medimmune), denintuzumabmafodotin (Seattle Genetics), B4 (or DI-B4) (Merck Serono), taplitumomabpaptox (National Cancer Institute), XmAb 5871 (Amgen/Xencor, Inc.), MDX-1342 (Medarex) or AFM11 (Affimed).
  • the CD19-specific CAR-T cell further comprises a transmembrane domain selected from a CD8a transmembrane domain or a CD3 ⁇ transmembrane domain; one or more costimulatory domains selected from CD27, CD28, 4-1BB (CD137), ICOS, DAP10, DAP 12, OX40 (CD134) or fragment or combination thereof; and a signaling domain from ⁇ 3 ⁇ .
  • a CD19-specific CAR-T cell described herein comprise a scFv antigen binding domain, and the antigen binding domain recognizes an epitope on CD 19 that is also recognized by blinatumomab (Amgen), coltuximabravtansine (ImmunoGen Inc./Sanofi-aventis), MOR208 (Morphosys AG/Xencor Inc.), MEDI-551 (Medimmune), denintuzumabmafodotin (Seattle Genetics), B4 (or DI-B4) (Merck Serono), taplitumomabpaptox (National Cancer Institute), XmAb 5871 (Amgen/Xencor, Inc.), MDX-1342 (Medarex) or AFMl l (Affimed).
  • the CD19-specific CAR-T cell further comprises a transmembrane domain selected from a CD8alpha transmembrane domain or a ⁇ 3 ⁇ transmembrane domain; one or more costimulatory domains selected from CD27, CD28, 4-1BB (CD137), ICOS, DAP10, DAP12, OX40 (CD134) or fragment or combination thereof; and a signaling domain from ⁇ 3 ⁇ .
  • a polynucleotide encoding a CAR comprises a nucleotide sequence which has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity to a nucleotide sequence selected from the list consisting of SEQ ID NO: 169 (encoding CD19-CD3 ⁇ CAR), SEQ ID NO: 171 (encoding CD19-CD137-CD3C CAR), SEQ ID NO: 173 (encoding CD19- CD28-CD3C CAR), and SEQ ID NO: 175 (encoding CD19-CD28-CD CAR further comprising an IgG4 Fc spacer).
  • an amino acid sequence comprising a CAR has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity to an amino acid sequence selected from the list consisting of SEQ ID NO: 170 (CD19-CD3C CAR), SEQ ID NO: 172 (CD19- CD137-CD3C CAR), SEQ ID NO: 174 (CD19 ⁇ CD28 ⁇ CD3C CAR), and SEQ ID NO: 176 (CD19- € ⁇ 28- € ⁇ 3 ⁇ CAR further comprising an IgG4 Fc spacer).
  • a polynucleotide disclosed herein can compri se a codon- optimized cDNA sequence encoding an anti-CD 19 CAR and a cleavable T2A linker connecting to a cell surface polypeptide (e.g. HER. It).
  • a cytotoxic T lymphocyte can be engineered to express a CB19-specific chimeric antigen receptor (CAR) that signals via a cytoplasmic costimulatory (CD28) domain fused to the cytoplasmic CDj- ⁇ domain.
  • CAR CB19-specific chimeric antigen receptor
  • CD28 cytoplasmic costimulatory
  • This polypeptide can further incorporate a C-terminal 2A cleavable linker followed by for example an extracellular cell tag comprising, in some embodiments, truncated human HER1 (HERlt), truncated CD20 (CD20t), truncated CD52 (CD52t), or truncated LNGFR (LNGFRt).
  • a polypeptide can comprise a polypeptide construct comprising a truncated variant preceding a CD19-specific CAR (e.g. via a P2A cleavable linker).
  • a polypeptide construct incorporating an anti-CD19 C AR, cleavable T2Alinker and cell surface polypeptide has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100%) identity to an amino acid sequence selected from the list consisting of SEQ ID NO: 179 (CD19-CD137-CD3C CAR.T2A.Ig Kappa signal peptide.HERlt from SEQ ID NO:55), SEQ ID NO: 180 (CD 19-CD 137-CD3 CAR.T2A.Ig Kappa signal peptide.HERlt from SEQ ID NO:55), SEQ ID NO: 182 ( ⁇ 19- ⁇ 28- ⁇ 3 ⁇ CAR.P2A.Ig Kappa signal peptide.HERltl from SEQ ID NO: 57), SEQ ID NO: 183 (Ig Kappa signal peptide.HERltl .
  • CAR.P2A.CD20t4 from SEQ ID NO: 115), SEQ ID NO: 197 (CD52t3.P2A.CD8a signal peptide.
  • TCR T-cell Receptor
  • the chimeric receptor encoded by a polynucleotide described herein comprises an engineered T-cell receptor.
  • the T cell receptor (TCR) is composed of two chains ( ⁇ or ⁇ ) that pair on the surface of the T cell to form a heterodimeric receptor.
  • the ⁇ TCR is expressed on most T cells in the body and is known to be involved in the recognition of specific MHC-restricted antigens.
  • Each a and ⁇ chain are composed of two domains: a constant domain (C) which anchors the protein to the cell membrane and is associated with invariant subunits of the CD3 signaling apparatus; and a variable domain (V) that confers antigen recognition through six loops, referred to as complementarity determining regions (CDRs).
  • C constant domain
  • V variable domain
  • each of the V domains comprises three CDRs; e.g., CDR1, CDR2 and CDR3 with CDR3 as the hypervariable region.
  • the constant domain further comprises a joining region that connects the constant domain to the variable domain.
  • the beta chain further comprises a short diversity region which makes up part of the joining region.
  • TCR are reactive to specific tumor antigen, e.g. NY-ESO, Mage A3, Titin.
  • TCR are reactive to specific neoantigens expressed within a patient's tumor (i.e. patient-specific, somatic, non-synonymous mutations expressed by tumors).
  • engineered TCRs can be affinity-enhanced.
  • a TCR is described using the International Immunogenetics (EVIGT) TCR nomenclature, and links to the IMGT public database of TCR sequences.
  • EIGT International Immunogenetics
  • Va alpha chain variable
  • beta chain variable regions distinguished by their framework, CDR1, CDR2, and CDR3 sequences.
  • a Va type can be referred to in EVIGT nomenclature by a unique TRAV number.
  • TRAV21 defines a TCR Va region having unique framework and CDR1 and CDR2 sequences, and a CDR3 sequence which is partly defined by an amino acid sequence which is preserved from TCR to TCR but which also includes an amino acid sequence which varies from TCR to TCR.
  • TRBV5-1 defines a TCR ⁇ region having unique framework and CDR1 and CDR2 sequences, but with only a partly defined CDR3 sequence.
  • the beta chain diversity region is referred to in IMGT nomenclature by the abbreviation TRBD.
  • the unique sequences defined by the IMGT nomenclature are widely known and accessible to those working in the TCR field. For example, they can be found in the IMGT public database and in "T cell Receptor Factsbook", (2001) LeFranc and LeFranc, Academic Press, ISBN 0-12-441352-8.
  • an ⁇ heterodimeric TCR is, for example, transfected as full length chains having both cytoplasmic and transmembrane domains.
  • the TCRs contain an introduced disulfide bond between residues of the respective constant domains, as described, for example, in WO 2006/000830.
  • TCRs described herein are in single chain format, for example see WO 2004/033685.
  • Single chain formats include ⁇ TCR polypeptides of the Va-L- ⁇ , ⁇ -L-Va, Va-Ca-L- ⁇ , Va-L-Vp-Cp, Va-Ca-L-Vp-Cp types, wherein Va and ⁇ are TCR a and ⁇ variable regions respectively, Ca and ⁇ are TCR a and ⁇ constant regions respectively, and L is a linker sequence.
  • single chain TCRs of the present disclosure may have an introduced disulfide bond between residues of the respective constant domains, as described in WO 2004/033685.
  • the TCR described herein may be associated with a detectable label, a therapeutic agent or a PK modifying moiety.
  • Exemplary detectable labels for diagnostic purposes include, but are not limited to, fluorescent labels, radiolabels, enzymes, nucleic acid probes and contrast reagents.
  • a polynucleotide disclosed herein can comprise a codon-optimized cDNA sequence encoding a TCR and a cleavable T2A linker connecting to a cell surface polypeptide (e.g. HERlt).
  • a cytotoxic T lymphocyte can be engineered to express a TCR polypeptide that further incorporates a C -terminal 2A cleavable linker followed by for example an extracellular ceil tag comprising, in some embodiments, truncated human FIERI (HERlt), truncated CD20 (CD201), truncated CD52 (CD52t), or truncated LNGFR (LNGFRt).
  • a polypeptide can comprise a polypeptide construct comprising a truncated variant preceding a TCR (e.g. linked via a P2A cleavable linker).
  • Cytokine is a category of small proteins between about 5-20 kDa that are involved in cell signaling.
  • the cytokines can be membrane bound or secreted.
  • the cytokines can be intracellular.
  • cytokines include chemokines, interferons, interleukins, colony-stimulating factors or tumor necrosis factors.
  • chemokines play a role as a chemoattractant to guide the migration of cells, and is classified into four subfamilies: CXC, CC, CX3C, and XC.
  • Non-limiting exemplary chemokines include chemokines from the CC subfamily: CCL1, CCL2 (MCP-1), CCL3, CCL4, CCL5 (RANTES), CCL6, CCL7, CCL8, CCL9 (or CCL10), CCL1 1, CCL12, CCL13, CCL14, CCL15, CCL16, CCL17, CCL18, CCL19, CCL20, CCL21, CCL22, CCL23, CCL24, CCL25, CCL26, CCL27, and CCL28; the CXC subfamily: CXCLl, CXCL2, CXCL3, CXCL4, CXCL5, CXCL6, CXCL7, CXCL8, CXCL9, CXCL10, CXCLl 1, CXCLl 2, C
  • Interferons comprise interferon type I (e.g. IFN-a, IFN- ⁇ , IFN- ⁇ , IFN- ⁇ , and IFN-co), interferon type II (e.g. IFN- ⁇ ), and interferon type III.
  • IFN-a is further classified into about 13 subtypes including IFNA1, IFNA2, IFNA4, IFNA5, IFNA6, IFNA7, IFNA8, IFNA10, IFNA13, IFNA14, IFNA16, IFNA17, and IFNA21.
  • Interleukins are expressed by leukocytes or white blood cells and they promote the development and differentiation of T and B lymphocytes and hematopoietic cells.
  • exemplary interleukines include IL-1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8 (CXCL8), IL-9, IL-10, IL-1 1, IL-12, IL-13, IL-14, IL-15, IL-16, IL-17, IL-18, IL-19, IL-20, IL-21, IL-22, IL-23, IL-24, IL-25, IL-26, IL-27, IL-28, IL-29, IL-30, IL-31, IL-32, IL-33, IL-35, and IL-36.
  • an interleukin comprises mb IL-15.
  • a mbIL-15 is a membrane-bound chimeric IL-15 which can be co-expressed with a modified effector cell described herein.
  • the mbIL-15 comprises a full-length IL-15 (e.g., a native IL-15 polypeptide) or fragment or variant thereof, fused in frame with a full length IL-15Ra, functional fragment or variant thereof.
  • the IL-15 is indirectly linked to the IL-15Ra through a linker.
  • the mbIL-15 is as described in Hurton et al., "Tethered IL-15 augments antitumor activity and promotes a stem-cell memory subset in tumor- specific T cells," PNAS 2016.
  • mbIL-15 is encoded by a polynucleotide comprising a nucleotide sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100%) identity to the nucleotide sequence of SEQ ID NO: 177.
  • mbIL-15 has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 178.
  • the interleukin can comprise IL-12.
  • the IL-12 is a single chain IL-12 (scIL-12), protease sensitive IL- 12, destabilized IL-12, membrane bound IL-12, intercalated IL-12.
  • scIL-12 single chain IL-12
  • protease sensitive IL- 12 destabilized IL-12
  • membrane bound IL-12 membrane bound IL-12
  • intercalated IL-12 intercalated IL-12.
  • the IL-12 variants are as described in
  • Tumor necrosis factors are a group of cytokines that modulate apoptosis. In some instances, there are about 19 members within the TNF family, including, not limited to, TNFa, lymphotoxin-alpha (LT-alpha), lymphotoxin-beta (LT-beta), T cell antigen gp39
  • CD40L CD27L
  • CD30L CD30L
  • FASL 4-1BBL
  • OX40L TNF-related apoptosis inducing ligand
  • Colony-stimulating factors are secreted glycoproteins that interact with receptor proteins on the surface of hemopoietic stem cells, which subsequently modulates cell
  • a CSF comprises macrophage colony-stimulating factor, granulocyte macrophage colony-stimulating factor (GM-CSF), granulocyte colony-stimulating factor (G-CSF) or promegapoietin.
  • GM-CSF granulocyte macrophage colony-stimulating factor
  • G-CSF granulocyte colony-stimulating factor
  • the cytokine is a membrane-bound cytokine, which is co- expressed with a chimeric antigen receptor and/or a TCR described herein.
  • one or more methods described herein further comprise administration of a cytokine.
  • the cytokine comprises a chemokine, an interferon, an interleukin, a colony-stimulating factor or a tumor necrosis factor.
  • one or more methods described herein further comprise administration of a cytokine selected from a chemokine, an interferon, an interleukin, a colony-stimulating factor or a tumor necrosis factor.
  • one or more methods described herein further comprise administration of a cytokine selected from IL2, IL7, IL12, IL15, IL21, IFNy or T F-a.
  • a polynucleotide disclosed herein can comprise a codon- optimized cDNA sequence encoding a cytokine and a cleavable T2A linker connecting to a cell surface polypeptide (e.g. HER] t).
  • a cytotoxic T lymphocyte can be engineered to express a polypeptide comprising a cytokine and further incorporating a 2A cleavable linker fol lowed by for example an extracellular cell tag comprising, in some embodiments, truncated human HER1 (HER.lt), truncated CD20 (CD20t), truncated CD52 (CD52t), or truncated LNGFR (LNGFRt).
  • a polypeptide can comprise a polypeptide construct comprising a truncated variant preceding a cytokine (e.g. linked via a P2A cleavable linker).
  • a polypeptide construct incorporating a cytokine, cleavable T2A linker and cell surface polypeptide is has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 193 (membrane bound IL-15.T2A.HERltl from SEQ ID NO:57).
  • constructs comprising linkers and IRES elements to facilitate the expression and functionality of the polynucleotides and polypeptides described herein.
  • IRES internal ribosome entry site
  • a first gene can be translated by a cap-dependent, ribosome scanning, mechanism with its own 5'-UTR, whereas translation of a subsequent gene can be accomplished by direct recruitment of a ribosome to an IRES in a cap-independent manner.
  • An IRES sequence can allow eukaryotic ribosomes to bind and begin translation without binding to a 5' capped end.
  • An IRES sequence can allow expression of multiple genes from one transcript (Mountford and Smith 1995).
  • CAP refers to a modified nucleotide, generally a 7- methyl guanosine, linked 3 ' to 5 ' (7meG-ppp-G), to the 5' end of a eukaryotic mRNA, that serves as a required element in the normal translation initiation pathway during expression of protein from that mRNA.
  • an IRES region can be derived from a virus, such as picornavirus, encephalomyocarditis virus, hepatitis C virus IRES sequence. In other cases, an IRES sequence can be derived from an encephalomyocarditis virus.
  • EMCV or
  • encephalomyocarditis virus refers to any member isolate or strain of the encephalomyocarditis virus species of the genus of the family Picornaviridae. Examples are: EMCV-R (Rueckert) strain virus, Columbia-SK virus.
  • a cellular IRES element such as eukaryotic initiation factor 4G, immunoglobulin heavy chain binding protein, c-myc proto-oncogene, vascular endothelial growth factor, fibroblast growth factor- 1 IRES, or any combination or modification thereof can be used.
  • a cellular IRES can have increased gene expression when compared to a viral IRES.
  • An IRES sequence of viral, cellular or a combination thereof can be utilized in a vector.
  • An IRES can be from encephalomyocarditis (EMCV) or poliovirus (PV).
  • an IRES element is selected from a group consisting of Poliovirus (PV), Encephalomyelitis virus (EMCV), Foot-and-mouth disease virus (FMDV), Porcine teschovirus-1 (PTV-1), Aichivirus (AiV), Seneca Valley virus (SVV), Hepatitis C virus (HCV), Classical swine fever virus (CSFV), Human immunodeficiency virus-2 (HIV-2), Human immunodeficiency virus- 1 (HIV-1),
  • Moloney murine leukemia virus (MoMLV), Feline immunodeficiency virus (FIV), Mouse mammary tumor virus (MMTV), Human cytomegalovirus latency (pUL138), Epstein-Barr virus (EBNA-1), Herpes virus Marek's disease (MDV RLORF9), SV40 polycistronic 19S (SV40 19S), Rhopalosiphum padi virus (RhPV), Cricket paralysis virus (CrPV), Ectropis obliqua picorna-like virus (EoPV), Plautia stali intestine virus (PSIV), Triatoma virus (TrV), Bee paralysis
  • MoMLV Moloney murine leukemia virus
  • FV Feline immunodeficiency virus
  • MMTV Mouse mammary tumor virus
  • pUL138 Epstein-Barr virus
  • EBNA-1 Epstein-Barr virus
  • MDV RLORF9 Herpes virus Marek's disease
  • IAPV dicistrovirus
  • KBV Black currant reversion virus
  • PFBV Pelargonium flower break virus
  • HCRSV Hibiscus chlorotic ringspot virus
  • CrTMV Crucifer-infecting tobamovirus
  • PLRV Potato leaf roll polerovirus
  • TSV Tobacco etch virus
  • LV-1 Leishmania RNA virus-1
  • an IRES is selected from a group consisting of Apaf-1, XIAP, HIAP2/c-IAPl, DAP5, Bcl-2, c-myc, CAT-1, INR, Differentiation LEF-1, PDGF2, HIF-la, VEGF, FGF2, BiP, BAG-1, CIRP, p53, SHMT1, PITSLREp58, CDK1, Rpr, hid, hsp70, grim, ski, Antennapedia, dFoxO, dlnR, Adh- Adhr, HSP101, ADH, URE-2,GPR1, NCE102, YMR181a, MSN1, BOI1, FL08, GIC1, and any combination or modification thereof.
  • a IRES is an EMCV IRES comprising a nucleotide sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, 99.5% or 100% identity with the nucleotide sequence of SEQ ID NO:49.
  • initiation of translation can occur by a canonical 5'- m7GpppN cap-dependent mechanism in a first ORF and a cap-independent mechanism in a second ORF downstream of the IRES element.
  • genes can be linked by an internal ribosomal entry site (IRES).
  • IRES internal ribosomal entry site
  • An IRES can allow simultaneous expression of multiple genes.
  • an IRES sequence can permit production of multiple proteins from a single mRNA transcript.
  • a ribosomes can bind to an IRES in a 5 '-cap independent manner and initiate translation.
  • an IRES sequence can be or can be about 500 base pairs.
  • An IRES sequence can be from 300 base pairs to 1000 base pairs.
  • an IRES can be 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, or 1000 base pairs long.
  • expression of a downstream gene within a vector comprising an IRES sequence can be reduced.
  • a gene following an IRES sequence can have reduced expression over a gene preceding an IRES sequence.
  • Reduced expression can be from 1% to 99% reduction over a preceding gene.
  • a polynucleotide linker can be utilized in a polynucleotide described herein.
  • a polynucleotide linker can be a double-stranded segment of DNA containing desired restriction sites that may be added to create end structures that are compatible with a vector comprising a polynucleotide described herein.
  • a polynucleotide linker can be useful for modifying vectors comprising polynucleotides described herein.
  • a vector modification comprising a polynucleotide linker can be a change in a multiple cloning site, or the addition of a poly-histidine tail.
  • Polynucleotide linkers can also be used to adapt the ends of blunt insert DNA for cloning into a vector cleaved with a restriction enzyme with cohesive end termini.
  • the use of polynucleotide linkers can be more efficient than a blunt ligation into a vector and can provide a method of releasing an insert from a vector in
  • an insert can be a polynucleotide sequence encoding polypeptides useful for therapeutic applications.
  • a polynucleotide linker can be an oligomer.
  • a polynucleotide linker can be a DNA double strand, single strand, or a combination thereof.
  • a linker can be RNA.
  • a polynucleotide linker can be ligated into a vector comprising a polynucleotide described herein by a T4 ligase in some cases.
  • T4 ligase ligated into a vector comprising a polynucleotide described herein by a T4 ligase in some cases.
  • an excess of polynucleotide linkers can be added to a composition comprising an insert and a vector.
  • an insert and vector are pre-treated before a linker is introduced. For example, pre-treatment with a methylase can prevent unwanted cleavage of insert DNA.
  • a polynucleotide linker comprises a nucleotide sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, 99.5% or 100% identity with the nucleotide sequence of porcine teschovirus-1 2A region (P2A) (SEQ ID NO:41); equine rhinitis A virus 2A region (E2A) (SEQ ID NO:43); Thosea asigna virus 2A region (T2A) (SEQ ID NO:45); or foot- and-mouth disease virus 2A region (F2A) (SEQ ID NO:47).
  • P2A porcine teschovirus-1 2A region
  • E2A equine rhinitis A virus 2A region
  • T2A Thosea asigna virus 2A region
  • F2A foot- and-mouth disease virus 2A region
  • two or more polypeptides encoded by a polynucleotide described herein can be separated by an intervening sequence encoding an intervening linker polypeptide.
  • intervening linker polypeptide referring to an amino acid sequence separating two or more polypeptides encoded by a polynucleotide is distinguished from the term "peptide linker” which refers to the sequence of amino acids which is optionally included in a polypeptide construct disclosed herein to connect the transmembrane domain to the cell surface polypeptide (e.g. comprising a truncated variant of a natural polypeptide).
  • the intervening linker polypeptide is a cleavage-susceptible intervening linker polypeptide.
  • polypeptides of interest are expressed as fusion proteins linked by a cleavage-susceptible intervening linker polypeptide.
  • cleavage- susceptible intervening linker polypeptide(s) can be any one or more of: F/T2A, T2A, p2A, 2 A, GSG-p2A, GSG linker (SEQ ID NO: 16), and furin link variants.
  • an intervening linker polypeptide comprises an amino acid sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, 99.5% or 100% identity with the amino acid sequence of porcine teschovirus-1 2A region (P2A) (SEQ ID NO:41); equine rhinitis A virus 2A region (E2A) (SEQ ID NO:44); Thosea asigna virus 2A region (T2A) (SEQ ID NO:46); or foot-and-mouth disease virus 2A region (F2A) (SEQ ID NO:48).
  • P2A porcine teschovirus-1 2A region
  • E2A equine rhinitis A virus 2A region
  • T2A Thosea asigna virus 2A region
  • F2A foot-and-mouth disease virus 2A region
  • a viral 2A sequence can be used.
  • 2A elements can be shorter than IRES, having from 5 to 100 base pairs.
  • a 2A sequence can have 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, or 100 nucleotides in length.
  • 2A linked genes can be expressed in one single open reading frame and "self-cleavage" can occur co-translationally between the last two amino acids, GP, at the C-terminus of the 2A polypeptide, giving rise to equal amounts of co-expressed proteins.
  • a viral 2A sequence can be about 20 amino acids.
  • a viral 2A sequence can contain a consensus motif Asp-Val/Ile-Glu-X-Asn-Pro-Gly-Pro (SEQ ID NO: 229).
  • a consensus motif sequence can act co-translationally. For example, formation of a normal peptide bond between a glycine and proline residue can be prevented, which can result in ribosomal skipping and cleavage of a nascent polypeptide. This effect can produce multiple genes at equimolar levels.
  • a 2A peptide can allow translation of multiple proteins in a single open reading frame into a polypeptide that can be subsequently cleaved into individual polypeptide through a ribosome-skipping mechanism (Funston, Kallioinen et al. 2008).
  • a 2A sequence can include: F/T2A, T2A, p2A, 2A, T2A, E2A, F2A, and BmCPV2A, BmIFV2A, and any combination thereof.
  • a vector can comprise an IRES sequence and a 2A polynucleotide linker sequence.
  • expression of multiple genes linked with 2A peptides can be facilitated by a spacer sequence (GSG (SEQ ID NO: 16)) ahead of the 2 A peptides.
  • constructs can combine a spacers, linkers, adaptors, promotors, or combinations thereof.
  • a construct can have a spacer (SGSG (SEQ ID NO: 18) or GSG (SEQ ID NO: 16)) and furin intervening polypeptide linker (R-A-K-R (SEQ ID NO: 230)) cleavage site with different 2 A peptides.
  • a spacer can be an I-Ceui.
  • a linker can be engineered.
  • a linker can be designed to comprise chemical characteristics such as hydrophobicity.
  • at least two linker sequences can produce the same protein.
  • multiple linkers can be used in a vector.
  • an intervening linker polypeptide can comprise an amino acid sequence "RAKR (SEQ ID NO: 230)".
  • a Furin intervening linker polypeptide can be encoded by a polynucleotide sequence comprising "AGAGCTAAGAGG (SEQ ID NO: 231)."
  • an intervening linker polypeptide can be a linker comprising a sequence disclosed in the table below:
  • a linker can be utilized in a polynucleotide described herein.
  • a linker can be a flexible linker, a rigid linker, an in vivo cleavable linker, or any combination thereof.
  • a linker may link functional domains together (as in flexible and rigid linkers) or releasing free functional domain in vivo as in in vivo cleavable linkers.
  • polynucleotide linkers and intervening linker polypeptides can improve biological activity, increase expression yield, and achieve desirable pharmacokinetic profiles.
  • an intervening linker polypeptide sequence described herein can include a flexible linker.
  • Flexible linkers can be applied when a joined domain requires a certain degree of movement or interaction.
  • Flexible linkers can be composed of small, non-polar ⁇ e.g., Gly) or polar ⁇ e.g., Ser or Thr) amino acids.
  • a flexible linker can have sequences consisting primarily of stretches of Gly and Ser residues ("GS" linker).
  • An example of a flexible linker can have the sequence of (Gly-Gly-Gly-Gly-Ser)n (SEQ ID NO: 221; e.g., SEQ ID NO: 20 or 22).
  • this exemplary GS linker can be optimized to achieve appropriate separation of functional domains, or to maintain necessary inter-domain interactions.
  • other flexible linkers can be utilized for recombinant fusion proteins.
  • flexible linkers can also be rich in small or polar amino acids such as Gly and Ser, but can contain additional amino acids such as Thr and Ala to maintain flexibility.
  • polar amino acids such as Lys and Glu can be used to improve solubility.
  • Flexible linkers included in linker sequences described herein can be rich in small or polar amino acids such as Gly and Ser to provide good flexibility and solubility. Flexible linkers can be suitable choices when certain movements or interactions are desired for fusion protein domains. In addition, although flexible linkers may not have rigid structures, they can serve as a passive linker to keep a distance between functional domains. The length of a flexible linker can be adjusted to allow for proper folding or to achieve optimal biological activity of the fusion proteins.
  • An intervening linker polypeptide described herein can further include a rigid linker in some cases.
  • a rigid linker can be utilized to maintain a fixed distance between domains of a polypeptide.
  • Rigid linkers can exhibit relatively stiff structures by adopting a-helical structures or by containing multiple Pro residues in some cases.
  • An intervening linker polypeptide described herein can be cleavable in some cases. In other cases an intervening linker polypeptide is not cleavable. Linkers that are not cleavable may covalently join functional domains together to act as one molecule throughout an in vivo process or an ex vivo process. An intervening linker polypeptide can also be cleavable in vivo. A cleavable intervening linker polypeptide can for example be introduced to release free functional domains in vivo. An intervening linker polypeptide can be cleaved by for example the presence of reducing reagents and proteases.
  • a reduction of a disulfide bond may be utilized to produce a cleavable intervening linker polypeptide.
  • a cleavage event through disulfide exchange with a thiol, such as glutathione could produce a cleavage.
  • an in vivo cleavage of a intervening linker polypeptide in a recombinant fusion protein may also be carried out by proteases that can be expressed in vivo under pathological conditions ⁇ e.g. cancer or inflammation), in specific cells or tissues, or constrained within certain cellular compartments.
  • a cleavable intervening linker polypeptide may allow for targeted cleavage.
  • the specificity of many proteases can offer slower cleavage of a intervening linker polypeptide in constrained compartments.
  • a cleavable intervening linker polypeptide can also comprise hydrazone, peptides, disulfide, or thioesther.
  • a hydrazone can confer serum stability.
  • a hydrazone can allow for cleavage in an acidic compartment.
  • An acidic compartment can have a pH up to about 7.
  • a linker can also include a thioether.
  • a thioether can be nonreducible and/or can be designed for intracellular proteolytic degradation.
  • a linker can be an engineered linker. Methods of designing linkers can be
  • computational methods can include graphic techniques.
  • Computation methods can be used to search for suitable peptides from libraries of three- dimensional peptide structures derived from databases. For example, a Brookhaven Protein Data Bank (PDB) can be used to span the distance in space between selected amino acids of a linker.
  • PDB Brookhaven Protein Data Bank
  • polypeptide construct comprising a furin polypeptide and a 2A polypeptide, wherein the furin polypeptide and the 2A polypeptide are connected by an intervening linker polypeptide comprising at least three hydrophobic amino acids.
  • At least three hydrophobic amino acids are selected from the list consisting of glycine (Gly)(G), alanine (Ala)(A), valine (Val)(V), leucine (Leu)(L), isoleucine (Ile)(I), proline (Pro)(P), phenylalanine (Phe)(F), methionine (Met)(M), tryptophan (Trp)(W).
  • the polynucleotides and polypeptides described herein can be constitutively expressed, for example using the constitutive promoters of viral and non-viral delivery systems (see below).
  • the polypeptide constructs, polynucleotides and methods provided herein can be implemented in a gene switch system.
  • the term "gene switch" refers to the combination of a response element associated with a promoter, and for instance, an EcR based system which, in the presence of one or more ligands, modulates the expression of a gene into which the response element and promoter are incorporated.
  • Tightly regulated inducible gene expression systems or gene switches are useful for various applications such as gene therapy, large scale production of proteins in cells, cell based high throughput screening assays, functional genomics and regulation of traits in transgenic plants and animals.
  • Such inducible gene expression systems may include ligand inducible heterologous gene expression systems.
  • PCT/US99/08381 disclose methods for modulating the expression of an exogenous gene in which a DNA construct comprising the exogenous gene and an ecdysone response element is activated by a second DNA construct comprising an ecdysone receptor that, in the presence of a ligand therefor, and optionally in the presence of a receptor capable of acting as a silent partner, binds to the ecdysone response element to induce gene expression.
  • the ecdysone receptor was isolated from Drosophila melanogaster.
  • the silent partner preferably retinoid X receptor (RXR)
  • RXR retinoid X receptor
  • insect ecdysone receptor In mammalian cells, insect ecdysone receptor (EcR) is capable of heterodimerizing with mammalian retinoid X receptor (RXR) and, thereby, be used to regulate expression of target genes or heterologous genes in a ligand dependent manner.
  • RXR mammalian retinoid X receptor
  • International Patent Application No. PCT/US98/14215 discloses that the ecdysone receptor isolated from the silk moth Bombyx mori is functional in mammalian systems without the need for an exogenous dimer partner.
  • U.S. Pat. No. 6,265, 173 discloses that various members of the steroid/thyroid superfamily of receptors can combine with Drosophila melanogaster ultraspiracle receptor (USP) or fragments thereof comprising at least the dimerization domain of USP for use in a gene expression system.
  • U.S. Pat. No. 5,880,333 discloses a Drosophila melanogaster EcR and ultraspiracle (USP) heterodimer system used in plants in which the transactivation domain and the DNA binding domain are positioned on two different hybrid proteins. In each of these cases, the transactivation domain and the DNA binding domain (either as native EcR as in International Patent Application No. PCT/US98/14215 or as modified EcR as in International Patent
  • PCT/US01/0905 discloses an ecdysone receptor- based inducible gene expression system in which the transactivation and DNA binding domains are separated from each other by placing them on two different proteins results in greatly reduced background activity in the absence of a ligand and significantly increased activity over background in the presence of a ligand.
  • This two-hybrid system is a significantly improved inducible gene expression modulation system compared to the two systems disclosed in applications PCT/US97/05330 and PCT/US98/14215.
  • the two-hybrid system is believed to exploit the ability of a pair of interacting proteins to bring the transcription activation domain into a more favorable position relative to the DNA binding domain such that when the DNA binding domain binds to the DNA binding site on the gene, the transactivation domain more effectively activates the promoter (see, for example, U.S. Pat. No. 5,283, 173).
  • the two-hybrid gene expression system comprises two gene expression cassettes; the first encoding a DNA binding domain fused to a nuclear receptor polypeptide, and the second encoding a transactivation domain fused to a different nuclear receptor polypeptide.
  • EcR ecdysone receptor
  • group H referred to herein as "Group H nuclear receptors”
  • the members of each group share 40-60% amino acid identity in the E (ligand binding) domain (Laudet et al., A Unified Nomenclature System for the Nuclear Receptor Subfamily, 1999; Cell 97: 161-163).
  • group H include: ubiquitous receptor (UR), Orphan receptor 1 (OR-1), steroid hormone nuclear receptor 1 (NER-1), RXR interacting protein- 15 (RIP- 15), liver x receptor ⁇ (LXRP), steroid hormone receptor like protein (RLD-1), liver x receptor (LXR), liver x receptor a (LXRa), farnesoid x receptor (FXR), receptor interacting protein 14 (RIP- 14), and farnesol receptor (HRR-1).
  • UR ubiquitous receptor
  • OR-1 Orphan receptor 1
  • NER-1 steroid hormone nuclear receptor 1
  • RIP- 15 RXR interacting protein- 15
  • LXRP liver x receptor ⁇
  • RTD-1 steroid hormone receptor like protein
  • LXR liver x receptor
  • LXRa liver x receptor a
  • FXR farnesoid x receptor
  • RIP- 14 receptor interacting protein 14
  • HRR-1 farnesol receptor
  • an inducible promoter can be a small molecule ligand-inducible two polypeptide ecdysone receptor-based gene switch, such as Intrexon Corporation's
  • a gene switch can be selected from ecdysone- based receptor components as described in, but without limitation to, any of the systems described in: PCT/US2001/009050 (WO 2001/070816); U.S. Pat. Nos. 7,091,038; 7,776,587; 7,807,417; 8,202,718; PCT/US2001/030608 (WO 2002/029075); U.S. Pat. Nos. 8,105,825; 8,168,426; PCT/1J52002/005235 (WO 2002/066613); U.S. App. No. 10/468,200 (U.S. Pub. No.
  • effector cells modified to express one or more polypeptide constructs capable of functioning in the effector cells as cell tags.
  • T cell or "T lymphocyte” as used herein is a type of lymphocyte that plays a central role in cell-mediated immunity. They may be distinguished from other lymphocytes, such as B cells and natural killer cells (NK cells), by the presence of a T-cell receptor (TCR) on the cell surface.
  • TCR T-cell receptor
  • modified effector cells are modified immune cells that comprise T cells and/or natural killer cells.
  • T cells or T lymphocytes are a subtype of white blood cells that are involved in cell-mediated immunity.
  • Exemplary T cells include T helper cells, cytotoxic T cells, TH17 cells, stem memory T cells (TSCM), naive T cells, memory T cells, effector T cells, regulatory T cells, or natural killer T cells.
  • T helper cells assist other white blood cells in immunologic processes, including maturation of B cells into plasma cells and memory B cells, and activation of cytotoxic T cells and macrophages.
  • TH cells are known as CD4+ T cells due to expression of the CD4 glycoprotein on the cell surfaces.
  • Helper T cells become activated when they are presented with peptide antigens by MHC class II molecules, which are expressed on the surface of antigen-presenting cells (APCs). Once activated, they divide rapidly and secrete small proteins called cytokines that regulate or assist in the active immune response.
  • cytokines can be secreted from the APC.
  • secreted cytokines can be recombinant.
  • Cytotoxic T cells destroy virus-infected cells and tumor cells, and are also implicated in transplant rejection. These cells are also known as CD8+ T cells since they express the CD8 glycoprotein on their surfaces. These cells recognize their targets by binding to antigen associated with MHC class I molecules, which are present on the surface of all nucleated cells. Through IL-10, adenosine, and other molecules secreted by regulatory T cells, the CD8+ cells can be inactivated to an anergic state, which prevents autoimmune diseases.
  • Memory T cells are a subset of antigen-specific T cells that persist long-term after an infection has resolved.
  • Memory T cells comprise subtypes: stem memory T cells (TSCM), central memory T cells (TCM cells) and two types of effector memory T cells (TEM cells and TEMRA cells). Memory cells may be either CD4+ or CD8+. Memory T cells may express the cell surface proteins CD45RO, CD45RA and/or CCR7.
  • Treg cells Regulatory T cells
  • Regulatory T cells formerly known as suppressor T cells, play a role in the maintenance of immunological tolerance. Their major role is to shut down T cell-mediated immunity toward the end of an immune reaction and to suppress autoreactive T cells that escaped the process of negative selection in the thymus.
  • Natural killer T cells bridge the adaptive immune system with the innate immune system. Unlike conventional T cells that recognize peptide antigens presented by major histocompatibility complex (MHC) molecules, NKT cells recognize glycolipid antigen presented by a molecule called CD Id. Once activated, these cells can perform functions ascribed to both Th and Tc cells (i.e., cytokine production and release of cytolytic/cell killing molecules). They are also able to recognize and eliminate some tumor cells and cells infected with herpes viruses.
  • MHC major histocompatibility complex
  • NK cells are a type of cytotoxic lymphocyte of the innate immune system.
  • NK cells provide a first line defense against viral infections and/or tumor formation.
  • NK cells can detect MHC presented on infected or cancerous cells, triggering cytokine release, and subsequently induce lysis and apoptosis.
  • NK cells can further detect stressed cells in the absence of antibodies and/or MHC, thereby allowing a rapid immune response.
  • the present disclosure also provides delivery systems, such as viral-based systems, in which a nucleic acid described herein is inserted.
  • Representative viral expression vectors include, but are not limited to, adeno-associated viral vectors, adenovirus-based vectors (e.g., the adenovirus-based Per.C6 system available from Crucell, Inc. (Leiden, The Netherlands)), lentivirus-based vectors (e.g., the lentiviral -based pLPI from Life Technologies (Carlsbad, Calif.)), retroviral vectors (e.g., the pFB-ERV plus pCFB-EGSH), and herpes virus-based vectors.
  • the viral vector is a lentivirus vector.
  • retroviruses such as the lentivirus are suitable tools to achieve long-term gene transfer since they allow long-term, stable integration of a transgene and its propagation in daughter cells.
  • Lentiviral vectors have the added advantage over vectors derived from onco-retroviruses such as murine leukemia viruses in that they can transduce non-proliferating cells, such as hepatocytes. They also have the added advantage of low immunogenicity.
  • the viral vector is an adeno-associated viral vector.
  • the viral vector is a retroviral vector.
  • a suitable vector contains an origin of replication functional in at least one organism, a promoter sequence, convenient restriction endonuclease sites, and one or more selectable markers, (e.g., WO 01/96584; WO 01/29058; and U. S. Pat. No. 6,326, 193).
  • Additional suitable vectors include integrating expression vectors, which may randomly integrate into the host cell's DNA, or may include a recombination site to enable the specific recombination between the expression vector and the host cell' s chromosome.
  • Such integrating expression vectors may utilize the endogenous expression control sequences of the host cell' s chromosomes to effect expression of the desired protein.
  • Examples of vectors that integrate in a site specific manner include, for example, components of the flp-in system from Invitrogen (Carlsbad, Calif.) (e.g., pcDNATM5/FRT), or the cre-lox system, such as can be found in the pExchange-6 Core Vectors from Stratagene (La Jolla, Calif).
  • vectors that randomly integrate into host cell chromosomes include, for example, pcDNA3.1 (when introduced in the absence of T-antigen) from Invitrogen (Carlsbad, Calif), and pCI or pFNIOA (ACT) FLEXITM from Promega (Madison, Wis.).
  • Additional promoter elements e.g., enhancers, regulate the frequency of transcriptional initiation. Typically, these are located in the region 30-1 10 bp upstream of the start site, although a number of promoters have recently been shown to contain functional elements downstream of the start site as well.
  • the spacing between promoter elements frequently is flexible, so that promoter function is preserved when elements are inverted or moved relative to one another. In the thymidine kinase (tk) promoter, the spacing between promoter elements can be increased to 50 bp apart before activity begins to decline. Depending on the promoter, it appears that individual elements can function either cooperatively or independently to activate transcription.
  • a suitable promoter is the immediate early cytomegalovirus (CMV) promoter sequence. This promoter sequence is a strong constitutive promoter sequence capable of driving high levels of expression of any polynucleotide sequence operatively linked thereto.
  • CMV immediate early cytomegalovirus
  • hEFlal human elongation growth factor 1 alpha 1
  • the vector construct comprising the CARs and/or TCRs of the present disclosure comprises hEFlal functional variants.
  • constitutive promoter sequences may also be used, including, but not limited to the simian virus 40 (SV40) early promoter, mouse mammary tumor virus (MMTV), human immunodeficiency virus (HIV) long terminal repeat (LTR) promoter, MoMuLV promoter, an avian leukemia virus promoter, an Epstein-Barr virus immediate early promoter, a Rous sarcoma virus promoter, as well as human gene promoters such as, but not limited to, the actin promoter, the myosin promoter, the hemoglobin promoter, and the creatine kinase promoter. Further, the present disclosure should not be limited to the use of constitutive promoters.
  • inducible promoters are also contemplated as part of the present disclosure.
  • the use of an inducible promoter provides a molecular switch capable of turning on expression of the polynucleotide sequence which it is operatively linked when such expression is desired, or turning off the expression when expression is not desired.
  • inducible promoters include, but are not limited to a metallothionine promoter, a glucocorticoid promoter, a progesterone promoter, and a tetracycline promoter.
  • the expression vector to be introduced into a cell can also contain either a selectable marker gene or a reporter gene or both to facilitate identification and selection of expressing cells from the population of cells sought to be transfected or infected through viral vectors.
  • the selectable marker may be carried on a separate piece of DNA and used in a co-transfection procedure. Both selectable markers and reporter genes may be flanked with appropriate regulatory sequences to enable expression in the host cells.
  • Useful selectable markers include, for example, antibiotic-resistance genes, such as neomycin resistance gene (neo) and ampicillin resistance gene and the like.
  • a truncated epidermal growth factor receptor (HERlt) tag may be used as a selectable marker gene.
  • Reporter genes can be used for identifying potentially transfected cells and for evaluating the functionality of regulatory sequences.
  • a reporter gene is a gene that is not present in or expressed by the recipient organism or tissue and that encodes a polypeptide whose expression is manifested by some easily detectable property, e.g., enzymatic activity. Expression of the reporter gene is assayed at a suitable time after the DNA has been introduced into the recipient cells.
  • Suitable reporter genes may include genes encoding luciferase, beta- galactosidase, chloramphenicol acetyl transferase, secreted alkaline phosphatase, or the green fluorescent protein gene (e.g., Ui-Tei et al., FEBS Letters 479: 79-82 (2000)).
  • Suitable expression systems are well known and may be prepared using known techniques or obtained commercially.
  • the construct with the minimal 5' flanking region showing the highest level of expression of reporter gene is identified as the promoter.
  • Such promoter regions may be linked to a reporter gene and used to evaluate agents for the ability to modulate promoter-driven transcription.
  • the vectors comprise a hEFlal promoter to drive expression of transgenes, a bovine growth hormone polyA sequence to enhance transcription, a woodchuck hepatitis virus posttranscriptional regulatory element (WPRE), as well as LTR sequences derived from the pFUGW plasmid.
  • a hEFlal promoter to drive expression of transgenes
  • a bovine growth hormone polyA sequence to enhance transcription e.g., a bovine growth hormone polyA sequence to enhance transcription
  • WPRE woodchuck hepatitis virus posttranscriptional regulatory element
  • the vector can be readily introduced into a host cell, e.g., mammalian, bacterial, yeast, or insect cell by any method in the art.
  • the expression vector can be transferred into a host cell by physical, chemical, or biological means.
  • Physical methods for introducing a polynucleotide into a host cell include calcium phosphate precipitation, lipofection, particle bombardment, microinjection, electroporation, and the like. Methods for producing cells comprising vectors and/or exogenous nucleic acids are well-known in the art. See, for example, Sambrook et al. (Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York (2001)). In embodiments, a method for the introduction of a polynucleotide into a host cell is calcium phosphate transfection or
  • PEI polyethylenimine
  • Biological methods for introducing a polynucleotide of interest into a host cell include the use of DNA and RNA vectors.
  • Viral vectors, and especially retroviral vectors have become the most widely used method for inserting genes into mammalian, e.g., human cells.
  • Other viral vectors can be derived from lentivirus, poxviruses, herpes simplex virus I, adenoviruses and adeno-associated viruses, and the like. See, for example, U.S. Pat. Nos. 5,350,674 and 5,585,362.
  • Chemical means for introducing a polynucleotide into a host cell include colloidal dispersion systems, such as macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes.
  • colloidal dispersion systems such as macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes.
  • An exemplary colloidal system for use as a delivery vehicle in vitro and in vivo is a liposome ⁇ e.g., an artificial membrane vesicle).
  • an exemplary delivery vehicle is a liposome.
  • lipid formulations is contemplated for the introduction of the nucleic acids into a host cell (in vitro, ex vivo or in vivo).
  • the nucleic acid may be associated with a lipid.
  • the nucleic acid associated with a lipid may be encapsulated in the aqueous interior of a liposome, interspersed within the lipid bilayer of a liposome, attached to a liposome via a linking molecule that is associated with both the liposome and the oligonucleotide, entrapped in a liposome, complexed with a liposome, dispersed in a solution containing a lipid, mixed with a lipid, combined with a lipid, contained as a suspension in a lipid, contained or complexed with a micelle, or otherwise associated with a lipid.
  • Lipid, lipid/DNA or lipid/expression vector associated compositions are not limited to any particular structure in solution.
  • Lipids are fatty substances which may be naturally occurring or synthetic lipids.
  • lipids include the fatty droplets that naturally occur in the cytoplasm as well as the class of compounds which contain long-chain aliphatic hydrocarbons and their derivatives, such as fatty acids, alcohols, amines, amino alcohols, and aldehydes.
  • Lipids suitable for use can be obtained from commercial sources.
  • DMPC dimyristyl phosphatidylcholine
  • DCP dicetyl phosphate
  • Choi cholesterol
  • DMPG dimyristyl phosphatidylglycerol
  • Stock solutions of lipids in chloroform or chloroform/methanol can be stored at about -20o C.
  • Chloroform is used as the only solvent since it is more readily evaporated than methanol.
  • Liposome is a generic term encompassing a variety of single and multilamellar lipid vehicles formed by the generation of enclosed lipid bilayers or aggregates. Liposomes can be
  • Multilamellar liposomes have multiple lipid layers separated by aqueous medium. They form spontaneously when phospholipids are suspended in an excess of aqueous solution. The lipid components undergo self-rearrangement before the formation of closed structures and entrap water and dissolved solutes between the lipid bilayers (Ghosh et al., Glycobiology 5: 505-10 (1991)). However, compositions that have different structures in solution than the normal vesicular structure are also encompassed. For example, the lipids may assume a micellar structure or merely exist as non-uniform aggregates of lipid molecules. Also
  • lipofectamine-nucleic acid complexes contemplated are lipofectamine-nucleic acid complexes.
  • Non- Viral Based Delivery Systems polynucleotides encoding cell tags described herein can also be introduced into T cells using non-viral based delivery systems, such as the "Sleeping Beauty (SB) Transposon System,” which refers a synthetic DNA transposon system for introducing DNA sequences into the chromosomes of vertebrates.
  • SB Sleeping Beauty
  • the Sleeping Beauty transposon system is composed of a Sleeping Beauty (SB) transposase and a SB transposon.
  • the Sleeping Beauty transposon system can include the SB 11 transposon system, the SB100X transposon system, or the SB 110 transposon system.
  • DNA transposons translocate from one DNA site to another in a simple, cut-and-paste manner. Transposition is a precise process in which a defined DNA segment is excised from one DNA molecule and moved to another site in the same or different DNA molecule or genome. As do other Tcl/mariner-type transposases, SB transposase inserts a transposon into a TA
  • the insertion site can be elsewhere in the same DNA molecule, or in another DNA molecule (or chromosome). In mammalian genomes, including humans, there are approximately 200 million TA sites.
  • the TA insertion site is duplicated in the process of transposon integration. This duplication of the TA sequence is a hallmark of transposition and used to ascertain the mechanism in some experiments.
  • the transposase can be encoded either within the transposon or the transposase can be supplied by another source, for instance a DNA or mRNA source, in which case the transposon becomes a non-autonomous element.
  • Non-autonomous transposons are most useful as genetic tools because after insertion they cannot independently continue to excise and re-insert.
  • SB transposons envisaged to be used as non-viral vectors for introduction of genes into genomes of vertebrate animals and for gene therapy. Briefly, the Sleeping Beauty (SB) system (Hackett et al., Mol Ther 18:674-83, (2010)) was adapted to genetically modify the T cells (Cooper et al., Blood 105: 1622- 31, (2005)).
  • SB Sleeping Beauty
  • the SB transposon system includes coding sequence encoding membrane boundIL-15and/or a chimeric antigen receptor.
  • coding sequence encoding membrane boundIL-15and/or a chimeric antigen receptor.
  • Such systems are described for example in Singh et al., Cancer Res (8):68 (2008). April 15, 2008 and Maiti et al., J Immunother. 36(2): 112-123 (2013), incorporated herein by reference in their entireties.
  • the DNA plasmid expressing a SB transposon comprising a CAR or TCR and a cytokine and polypeptide cell tag are electroporated into an effector cell which is then infused into a patient without further propagation and expansion.
  • a polynucleotide encoding a CAR or a TCR or a cytokine and one or more polypeptide cell tag(s) in a modified effector cell described herein is encoded in one or more transposon DNA plasmid vectors, and the SB transposase is encoded in a separate vector.
  • the polypeptide cell tag is encoded in a transposon DNA plasmid vector
  • a CAR or TCR or cytokine is encoded in a second transposon DNA plasmid vector
  • the SB transposase is encoded in a third DNA plasmid vector.
  • the CAR or TCR and cytokine and polypeptide cell tag is encoded in a single transposon.
  • the polypeptides described herein provides a safety mechanism by allowing for depletion of infused CAR-T cells through administering FDA approved antibodies or any antibody that recognizes a polypeptide construct to induce a cell depletion pathway.
  • HERlt variants described herein provide a safety mechanism by binding to introduced cetuximab and allowing for cell depletion.
  • CD20t variants also provide a safety mechanism by allowing for depletion of infused CAR-T cells through administering FDA-approved rituximab therapy.
  • assays include, for example, molecular assays well known to those of skill in the art, such as Southern and Northern blotting, RT-PCR and PCR; "biochemical” assays, such as detecting the presence or absence of a particular peptide, e.g., by immunological means (ELISAs and Western blots) or by assays described herein to identify agents falling within the scope of the present disclosure.
  • molecular assays well known to those of skill in the art, such as Southern and Northern blotting, RT-PCR and PCR
  • biochemical assays such as detecting the presence or absence of a particular peptide, e.g., by immunological means (ELISAs and Western blots) or by assays described herein to identify agents falling within the scope of the present disclosure.
  • a modified effector cell described herein and other genetic elements are delivered to a cell using the SB 11 transposon system, the SB 100X transposon system, the SB110 transposon system, the piggyBac transposon system (see, e.g., Wilson et al, "PiggyBac Transposon-mediated Gene Transfer in Human Cells," Molecular Therapy 15: 139-145 (2007), incorporated herein by reference in its entirety) and/or the piggyBac transposon system (see, e.g., Mitra et al., "Functional characterization of piggyBac from the bat Myotis lucifugus unveils an active mammalian DNA transposon," Proc. Natl. Acad. Sci USA 110:234-239 (2013).
  • Additional suitable non-viral systems can include integrating expression vectors, which may randomly integrate into the host cell's DNA, or may include a recombination site to enable the specific recombination between the expression vector and the host cell's chromosome. Targeted integration of transgenes into predefined genetic loci is a desirable goal for many applications. First, a first recombination site for a site-specific recombinase is inserted at a genomic site, either at a random or at a predetermined location.
  • the cells are transfected with a plasmid carrying the gene or DNA of interest and the second recombination site and a source for recombinase (expression plasmid, RNA, protein, or virus-expressing recombinase).
  • a plasmid carrying the gene or DNA of interest and the second recombination site and a source for recombinase (expression plasmid, RNA, protein, or virus-expressing recombinase).
  • Recombination between the first and second recombination sites leads to integration of plasmid DNA.
  • Such integrating expression vectors may utilize the endogenous expression control sequences of the host cell's chromosomes to effect expression of the desired protein.
  • targeted integration is promoted by the presence of sequences on the donor polynucleotide that are homologous to sequences flanking the integration site.
  • targeted integration using the donor polynucleotides described herein may be achieved following conventional transfection techniques, e.g. techniques used to create gene knockouts or knockins by homologous recombination.
  • targeted integration is promoted both by the presence of sequences on the donor polynucleotide that are homologous to sequences flanking the integration site, and by contacting the cells with donor polynucleotide in the presence of a site-specific recombinase.
  • a site-specific recombinase or simply a recombinase, it is meant is a polypeptide that catalyzes conservative site-specific recombination between its compatible recombination sites.
  • a site-specific recombinase includes native polypeptides as well as derivatives, variants and/or fragments that retain activity, and native polynucleotides, derivatives, variants, and/or fragments that encode a recombinase that retains activity.
  • a system for integrating heterologous genes in a host cell comprising one or more gene expression cassettes.
  • the system includes a first gene expression cassette comprising a first polynucleotide encoding a first polypeptide construct.
  • the system can include a second gene expression cassette comprising a second polynucleotide encoding a second polypeptide construct.
  • the system can include a third gene expression cassette.
  • the system includes recombinant attachment sites; and a serine recombinase; such that upon contacting said host cell with at least said first gene expression cassette, in the presence of said serine recombinase, said heterologous genes are integrated in said host cell.
  • the system further comprises a ligand; such that upon contacting said host cell, in the presence of said ligand, said heterologous gene are expressed in said host cell.
  • the system also includes recombinant attachment sites.
  • one recombination attachment site is a phage genomic recombination attachment site (attP) or a bacterial genomic recombination attachment site (attB).
  • the host cell is an eukaryotic cell.
  • the host cell is a human cell.
  • the host cell is a T cell or NK cell.
  • the heterologous gene in the system described above comprises a CAR.
  • the CAR binds at least one of CD19, CD33, BCMA, CD44, a- Folate receptor, CAIX, CD30, ROR1, CEA, EGP-2, EGP-40, HER2, HER3, Folate-binding Protein, GD2, GD3, IL-13R-a2, KDR, EDB-F, mesothelin, CD22, EGFR, MUC-1, MUC-16, MAGE-A1, h5T4, PSMA, TAG-72, EGFRvIII, CD123 and VEGF-R2.
  • the system includes a heterologous gene comprising a cytokine.
  • the cytokine comprises at least one of IL-15, IL-2, IL-12, IL-21, and a fusion of IL-15 and IL-15Roc.
  • the system includes a heterologous gene comprising at least one cell tag described herein.
  • said cell tag comprises at least one of a HERl polypeptide, a LNGFR polypeptide, a CD20 polypeptide and a CD52 polypeptide.
  • the mb IL-15 is encoded with a cell tag. Examples of cell tags can include truncated: HERl polypeptide, LNGFR polypeptide, CD20 polypeptide, CD52 polypeptide or any other appropriate cell tags for use as a depletion or kill switch, or enrichment marker.
  • said system is contained in one or more vectors.
  • the system is contained in one vector.
  • the first gene expression cassette, the second gene expression cassette, and the recombinant attachment sites are contained in one vector.
  • the first gene expression cassette, the second gene expression cassette, the third gene expression cassette and the recombinant attachment sites are contained in one vector.
  • the serine recombinase is SF370. In other instances, the serine recombinase is in a separate vector.
  • the recombinases can be introduced into a target cell before, concurrently with, or after the introduction of a targeting vector.
  • the recombinase can be directly introduced into a cell as a protein, for example, using liposomes, coated particles, or microinjection.
  • a polynucleotide, either DNA or messenger RNA, encoding the recombinase can be introduced into the cell using a suitable expression vector.
  • the targeting vector components described above are useful in the construction of expression cassettes containing sequences encoding a recombinase of interest.
  • expression of the recombinase can be regulated in other ways, for example, by placing the expression of the recombinase under the control of a regulatable promoter (i.e., a promoter whose expression can be selectively induced or repressed).
  • Recombinases for use in the practice of the present invention can be produced recombinantly or purified as previously described.
  • Polypeptides having the desired recombinase activity can be purified to a desired degree of purity by methods known in the art of protein ammonium sulfate precipitation, purification, including, but not limited to, size fractionation, affinity chromatography, HPLC, ion exchange chromatography, heparin agarose affinity chromatography (e.g., Thorpe & Smith, Proc. Nat. Acad. Sci. 95:5505-5510, 1998.)
  • the recombinases can be introduced into the eukaryotic cells that contain the recombination attachment sites at which recombination is desired by any suitable method.
  • Methods of introducing functional proteins, e.g., by microinjection or other methods, into cells are well known in the art. Introduction of purified recombinase protein ensures a transient presence of the protein and its function, which is often a preferred embodiment.
  • a gene encoding the recombinase can be included in an expression vector used to transform the cell, in which the recombinase-encoding polynucleotide is operably linked to a promoter which mediates expression of the polynucleotide in the eukaryotic cell.
  • recombinase polypeptide can also be introduced into the eukaryotic cell by messenger RNA that encodes the recombinase polypeptide. It is generally preferred that the recombinase be present for only such time as is necessary for insertion of the nucleic acid fragments into the genome being modified. Thus, the lack of permanence associated with most expression vectors is not expected to be detrimental.
  • the recombinase gene is present within the vector that carries the polynucleotide that is to be inserted; the recombinase gene can even be included within the polynucleotide.
  • the recombinase gene is introduced into a transgenic eukaryotic organism. Transgenic cells or animals can be made that express a recombinase constitutively or under cell- specific, tissue-specific, developmental-specific, organelle-specific, or small molecule-inducible or repressible promoters.
  • the recombinases can be also expressed as a fusion protein with other peptides, proteins, nuclear localizing signal peptides, signal peptides, or organelle-specific signal peptides (e.g., mitochondrial or chloroplast transit peptides to facilitate recombination in mitochondria or chloroplast).
  • organelle-specific signal peptides e.g., mitochondrial or chloroplast transit peptides to facilitate recombination in mitochondria or chloroplast.
  • a recombinase may be from the Integrase or Resolvase families.
  • the Integrase family of recombinases has over one hundred members and includes, for example, FLP, Cre, and lambda integrase.
  • the Integrase family also referred to as the tyrosine family or the lambda integrase family, uses the catalytic tyrosine's hydroxyl group for a nucleophilic attack on the phosphodiester bond of the DNA.
  • members of the tyrosine family initially nick the DNA, which later forms a double strand break.
  • tyrosine family integrases examples include Cre, FLP, SSV1, and lambda ( ⁇ ) integrase.
  • Cre tyrosine family integrases
  • FLP FLP
  • SSV1 styrosine family integrases
  • lambda
  • resolvase family also known as the serine recombinase family, a conserved serine residue forms a covalent link to the DNA target site (Grindley, et al., (2006) Ann Rev Biochem 16: 16).
  • the recombinase is an isolated polynucleotide sequence comprising a nucleic acid sequence that encodes a recombinase selecting from the group consisting of a SPPc2 recombinase, a SF370.1 recombinase, a Bxbl recombinase, an Al 18 recombinase and a ⁇ j)Rvl recombinase.
  • SPPc2 recombinase a SF370.1 recombinase
  • Bxbl recombinase a Bxbl recombinase
  • Al 18 recombinase Al 18 recombinase
  • ⁇ j Rvl recombinase
  • a method for site-specific recombination comprises providing a first recombination site and a second recombination site; contacting the first and second recombination sites with a prokaryotic recombinase polypeptide, resulting in recombination between the recombination sites, wherein the recombinase polypeptide can mediate
  • the first recombination site is attP or attB
  • the second recombination site is attB or attP
  • the recombinase is selected from the group consisting of a Listeria monocytogenes phage recombinase, a Streptococcus pyogenes phage recombinase, a Bacillus subtilis phage recombinase, a Mycobacterium tuberculosis phage recombinase and ⁇ Mycobacterium smegmatis phage recombinase, provided that when the first recombination attachment site is attB, the second recombination attachment site is attP, and when the first recombination attachment site is attP, the second recombination attachment site is attB
  • Further embodiments provide for the introduction of a site-specific recombina
  • the recombinase is selected from the group consisting of an Al 18 recombinase, a SF370.1 recombinase, a SPPc2 recombinase, a cbRvl recombinase, and a Bxbl recombinase.
  • the recombination results in integration.
  • the embodiments described herein include methods of making and/or expanding the antigen-specific redirected immune effector cells (e.g., T-cells, K-cell or K T- cells) that comprises transfecting the cells with an expression vector containing a DNA (or RNA) construct encoding the polypeptide construct, then, optionally, stimulating the cells with feeder cells, recombinant antigen, or an antibody to the receptor to cause the cells to proliferate.
  • the cell (or cell population) engineered to express a CAR or TCR is a stem cell, iPS cell, immune effector cell or a precursor of these cells.
  • Sources of immune effector cells can include both allogeneic and autologous sources.
  • immune effector cells may be differentiated from stem cells or induced pluripotent stem cells (iPSCs).
  • iPSCs induced pluripotent stem cells
  • cell for engineering can be isolated from umbilical cord blood, peripheral blood, human embryonic stem cells, or iPSCs.
  • allogeneic T cells can be modified to include a chimeric antigen receptor (and optionally, to lack functional TCR).
  • the immune effector cells are primary human T cells such as T cells derived from human peripheral blood mononuclear cells (PBMC).
  • PBMC peripheral blood mononuclear cells
  • PBMCs can be collected from the peripheral blood or after stimulation with G-CSF (Granulocyte colony stimulating factor) from the bone marrow, or umbilical cord blood.
  • G-CSF G-CSF
  • the cells may be immediately infused or may be cryo-preserved.
  • the cells may be propagated for days, weeks, or months ex vivo as a bulk population within about 1, 2, 3, 4, 5 days or more following gene transfer into cells.
  • the transfectants are cloned and a clone demonstrating presence of a single integrated or episomally maintained expression cassette or plasmid, and expression of the chimeric antigen receptor is expanded ex vivo.
  • the clone selected for expansion demonstrates the capacity to specifically recognize and lyse antigen-expressing target cells.
  • the recombinant T cells may be expanded by stimulation with IL-2, or other cytokines that bind the common gamma-chain (e.g., IL-7, IL-12, IL-15, IL-21, and others).
  • the recombinant T cells may be expanded by stimulation with artificial antigen presenting cells.
  • the recombinant T cells may be expanded on artificial antigen presenting cell or with an antibody, such as OKT3, which cross links CD3 on the T cell surface.
  • Subsets of the recombinant T cells may be further selected with the use of magnetic bead based isolation methods and/or fluorescence activated cell sorting technology and further cultured with the AaPCs.
  • the genetically modified cells may be cryopreserved.
  • T cells can also be obtained from a number of sources, including peripheral blood, bone marrow, lymph node tissue, cord blood, thymus tissue, tissue from a site of infection, ascites, pleural effusion, spleen tissue, and tumor (tumor-infiltrating lymphocytes).
  • sources including peripheral blood, bone marrow, lymph node tissue, cord blood, thymus tissue, tissue from a site of infection, ascites, pleural effusion, spleen tissue, and tumor (tumor-infiltrating lymphocytes).
  • T cells can be obtained from a unit of blood collected from a subject using any number of techniques known to the skilled artisan, such as Ficoll® separation.
  • cells from the circulating blood of an individual are obtained by apheresis.
  • the apheresis product typically contains lymphocytes, including T cells, monocytes, granulocytes, B cells, other nucleated white blood cells, red blood cells, and platelets.
  • the cells collected by apheresis may be washed to remove the plasma fraction and to place the cells in an appropriate buffer or media for subsequent processing steps.
  • the cells are washed with phosphate buffered saline (PBS).
  • PBS phosphate buffered saline
  • the wash solution lacks calcium and may lack magnesium or may lack many if not all divalent cations. Initial activation steps in the absence of calcium lead to magnified activation.
  • a washing step may be accomplished by methods known to those in the art, such as by using a semi- automated "flow-through" centrifuge (for example, the Cobe 2991 cell processor, the Baxter CytoMate, or the Haemonetics Cell Saver 5) according to the manufacturer's instructions.
  • the cells may be resuspended in a variety of biocompatible buffers, such as, for example, Ca2+-free, Mg2+-free PBS, PlasmaLyte A, or other saline solution with or without buffer.
  • buffers such as, for example, Ca2+-free, Mg2+-free PBS, PlasmaLyte A, or other saline solution with or without buffer.
  • the undesirable components of the apheresis sample may be removed and the cells directly resuspended in culture media.
  • T cells are isolated from peripheral blood lymphocytes by lysing the red blood cells and depleting the monocytes, for example, by centrifugation through a PERCOLL® gradient or by counterflow centrifugal elutriation.
  • a specific subpopulation of T cells such as CD3+, CD28+, CD4+, CD8+, CD45RA+, and CD45RO+ T cells, can be further isolated by positive or negative selection techniques.
  • CD14+ cells are depleted from the T-cell population.
  • T cells are isolated by incubation with anti-CD3/anti-CD28 (i.e., 3x28)-conjugated beads, such as DYNABEADS® M- 450 CD3/CD28 T, for a time period sufficient for positive selection of the desired T cells.
  • the time period is about 30 minutes.
  • the time period ranges from 30 minutes to 36 hours or longer and all integer values there between.
  • the time period is at least 1, 2, 3, 4, 5, or 6 hours.
  • the time period is 10 to 24 hours.
  • the incubation time period is 24 hours.
  • use of longer incubation times, such as 24 hours can increase cell yield.
  • TIL tumor infiltrating lymphocytes
  • subpopulations of T cells can be preferentially selected for or against at culture initiation or at other desired time points.
  • multiple rounds of selection can also be used in the context of this disclosure.
  • "Unselected” cells can also be subjected to further rounds of selection.
  • Enrichment of a T cell population by negative selection can be accomplished with a combination of antibodies directed to surface markers unique to the negatively selected cells.
  • One method is cell sorting and/or selection via negative magnetic immunoadherence or flow cytometry that uses a cocktail of monoclonal antibodies directed to cell surface markers present on the cells negatively selected.
  • a monoclonal antibody cocktail typically includes antibodies to CD14, CD20, CDl lb, CD16, HLA-DR, and CD8.
  • T regulatory cells are depleted by anti-CD25 conjugated beads or other similar method of selection.
  • the concentration of cells and surface can be varied. In certain embodiments, it may be desirable to significantly decrease the volume in which beads and cells are mixed together (i.e., increase the concentration of cells), to ensure maximum contact of cells and beads. For example, in one embodiment, a concentration of 2 billion cells/ml is used. In one embodiment, a concentration of 1 billion cells/ml is used. In a further embodiment, greater than 100 million cells/ml is used. In a further embodiment, a concentration of cells of 10, 15, 20, 25, 30, 35, 40, 45, or 50 million cells/ml is used.
  • a concentration of cells from 75, 80, 85, 90, 95, or 100 million cells/ml is used. In further embodiments, concentrations of 125 or 150 million cells/ml can be used.
  • concentrations can result in increased cell yield, cell activation, and cell expansion.
  • use of high cell concentrations allows more efficient capture of cells that may weakly express target antigens of interest, such as CD28- negative T cells, or from samples where there are many tumor cells present (i.e., leukemic blood, tumor tissue, etc.). Such populations of cells may have therapeutic value and would be desirable to obtain. For example, using high concentration of cells allows more efficient selection of CD8+ T cells that normally have weaker CD28 expression.
  • concentrations of cells By significantly diluting the mixture of T cells and surface (e.g., particles such as beads), interactions between the particles and cells is minimized. This selects for cells that express high amounts of desired antigens to be bound to the particles.
  • CD4+ T cells express higher levels of CD28 and are more efficiently captured than CD8+ T cells in dilute
  • the concentration of cells used is 5xl06/ml. In other embodiments, the concentration used can be from about lxl05/ml to lxl06/ml, and any integer value in between.
  • the cells may be incubated on a rotator for varying lengths of time at varying speeds at either 2-10o C or at room temperature.
  • T cells for stimulation can also be frozen after a washing step. After the washing step that removes plasma and platelets, the cells may be suspended in a freezing solution. While many freezing solutions and parameters are known in the art and will be useful in this context, one method involves using PBS containing 20% DMSO and 8% human serum albumin, or culture media containing 10% Dextran 40 and 5% Dextrose, 20% Human Serum Albumin and 7.5% DMSO, or 31.25% Plasmalyte-A, 31.25% Dextrose 5%, 0.45% NaCl, 10% Dextran 40 and 5% Dextrose, 20% Human Serum Albumin, and 7.5% DMSO or other suitable cell freezing media containing for example, Hespan and PlasmaLyte A, the cells then are frozen to -80o C at a rate of lo per minute and stored in the vapor phase of a liquid nitrogen storage tank. Other methods of controlled freezing may be used as well as uncontrolled freezing immediately at -20o C or in liquid nitrogen.
  • cryopreserved cells are thawed and washed as described herein and allowed to rest for one hour at room temperature prior to activation using the methods of the present disclosure.
  • a blood sample or an apheresis product is taken from a generally healthy subject.
  • a blood sample or an apheresis is taken from a generally healthy subject who is at risk of developing a disease, but who has not yet developed a disease, and the cells of interest are isolated and frozen for later use.
  • the T cells may be expanded, frozen, and used at a later time.
  • samples are collected from a patient shortly after diagnosis of a particular disease as described herein but prior to any treatments.
  • the cells are isolated from a blood sample or an apheresis from a subject prior to any number of relevant treatment modalities, including but not limited to treatment with agents such as natalizumab, efalizumab, antiviral agents, chemotherapy, radiation, immunosuppressive agents, such as cyclosporin, azathioprine, methotrexate, mycophenolate, and FK506, antibodies, or other immunoablative agents such as CAMPATH, anti-CD3 antibodies, Cytoxan, fludarabine, cyclosporin, FK506, rapamycin, mycophenolic acid, steroids, FR901228, and irradiation.
  • agents such as natalizumab, efalizumab, antiviral agents, chemotherapy, radiation, immunosuppressive agents, such as cyclosporin, azathioprine, methotrexate, my
  • the cells are isolated for a patient and frozen for later use in conjunction with (e.g., before, simultaneously or following) bone marrow or stem cell transplantation, T cell ablative therapy using either chemotherapy agents such as, fludarabine, external-beam radiation therapy (XRT), cyclophosphamide, or antibodies such as OKT3 or CAMPATH.
  • chemotherapy agents such as, fludarabine, external-beam radiation therapy (XRT), cyclophosphamide, or antibodies such as OKT3 or CAMPATH.
  • the cells are isolated prior to and can be frozen for later use for treatment following B-cell ablative therapy such as agents that react with CD20, e.g., Rituxan.
  • T cells are obtained from a patient directly following treatment.
  • certain cancer treatments in particular treatments with drugs that damage the immune system, shortly after treatment during the period when patients would normally be recovering from the treatment, the quality of T cells obtained may be optimal or improved for their ability to expand ex vivo.
  • these cells may be in a preferred state for enhanced engraftment and in vivo expansion.
  • these cells may be in a preferred state for enhanced engraftment and in vivo expansion.
  • blood cells including T cells, dendritic cells, or other cells of the hematopoietic lineage, during this recovery phase.
  • mobilization for example, mobilization with GM-CSF
  • conditioning regimens can be used to create a condition in a subject wherein repopulation, recirculation, regeneration, and/or expansion of particular cell types is favored, especially during a defined window of time following therapy.
  • Illustrative cell types include T cells, B cells, dendritic cells, and other cells of the immune system.
  • T cells comprising polynucleotides and polypeptides described herein can optionally, be activated and expanded generally using methods as described, for example, in U.S. Pat. Nos. 6,352,694; 6,534,055; 6,905,680; 6,692,964; 5,858,358; 6,887,466; 6,905,681; 7, 144,575; 7,067,318; 7, 172,869; 7,232,566; 7, 175,843; 5,883,223; 6,905,874;
  • adoptive T cell transfer refers to the isolation and ex vivo expansion of tumor specific T cells to achieve greater number of T cells than what could be obtained by vaccination alone or the patient's natural tumor response.
  • the tumor specific T cells are then infused into patients with cancer in an attempt to give their immune system the ability to overwhelm remaining tumor via T cells which can attack and kill cancer.
  • adoptive T cell therapy is used for cancer treatment; culturing tumor infiltrating lymphocytes or TIL, isolating and expanding one particular T cell or clone, and even using T cells that have been engineered to potently recognize and attack tumors.
  • T cells described herein are expanded by contact with a surface having attached thereto an agent that stimulates a CD3/TCR complex associated signal and a ligand that stimulates a co-stimulatory molecule on the surface of the T cells.
  • T cell populations may be stimulated as described herein, such as by contact with an anti-CD3 antibody, or antigen-binding fragment thereof, or an anti-CD2 antibody immobilized on a surface, or by contact with a protein kinase C activator (e.g., bryostatin) in conjunction with a calcium ionophore.
  • a ligand that binds the accessory molecule is used for co-stimulation of an accessory molecule on the surface of the T cells.
  • a population of T cells can be contacted with an anti-CD3 antibody and an anti-CD28 antibody, under conditions appropriate for stimulating proliferation of the T cells.
  • an anti-CD3 antibody and an anti-CD28 antibody can be used as can other methods commonly known in the art (Berg et al., Transplant Proc. 30(8):3975-3977, (1998); Haanen et al., J. Exp. Med. 190(9): 13191328, (1999); Garland et al., J. Immunol Meth. 227(1- 2):53-63, (1999)).
  • the primary stimulatory signal and the co- stimulatory signal for the T cell may be provided by different protocols.
  • the agents providing each signal may be in solution or coupled to a surface. When coupled to a surface, the agents may be coupled to the same surface (i.e., in "cis” formation) or to separate surfaces (i.e., in "trans” formation).
  • one agent may be coupled to a surface and the other agent in solution.
  • the agent providing the co-stimulatory signal is bound to a cell surface and the agent providing the primary activation signal is in solution or coupled to a surface. In certain embodiments, both agents can be in solution.
  • the agents may be in soluble form, and then cross-linked to a surface, such as a cell expressing Fc receptors or an antibody or other binding agent which will bind to the agents.
  • a surface such as a cell expressing Fc receptors or an antibody or other binding agent which will bind to the agents.
  • the two agents are immobilized on beads, either on the same bead, i.e., "cis," or to separate beads, i.e., "trans.”
  • the agent providing the primary activation signal is an anti-CD3 antibody or an antigen-binding fragment thereof and the agent providing the co-stimulatory signal is an anti-CD28 antibody or antigen-binding fragment thereof; and both agents are co-immobilized to the same bead in equivalent molecular amounts.
  • a 1 : 1 ratio of each antibody bound to the beads for CD4+ T cell expansion and T cell growth is used.
  • a ratio of anti CD3 :CD28 antibodies bound to the beads is used such that an increase in T cell expansion is observed as compared to the expansion observed using a ratio of 1 : 1. In one particular embodiment an increase of from about 1 to about 3 fold is observed as compared to the expansion observed using a ratio of 1 : 1. In one embodiment, the ratio of CD3 :CD28 antibody bound to the beads ranges from 100: 1 to 1 : 100 and all integer values there between. In one aspect of the present disclosure, more anti-CD28 antibody is bound to the particles than anti-CD3 antibody, i.e., the ratio of CD3 :CD28 is less than one. In certain embodiments of the present disclosure, the ratio of anti CD28 antibody to anti CD3 antibody bound to the beads is greater than 2: 1. In one particular embodiment, a 1 : 100 CD3 :CD28 ratio of antibody bound to beads is used. In another
  • a 1 :75 CD3 :CD28 ratio of antibody bound to beads is used.
  • a 1 :50 CD3 :CD28 ratio of antibody bound to beads is used.
  • a 1 :30 CD3 :CD28 ratio of antibody bound to beads is used.
  • a 1 : 10 CD3 :CD28 ratio of antibody bound to beads is used.
  • a 1 :3 CD3 :CD28 ratio of antibody bound to the beads is used.
  • a 3 : 1 CD3 :CD28 ratio of antibody bound to the beads is used.
  • Ratios of particles to cells from 1 :500 to 500: 1 and any integer values in between may be used to stimulate T cells or other target cells.
  • the ratio of particles to cells may depend on particle size relative to the target cell. For example, small sized beads could only bind a few cells, while larger beads could bind many.
  • the ratio of cells to particles ranges from 1 : 100 to 100: 1 and any integer values in-between and in further embodiments the ratio comprises 1 :9 to 9: 1 and any integer values in between, can also be used to stimulate T cells.
  • the ratio of anti-CD3- and anti-CD28- coupled particles to T cells that result in T cell stimulation can vary as noted above, however certain values include 1 : 100, 1 :50, 1 :40, 1 :30, 1 :20, 1 : 10, 1 :9, 1 :8, 1 :7, 1 :6, 1 :5, 1 :4, 1 :3, 1 :2, 1 : 1, 2: 1, 3 : 1, 4: 1, 5: 1, 6: 1, 7: 1, 8: 1, 9: 1, 10: 1, and 15: 1 with one ratio being at least 1 : 1 particles per T cell.
  • a ratio of particles to cells of 1 : 1 or less is used.
  • the particlexell ratio is 1 :5.
  • the ratio of particles to cells can be varied depending on the day of stimulation.
  • the ratio of particles to cells is from 1 : 1 to 10: 1 on the first day and additional particles are added to the cells every day or every other day thereafter for up to 10 days, at final ratios of from 1 : 1 to 1 : 10 (based on cell counts on the day of addition).
  • the ratio of particles to cells is 1 : 1 on the first day of stimulation and adjusted to 1 :5 on the third and fifth days of stimulation.
  • particles are added on a daily or every other day basis to a final ratio of 1 : 1 on the first day, and 1 :5 on the third and fifth days of stimulation.
  • the ratio of particles to cells is 2: 1 on the first day of stimulation and adjusted to 1 : 10 on the third and fifth days of stimulation.
  • particles are added on a daily or every other day basis to a final ratio of 1 : 1 on the first day, and 1 : 10 on the third and fifth days of
  • ratios may be suitable for use in the present disclosure. In particular, ratios will vary depending on particle size and on cell size and type.
  • the cells such as T cells
  • the beads and the cells are subsequently separated, and then the cells are cultured.
  • the agent-coated beads and cells prior to culture, are not separated but are cultured together.
  • the beads and cells are first concentrated by application of a force, such as a magnetic force, resulting in increased ligation of cell surface markers, thereby inducing cell stimulation.
  • cell surface proteins may be ligated by allowing paramagnetic beads to which anti-CD3 and anti-CD28 are attached (3x28 beads) to contact the T cells.
  • the cells for example, 104 to 109 T cells
  • beads for example, DYNABEADS® M-450 CD3/CD28 T paramagnetic beads at a ratio of 1 : 1, or MACS® MicroBeads from
  • the target cell may be very rare in the sample and comprise only 0.01% of the sample or the entire sample (i.e., 100%) may comprise the target cell of interest. Accordingly, any cell number is within the context of the present disclosure.
  • it may be desirable to significantly decrease the volume in which particles and cells are mixed together i.e., increase the concentration of cells, to ensure maximum contact of cells and particles. For example, in one embodiment, a concentration of about 2 billion cells/ml is used. In another embodiment, greater than 100 million cells/ml is used.
  • a concentration of cells of 10, 15, 20, 25, 30, 35, 40, 45, or 50 million cells/ml is used.
  • a concentration of cells from 75, 80, 85, 90, 95, or 100 million cells/ml is used.
  • concentrations of 125 or 150 million cells/ml can be used.
  • Using high concentrations can result in increased cell yield, cell activation, and cell expansion. Further, use of high cell concentrations allows more efficient capture of cells that may weakly express target antigens of interest, such as CD28-negative T cells. Such populations of cells may have therapeutic value and would be desirable to obtain in certain embodiments. For example, using high concentration of cells allows more efficient selection of CD8+ T cells that normally have weaker CD28 expression.
  • the mixture may be cultured for several hours (about 3 hours) to about 14 days or any hourly integer value in between. In another embodiment, the mixture may be cultured for 21 days. In one embodiment of the invention the beads and the T cells are cultured together for about eight days. In another embodiment, the beads and T cells are cultured together for 2-3 days. Several cycles of stimulation may also be desired such that culture time of T cells can be 60 days or more.
  • Conditions appropriate for T cell culture include an appropriate media (e.g., Minimal Essential Media or RPMI Media 1640 or, X- vivo 15, (Lonza)) that may contain factors necessary for proliferation and viability, including serum (e.g., fetal bovine or human serum), interleukin-2 (IL-2), insulin, IFN-. gamma., IL-4, IL-7, GM-CSF, IL-10, IL-12, IL-15, TGFbeta, and TNF-alpha or any other additives for the growth of cells known to the skilled artisan.
  • serum e.g., fetal bovine or human serum
  • IL-2 interleukin-2
  • insulin IFN-. gamma.
  • TGFbeta TGFbeta
  • TNF-alpha any
  • additives for the growth of cells include, but are not limited to, surfactant, plasmanate, and reducing agents such as N-acetyl-cysteine and 2- mercaptoethanol.
  • Media can include RPMI 1640, AFM-V, DMEM, MEM, alpha-MEM, F-12, X- Vivo 15, and X-Vivo 20, Optimizer, with added amino acids, sodium pyruvate, and vitamins, either serum-free or supplemented with an appropriate amount of serum (or plasma) or a defined set of hormones, and/or an amount of cytokine(s) sufficient for the growth and expansion of T cells.
  • Antibiotics e.g., penicillin and streptomycin
  • the target cells are maintained under conditions necessary to support growth, for example, an appropriate temperature (e.g., 37o C.) and atmosphere (e.g., air plus 5% C02).
  • T cells that have been exposed to varied stimulation times may exhibit different characteristics.
  • typical blood or apheresed peripheral blood mononuclear cell products have a helper T cell population (TH, CD4+) that is greater than the cytotoxic or suppressor T cell population (TC, CD8+).
  • TH, CD4+ helper T cell population
  • TC, CD8+ cytotoxic or suppressor T cell population
  • the population of T cells comprises an increasingly greater population of TC cells. Accordingly, depending on the purpose of treatment, infusing a subject with a T cell population comprising predominately of TH cells may be advantageous. Similarly, if an antigen-specific subset of TC cells has been isolated it may be beneficial to expand this subset to a greater degree.
  • immune effector cells of the embodiments are co-cultured with activating and propagating cells (AaPCs), to aid in cell expansion.
  • AaPCs can also be referred to as artificial Antigen Presenting cells (aAPCs).
  • AaPCs antigen presenting cells
  • the AaPCs may be genetically modified K562 cells.
  • culturing the genetically modified CAR cells comprises culturing the genetically modified CAR cells in the presence of dendritic cells or activating and propagating cells (AaPCs) that stimulate expansion of the CAR-expressing immune effector cells.
  • AaPCs comprise a CAR-binding antibody or fragment thereof expressed on the surface of the AaPCs.
  • the AaPCs may comprise additional molecules that activate or co-stimulate T-cells in some cases.
  • the additional molecules may, in some cases, comprise membrane-bound Cy cytokines.
  • the AaPCs are inactivated or irradiated, or have been tested for and confirmed to be free of infectious material.
  • culturing the transgenic CAR cells in the presence of AaPCs comprises culturing the transgenic CAR cells in a medium comprising soluble cytokines, such as IL-15, IL-21 and/or IL-2.
  • the cells may be cultured at a ratio of about 10: 1 to about 1 : 10; about 3 : 1 to about 1 :5; about 1 : 1 to about 1 :3 (immune effector cells to AaPCs); or any range derivable therein.
  • the co-culture of T cells and AaPCs can be at a ratio of about 1 : 1, about 1 :2 or about 1 :3.
  • the AaPCs may express CD137L. In some aspects, the AaPCs can further express the antigen that is targeted by the CAR cell. In other aspects, the AaPCs may further express CD 19, CD64, CD86, or mIL15. In certain aspects, the AaPCs may express at least one anti-CD3 antibody clone, such as, for example, OKT3 and/or UCHT1. In one aspect, the AaPCs may be treated (e.g. irradiated or mytomycin C) to eliminate their growth potential. In one aspect, the AaPCs may have been tested for and confirmed to be free of infectious material. Methods for producing such AaPCs are known in the art.
  • culturing the CAR- modified T cell population with AaPCs may comprise culturing the cells at a ratio of about 10: 1 to about 1 : 10; about 3 : 1 to about 1 :5; about 1 : 1 to about 1 :3 (T cells to AaPCs); or any range derivable therein.
  • the co-culture of T cells and AaPCs can be at a ratio of about 1 : 1, about 1 :2 or about 1 :3.
  • the culturing step may further comprise culturing with an aminobisphosphonate (e.g., zoledronic acid).
  • the population of CAR-T cells is cultured and/or stimulated for no more than 7, 14, 21, 28, 35 42 days, 49, 56, 63 or 70 days. In some embodiments, the population of CAR-T cells is cultured and/or stimulated for at least 0, 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30 or more days. In some embodiments, the population of CAR-T cells is cultured and/or stimulated for at least 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60 or more days. In some embodiments, the population of CAR-T cells is cultured and/or stimulated for at least 7, 14, 21, 28, 35, 42, 49, 56, 63 or more days.
  • a stimulation includes the co-culture of the CAR-T cells with AaPCs to promote the growth of CAR positive T cells.
  • the population of genetically modified CAR cells is stimulated for not more than: IX stimulation, 2X stimulation, 3X stimulation, 4X stimulation, 5X stimulation, 5X stimulation, 6X stimulation, 7X stimulation, 8X stimulation, 9X stimulation or 10X stimulation.
  • the genetically modified cells are not cultured ex vivo in the presence of AaPCs.
  • the method of the embodiment further comprises enriching the cell population for CAR-expressing immune effector cells (e.g., T-cells) after the transfection and/or culturing step.
  • the enriching may comprise fluorescence-activated cell sorting (FACS) and sorting for CAR-expressing cells.
  • the sorting for CAR-expressing cells comprises use of a CAR-binding antibody.
  • the enriching may also comprise depletion of CD56+ cells.
  • the method further comprises cryopreserving a sample of the population of genetically modified CAR cells.
  • AaPCs are incubated with a peptide of an optimal length that allows for direct binding of the peptide to the MHC molecule without additional processing.
  • the cells can express an antigen of interest (i.e., in the case of MHC -independent antigen recognition).
  • APCs can express an antibody that binds to either a specific CAR polypeptide or to CAR polypeptides in general (e.g., a universal activating and propagating cell (uAPC).
  • uAPC universal activating and propagating cell
  • the AaPC systems may also comprise at least one exogenous assisting molecule. Any suitable number and combination of assisting molecules may be employed.
  • the assisting molecule may be selected from assisting molecules such as co- stimulatory molecules and adhesion molecules.
  • Exemplary co-stimulatory molecules include CD70 and B7.1 (B7.1 was previously known as B7 and also known as CD80), which among other things, bind to CD28 and/or CTLA-4 molecules on the surface of T cells, thereby affecting, for example, T-cell expansion, Thl differentiation, short-term T-cell survival, and cytokine secretion such as interleukin (IL)-2.
  • IL interleukin
  • Adhesion molecules can include carbohydrate-binding glycoproteins such as selectins, transmembrane binding glycoproteins such as integrins, calcium-dependent proteins such as cadherins, and single-pass transmembrane immunoglobulin (Ig) superfamily proteins, such as intercellular adhesion molecules (ICAMs), that promote, for example, cell-to-cell or cell-to-matrix contact.
  • Ig intercellular adhesion molecules
  • Exemplary adhesion molecules include LFA-3 and ICAMs, such as ICAM-1.
  • Cells selected to become AaPCs preferably have deficiencies in intracellular antigen- processing, intracellular peptide trafficking, and/or intracellular MHC Class I or Class II molecule-peptide loading, or are poikilothermic (i.e., less sensitive to temperature challenge than mammalian cell lines), or possess both deficiencies and poikilothermic properties.
  • cells selected to become AaPCs also lack the ability to express at least one endogenous counterpart (e.g., endogenous MHC Class I or Class II molecule and/or endogenous assisting molecules as described above) to the exogenous MHC Class I or Class II molecule and assisting molecule components that are introduced into the cells.
  • AaPCs preferably retain the deficiencies and poikilothermic properties that were possessed by the cells prior to their modification to generate the AaPCs.
  • Exemplary AaPCs either constitute or are derived from a transporter associated with antigen processing (TAP)-deficient cell line, such as an insect cell line.
  • TEP antigen processing
  • An exemplary poikilothermic insect cells line is a Drosophila cell line, such as a Schneider 2 cell line (see, e.g., Schneider 1972 Illustrative methods for the preparation, growth, and culture of Schneider 2 cells, are provided in U.S. Pat. Nos. 6,225,042, 6,355,479, and 6,362,001.
  • AaPCs are also subjected to a freeze-thaw cycle.
  • the AaPCs may be frozen by contacting a suitable receptacle containing the AaPCs with an appropriate amount of liquid nitrogen, solid carbon dioxide (i.e., dry ice), or similar low-temperature material, such that freezing occurs rapidly.
  • the frozen APCs are then thawed, either by removal of the AaPCs from the low-temperature material and exposure to ambient room temperature conditions, or by a facilitated thawing process in which a lukewarm water bath or warm hand is employed to facilitate a shorter thawing time.
  • AaPCs may be frozen and stored for an extended period of time prior to thawing. Frozen AaPCs may also be thawed and then lyophilized before further use.
  • preservatives that might detrimentally impact the freeze-thaw procedures such as dimethyl sulfoxide (DMSO), polyethylene glycols (PEGs), and other preservatives, are absent from media containing AaPCs that undergo the freeze-thaw cycle, or are essentially removed, such as by transfer of AaPCs to media that is essentially devoid of such preservatives.
  • DMSO dimethyl sulfoxide
  • PEGs polyethylene glycols
  • xenogenic nucleic acid and nucleic acid endogenous to the AaPCs may be inactivated by crosslinking, so that essentially no cell growth, replication or expression of nucleic acid occurs after the inactivation.
  • AaPCs are inactivated at a point subsequent to the expression of exogenous MHC and assisting molecules, presentation of such molecules on the surface of the AaPCs, and loading of presented MHC molecules with selected peptide or peptides. Accordingly, such inactivated and selected peptide loaded AaPCs, while rendered essentially incapable of proliferating or replicating, retain selected peptide presentation function.
  • the crosslinking also yields AaPCs that are essentially free of contaminating microorganisms, such as bacteria and viruses, without substantially decreasing the antigen-presenting cell function of the AaPCs.
  • AaPCs that are essentially free of contaminating microorganisms, such as bacteria and viruses.
  • crosslinking maintains the important AaPC functions of while helping to alleviate concerns about safety of a cell therapy product developed using the AaPCs.
  • APC engineered antigen presenting cell
  • Such cells may be used, for example, as described above, to propagate immune effector cells ex vivo.
  • engineered APCs may, themselves be administered to a patient and thereby stimulate expansion of immune effector cells in vivo.
  • Engineered APCs of the embodiments may, themselves, be used as a therapeutic agent.
  • the engineered APCs can used as a therapeutic agent that can stimulate activation of endogenous immune effector cells specific for a target antigen and/or to increase the activity or persistence of adoptively transferred immune effector cells specific to a target antigen.
  • engineered APC refers to cell(s) that comprises at least a first transgene, wherein the first transgene encodes a HLA. Such engineered APCs may further comprise a second transgene for expression of an antigen, such that the antigen is presented at the surface on the APC in complex with the HLA.
  • the engineered APC can be a cell type that presented antigens ⁇ e.g., a dendritic cell).
  • engineered APC can be produced from a cell type that does not normally present antigens, such a T-cell or T-cell progenitor (referred to as "T-APC").
  • an engineered APC of the embodiments comprises a first transgene encoding a target antigen and a second transgene encoding a human leukocyte antigen (HLA), such that the HLA is expressed on the surface of the engineered APC in complex with an epitope of the target antigen.
  • HLA human leukocyte antigen
  • the HLA expressed in the engineered APC is HLA-A2.
  • an engineered APC of the embodiments may further comprise at least a third transgene encoding co-stimulatory molecule.
  • the co-stimulatory molecule may be a co- stimulatory cytokine that may be a membrane-bound Cy cytokine.
  • the co- stimulatory cytokine is IL-15, such as membrane-bound IL-15.
  • an engineered APC may comprise an edited (or deleted) gene.
  • an inhibitory gene such as PD-1, LIM-3, CTLA-4 or a TCR, can be edited to reduce or eliminate expression of the gene.
  • An engineered APC of the embodiments may further comprise a transgene encoding any target antigen of interest.
  • the target antigen can be an infectious disease antigen or a tumor-associated antigen (TAA).
  • TAA tumor-associated antigen
  • the immune effector cells described herein are modified at a point-of-care site.
  • the point-of-care site is at a hospital or at a facility (e.g., a medical facility) near a subject in need of treatment.
  • the subject undergoes apheresis and peripheral blood mononuclear cells (PBMCs) or a sub population of PBMC can be enriched for example, by elutriation or Ficoll separation.
  • Enriched PBMC or a subpopulation of PBMC can be cryopreserved in any appropriate cryopreservation solution prior to further processing.
  • the elutriation process is performed using a buffer solution containing human serum albumin.
  • Immune effector cells such as T cells can be isolated by selection methods described herein.
  • the selection method for T cells includes beads specific for CD3 and CD8 on T cells.
  • the beads can be paramagnetic beads.
  • the harvested immune effector cells can be cryopreserved in any appropriate cryopreservation solution prior to modification.
  • the immune effector cells can be thawed up to 24 hours, 36 hours, 48 hours. 72 hours or 96 hours ahead of infusion.
  • the thawed cells can be placed in cell culture buffer, for example in cell culture buffer (e.g. RPMI) supplemented with fetal bovine serum (FBS) or placed in a buffer that includes cytokines such as IL-2 and IL-21, prior to modification.
  • the harvested immune effector cells can be modified
  • the immune effector cells are modified by engineering/introducing a chimeric receptor, one or more cell tag(s) described herein, and/or cytokine into the immune effector cells and then rapidly infused into a subject.
  • the sources of immune effector cells can include both allogeneic and autologous sources.
  • the immune effector cells can be T cells or NK cells.
  • the chimeric receptor can be a CD 19 CAR.
  • the chimeric receptor can be a CD33CAR.
  • the chimeric receptor can be a MUC16 CAR.
  • the cytokine can be mbIL-15.
  • the mbIL-15 is of SEQ ID NO: 178, or variant or fragment thereof.
  • the cell tag can be SEQ ID NO: 57.
  • expression of mbIL-15 is modulated by ligand inducible gene-switch expression systems described herein.
  • a ligand such as veledimex can be delivered to the subject to modulate the expression of mbIL-15.
  • veledimex is provided at 5 mg, 10 mg, 15 mg, 20 mg, 30 mg, 40 mg, 50 mg, 60 mg, 70 mg, 80 mg, 90 mg or 100 mg.
  • veledimex is administered to the subject 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1, 12, 13, 14, 15, 16, 17, 18, 19, 20, or 21 days prior to infusion of the modified immune effector cells.
  • veledimex is administered about once every 12 hours, about once every 24 hours, about once every 36 hours or about once every48 hours, for an effective period of time to a subject post infusion of the modified immune effector cells.
  • an effective period of time for veledimex administration is about: 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30 days.
  • veledimex can be re-administered after a rest period, after a drug holiday or when the subject experiences a relapse.
  • the cell tag can be activated, for example via cetuximab, for conditional in vivo ablation of modified immune effector cells comprising cell tags such as truncated epidermal growth factor receptor tags (HERlt variants) as described herein.
  • HERlt variants truncated epidermal growth factor receptor tags
  • such immune effectors cells are modified by the constructs through electroporation.
  • electroporation is performed with electroporators such as Lonza's NucleofectorTM electroporators.
  • the vector comprising the above-mentioned constructs is a non-viral or viral vector.
  • the non-viral vector includes a Sleeping Beauty transposon-transposase system.
  • the immune effector cells are electroporated using a specific sequence. For example, the immune effector cells can be electroporated with one transposon followed by the DNA encoding the transposase followed by a second transposon.
  • the immune effector cells can be electroporated with all transposons and transposase at the same time. In another instance, the immune effector cells can be electroporated with a transposase followed by both transposons or one transposon at a time. While undergoing sequential electroporation, the immune effector cells may be rested for a period of time prior to the next electroporation step.
  • the modified immune effector cells do not undergo a propagation and activation step. In some cases, the modified immune effector cells do not undergo an incubation or culturing step ⁇ e.g. ex vivo propagation). In certain cases, the modified immune effector cells are placed in a buffer that includes IL-2 and IL21 prior to infusion. In other instances, the modified immune effector cells are placed or rested in cell culture buffer, for example in cell culture buffer ⁇ e.g. RPMI) supplemented with fetal bovine serum (FBS) prior to infusion. Prior to infusion, the modified immune effector cells can be harvested, washed and formulated in saline buffer in preparation for infusion into the subject.
  • FBS fetal bovine serum
  • the subject has been lymphodepleted prior to infusion. In other instances, lymphodepletion is not required and the modified immune effector cells are rapidly infused into the subject. Exemplary lymphodepletion regimens are listed in Tables 2 and 3 below: Table 2. Regimen 1
  • Minimal lymphodepletion herein refers to a reduced lymphodepletion protocol such that the subject can be infused within 1 day, 2 days or 3 days following the lymphodepletion regimen.
  • a reduced lymphodepletion protocol can include lower doses of fludarabine and/or
  • a reduced lymphodepletion protocol can include a shortened period of lymphodepletion, for example 1 day or 2 days.
  • the immune effector cells are modified by engineering/introducing a chimeric receptor and a cytokine into said immune effector cells and then rapidly infused into a subject.
  • the immune effector cells are modified by engineering/introducing a chimeric receptor and a cytokine into said cells and then infused within at least: 0, 0.5, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23,24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50 hours into a subject.
  • immune effector cells are modified by engineering/introducing a chimeric receptor
  • an amount of modified effector cells is administered to a subject in need thereof and the amount is determined based on the efficacy and the potential of inducing a cytokine-associated toxicity.
  • the modified effector cells are CAR + and CD3 + cells.
  • an amount of modified effector cells comprises about 10 4 to about 10 9 modified effector cells/kg.
  • an amount of modified effector cells comprises about 10 4 to about 10 5 modified effector cells/kg.
  • an amount of modified effector cells comprises about 10 5 to about 10 6 modified effector cells/kg.
  • an amount of modified effector cells comprises about 10 6 to about 10 7 modified effector cells/kg.
  • an amount of modified effector cells comprises >10 4 but ⁇ 10 5 modified effector cells/kg. In some cases, an amount of modified effector cells comprises >10 5 but ⁇ 10 6 modified effector cells/kg. In some cases, an amount of modified effector cells comprises >10 6 but ⁇ 10 7 modified effector cells/kg. In one embodiment, a lower dose >10 2 but ⁇ 10 4 modified effector cells/kg may be infused.
  • the modified immune effector cells are targeted to the cancer via regional delivery directly to the tumor tissue.
  • the modified immune effector cells can be delivered intraperitoneally (IP) to the abdomen or peritoneal cavity.
  • IP delivery can be performed via a port or pre-existing port placed for delivery of chemotherapy drugs.
  • Other methods of regional delivery of modified immune effector cells can include catheter infusion into resection cavity, ultrasound guided intratumoral injection, hepatic artery infusion or intrapleural delivery.
  • a subject in need thereof can begin therapy with a first dose of modified immune effector cells delivered via IP followed by a second dose of modified immune effector cells delivered via IV.
  • the second dose of modified immune effector cells can be followed by subsequent doses which can be delivered via IV or IP.
  • the duration between the first and second or further subsequent dose can be about: 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30 days.
  • the duration between the first and second or further subsequent dose can be about: 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, or 36 months. In another embodiment, the duration between the first and second or further subsequent dose can be about: 0, 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 years.
  • a catheter can be placed at the tumor or metastasis site for further administration of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 doses of modified immune effector cells. In some cases, doses of modified effector cells can comprise about 10 2 to about 10 9 modified effector cells/kg.
  • doses of modified effector cells can comprise about 10 2 to about 10 5 modified effector cells/kg. In some cases, doses of modified effector cells can start at about 10 2 modified effector cells/kg and subsequent doses can be increased to about: 10 4 , 10 5 , 10 6 , 10 7 , 10 8 or 10 9 modified effector cells/kg.
  • a method of stimulating the proliferation and/or survival of engineered cells comprises obtaining a sample of cells from a subject, and transfecting cells of the sample of cells with one or more polynucleotides that comprise one or more transposons.
  • the transposons encode a chimeric antigen receptor (CAR), a cytokine, one or more cell tags, and a transposase effective to integrate said one or more polynucleotides into the genome of said cells, to provide a population of engineered cells.
  • CAR chimeric antigen receptor
  • the transposons encode a chimeric antigen receptor (CAR), a cytokine, one or more cell tags, gene switch polypeptides for ligand-inducible control of the cytokine and a transposase effective to integrate said one or more polynucleotides into the genome of said cells, to provide a population of engineered cells.
  • the gene switch polypeptides comprise i) a first gene switch polypeptide that comprises a DNA binding domain fused to a first nuclear receptor ligand binding domain, and ii) a second gene switch polypeptide that comprises a transactivation domain fused to a second nuclear receptor ligand binding domain.
  • the first gene switch polypeptide and the second gene switch polypeptide are connected by a linker. In one instance, lymphodepletion is not required prior to administration of the engineered cells to a subject.
  • a method of in vivo propagation of engineered cells comprises obtaining a sample of cells from a subject, and transfecting cells of the sample of cells with one or more polynucleotides that comprise one or more transposons.
  • the transposon(s) comprising a chimeric antigen receptor (CAR), a cytokine, one or more cell tags; and a transposase effective to integrate said one or more polynucleotides into the genome of said cells are electroporated into the sample of cells, to provide a population of engineered cells.
  • the transposons encode a chimeric antigen receptor (CAR), a cytokine, one or more cell tags, gene switch polypeptides for ligand-inducible control of the cytokine and a transposase effective to integrate said one or more polynucleotides into the genome of said cells, to provide a population of engineered cells.
  • the gene switch polypeptides comprise i) a first gene switch polypeptide that comprises a DNA binding domain fused to a first nuclear receptor ligand binding domain, and ii) a second gene switch polypeptide that comprises a transactivation domain fused to a second nuclear receptor ligand binding domain.
  • the first gene switch polypeptide and the second gene switch polypeptide are connected by a linker.
  • a single transposon can comprise a chimeric antigen receptor (CAR), a cytokine, one or more cell tags such as HERlt or any variants described herein.
  • CAR chimeric antigen receptor
  • cytokine a cytokine
  • cell tags such as HERlt or any variants described herein.
  • lymphodepletion is not required prior to administration of the engineered cells to a subject.
  • a method of enhancing in vivo persistence of engineered cells in a subject in need thereof comprises obtaining a sample of cells from a subject, and transfecting cells of the sample of cells with one or more polynucleotides that comprise one or more transposons.
  • the transposon(s) comprising a chimeric antigen receptor (CAR), a cytokine, one or more cell tags; and a transposase effective to integrate said one or more polynucleotides into the genome of said cells are electroporated into the sample of cells, to provide a population of engineered cells.
  • a single transposon can comprise a chimeric antigen receptor (CAR), a cytokine, one or more cell tags such as HERlt or any variants described herein.
  • one or more transposons encode a chimeric antigen receptor (CAR), a cytokine, one or more cell tags, gene switch polypeptides for ligand-inducible control of the cytokine and a transposase effective to integrate the DNA into the genome of said cells, to provide a population of engineered cells.
  • the gene switch polypeptides comprise i) a first gene switch polypeptide that comprises a DNA binding domain fused to a first nuclear receptor ligand binding domain, and ii) a second gene switch polypeptide that comprises a transactivation domain fused to a second nuclear receptor ligand binding domain, wherein the first gene switch polypeptide and the second gene switch polypeptide are connected by a linker.
  • lymphodepletion is not required prior to administration of the engineered cells to a subject.
  • a method of treating a subject with a solid tumor comprises obtaining a sample of cells from a subject, transfecting cells of the sample with one or more polynucleotides that comprise one or more transposons, and administering the population of engineered cells to the subject.
  • lymphodepletion is not required prior to administration of the engineered cells to a subject.
  • the one or more transposons encode a chimeric antigen receptor (CAR), a cytokine, one or more cell tags, and a transposase effective to integrate the DNA into the genome of the cells.
  • CAR chimeric antigen receptor
  • the one or more transposons encode a chimeric antigen receptor (CAR), a cytokine, one or more cell tags, gene switch polypeptides for ligand-inducible control of the cytokine and a transposase effective to integrate the DNA into the genome of the cells.
  • the gene switch polypeptides comprise: i) a first gene switch polypeptide that comprises a DNA binding domain fused to a first nuclear receptor ligand binding domain, and ii) a second gene switch polypeptide that comprises a transactivation domain fused to a second nuclear receptor ligand binding domain, wherein the first gene switch polypeptide and second gene switch polypeptide are connected by a linker.
  • the cells are transfected via electroporation.
  • the polynucleotides encoding the gene switch polypeptides are modulated by a promoter.
  • the promoter is a tissue-specific promoter or an EF 1 A promoter or functional variant thereof.
  • the tissue-specific promoter comprises a T cell specific response element or an NFAT response element.
  • the cytokine comprises at least one of IL-1, IL-2, IL-15, IL-12, IL-21, a fusion of IL-15, IL-15R or an IL-15 variant.
  • the cytokine is in secreted form.
  • the cytokine is in membrane-bound form.
  • the cells are NK cells, NKT cells, T-cells or T-cell progenitor cells.
  • the cells are administered to a subject (e.g. by infusing the subject with the engineered cells).
  • the method further comprises administering an effective amount of a ligand (e.g. veledimex) to induce expression of the cytokine.
  • a ligand e.g. veledimex
  • the CAR is capable of binding at least one of CD 19, CD33, BCMA, CD44, a-Folate receptor, CAIX, CD30, RORl, CEA, EGP-2, EGP-40, HER2, HER3, Folate-binding Protein, GD2, GD3, IL-13R-a2, KDR, EDB-F, mesothelin, CD22, EGFR, MUC-1, MUC-16, MAGE-Al, MUC-16, h5T4, PSMA, TAG-72, EGFRvIII, CD123 and VEGF-R2.
  • the transposase is salmonid-type Tcl-like transposase.
  • the transposase is SB 1 1 or SB lOOx transposase. In other cases, the transposase is PiggyBac. In some cases, the cell tag comprise at least one of a HERltl .
  • the cancer is a cancer associated with an expression of CD 19, CD20, CD33, CD44, BCMA, CD 123, EGFRvIII, a-Folate receptor, CAIX, CD30, RORl, CEA, EGP-2, EGP-40, HER2, HER3, Folate-binding Protein, GD2, GD3, IL-13R- a2, KDR, EDB-F, mesothelin, CD22, EGFR, MUC-1, MUC-16, MAGE-Al, h5T4, PSMA, TAG-72 or VEGF-R2.
  • disclosed herein are methods of administering a polynucleotide, polypeptide or a modified effector cell encoding a polynucleotide described herein, to a subject having a cancer associated with an overexpression of CD 19. In some embodiments, disclosed herein are methods of administering a modified effector cell to a subject having a cancer associated with an overexpression of CD33.
  • disclosed herein are methods of administering a modified effector cell to a subject having a cancer associated with an overexpression of CD44, BCMA, CD 123, EGFRvIII, a-Folate receptor, CAIX, CD30, ROR1, CEA, EGP-2, EGP-40, HER2, HER3, Folate-binding Protein, GD2, GD3, IL-13R-a2, KDR, EDB-F, mesothelin, CD22, EGFR, MUC-1, MUC-16, MAGE-A1, h5T4, PSMA, TAG-72 or VEGF-R2.
  • the cancer is a metastatic cancer. In other cases, the cancer is a relapsed or refractory cancer.
  • a cancer is a solid tumor or a hematologic malignancy. In some instances, the cancer is a solid tumor. In other instances, the cancer is a hematologic malignancy. In some cases, the cancer is a metastatic cancer. In some cases, the cancer is a relapsed or refractory cancer.
  • the cancer is a solid tumor.
  • solid tumors include, but are not limited to, anal cancer; appendix cancer; bile duct cancer (i.e., cholangiocarcinoma); bladder cancer; brain tumor; breast cancer; cervical cancer; colon cancer; cancer of Unknown Primary (CUP); esophageal cancer; eye cancer; fallopian tube cancer; gastroenterological cancer; kidney cancer; liver cancer; lung cancer; medulloblastoma; melanoma; oral cancer; ovarian cancer; pancreatic cancer; parathyroid disease; penile cancer; pituitary tumor; prostate cancer; rectal cancer; skin cancer; stomach cancer; testicular cancer; throat cancer; thyroid cancer; uterine cancer; vaginal cancer; or vulvar cancer.
  • the cancer is a hematologic malignancy. In some cases, a
  • hematologic malignancy comprises a lymphoma, a leukemia, a myeloma, or a B-cell malignancy. In some cases, a hematologic malignancy comprises a lymphoma, a leukemia or a myeloma.
  • exemplary hematologic malignancies include chronic lymphocytic leukemia (CLL), small lymphocytic lymphoma (SLL), high risk CLL, non-CLL/SLL lymphoma, prolymphocytic leukemia (PLL), follicular lymphoma (FL), diffuse large B-cell lymphoma (DLBCL), mantle cell lymphoma (MCL), Waldenstrom's macroglobulinemia, multiple myeloma, extranodal marginal zone B cell lymphoma, nodal marginal zone B cell lymphoma, Burkitt's lymphoma, non-Burkitt high grade B cell lymphoma, primary mediastinal B-cell lymphoma (PMBL), immunoblastic large cell lymphoma, precursor B-lymphoblastic lymphoma, B cell prolymphocytic leukemia, lymphoplasmacytic lymphoma, splenic marginal zone lymphoma, plasma cell myel
  • the hematologic malignancy comprises a myeloid leukemia. In some embodiments, the hematologic malignancy comprises acute myeloid leukemia (AML) or chronic myeloid leukemia (CML).
  • AML acute myeloid leukemia
  • CML chronic myeloid leukemia
  • a hematologic malignancy selected from chronic lymphocytic leukemia (CLL), small lymphocytic lymphoma (SLL), high risk CLL, non-CLL/SLL lymphoma, prolymphocytic leukemia (PLL), follicular lymphoma (FL), diffuse large B-cell lymphoma (DLBCL), mantle cell lymphoma (MCL), Waldenstrom's macroglobulinemia, multiple myeloma, extranodal marginal zone B cell lymphoma, nodal marginal zone B cell lymphoma, Burkitt' s lymphoma, non-Burkitt high grade B cell lymphoma, primary mediastinal B-cell lymphoma (PMBL), immunoblastic large cell lymphoma, precursor B-lymphoblastic lymphoma, B cell prolymphocytic leukemia,
  • CLL chronic lymphocytic leukemia
  • SLL small lymphocytic lymphoma
  • lymphoplasmacytic lymphoma splenic marginal zone lymphoma, plasma cell myeloma, plasmacytoma, mediastinal (thymic) large B cell lymphoma, intravascular large B cell lymphoma, primary effusion lymphoma, or lymphomatoid granulomatosis a modified effector cell described herein.
  • methods of administering to a subject having a hematologic malignancy selected from AML or CML a modified effector cell to the subject are disclosed herein.
  • an infectious disease can be a disease resulting from a bacterial, viral or fungi infection.
  • exemplary viral pathogens include those of the families of Adenoviridae, Epstein-Barr virus (EB V), Cytomegalovirus (CMV), Respiratory Syncytial Virus (RSV), JC virus, BK virus, HSV, HHV family of viruses, Picornaviridae, Herpesviridae, Hepadnaviridae, Flaviviridae, Retroviridae, Orthomyxoviridae, Paramyxoviridae, Papovaviridae, Polyomavirus, Rhabdoviridae, and Togaviridae.
  • Exemplary pathogenic viruses cause smallpox, influenza, mumps, measles, chickenpox, ebola, and rubella.
  • Exemplary pathogenic fungi include Candida, Aspergillus, Cryptococcus, Histoplasma, Pneumocystis, and Stachybotrys .
  • Exemplary pathogenic bacteria include Streptococcus, Pseudomonas, Shigella, Campylobacter, Staphylococcus, Helicobacter, E. coli, Rickettsia, Bacillus, Bordetella,
  • Chlamydia Chlamydia, Spirochetes, and Salmonella.
  • an amount of modified effector cells is administered to a subject in need thereof and the amount is determined based on the efficacy and the potential of inducing a cytokine-associated toxicity.
  • an amount of modified immune effector cells comprises about 10 2 to about 10 9 modified immune effector cells/kg.
  • an amount of modified immune effector cells comprises about 10 3 to about 10 9 modified immune effector cells/kg.
  • an amount of modified immune effector cells comprises about 10 4 to about 10 9 modified immune effector cells/kg.
  • an amount of modified effector cells comprises about 10 5 to about 10 9 modified effector cells/kg.
  • an amount of modified effector cells comprises about 10 5 to about 10 8 modified effector cells/kg. In some cases, an amount of modified effector cells comprises about 10 5 to about 10 7 modified effector cells/kg. In some cases, an amount of modified effector cells comprises about 10 6 to about 10 9 modified effector cells/kg. In some cases, an amount of modified effector cells comprises about 10 6 to about 10 8 modified effector cells/kg. In some cases, an amount of modified effector cells comprises about 10 7 to about 10 9 modified effector cells/kg. In some cases, an amount of modified effector cells comprises about 10 5 to about 10 6 modified effector cells/kg. In some cases, an amount of modified effector cells comprises about 10 6 to about 10 7 modified effector cells/kg.
  • an amount of modified effector cells comprises about 10 7 to about 10 8 modified effector cells/kg. In some cases, an amount of modified effector cells comprises about 10 8 to about 10 9 modified effector cells/kg. In some instances, an amount of modified effector cells comprises about 10 9 modified effector cells/kg. In some instances, an amount of modified effector cells comprises about 10 8 modified effector cells/kg. In some instances, an amount of modified effector cells comprises about 10 7 modified effector cells/kg. In some instances, an amount of modified effector cells comprises about 10 6 modified effector cells/kg. In some instances, an amount of modified effector cells comprises about 10 5 modified effector cells/kg.
  • the modified effector cells are modified T cells.
  • the modified T cells are CAR-T cells.
  • an amount of CAR-T cells comprises about 10 2 to about 10 4 CAR-T cells/kg.
  • an amount of CAR-T cells comprises about 10 5 to about 10 9 CAR-T cells/kg.
  • an amount of CAR-T cells comprises about 10 5 to about 10 8 CAR-T cells/kg.
  • an amount of CAR-T cells comprises about 10 5 to about 10 7 CAR-T cells/kg.
  • an amount of CAR-T cells comprises about 10 6 to about 10 9 CAR-T cells/kg.
  • an amount of CAR-T cells comprises about 10 6 to about 10 8 CAR-T cells/kg. In some cases, an amount of CAR-T cells comprises about 10 7 to about 10 9 CAR-T cells/kg. In some cases, an amount of CAR-T cells comprises about 10 5 to about 10 6 CAR-T cells/kg. In some cases, an amount of CAR-T cells comprises about 10 6 to about 10 7 CAR-T cells/kg. In some cases, an amount of CAR-T cells comprises about 10 7 to about 10 8 CAR-T cells/kg. In some cases, an amount of CAR-T cells comprises about 10 8 to about 10 9 CAR-T cells/kg. In some instances, an amount of CAR-T cells comprises about 10 9 CAR-T cells/kg.
  • an amount of CAR-T cells comprises about 10 8 CAR-T cells/kg. In some instances, an amount of CAR-T cells comprises about 10 7 CAR-T cells/kg. In some instances, an amount of CAR-T cells comprises about 10 6 CAR-T cells/kg. In some instances, an amount of CAR-T cells comprises about 10 5 CAR-T cells/kg.
  • the CAR-T cells are CD19-specific CAR-T cells. In some cases, an amount of CD19-specific CAR-T cells comprises about 10 2 to about 10 9 CAR-T cells/kg. In some embodiments, the CAR-T cells are CD19-specific CAR-T cells. In some cases, an amount of CD19-specific CAR-T cells comprises about 10 3 to about 10 9 CAR-T cells/kg. In some embodiments, the CAR-T cells are CD19-specific CAR-T cells. In some cases, an amount of CD19-specific CAR-T cells comprises about 10 4 to about 10 9 CAR-T cells/kg.
  • an amount of CD19-specific CAR-T cells comprises about 10 5 to about 10 9 CAR-T cells/kg. In some cases, an amount of CD19-specific CAR-T cells comprises about 10 5 to about 10 8 CAR-T cells/kg. In some cases, an amount of CD19-specific CAR-T cells comprises about 10 5 to about 10 7 CAR-T cells/kg. In some cases, an amount of CD19-specific CAR-T cells comprises about 10 6 to about 10 9 CAR-T cells/kg. In some cases, an amount of CD19-specific CAR-T cells comprises about 10 6 to about 10 8 CAR-T cells/kg. In some cases, an amount of CD19-specific CAR-T cells comprises about 10 7 to about 10 9 CAR-T cells/kg.
  • an amount of CD19-specific CAR-T cells comprises about 10 5 to about 10 6 CAR-T cells/kg. In some cases, an amount of CD19-specific CAR-T cells comprises about 10 6 to about 10 7 CAR-T cells/kg. In some cases, an amount of CD19-specific CAR-T cells comprises about 10 7 to about 10 8 CAR-T cells/kg. In some cases, an amount of CD19-specific CAR-T cells comprises about 10 8 to about 10 9 CAR-T cells/kg. In some instances, an amount of CD19-specific CAR-T cells comprises about 10 9 CAR-T cells/kg. In some instances, an amount of CD19-specific CAR-T cells comprises about 10 8 CAR-T cells/kg.
  • an amount of CD19-specific CAR-T cells comprises about 10 7 CAR-T cells/kg. In some instances, an amount of CD19-specific CAR- T cells comprises about 10 6 CAR-T cells/kg. In some instances, an amount of CD19-specific CAR-T cells comprises about 10 5 CAR-T cells/kg. In some instances, an amount of CD 19- specific CAR-T cells comprises about 10 4 CAR-T cells/kg. In some instances, an amount of CD19-specific CAR-T cells comprises about 10 3 CAR-T cells/kg. In some instances, an amount of CD19-specific CAR-T cells comprises about 10 2 CAR-T cells/kg.
  • the modified T cells are engineered TCR T-cells. In some cases, an amount of engineered TCR T- cells comprises about 10 2 to about 10 9 TCR cells/kg. In some cases, an amount of engineered TCR T- cells comprises about 10 3 to about 10 9 TCR cells/kg. In some cases, an amount of engineered TCR T- cells comprises about 10 4 to about 10 9 TCR cells/kg. In some cases, an amount of engineered TCR T- cells comprises about 10 5 to about 10 9 TCR cells/kg. In some cases, an amount of engineered TCR cells comprises about 10 5 to about 10 8 TCR cells/kg. In some cases, an amount of engineered TCR cells comprises about 10 5 to about 10 7 TCR cells/kg.
  • an amount of engineered TCR cells comprises about 10 6 to about 10 9 TCR cells/kg. In some cases, an amount of engineered TCR cells comprises about 10 6 to about 10 8 TCR cells/kg. In some cases, an amount of engineered TCR cells comprises about 10 7 to about 10 9 TCR cells/kg. In some cases, an amount of engineered TCR cells comprises about 10 5 to about 10 6 TCR cells/kg. In some cases, an amount of engineered TCR cells comprises about 10 6 to about 10 7 TCR cells/kg. In some cases, an amount of engineered TCR cells comprises about 10 7 to about 10 8 TCR cells/kg. In some cases, an amount of engineered TCR cells comprises about 10 8 to about 10 9 TCR cells/kg.
  • an amount of engineered TCR cells comprises about 10 9 TCR cells/kg. In some instances, an amount of engineered TCR cells comprises about 10 8 TCR cells/kg. In some instances, an amount of engineered TCR cells comprises about 10 7 TCR cells/kg. In some instances, an amount of engineered TCR cells comprises about 10 6 TCR cells/kg. In some instances, an amount of engineered TCR cells comprises about 10 5 TCR cells/kg. In some instances, an amount of engineered TCR cells comprises about 10 4 TCR cells/kg. In some instances, an amount of engineered TCR cells comprises about 10 3 TCR cells/kg. In some instances, an amount of engineered TCR cells comprises about 10 2 TCR cells/kg.
  • compositions comprising a polynucleotide or polypeptide disclosed herein for administration in a subject.
  • modified effector cell compositions encoding a polynucleotide or polypeptide disclosed herein, and optionally containing a cytokine and/or an additional therapeutic agent.
  • vectors encoding polypeptide constructs for expressing cell tags for modification of an effector cell.
  • compositions of a modified effector cell or a vector encoding polypeptide constructs and a chimeric antigen receptor are formulated in a conventional manner using one or more physiologically acceptable carriers including excipients and auxiliaries which facilitate processing of the active compounds into preparations which can be used pharmaceutically. Proper formulation is dependent upon the route of administration chosen.
  • a summary of pharmaceutical compositions described herein is found, for example, in Remington: The Science and Practice of Pharmacy, Nineteenth Ed (Easton, Pa. : Mack Publishing Company, 1995); Hoover, John E., Remington' s Pharmaceutical Sciences, Mack Publishing Co., Easton, Pennsylvania 1975; Liberman, H.A. and Lachman, L., Eds., Pharmaceutical Dosage Forms, Marcel Decker, New York, N.Y., 1980; and Pharmaceutical Dosage Forms and Drug Delivery Systems, Seventh Ed. (Lippincott Williams & Wilkinsl999).
  • compositions are optionally manufactured in a conventional manner, such as, by way of example only, by means of conventional mixing, dissolving, granulating, dragee-making, levigating, emulsifying, encapsulating, entrapping or compression processes.
  • compositions may also include one or more pH adjusting agents or buffering agents, including acids such as acetic, boric, citric, lactic, phosphoric and hydrochloric acids; bases such as sodium hydroxide, sodium phosphate, sodium borate, sodium citrate, sodium acetate, sodium lactate and tris-hydroxymethylaminomethane; and buffers such as citrate/dextrose, sodium bicarbonate and ammonium chloride.
  • acids such as acetic, boric, citric, lactic, phosphoric and hydrochloric acids
  • bases such as sodium hydroxide, sodium phosphate, sodium borate, sodium citrate, sodium acetate, sodium lactate and tris-hydroxymethylaminomethane
  • buffers such as citrate/dextrose, sodium bicarbonate and ammonium chloride.
  • acids, bases and buffers are included in an amount required to maintain pH of the composition in an acceptable range.
  • compositions may also include one or more salts in an amount required to bring osmolality of the composition into an acceptable range.
  • salts include those having sodium, potassium or ammonium cations and chloride, citrate, ascorbate, borate, phosphate, bicarbonate, sulfate, thiosulfate or bisulfite anions; suitable salts include sodium chloride, potassium chloride, sodium thiosulfate, sodium bisulfite and ammonium sulfate.
  • compositions described herein are administered by any suitable administration route, including but not limited to, oral, parenteral (e.g., intravenous,
  • the pharmaceutical composition is formulated for parenteral (e.g., intravenous, subcutaneous, intramuscular, intracerebral, intracerebroventricular, intra-articular,
  • the pharmaceutical compositions described herein are formulated into any suitable dosage form, including but not limited to, aqueous oral dispersions, liquids, gels, syrups, elixirs, slurries, suspensions and the like, for oral ingestion by an individual to be treated, solid oral dosage forms, aerosols, controlled release formulations, fast melt formulations, effervescent formulations, lyophilized formulations, tablets, powders, pills, dragees, capsules, delayed release formulations, extended release formulations, pulsatile release formulations, multiparticulate formulations, and mixed immediate release and controlled release formulations.
  • the pharmaceutical compositions are formulated into capsules.
  • the pharmaceutical compositions are formulated into solutions (for example, for IV administration).
  • the pharmaceutical composition is formulated as an infusion.
  • the pharmaceutical composition is formulated as an injection.
  • the pharmaceutical solid dosage forms described herein optionally include a compound described herein and one or more pharmaceutically acceptable additives such as a compatible carrier, binder, filling agent, suspending agent, flavoring agent, sweetening agent, disintegrating agent, dispersing agent, surfactant, lubricant, colorant, diluent, solubilizer, moistening agent, plasticizer, stabilizer, penetration enhancer, wetting agent, anti-foaming agent, antioxidant, preservative, or one or more combination thereof.
  • a compatible carrier such as a compatible carrier, binder, filling agent, suspending agent, flavoring agent, sweetening agent, disintegrating agent, dispersing agent, surfactant, lubricant, colorant, diluent, solubilizer, moistening agent, plasticizer, stabilizer, penetration enhancer, wetting agent, anti-foaming agent, antioxidant, preservative, or one or more combination thereof.
  • compositions are formulated into particles (for example for administration by capsule) and some or all of the particles are coated.
  • the compositions are formulated into particles (for example for administration by capsule) and some or all of the particles are microencapsulated.
  • the compositions are formulated into particles (for example for administration by capsule) and some or all of the particles are not microencapsulated and are uncoated.
  • compositions provided herein may also include one or more preservatives to inhibit microbial activity.
  • Suitable preservatives include mercury-containing substances such as merfen and thiomersal; stabilized chlorine dioxide; and quaternary ammonium compounds such as benzalkonium chloride, cetyltrimethylammonium bromide and cetylpyridinium chloride.
  • Proliferative disease as referred to herein means a unifying concept that excessive proliferation of cells and turnover of cellular matrix contribute significantly to the pathogenesis of several diseases, including cancer is presented.
  • "Patient” as used herein refers to a mammalian subject diagnosed with or suspected of having or developing a physiological condition, for instance a cancer or an autoimmune condition or an infection.
  • the term "patient” refers to a mammalian subject with a higher than average likelihood of developing cancer.
  • Exemplary patients may be humans, apes, dogs, pigs, cattle, cats, horses, goats, sheep, rodents and other mammalians that can benefit from the therapies disclosed herein.
  • Exemplary human patients can be male and/or female.
  • composition administration is referred to herein as providing the compositions of the present disclosure to a patient.
  • composition administration may be performed by intravenous (i.v.) injection, sub-cutaneous (s.c.) injection, intradermal (i.d.) injection, intraperitoneal (i.p.) injection, or intramuscular (i.m.) injection.
  • i.v. intravenous
  • s.c. sub-cutaneous
  • i.d. intradermal
  • i.p. intraperitoneal
  • intramuscular injection intramuscular injection.
  • Parenteral administration can be, for example, by bolus injection or by gradual perfusion over time. Alternatively, or concurrently, administration may be by the oral route. Additionally, administration may also be by surgical deposition of a bolus or pellet of cells, or positioning of a medical device.
  • a patient in need thereof or "subject in need thereof is referred to herein as a patient or subject diagnosed with or suspected of having a disease or disorder, for instance, but not restricted to a proliferative disorder such as cancer.
  • the patient or subject has or is likely to develop solid tumors or leukemia.
  • leukemia can be, for instance, acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), chronic lymphocytic leukemia (CLL) and chronic myeloid leukemia (CML).
  • compositions of the present disclosure may comprises host cells expressing the inventive nucleic acid sequences, or a vector comprising the inventive nucleic acid sequence, in an amount that is effective to treat or prevent proliferative disorders.
  • treatment refers to obtaining a desired pharmacologic and/or physiologic effect.
  • the effect is therapeutic, i.e., the effect partially or completely cures a disease and/or adverse symptom attributable to the disease.
  • the inventive method comprises administering a "therapeutically effective amount" of the composition comprising the host cells expressing the inventive nucleic acid sequence, or a vector comprising the inventive nucleic acid sequences.
  • a “therapeutically effective amount” refers to an amount effective, at dosages and for periods of time necessary, to achieve a desired therapeutic result.
  • the therapeutically effective amount may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the inventive nucleic acid sequences to elicit a desired response in the individual.
  • the pharmacologic and/or physiologic effect may be "prophylactic,” i.e., the effect completely or partially prevents a disease or symptom thereof.
  • a “prophylactically effective amount” refers to an amount effective, at dosages and for periods of time necessary, to achieve a desired prophylactic result ⁇ e.g., prevention of disease onset).
  • Antifoaming agents reduce foaming during processing which can result in
  • anti-foaming agents include silicon emulsions or sorbitan sesquoleate.
  • Antioxidants include, for example, butylated hydroxytoluene (BHT), sodium ascorbate, ascorbic acid, sodium metabisulfite and tocopherol. In certain embodiments, antioxidants enhance chemical stability where required.
  • BHT butylated hydroxytoluene
  • antioxidants enhance chemical stability where required.
  • Formulations described herein may benefit from antioxidants, metal chelating agents, thiol containing compounds and other general stabilizing agents.
  • stabilizing agents include, but are not limited to: (a) about 0.5% to about 2% w/v glycerol, (b) about 0.1% to about 1% w/v methionine, (c) about 0.1% to about 2% w/v monothioglycerol, (d) about 1 mM to about 10 mM EDTA, (e) about 0.01% to about 2% w/v ascorbic acid, (f) 0.003% to about 0.02% w/v polysorbate 80, (g) 0.001% to about 0.05% w/v.
  • polysorbate 20 (h) arginine, (i) heparin, (j) dextran sulfate, (k) cyclodextrins, (1) pentosan poly sulfate and other heparinoids, (m) divalent cations such as magnesium and zinc; or (n) combinations thereof.
  • Binders impart cohesive qualities and include, e.g., alginic acid and salts thereof; cellulose derivatives such as carboxymethylcellulose, methylcellulose ⁇ e.g., Methocel®), hydroxypropylmethylcellulose, hydroxy ethylcellulose, hydroxypropylcellulose ⁇ e.g., Klucel®), ethylcellulose ⁇ e.g., Ethocel®), and microcrystalline cellulose ⁇ e.g., Avicel®); microcrystalline dextrose; amylose; magnesium aluminum silicate; polysaccharide acids; bentonites; gelatin; polyvinylpyrrolidone/vinyl acetate copolymer; crospovidone; povidone; starch; pregelatinized starch; tragacanth, dextrin, a sugar, such as sucrose ⁇ e.g.
  • Dipac® Dipac®
  • glucose dextrose
  • molasses mannitol
  • sorbitol xylitol
  • xylitol ⁇ e.g., Xylitab®
  • lactose a natural or synthetic gum such as acacia, tragacanth, ghatti gum, mucilage of isapol husks, polyvinylpyrrolidone ⁇ e.g., Polyvidone® CL, Kollidon® CL, Polyplasdone® XL- 10), larch arabogalactan, Veegum®, polyethylene glycol, waxes, sodium alginate, and the like.
  • a “carrier” or “carrier materials” include any commonly used excipients in pharmaceutics and should be selected on the basis of compatibility with compounds disclosed herein, such as, compounds of ibrutinib and an anticancer agent, and the release profile properties of the desired dosage form.
  • exemplary carrier materials include, e.g., binders, suspending agents, disintegration agents, filling agents, surfactants, solubilizers, stabilizers, lubricants, wetting agents, diluents, and the like.
  • “Pharmaceutically compatible carrier materials” may include, but are not limited to, acacia, gelatin, colloidal silicon dioxide, calcium glycerophosphate, calcium lactate, maltodextrin, glycerine, magnesium silicate, polyvinylpyrrollidone (PVP), cholesterol, cholesterol esters, sodium caseinate, soy lecithin, taurocholic acid, phosphotidylcholine, sodium chloride, tricalcium phosphate, dipotassium phosphate, cellulose and cellulose conjugates, sugars sodium stearoyl lactylate, carrageenan, monoglyceride, diglyceride, pregelatinized starch, and the like.
  • PVP polyvinylpyrrollidone
  • Disposing agents include materials that control the diffusion and homogeneity of a drug through liquid media or a granulation method or blend method. In some embodiments, these agents also facilitate the effectiveness of a coating or eroding matrix.
  • Exemplary diffusion facilitators/dispersing agents include, e.g., hydrophilic polymers, electrolytes, Tween ® 60 or 80, PEG, polyvinylpyrrolidone (PVP; commercially known as Plasdone®), and the carbohydrate-based dispersing agents such as, for example, hydroxypropyl celluloses (e.g., HPC, HPC-SL, and FIPC-L), hydroxypropyl methylcelluloses (e.g., HPMC K100, HPMC K4M, HPMC K15M, and HPMC K100M), carboxymethylcellulose sodium, methylcellulose, hydroxyethylcellulose, hydroxypropylcellulose,
  • FIPMCAS noncrystalline cellulose, magnesium aluminum silicate, triethanolamine, polyvinyl alcohol (PVA), vinyl pyrrolidone/vinyl acetate copolymer (S630), 4-(l,l,3,3-tetramethylbutyl)- phenol polymer with ethylene oxide and formaldehyde (also known as tyloxapol), poloxamers (e.g., Pluronics F68®, F88®, and F108®, which are block copolymers of ethylene oxide and propylene oxide); and poloxamines (e.g., Tetronic 908®, also known as Poloxamine 908®, which is a tetrafunctional block copolymer derived from sequential addition of propylene oxide and ethylene oxide to ethylenediamine (BASF Corporation, Parsippany, N.J.)), polyvinylpyrrolidone K12, polyvinylpyrrolidone K17, polyvinylpyrrolidone K25, or
  • polyvinylpyrrolidone K30 polyvinylpyrrolidone/vinyl acetate copolymer (S-630), polyethylene glycol
  • the polyethylene glycol can have a molecular weight of about 300 to about 6000, or about 3350 to about 4000, or about 7000 to about 5400, sodium carboxymethylcellulose, methylcellulose, polysorbate-80, sodium alginate, gums, such as, e.g., gum tragacanth and gum acacia, guar gum, xanthans, including xanthan gum, sugars, cellulosics, such as, e.g., sodium carboxymethylcellulose, methylcellulose, sodium carboxymethylcellulose, polysorbate-80, sodium alginate, polyethoxylated sorbitan monolaurate, polyethoxylated sorbitan monolaurate, povidone, carbomers, polyvinyl alcohol (PVA), alginates, chitosans and combinations
  • Dispersing agents particularly useful in liposomal dispersions and self-emulsifying dispersions are dimyristoyl phosphatidyl choline, natural phosphatidyl choline from eggs, natural phosphatidyl glycerol from eggs, cholesterol and isopropyl myristate.
  • Combinations of one or more erosion facilitator with one or more diffusion facilitator can also be used in the present compositions.
  • diluent refers to chemical compounds that are used to dilute the compound of interest prior to delivery. Diluents can also be used to stabilize compounds because they can provide a more stable environment. Salts dissolved in buffered solutions (which also can provide pH control or maintenance) are utilized as diluents in the art, including, but not limited to a phosphate buffered saline solution. In certain embodiments, diluents increase bulk of the composition to facilitate compression or create sufficient bulk for homogenous blend for capsule filling. Such compounds include e.g., lactose, starch, mannitol, sorbitol, dextrose,
  • microcrystalline cellulose such as Avicel®; dibasic calcium phosphate, dicalcium phosphate dihydrate; tricalcium phosphate, calcium phosphate; anhydrous lactose, spray-dried lactose; pregelatinized starch, compressible sugar, such as Di-Pac® (Amstar); mannitol,
  • hydroxypropylmethylcellulose hydroxypropylmethylcellulose acetate stearate, sucrose-based diluents, confectioner's sugar; monobasic calcium sulfate monohydrate, calcium sulfate dihydrate; calcium lactate trihydrate, dextrates; hydrolyzed cereal solids, amylose; powdered cellulose, calcium carbonate; glycine, kaolin; mannitol, sodium chloride; inositol, bentonite, and the like.
  • Filling agents include compounds such as lactose, calcium carbonate, calcium phosphate, dibasic calcium phosphate, calcium sulfate, microcrystalline cellulose, cellulose powder, dextrose, dextrates, dextran, starches, pregelatinized starch, sucrose, xylitol, lactitol, mannitol, sorbitol, sodium chloride, polyethylene glycol, and the like.
  • Lubricants and “glidants” are compounds that prevent, reduce or inhibit adhesion or friction of materials.
  • exemplary lubricants include, e.g., stearic acid, calcium hydroxide, talc, sodium stearyl fumerate, a hydrocarbon such as mineral oil, or hydrogenated vegetable oil such as hydrogenated soybean oil (Sterotex®), higher fatty acids and their alkali-metal and alkaline earth metal salts, such as aluminum, calcium, magnesium, zinc, stearic acid, sodium stearates, glycerol, talc, waxes, Stearowet®, boric acid, sodium benzoate, sodium acetate, sodium chloride, leucine, a polyethylene glycol (e.g., PEG-4000) or a methoxypoly ethylene glycol such as CarbowaxTM, sodium oleate, sodium benzoate, glyceryl behenate, polyethylene glycol, magnesium or sodium lauryl sulfate,
  • Plasticizers are compounds used to soften the microencapsulation material or film coatings to make them less brittle.
  • Suitable plasticizers include, e.g., polyethylene glycols such as PEG 300, PEG 400, PEG 600, PEG 1450, PEG 3350, and PEG 800, stearic acid, propylene glycol, oleic acid, triethyl cellulose and triacetin.
  • plasticizers can also function as dispersing agents or wetting agents.
  • Solubilizers include compounds such as triacetin, triethylcitrate, ethyl oleate, ethyl caprylate, sodium lauryl sulfate, sodium doccusate, vitamin E TPGS, dimethylacetamide, N- methylpyrrolidone, N-hydroxyethylpyrrolidone, polyvinylpyrrolidone, hydroxypropylmethyl cellulose, hydroxypropyl cyclodextrins, ethanol, n-butanol, isopropyl alcohol, cholesterol, bile salts, polyethylene glycol 200-600, glycofurol, transcutol, propylene glycol, and dimethyl isosorbide and the like.
  • Stabilizers include compounds such as any anti oxidation agents, buffers, acids, preservatives and the like.
  • “Suspending agents” include compounds such as polyvinylpyrrolidone, e.g., polyvinylpyrrolidone K12, polyvinylpyrrolidone K17, polyvinylpyrrolidone K25, or
  • polyvinylpyrrolidone K30 vinyl pyrrolidone/vinyl acetate copolymer (S630), polyethylene glycol
  • the polyethylene glycol can have a molecular weight of about 300 to about 6000, or about 3350 to about 4000, or about 7000 to about 5400, sodium carboxymethylcellulose, methylcellulose, hydroxypropylmethylcellulose, hydroxymethylcellulose acetate stearate, polysorbate-80, hydroxy ethylcellulose, sodium alginate, gums, such as, e.g., gum tragacanth and gum acacia, guar gum, xanthans, including xanthan gum, sugars, cellulosics, such as, e.g., sodium carboxymethylcellulose, methylcellulose, sodium carboxymethylcellulose, hydroxypropylmethylcellulose, hydroxyethylcellulose, polysorbate-80, sodium alginate, polyethoxylated sorbitan monolaurate, poly
  • “Surfactants” include compounds such as sodium lauryl sulfate, sodium docusate, Tween 60 or 80, triacetin, vitamin E TPGS, sorbitan monooleate, polyoxyethylene sorbitan monooleate, polysorbates, polaxomers, bile salts, glyceryl monostearate, copolymers of ethylene oxide and propylene oxide, e.g., Pluronic® (BASF), and the like.
  • Some other surfactants include polyoxyethylene fatty acid glycerides and vegetable oils, e.g., polyoxyethylene (60)
  • surfactants may be included to enhance physical stability or for other purposes.
  • Viscosity enhancing agents include, e.g., methyl cellulose, xanthan gum,
  • hydroxypropylmethyl cellulose acetate stearate hydroxypropylmethyl cellulose phthalate, carbomer, polyvinyl alcohol, alginates, acacia, chitosans and combinations thereof.
  • Weight agents include compounds such as oleic acid, glyceryl monostearate, sorbitan monooleate, sorbitan monolaurate, triethanolamine oleate, polyoxyethylene sorbitan monooleate, polyoxyethylene sorbitan monolaurate, sodium docusate, sodium oleate, sodium lauryl sulfate, sodium doccusate, triacetin, Tween 80, vitamin E TPGS, ammonium salts and the like.
  • kits and articles of manufacture for use with one or more methods described herein.
  • Such kits include a carrier, package, or container that is compartmentalized to receive one or more containers such as vials, tubes, and the like, each of the container(s) comprising one of the separate elements to be used in a method described herein.
  • Suitable containers include, for example, bottles, vials, syringes, and test tubes.
  • the containers are formed from a variety of materials such as glass or plastic.
  • the articles of manufacture provided herein contain packaging materials.
  • packaging materials include, but are not limited to, blister packs, bottles, tubes, bags, containers, bottles, and any packaging material suitable for a selected formulation and intended mode of administration and treatment.
  • the container(s) include cells encoding polypeptide constructs expressing one or more of the truncated non-immunogenic polypeptides described herein (e.g., CD20 or CD52).
  • the cells may additionally contain one or more heterologous genes, for example a gene encoding a CAR, T-cell receptor and/or a cytokine.
  • kits optionally include an identifying description or label or instructions relating to its use in the methods described herein.
  • a kit typically includes labels listing contents and/or instructions for use, and package inserts with instructions for use. A set of instructions will also typically be included.
  • a label is on or associated with the container.
  • a label is on a container when letters, numbers or other characters forming the label are attached, molded or etched into the container itself; a label is associated with a container when it is present within a receptacle or carrier that also holds the container, e.g., as a package insert.
  • a label is used to indicate that the contents are to be used for a specific therapeutic application.
  • the label also indicates directions for use of the contents, such as in the methods described herein.
  • Receptor 52 MRANDALQVLGLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEW tyrosine-protein MGNLEIVLTGHNADLSFLQ IREVTGYVLVAMNEFSTLPLPNLRWRGTQVYDGKFAIF kinase ErbB3 VMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTID RDIVRDRDAEIWK (HER3) isoform 1 DNGRSCPPCHEVCKGRC GPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCS precursor GPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFV (aa) VDQTSCVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNC
  • TKILGNLDFLITGLNGDP HKIPALDPEKLNVFRTVREITGYLNIQS PPHMHNFSVFS
  • HERlt7 (aa) SGNKNLCYANTIN KKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPE
  • HER2 Chimera CTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQA P with GMCSFR ENRTDLHAFENLEIIRGRTKQHGQFSLAWSLNITSLGLRSLKEISDGDV alpha signal IISGNKNLCYANTIN KKLFGTSGQKTKIISNRGENSCKATGQACHQLCA peptide (aa) RGHC GPGPTQCVNCSQFLRGQECVEECRVLQGLPREYVNARHCLPCHPE
  • Truncated EGFR- 88 cgcaaagtgtgtaacggaataggtattggtgaatttaaagactcactctccataaatgc HER2 Chimera tacgaatattaaacacttcaaaaactgcacctccatcagtggcgatctccacatcctgc (nt) cggtggcatttaggggtgactccttcacacatactcctctctctggatccacaggaactgccatctgaaaaccgtaaggaaatcacagggtttttgctgattcaggcttggcctga aacaggacggacctccatgcctttgagaacctagaaatcatacgcggcaggaccaagcgcggcaggaccaagc aacatggtcagttttctgtgaacatggtcag
  • Truncated EGFR- 90 atgcttctcctggtgacaagccttctgctctgtgagttaccacacccagcattcctcct HER2 (delta 16) gatcccacgcaaagtgtgtaacggaataggtattggtgaatttaaagactcactctcca Chimera with taaatgctacgaatattaaacacttcaaaaactgcacctccatcagtggcgatctccac GMCSFR alpha atcctgccggtggcatttaggggtgactccttcacacatactcctctctggatccaca signal peptide ggaactggatattctgaaaccgtaaaggaatcacagggtttttgctgattcaggctt (nt) ggcctga
  • Truncated EGFR- 92 cgcaaagtgtgtaacggaataggtattggtgaatttaaagactcactctccataaatgc HER2 (delta 16) tacgaatattaaacacttcaaaaactgcacctccatcagtggcgatctccacatcctgc (nt) cggtggcatttaggggtgactccttcacacatactcctctctctggatccacaggaactgccatctgaaaaccgtaaggaaatcacagggtttttgctgattcaggcttggcctga aacaggacggacctccatgcctttgagaacctagaaatcatacgcggcaggaccaagcggcaggaccaagc aacatggtcagtttctctgaacatggtcagt
  • Truncated EGFR- 94 atgcttctcctggtgacaagccttctgctctgtgagttaccacacccagcattcctcct ErbB3 Chimera gatcccacgcaaagtgtgtaacggaataggtattggtgaatttaaagactcactctcca with GMCSFR taaatgctacgaatattaaacacttcaaaaactgcacctccatcagtggcgatctccac alpha signal atcctgccggtggcatttaggggtgactccttcacacatactcctctctggatccaca peptide (nt) ggaactggatattctgaaaaccgtaaaggaaatcacagggtttttgctgattcaggcttgaaaaaa
  • Truncated EGFR- 96 cgcaaagtgtgtaacggaataggtattggtgaatttaaagactcactctccataaatgc ErbB3 Chimera tacgaatattaaacacttcaaaaactgcacctccatcagtggcgatctccacatcctgc (nt) cggtggcatttaggggtgactccttcacacatactcctctctctggatccacaggaactgccatctgaaaaccgtaaggaaatcacagggtttttgctgattcaggcttggcctga aacaggacggacctccatgcctttgagaacctagaaatcatacgcggcaggaccaagcggcaggaccaagc aacatggtcagtttctctgaaacatggtcagt
  • Truncated EGFR- 100 cgcaaagtgtgtaacggaataggtattggtgaatttaaagactcactctccataaatgc ErbB4 (DM-a) tacgaatattaaacacttcaaaaactgcacctccatcagtggcgatctccacatcctgc Chimera (nt) cggtggcatttaggggtgactccttcacacatactcctctctctggatccacaggaactgccattgaaaaccgtaaggaaatcacagggtttttgctgattcaggcttggcctga aacaggacggacctccatgcctttgagaacctagaaatcatacgcggcaggaccaagcggcaggaccaagcggcaggaccaagc aacatggtcagtttctt
  • Truncated EGFR- 102 atgcttctcctggtgacaagccttctgctctgtgagttaccacacccagcattcctcct ErbB4 (DM-b) gatcccacgcaaagtgtgtaacggaataggtattggtgaatttaaagactcactctcca Chimera with taaatgctacgaatattaaacacttcaaaaactgcacctccatcagtggcgatctccac GMCSFR alpha atcctgccggtggcatttaggggtgactccttcacacatactcctctctggatccaca signal peptide ggaactggatattctgaaaccgtaaggaaatcacagggtttttgctgattcaggctt (nt) ggccttg
  • Truncated EGFR- 104 Cgcaaagtgtgtaacggaataggtattggtgaatttaaagactcactctccataaatgc ErbB4 (DM-b) tacgaatattaaacacttcaaaaactgcacctccatcagtggcgatctccacatcctgc Chimera (nt) cggtggcatttaggggtgactccttcacacatactcctctctctggatccacaggaactgccattgaaaaccgtaaggaaatcacagggtttttgctgattcaggcttggcctga aacaggacggacctccatgcctttgagaacctagaaatcatacgcggcaggaccaagcggcaggaccaagcggcaggaccaagc aacatggtcagtttctt
  • Truncated CD52 148 atgaagcgcttcctcttcctactcaccatcagcctcctggttatggtacagataca Design 3 aactggactctcaggacaaaacgacaccagccaaaccagcagcccctcaggcagcacct (CD52t3) with ccggcagcggcaagcctggcagcggcgagggcagcaccaagggcggccagaatgataca CD52 signal tctcagacttcatctcctagcggatccacttctggttccggtaaaccaggttctgggga peptide (nt) aggtagtacaaaaggaggtcagaacgacacttcacagacatctagtccatccggcagta caagcggaagtggaaagccccggaagtggtgg
  • TNFRSF16 (aa) GSSQPWTRGTTDNLIPVYCSILAAVWGLVAYIAFKRWNSCKQNKQGANSRPVNQTPP
  • Truncated LNGFR 161 aaggaggcatgccccacaggcctgtacacacacacagcggtgagtgctgcaaagcctgcaa design 1 cctgggcgagggtgtggcccagccttgtggagccaaccagaccgtgtgtgagccctgcc (LNGFRtl) (nt) tggacagcgtgtgacgttctccgacgtggtgagcgcgaccgagccgtgcaagccgtgcacc gagtgcgtggggctccagagcatgtcggcgcgtgcgtggaggccgacgcgtgtgtgtgtg ccgctacggctactaccaggatgagacgactgggcgctgcgaggcgtg
  • LNGFRt3 (aa) LPCTVCEDTERQLRECTR ADAECEEIPGR ITRSTPPEGSDSTAPSTQE
  • LNGFRt4 (aa) TAPSTQEPEAPPEQDLIASTVAGWTTVMGSSQPWTRGTTDNGGGGSGG
  • LNGFRt7 (aa) TAPSTQEPEAPPEQDLIASTVAGWTTVMGSSQPWTRGTTDNGGGGSGG
  • CD19-CD3 ⁇ CAR 169 atggcgctgcccgtgaccgccttgctcctgccgctggccttgctgctccacgccgccag (nt) gccggacatccagatgacacagactacatcctccctgtctgcctctgggagacagag tcaccatcagttgcagggcaagtcaggacattagtaaatatttaaattggtatcagcag aaccagatggaactgttaaactcctgatctaccatacatcaagattacactcaggagt cccatcaaggttcagtggcagtgggtctggaacagattattctctcaccattagcaatt tggagcaggaaagatattgccacttacttttgccaacagggtaatacgg
  • CD19-CD3 CAR 170 MALPVTALLLPLALLLHAARPDIQMTQTTSSLSASLGDRVTISCRASQDI
  • CD19-CD137-CD3 ⁇ 172 MALPVTALLLPLALLLHAARPDIQMTQTTSSLSASLGDRVTISCRASQDI

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Immunology (AREA)
  • Medicinal Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Zoology (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Cell Biology (AREA)
  • Toxicology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Engineering & Computer Science (AREA)
  • Epidemiology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Wood Science & Technology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • General Engineering & Computer Science (AREA)
  • Microbiology (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • Oncology (AREA)
  • Mycology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Endocrinology (AREA)
  • Developmental Biology & Embryology (AREA)
  • Hematology (AREA)
  • Virology (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
PCT/US2018/036357 2017-06-07 2018-06-06 Expression of novel cell tags Ceased WO2018226897A1 (en)

Priority Applications (14)

Application Number Priority Date Filing Date Title
CN201880051711.8A CN110997920A (zh) 2017-06-07 2018-06-06 新型细胞标签的表达
IL270990A IL270990B2 (en) 2017-06-07 2018-06-06 Expression of new cell markers
JP2019567571A JP7262403B2 (ja) 2017-06-07 2018-06-06 新規の細胞タグの発現
AU2018281316A AU2018281316B2 (en) 2017-06-07 2018-06-06 Expression of novel cell tags
KR1020207000388A KR102557834B1 (ko) 2017-06-07 2018-06-06 신규의 세포 태그의 발현
KR1020237024368A KR102719575B1 (ko) 2017-06-07 2018-06-06 신규의 세포 태그의 발현
IL306102A IL306102B2 (en) 2017-06-07 2018-06-06 Expression of new cell markers
EP18812776.5A EP3635132A4 (en) 2017-06-07 2018-06-06 EXPRESSION OF NOVEL CELL MARKERS
EP25206364.9A EP4681734A3 (en) 2017-06-07 2018-06-06 Expression of novel cell tags
CA3065930A CA3065930A1 (en) 2017-06-07 2018-06-06 Expression of novel cell tags
RU2019142086A RU2796334C9 (ru) 2017-06-07 2018-06-06 Экспрессия новых клеточных меток
ZA2019/08215A ZA201908215B (en) 2017-06-07 2019-12-10 Expression of novel cell tags
JP2023063807A JP7713486B2 (ja) 2017-06-07 2023-04-11 新規の細胞タグの発現
AU2024205827A AU2024205827B2 (en) 2017-06-07 2024-08-16 Expression of novel cell tags

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201762516639P 2017-06-07 2017-06-07
US62/516,639 2017-06-07

Publications (1)

Publication Number Publication Date
WO2018226897A1 true WO2018226897A1 (en) 2018-12-13

Family

ID=64566601

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2018/036357 Ceased WO2018226897A1 (en) 2017-06-07 2018-06-06 Expression of novel cell tags

Country Status (10)

Country Link
US (4) US11118168B2 (https=)
EP (2) EP4681734A3 (https=)
JP (2) JP7262403B2 (https=)
KR (2) KR102719575B1 (https=)
CN (1) CN110997920A (https=)
AU (2) AU2018281316B2 (https=)
CA (1) CA3065930A1 (https=)
IL (2) IL306102B2 (https=)
WO (1) WO2018226897A1 (https=)
ZA (3) ZA201908215B (https=)

Cited By (22)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
SE1950746A1 (en) * 2019-06-18 2020-12-19 Tx Medic Ab Allogenic car-t cell therapy
WO2021229075A3 (en) * 2020-05-14 2022-02-10 Ospedale San Raffaele S.R.L. A modified epidermal growth factor receptor and its use in tracking cells
WO2022147444A3 (en) * 2020-12-30 2022-08-18 Alaunos Therapeutics, Inc. Recombinant vectors comprising polycistronic expression cassettes and methods of use thereof
WO2022177677A1 (en) * 2021-02-16 2022-08-25 City Of Hope Truncated domain iv egfr and uses thereof
WO2022150732A3 (en) * 2021-01-11 2022-08-25 Precigen, Inc. Chimeric receptor therapy
WO2022183167A1 (en) * 2021-02-25 2022-09-01 Alaunos Therapeutics, Inc. Recombinant vectors comprising polycistronic expression cassettes and methods of use thereof
WO2022187289A1 (en) 2021-03-01 2022-09-09 Exuma Biotech Corp. Methods and compositions for the delivery of retroviral particles
US11617767B2 (en) 2020-11-20 2023-04-04 Simcere Innovation, Inc. Armed dual CAR-T compositions and methods for cancer immunotherapy
US11661459B2 (en) 2020-12-03 2023-05-30 Century Therapeutics, Inc. Artificial cell death polypeptide for chimeric antigen receptor and uses thereof
US11692194B2 (en) 2017-01-10 2023-07-04 Precigen, Inc. Modulating expression of polypeptides via new gene switch expression systems
WO2023168305A1 (en) 2022-03-01 2023-09-07 Exuma Biotech Corp. Viral particles with membrane-bound hyaluronidase
WO2024117920A1 (en) * 2022-11-29 2024-06-06 Malcorp Biodiscoveries Limited Novel cd20 protein
US12104178B2 (en) 2017-03-03 2024-10-01 Obsidian Therapeutics, Inc. DHFR tunable protein regulation
EP4204004A4 (en) * 2020-08-31 2024-11-27 Exuma Biotech Corp. ANTI-IDIOTYPE COMPOSITIONS AND METHODS OF USE
US12258574B2 (en) 2016-03-19 2025-03-25 Exuma Biotech Corp. Methods and compositions for transducing lymphocytes and regulating the activity thereof
US12269888B2 (en) 2020-12-03 2025-04-08 Century Therapeutics, Inc. Artificial cell death polypeptide for chimeric antigen receptor and uses thereof
US12275772B2 (en) 2018-07-10 2025-04-15 Precigen, Inc. ROR-1 specific chimeric antigen receptors and uses thereof
US12325728B2 (en) 2016-03-19 2025-06-10 Exuma Biotech Corp. Methods and compositions for genetically modifying lymphocytes to express polypeptides comprising the intracellular domain of CD79A and CD79B
EP4405383A4 (en) * 2021-09-22 2025-08-20 Sonoma Biotherapeutics Inc IL5RA CELL SURFACE MARKERS
EP4435101A4 (en) * 2021-11-17 2025-11-12 Shanghai Juncell Therapeutics Co Ltd MEMBRANE SURFACE PROTEIN CONTAINING A GPI ANCHOR REGION
WO2026020171A3 (en) * 2024-07-19 2026-02-26 Aera Therapeutics, Inc. Chimeric antigen receptor constructs
US12590321B2 (en) 2016-03-19 2026-03-31 Exuma Biotech Corp. Methods and compositions for genetically modifying and expanding lymphocytes and regulating the activity thereof

Families Citing this family (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11771718B2 (en) * 2017-10-18 2023-10-03 Precigen, Inc. Polypeptide compositions comprising spacers
EP3710471A1 (en) 2017-11-16 2020-09-23 Kite Pharma, Inc. Modified chimeric antigen receptors and methods of use
KR20200110576A (ko) * 2019-03-15 2020-09-24 재단법인대구경북과학기술원 사이토카인 기반 면역세포 및 그의 면역 치료 용도
CA3261027A1 (en) * 2022-07-10 2024-01-18 Precigen, Inc. POLYCISTRONIC miRNA CONSTRUCTS FOR IMMUNE CHECKPOINT INHIBITION
CN118206620A (zh) * 2022-12-09 2024-06-18 上海细胞治疗集团股份有限公司 一种多肽标签及其应用
CN118557756B (zh) * 2024-05-24 2025-04-29 华中科技大学同济医学院附属协和医院 一种基于aav的遗传性抗凝血酶缺乏的基因疗法
CN121378506A (zh) * 2025-10-21 2026-01-23 北京京科信拓生物技术有限公司 表达car的免疫细胞及其应用

Citations (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2007146959A2 (en) * 2006-06-12 2007-12-21 Receptor Biologix Inc. Pan-cell surface receptor- specific therapeutics
WO2015018306A1 (en) * 2013-08-06 2015-02-12 Bio-Thera Solutions, Ltd. Bispecific antibodies
US20150118228A1 (en) * 2012-04-25 2015-04-30 Ligacept Llc Broad spectrum erbb ligand binding molecules and methods for their use
US20160060345A1 (en) * 2010-10-29 2016-03-03 Immunogen, Inc. Novel EGFR-Binding Molecules and Immunoconjugates Thereof
US20160158359A1 (en) * 2014-12-03 2016-06-09 Juno Therapeutics, Inc. Methods and compositions for adoptive cell therapy
US9447194B2 (en) * 2012-02-13 2016-09-20 Seattle Children's Hospital Bispecific chimeric antigen receptors and encoding polynucleotides thereof
US20180002397A1 (en) * 2016-06-08 2018-01-04 Intrexon Corporation Cd33 specific chimeric antigen receptors
CN108330133A (zh) * 2017-01-20 2018-07-27 上海恒润达生生物科技有限公司 靶向cd19嵌合抗原受体并对其双重修饰的方法及其用途

Family Cites Families (84)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10905A (en) 1854-05-16 Lath-machine
US509002A (en) 1893-11-21 Eleotbic bail way
US570802A (en) 1896-11-03 Nicholas powell horton
FR901228A (fr) 1943-01-16 1945-07-20 Deutsche Edelstahlwerke Ag Système d'aimant à entrefer annulaire
GB8601597D0 (en) 1986-01-23 1986-02-26 Wilson R H Nucleotide sequences
US6352694B1 (en) 1994-06-03 2002-03-05 Genetics Institute, Inc. Methods for inducing a population of T cells to proliferate using agents which recognize TCR/CD3 and ligands which stimulate an accessory molecule on the surface of the T cells
US6905680B2 (en) 1988-11-23 2005-06-14 Genetics Institute, Inc. Methods of treating HIV infected subjects
US6534055B1 (en) 1988-11-23 2003-03-18 Genetics Institute, Inc. Methods for selectively stimulating proliferation of T cells
US5858358A (en) 1992-04-07 1999-01-12 The United States Of America As Represented By The Secretary Of The Navy Methods for selectively stimulating proliferation of T cells
US5585362A (en) 1989-08-22 1996-12-17 The Regents Of The University Of Michigan Adenovirus vectors for gene therapy
US5283173A (en) 1990-01-24 1994-02-01 The Research Foundation Of State University Of New York System to detect protein-protein interactions
JPH11508121A (ja) 1990-03-22 1999-07-21 ザ ソーク インスティテュート フォア バイオロジカル スタディーズ 昆虫レチノイドレセプター組成物および方法
IE913929A1 (en) 1990-11-13 1992-05-20 Immunex Corp Bifunctional selectable fusion genes
US5350674A (en) 1992-09-04 1994-09-27 Becton, Dickinson And Company Intrinsic factor - horse peroxidase conjugates and a method for increasing the stability thereof
AU6953394A (en) 1993-05-21 1994-12-20 Targeted Genetics Corporation Bifunctional selectable fusion genes based on the cytosine deaminase (cd) gene
US7175843B2 (en) 1994-06-03 2007-02-13 Genetics Institute, Llc Methods for selectively stimulating proliferation of T cells
ATE293699T1 (de) 1995-03-03 2005-05-15 Syngenta Participations Ag Kontrolle der pflanzengenexpression durch rezeptor-vermittelte transaktivation in gegenwart von einem chemischen ligand
CA2214649C (en) 1995-03-08 2007-06-12 Zeling Cai Antigen presenting system and methods for activation of t-cells
US7067318B2 (en) 1995-06-07 2006-06-27 The Regents Of The University Of Michigan Methods for transfecting T cells
US6692964B1 (en) 1995-05-04 2004-02-17 The United States Of America As Represented By The Secretary Of The Navy Methods for transfecting T cells
US5885827A (en) 1996-01-23 1999-03-23 The Regents Of The Universtiy Of California Eukaryotic high rate mutagenesis system
AU734051B2 (en) 1996-04-05 2001-05-31 Salk Institute For Biological Studies, The Hormone-mediated methods for modulating expression of exogenous genes in mammalian systems, and products related thereto
ES2278390T3 (es) 1996-05-23 2007-08-01 The Scripps Research Institute Sistema de presentacion de antigenos de clase ii de cmh y procedimientos de activacion de linfocitos t cd4+.
ATE466948T1 (de) 1997-03-11 2010-05-15 Univ Minnesota Dns-basiertes transposon-system für die einführung von nucleinsäure in die dns einer zelle
EP0998560A1 (en) 1997-07-10 2000-05-10 The Salk Institute For Biological Studies Modified lepidopteran receptors and hybrid multifunctional proteins for use in regulation of transgene expression
US6333318B1 (en) 1998-05-14 2001-12-25 The Salk Institute For Biological Studies Formulations useful for modulating expression of exogenous genes in mammalian systems, and products related thereto
US6790662B1 (en) 1999-03-12 2004-09-14 Ortho-Mcneil Pharmaceutical, Inc. Method of isolating CD8+ cells, and related hybridoma cells antibodies and polypeptides
HK1047109A1 (zh) 1999-10-15 2003-02-07 University Of Massachusetts 作为指定基因干预工具的rna干预轨迹基因
WO2001030965A2 (en) 1999-10-28 2001-05-03 The Board Of Trustees Of The Leland Stanford Junior University Methods of in vivo gene transfer using a sleeping beauty transposon system
US6326193B1 (en) 1999-11-05 2001-12-04 Cambria Biosciences, Llc Insect control agent
US6867041B2 (en) 2000-02-24 2005-03-15 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US7572631B2 (en) 2000-02-24 2009-08-11 Invitrogen Corporation Activation and expansion of T cells
KR20030032922A (ko) 2000-02-24 2003-04-26 싸이트 테라피스 인코포레이티드 세포의 동시 자극 및 농축
US6797514B2 (en) 2000-02-24 2004-09-28 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US20040033600A1 (en) 2001-03-21 2004-02-19 Palli Subba Reddy Ecdysone receptor-based inducible gene expression system
AU2001249315A1 (en) 2000-03-22 2001-10-03 Rheogene, Inc. Ecdysone receptor-based inducible gene expression system
AU2001275474A1 (en) 2000-06-12 2001-12-24 Akkadix Corporation Materials and methods for the control of nematodes
US20020082787A1 (en) 2000-07-07 2002-06-27 Woodworth Robert E. Method and apparatus for monitoring a product during shipping, storage and use
US8105825B2 (en) 2000-10-03 2012-01-31 Intrexon Corporation Multiple inducible gene regulation system
EP1373470B1 (en) 2001-02-20 2013-04-24 Intrexon Corporation Novel substitution mutant receptors and their use in a nuclear receptor-based inducible gene expression system
US20040071671A1 (en) 2001-02-20 2004-04-15 Leturcq Didier J. Cell therapy method for the treatment of tumors
JP4955904B2 (ja) 2001-02-20 2012-06-20 イントレキソン コーポレーション 新規エクジソン受容体/無脊椎動物レチノイドx受容体−ベースの誘導性遺伝子発現システム
WO2002066614A2 (en) 2001-02-20 2002-08-29 Rheogene Holdings, Inc. Chimeric retinoid x receptors and their use in a novel ecdysone receptor-based inducible gene expression system
EP1534738B1 (en) 2001-02-20 2012-06-20 Intrexon Corporation Novel substitution mutant receptors and their use in a nuclear receptor-based inducible gene expression system
WO2002081649A2 (en) 2001-04-06 2002-10-17 The Trustees Of The University Of Pennsylvania ErbB INTERFACE PEPTIDOMIMETICS AND METHODS OF USE THEREOF
US7919269B2 (en) 2001-09-26 2011-04-05 Intrexon Corporation Whitefly ecdysone receptor nucleic acids, polypeptides, and uses thereof
MXPA04002810A (es) 2001-09-26 2005-06-06 Rheogene Holdings Inc Acidos nucleicos receptores de ecdisona de saltarilla, polipeptidos, y sus usos.
US7745140B2 (en) 2002-01-03 2010-06-29 The Trustees Of The University Of Pennsylvania Activation and expansion of T-cells using an engineered multivalent signaling platform as a research tool
WO2003089618A2 (en) 2002-04-22 2003-10-30 Regents Of The University Of Minnesota Transposon system and methods of use
CA2501870C (en) 2002-10-09 2013-07-02 Avidex Limited Single chain recombinant t cell receptors
US7985739B2 (en) 2003-06-04 2011-07-26 The Board Of Trustees Of The Leland Stanford Junior University Enhanced sleeping beauty transposon system and methods for using the same
US7935510B2 (en) 2004-04-30 2011-05-03 Intrexon Corporation Mutant receptors and their use in a nuclear receptor-based inducible gene expression system
WO2005118788A2 (en) 2004-05-27 2005-12-15 The Trustees Of The University Of Pennsylvania Novel artificial antigen presenting cells and uses therefor
ATE475669T1 (de) 2004-06-29 2010-08-15 Immunocore Ltd Einen modifizierten t-zellen-rezeptor exprimierende zellen
US9034650B2 (en) 2005-02-02 2015-05-19 Intrexon Corporation Site-specific serine recombinases and methods of their use
GB0523954D0 (en) * 2005-11-24 2006-01-04 Ucb Celltech Bioassays
CA2643337C (en) 2006-03-01 2016-01-12 Janssen Pharmaceutica N.V. Cancer treatment combining lymphodepleting agent with ctls and cytokines
JP5543207B2 (ja) 2006-10-04 2014-07-09 ジヤンセン・フアーマシユーチカ・ナームローゼ・フエンノートシヤツプ 不活性化された人工抗原提示細胞の調製および細胞治療におけるそれらの使用
US20090075378A1 (en) 2007-02-20 2009-03-19 Anaptysbio, Inc. Somatic hypermutation systems
EP2160461B1 (en) 2007-07-04 2012-08-08 Max-Delbrück-Centrum für Molekulare Medizin (MDC) Hyperactive variants of the transposase protein of the transposon system sleeping beauty
MX2010003371A (es) 2007-09-28 2010-05-05 Intrexon Corp Constructos interruptores genicos terapeuticos y biorreactores para la expresion de moleculas bioterapeuticas y usos de los mismos.
BRPI0818287A2 (pt) 2007-10-08 2015-11-03 Intrexon Corp células dendríticas manipuladas e usos para o tratamento do câncer.
WO2009054917A1 (en) 2007-10-19 2009-04-30 Amgen Inc. Methods of selecting epidermal growth factor receptor (egfr) binding agents
RU2573912C2 (ru) 2008-10-08 2016-01-27 Интрексон Корпорейшн Сконструированные клетки, экспрессирующие множественные иммуномодуляторы, и их применения
TR201904484T4 (tr) 2009-11-03 2019-05-21 Hope City Transdüse T hücre seçimine yönelik kesik epiderimal büyüme faktörü reseptörü (EGFRt).
JP5508625B2 (ja) 2009-12-14 2014-06-04 トヨタ自動車株式会社 車両の制御装置及び車両の制御方法
KR20130010121A (ko) 2010-03-23 2013-01-25 인트렉손 코포레이션 치료적 단백질을 조건부로 발현하는 벡터,상기 벡터를 포함하는 숙주 세포 및 이의 용도
US9331524B1 (en) 2010-07-03 2016-05-03 Best Energy Reduction Technologies, Llc Method, system and apparatus for monitoring and measuring power usage
JP6189754B2 (ja) 2011-03-04 2017-08-30 イントレキソン コーポレーション タンパク質を条件的に発現するベクター
US9034652B2 (en) 2013-03-12 2015-05-19 Bio-Rad Laboratories, Inc. Colloidal Coomassie stain
CA2913052A1 (en) 2013-05-24 2014-11-27 Board Of Regents, The University Of Texas System Chimeric antigen receptor-targeting monoclonal antibodies
JP2017501712A (ja) 2013-12-18 2017-01-19 イントレキソン コーポレーション 単鎖il−12核酸、ポリペプチド、およびそれらの使用
KR102375998B1 (ko) 2014-02-14 2022-03-21 더 보드 오브 리젠츠 오브 더 유니버시티 오브 텍사스 시스템 키메라 항원 수용체 및 제조방법
US9814215B2 (en) 2014-03-11 2017-11-14 Little Big Cat, Inc. Pet toy with telescoping wand with metallic wire
ES2836743T3 (es) 2014-06-02 2021-06-28 Us Health Receptores de antígeno quiméricos que seleccionan como diana CD-19
BR112017001183A2 (pt) 2014-07-21 2017-11-28 Novartis Ag tratamento de câncer usando receptor de antígeno quimérico anti-bcma humanizado
CN105294682B (zh) 2014-07-26 2017-07-07 广东东阳光药业有限公司 Cdk类小分子抑制剂的化合物及其用途
TWI751102B (zh) 2014-08-28 2022-01-01 美商奇諾治療有限公司 對cd19具專一性之抗體及嵌合抗原受體
EP3197911A4 (en) 2014-09-22 2018-06-20 Intrexon Corporation Improved therapeutic control of heterodimeric and single chain forms of interleukin-12
US20170333480A1 (en) 2014-11-05 2017-11-23 Board Of Regents, The University Of Texas System Gene modified immune effector cells and engineered cells for expansion of immune effector cells
BR112017013981A2 (pt) 2015-01-26 2018-01-02 Cellectis receptores antigênicos quiméricos com uma única cadeia específicos anti-cll1 (sccars) para imunoterapia de câncer
WO2017062953A1 (en) 2015-10-10 2017-04-13 Intrexon Corporation Improved therapeutic control of proteolytically sensitive, destabilized forms of interleukin-12
US11815514B2 (en) 2015-12-04 2023-11-14 Juno Therapeutics, Inc. Methods and compositions related to toxicity associated with cell therapy
CN110573177A (zh) 2017-04-28 2019-12-13 尤利乌斯·马克西米利安维尔茨堡大学 具有人源化靶向结构域的ror1特异性嵌合抗原受体(car)

Patent Citations (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2007146959A2 (en) * 2006-06-12 2007-12-21 Receptor Biologix Inc. Pan-cell surface receptor- specific therapeutics
US20160060345A1 (en) * 2010-10-29 2016-03-03 Immunogen, Inc. Novel EGFR-Binding Molecules and Immunoconjugates Thereof
US9447194B2 (en) * 2012-02-13 2016-09-20 Seattle Children's Hospital Bispecific chimeric antigen receptors and encoding polynucleotides thereof
US20150118228A1 (en) * 2012-04-25 2015-04-30 Ligacept Llc Broad spectrum erbb ligand binding molecules and methods for their use
WO2015018306A1 (en) * 2013-08-06 2015-02-12 Bio-Thera Solutions, Ltd. Bispecific antibodies
US20160158359A1 (en) * 2014-12-03 2016-06-09 Juno Therapeutics, Inc. Methods and compositions for adoptive cell therapy
US20180002397A1 (en) * 2016-06-08 2018-01-04 Intrexon Corporation Cd33 specific chimeric antigen receptors
CN108330133A (zh) * 2017-01-20 2018-07-27 上海恒润达生生物科技有限公司 靶向cd19嵌合抗原受体并对其双重修饰的方法及其用途

Cited By (30)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12258574B2 (en) 2016-03-19 2025-03-25 Exuma Biotech Corp. Methods and compositions for transducing lymphocytes and regulating the activity thereof
US12590321B2 (en) 2016-03-19 2026-03-31 Exuma Biotech Corp. Methods and compositions for genetically modifying and expanding lymphocytes and regulating the activity thereof
US12325728B2 (en) 2016-03-19 2025-06-10 Exuma Biotech Corp. Methods and compositions for genetically modifying lymphocytes to express polypeptides comprising the intracellular domain of CD79A and CD79B
US11692194B2 (en) 2017-01-10 2023-07-04 Precigen, Inc. Modulating expression of polypeptides via new gene switch expression systems
US11946054B2 (en) 2017-01-10 2024-04-02 Precigen, Inc. Modulating expression of polypeptides via new gene switch expression systems
US12104178B2 (en) 2017-03-03 2024-10-01 Obsidian Therapeutics, Inc. DHFR tunable protein regulation
US12275772B2 (en) 2018-07-10 2025-04-15 Precigen, Inc. ROR-1 specific chimeric antigen receptors and uses thereof
SE1950746A1 (en) * 2019-06-18 2020-12-19 Tx Medic Ab Allogenic car-t cell therapy
WO2020256627A1 (en) * 2019-06-18 2020-12-24 Tx Medic Ab Allogenic car-t cell therapy
JP2022537967A (ja) * 2019-06-18 2022-08-31 ティーエックス メディック エービー 同種異系car-t細胞療法
SE544015C2 (en) * 2019-06-18 2021-11-02 Tx Medic Ab Allogenic car-t cell therapy
CN115867569A (zh) * 2020-05-14 2023-03-28 圣拉斐尔医院有限责任公司 经修饰的表皮生长因子受体及其在追踪细胞中的用途
WO2021229075A3 (en) * 2020-05-14 2022-02-10 Ospedale San Raffaele S.R.L. A modified epidermal growth factor receptor and its use in tracking cells
JP2023526587A (ja) * 2020-05-14 2023-06-22 オスペダーレ サン ラファエレ エス.アール.エル 改変型上皮成長因子受容体及び細胞追跡におけるその使用
JP7848138B2 (ja) 2020-05-14 2026-04-20 オスペダーレ サン ラファエレ エス.アール.エル 改変型上皮成長因子受容体及び細胞追跡におけるその使用
EP4204004A4 (en) * 2020-08-31 2024-11-27 Exuma Biotech Corp. ANTI-IDIOTYPE COMPOSITIONS AND METHODS OF USE
US11617767B2 (en) 2020-11-20 2023-04-04 Simcere Innovation, Inc. Armed dual CAR-T compositions and methods for cancer immunotherapy
US12269888B2 (en) 2020-12-03 2025-04-08 Century Therapeutics, Inc. Artificial cell death polypeptide for chimeric antigen receptor and uses thereof
US11661459B2 (en) 2020-12-03 2023-05-30 Century Therapeutics, Inc. Artificial cell death polypeptide for chimeric antigen receptor and uses thereof
WO2022147444A3 (en) * 2020-12-30 2022-08-18 Alaunos Therapeutics, Inc. Recombinant vectors comprising polycistronic expression cassettes and methods of use thereof
WO2022150732A3 (en) * 2021-01-11 2022-08-25 Precigen, Inc. Chimeric receptor therapy
WO2022177677A1 (en) * 2021-02-16 2022-08-25 City Of Hope Truncated domain iv egfr and uses thereof
JP2024507929A (ja) * 2021-02-25 2024-02-21 アラウノス セラピューティクス インコーポレイテッド 多シストロン性発現カセットを含む組換えベクター及びそれらの使用方法
WO2022183167A1 (en) * 2021-02-25 2022-09-01 Alaunos Therapeutics, Inc. Recombinant vectors comprising polycistronic expression cassettes and methods of use thereof
WO2022187289A1 (en) 2021-03-01 2022-09-09 Exuma Biotech Corp. Methods and compositions for the delivery of retroviral particles
EP4405383A4 (en) * 2021-09-22 2025-08-20 Sonoma Biotherapeutics Inc IL5RA CELL SURFACE MARKERS
EP4435101A4 (en) * 2021-11-17 2025-11-12 Shanghai Juncell Therapeutics Co Ltd MEMBRANE SURFACE PROTEIN CONTAINING A GPI ANCHOR REGION
WO2023168305A1 (en) 2022-03-01 2023-09-07 Exuma Biotech Corp. Viral particles with membrane-bound hyaluronidase
WO2024117920A1 (en) * 2022-11-29 2024-06-06 Malcorp Biodiscoveries Limited Novel cd20 protein
WO2026020171A3 (en) * 2024-07-19 2026-02-26 Aera Therapeutics, Inc. Chimeric antigen receptor constructs

Also Published As

Publication number Publication date
IL270990B2 (en) 2024-02-01
KR102557834B1 (ko) 2023-07-21
KR102719575B1 (ko) 2024-10-21
IL306102B2 (en) 2025-01-01
AU2024205827B2 (en) 2025-10-09
JP7262403B2 (ja) 2023-04-21
US11118168B2 (en) 2021-09-14
JP7713486B2 (ja) 2025-07-25
US20210324350A1 (en) 2021-10-21
ZA202311278B (en) 2025-04-30
KR20230115343A (ko) 2023-08-02
US20180362940A1 (en) 2018-12-20
JP2023085527A (ja) 2023-06-20
EP4681734A2 (en) 2026-01-21
AU2018281316B2 (en) 2024-05-30
US12060585B2 (en) 2024-08-13
CN110997920A (zh) 2020-04-10
IL306102A (en) 2023-11-01
EP3635132A1 (en) 2020-04-15
CA3065930A1 (en) 2018-12-13
IL270990A (en) 2020-01-30
US20250304930A1 (en) 2025-10-02
RU2019142086A3 (https=) 2021-07-30
AU2018281316A1 (en) 2020-01-02
IL306102B1 (en) 2024-09-01
JP2020527937A (ja) 2020-09-17
US20220064609A1 (en) 2022-03-03
AU2024205827A1 (en) 2024-09-05
US12180517B2 (en) 2024-12-31
RU2019142086A (ru) 2021-07-09
EP4681734A3 (en) 2026-04-15
ZA201908215B (en) 2022-03-30
IL270990B1 (en) 2023-10-01
EP3635132A4 (en) 2021-05-26
ZA202110208B (en) 2024-04-24
KR20200015939A (ko) 2020-02-13

Similar Documents

Publication Publication Date Title
AU2024205827B2 (en) Expression of novel cell tags
US20240263183A1 (en) Modulating expression of polypeptides via new gene switch expression systems
US12275772B2 (en) ROR-1 specific chimeric antigen receptors and uses thereof
RU2796334C9 (ru) Экспрессия новых клеточных меток
RU2796334C2 (ru) Экспрессия новых клеточных меток
HK40111497A (en) Modulating expression of polypeptides via new gene switch expression systems

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 18812776

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3065930

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2019567571

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2018281316

Country of ref document: AU

Date of ref document: 20180606

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20207000388

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2019142086

Country of ref document: RU

ENP Entry into the national phase

Ref document number: 2018812776

Country of ref document: EP

Effective date: 20200107

WWW Wipo information: withdrawn in national office

Ref document number: 2018812776

Country of ref document: EP